Gene flow and genetic diversity in cultivated and wild cacao (Theobroma cacao) in Bolivia.
Chumacero de Schawe, Claudia; Durka, Walter; Tscharntke, Teja; Hensen, Isabell; Kessler, Michael
2013-11-01
The role of pollen flow within and between cultivated and wild tropical crop species is little known. To study the pollen flow of cacao, we estimated the degree of self-pollination and pollen dispersal distances as well as gene flow between wild and cultivated cacao (Theobroma cacao L.). We studied pollen flow and genetic diversity of cultivated and wild cacao populations by genotyping 143 wild and 86 cultivated mature plants and 374 seedlings raised from 19 wild and 25 cultivated trees at nine microsatellite loci. A principal component analysis distinguished wild and cultivated cacao trees, supporting the notion that Bolivia harbors truly wild cacao populations. Cultivated cacao had a higher level of genetic diversity than wild cacao, presumably reflecting the varied origin of cultivated plants. Both cacao types had high outcrossing rates, but the paternity analysis revealed 7-14% self-pollination in wild and cultivated cacao. Despite the tiny size of the pollinators, pollen was transported distances up to 3 km; wild cacao showed longer distances (mean = 922 m) than cultivated cacao (826 m). Our data revealed that 16-20% of pollination events occurred between cultivated and wild populations. We found evidence of self-pollination in both wild and cultivated cacao. Pollination distances are larger than those typically reported in tropical understory tree species. The relatively high pollen exchange from cultivated to wild cacao compromises genetic identity of wild populations, calling for the protection of extensive natural forest tracts to protect wild cacao in Bolivia.
Directory of Open Access Journals (Sweden)
Castillo Daynet Sosa del
2016-04-01
Full Text Available Flowery cushion gall of cacao is a disease complex with six types. Fusarium decemcellulare have been isolated from both flowery and green point galls and recognized as the etiological agent of the disease. In the present work we: i identified by ITS-rDNA sequencing and/or taxonomy the cultivable fungal species or Operative Taxonomic Units (OTUs associated with the five symptoms of cushion galls in cacao from Venezuela, and ii determined the gall inducing capacity on cacao peeled seeds after 45 days of inoculation with suspensions of mycelia/ spores from distinct isolate types. The whole isolate collection rendered an abundance of 113 isolates with a richness of 39 OTUs (27 and eight identified at the species or genera levels, respectively, and in unidentified fungi. The dominant recovered species (≈36% were F. decemcellulare and Lasiodiplodia theobromae. Some isolates of F. decemcellulare, L. theobromae, F. equiseti, Fusarium spp., F. solani, F. incarnatum, Rhizocthonia solani and Penicillium sp. were pathogenic. Some other isolates of the first six mentioned taxa behave as non-pathogenic. Furthermore, pathogenic and non-pathogenic isolates can also co-occur within a single plant and gall type. Moreover, 2-5 species within a single gall symptom in a single tree were identified (not necessarily at the same point in the tree, indicating a broad diversity of co-occurring taxa.
Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.
Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ~4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification pr...
Genetic diversity and spatial structure in cacao (Theobroma cacao L.) germplasm from Bolivia
Cacao (Theobroma cacao L.) is an important economic crop widely cultivated in the Bolivian Amazon. The germplasm group used by the Bolivian farmers was called “Cacao Nacional Boliviano” (CNB). Wild cacao populations are also found in the Beni River and in the valleys of Andes foot hills. Using DNA...
Theobroma cacao (cacao), the source of chocolate, is a tropical understory tree. Fungal diseases such as Witches’ Broom Disease (WBD) and Frosty Pod Rot Disease (FPRD) of cacao have devastated cacao production in much of the Western Hemisphere and are threats to the main cacao producing regions in A...
Agung, Muhammad Budi; Budiarsa, I. Made; Suwastika, I. Nengah
2017-02-01
Cocoa bean is one of the main commodities from Indonesia for the world, which still have problem regarding yield degradation due to pathogens and disease attack. Developing robust cacao plant that genetically resistant to pathogen and disease attack is an ideal solution in over taking on this problem. The aim of this study was to identify Theobroma cacao genes on database of cacao genome that homolog to response genes of pathogen and disease attack in other plant, through in silico analysis. Basic information survey and gene identification were performed in GenBank and The Arabidopsis Information Resource database. The In silico analysis contains protein BLAST, homology test of each gene's protein candidates, and identification of homologue gene in Cacao Genome Database using data source "Theobroma cacao cv. Matina 1-6 v1.1" genome. Identification found that Thecc1EG011959t1 (EDS1), Thecc1EG006803t1 (EDS5), Thecc1EG013842t1 (ICS1), and Thecc1EG015614t1 (BG_PPAP) gene of Cacao Genome Database were Theobroma cacao genes that homolog to plant's resistance genes which highly possible to have similar functions of each gene's homologue gene.
Presence of heavy metals in organic cacao (theobroma cacao l.) crop
HuamanI-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel Ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton
2013-01-01
La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...
Indian Academy of Sciences (India)
Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the ...
Cacao (Theobroma cacao L.) is indigenous to the Amazon region of South America. The Peruvian Amazon harbors a large number of diverse cacao populations. Since the 1930s, several numbers of populations have been collected from the Peruvian Amazon and maintained as ex situ germplasm repositories in ...
Spafford, Helen; Ching, Alexander; Manley, Megan; Hardin, Chelsea; Bittenbender, Harry
2016-01-01
The Chinese rose beetle (Adoretus sinicus Burmeister (Coleoptera: Scarabaeidae)) is an introduced, widely-established pest in Hawai’i. The adult beetles feed on the leaves of cacao (Theobroma cacao L.), which can lead to defoliation and even death of young trees. We evaluated the impact of five commercially available products with different active ingredients (imidacloprid, azadirachtin, Beauveria bassiana (Bals.-Criv.) Vuill., kaolin clay, and pyrethrin) and the presence or absence of weed mat cover in reducing adult beetle feeding on sapling cacao in the field. The use of weed mat cover reduced feeding damage compared to the untreated control, as did foliar application of imidacloprid, azadirachtin, and B. bassiana. In the laboratory, field-collected adult beetles were presented cacao leaf samples dipped in one of the five products and compared to a control. Beetles exposed to pyrethrin died rapidly. Among the other treatments, only exposure to imidacloprid significantly reduced survival relative to the control. Beetles fed very little on leaf samples with azadirachtin but their longevity was not significantly reduced. Imidacloprid, azadirachtin, and weed mat application had the most promise for reducing adult Chinese rose beetle feeding damage in young cacao and deserve further investigation for successful management of this significant pest. PMID:27348004
Abbey, Marcie J; Patil, Vinit V; Vause, Carrie V; Durham, Paul L
2008-01-17
Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation.
Mutation breeding against black pod (Phytophthora pod rot) disease of cacao (Theobroma cacao)
International Nuclear Information System (INIS)
Opeke, L.K.
1977-01-01
Black pod rot disease, caused by Phytophthora palmivora, is an important disease of cacao (Theobroma cacao L.) in Nigeria and other cacao producing countries of West Africa and Latin America. A naturally occurring source of genetic resistance to the disease has not been found. This paper completes the report, the first part of which was published in Induced Mutations in Vegetatively Propagated Plants, IAEA, Vienna (1973). The survivors of the irradiated seedlings reported on in this publication were transplanted to the field along with their controls. When the Phytophthora pod disease season began in 1973, all experimental plants along with the controls were sprayed with active and freshly prepared dense sporangial suspension of P. palmivora. Observations on Phytophthora infection were recorded at two-weekly intervals for three months. Results were pooled for each set of experimental plants, after having confirmed that no marked difference appeared among individual plants of each group. Contrary to the observations recorded at the nursery stage, all experimental plants that showed no infection indicated disease infection levels normally characteristic of the F 3 Amazon cultivar of Cacao in Nigeria. Although the nursery and the field data are difficult to reconcile and interpret, it is suggested that probably temporary disease tolerance/resistance, which some irradiated plants showed at the nursery (seedling) stage, was lost as the plants matured, thus suggesting different resistance factor systems for juvenile and mature cacao trees. (author)
Suárez Salazar, Juan Carlos; Ngo Bieng, Marie Ange; Melgarejo, Luz Marina; Di Rienzo, Julio A; Casanoves, Fernando
2018-01-01
We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use. We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development. We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees. Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of forest-friendly management enhancing sustainable peace building in Colombia.
Abbey, Marcie J.; Patil, Vinit V.; Vause, Carrie V.; Durham, Paul L.
2008-01-01
Ethnopharmacological relevance Cocoa bean preparations were first used by the ancient Maya and Aztec civilizations of South America to treat a variety of medical ailments involving the cardiovascular, gastrointestinal, and nervous systems. Diets rich in foods containing abundant polyphenols, as found in cocoa, underlie the protective effects reported in chronic inflammatory diseases. Release of calcitonin gene-related peptide (CGRP) from trigeminal nerves promotes inflammation in peripheral tissues and nociception. Aim of the study To determine whether a methanol extract of Theobroma cacao L. (Sterculiaceae) beans enriched for polyphenols could inhibit CGRP expression, both an in vitro and an in vivo approach was taken. Results Treatment of rat trigeminal ganglia cultures with depolarizing stimuli caused a significant increase in CGRP release that was repressed by pretreatment with Theobroma cacao extract. Pretreatment with Theobroma cacao was also shown to block the KCl- and capsaicin-stimulated increases in intracellular calcium. Next, the effects of Theobroma cacao on CGRP levels were determined using an in vivo model of temporomandibular joint (TMJ) inflammation. Capsaicin injection into the TMJ capsule caused an ipsilateral decrease in CGRP levels. Theobroma cacao extract injected into the TMJ capsule 24 h prior to capsaicin treatment repressed the stimulatory effects of capsaicin. Conclusions Our results demonstrate that Theobroma cacao extract can repress stimulated CGRP release by a mechanism that likely involves blockage of calcium channel activity. Furthermore, our findings suggest that the beneficial effects of diets rich in cocoa may include suppression of sensory trigeminal nerve activation. PMID:17997062
Suárez Salazar, Juan Carlos; Melgarejo, Luz Marina; Di Rienzo, Julio A.; Casanoves, Fernando
2018-01-01
Aim and background We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use. Material and methods We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development. Main results We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees. Main conclusions and prospects Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of
Directory of Open Access Journals (Sweden)
Juan Carlos Suárez Salazar
Full Text Available We present a typology of cacao agroforest systems in Colombian Amazonia. These systems had yet to be described in the literature, especially their potential in terms of biodiversity conservation. The systems studied are located in a post-conflict area, and a deforestation front in Colombian Amazonia. Cacao cropping systems are of key importance in Colombia: cacao plays a prime role in post conflict resolution, as cacao is a legal crop to replace illegal crops; cacao agroforests are expected to be a sustainable practice, promoting forest-friendly land use.We worked in 50 x 2000 m2 agroforest plots, in Colombian Amazonia. A cluster analysis was used to build a typology based on 28 variables characterised in each plot, and related to diversity, composition, spatial structure and light availability for the cacao trees. We included variables related to light availability to evaluate the amount of transmitted radiation to the cacao trees in each type, and its suitability for cacao ecophysiological development.We identified 4 types of cacao agroforests based on differences concerning tree species diversity and the impact of canopy spatial structure on light availability for the cacao trees in the understorey. We found 127 tree species in the dataset, with some exclusive species in each type. We also found that 3 out of the 4 types identified displayed an erosion of tree species diversity. This reduction in shade tree species may have been linked to the desire to reduce shade, but we also found that all the types described were compatible with good ecophysiological development of the cacao trees.Cacao agroforest systems may actually be achieving biodiversity conservation goals in Colombian Amazonia. One challenging prospect will be to monitor and encourage the conservation of tree species diversity in cacao agroforest systems during the development of these cropping systems, as a form of forest-friendly management enhancing sustainable peace building in
Niether, Wiebke; Maldonado, Carla; Silva, Erika; Schneider, Monika; Gerold, Gerhard
2013-01-01
Cocoa (Theobroma cacao L.) grows naturally as an understory tree in tropical forests and produces well under shaded and non-shaded conditions. It is cultivated by small scale farmers in South America under various conditions, ranging from monocultures to different kinds of agroforestry systems. While in monocultures it is exposed to direct sunlight, one or various tree species shade the cocoa in agroforestry systems. Also organic cocoa cultivation is becoming more and more popular due to prem...
Presencia de metales pesados en cultivo de cacao (Theobroma cacao L.) orgánico
Huamaní-Yupanqui, Hugo Alfredo; Huauya-Rojas, Miguel ángel; Mansilla-Minaya, Luis Germán; Florida-Rofner, Nelino; Neira-Trujillo, Gilmer Milton
2012-01-01
La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L.) es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron...
Directory of Open Access Journals (Sweden)
Donald Livingstone
2017-12-01
Full Text Available Cacao (Theobroma cacao L. is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.
Livingstone, Donald; Stack, Conrad; Mustiga, Guiliana M; Rodezno, Dayana C; Suarez, Carmen; Amores, Freddy; Feltus, Frank A; Mockaitis, Keithanne; Cornejo, Omar E; Motamayor, Juan C
2017-01-01
Cacao ( Theobroma cacao L.) is an important cash crop in tropical regions around the world and has a rich agronomic history in South America. As a key component in the cosmetic and confectionary industries, millions of people worldwide use products made from cacao, ranging from shampoo to chocolate. An Illumina Infinity II array was created using 13,530 SNPs identified within a small diversity panel of cacao. Of these SNPs, 12,643 derive from variation within annotated cacao genes. The genotypes of 3,072 trees were obtained, including two mapping populations from Ecuador. High-density linkage maps for these two populations were generated and compared to the cacao genome assembly. Phenotypic data from these populations were combined with the linkage maps to identify the QTLs for yield and disease resistance.
A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6.
Saski, Christopher A; Feltus, Frank A; Staton, Margaret E; Blackmon, Barbara P; Ficklin, Stephen P; Kuhn, David N; Schnell, Raymond J; Shapiro, Howard; Motamayor, Juan Carlos
2011-08-16
The fermented dried seeds of Theobroma cacao (cacao tree) are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS) II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105) span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map assembly. A comparison between the two T. cacao
A genetically anchored physical framework for Theobroma cacao cv. Matina 1-6
Directory of Open Access Journals (Sweden)
Kuhn David N
2011-08-01
Full Text Available Abstract Background The fermented dried seeds of Theobroma cacao (cacao tree are the main ingredient in chocolate. World cocoa production was estimated to be 3 million tons in 2010 with an annual estimated average growth rate of 2.2%. The cacao bean production industry is currently under threat from a rise in fungal diseases including black pod, frosty pod, and witches' broom. In order to address these issues, genome-sequencing efforts have been initiated recently to facilitate identification of genetic markers and genes that could be utilized to accelerate the release of robust T. cacao cultivars. However, problems inherent with assembly and resolution of distal regions of complex eukaryotic genomes, such as gaps, chimeric joins, and unresolvable repeat-induced compressions, have been unavoidably encountered with the sequencing strategies selected. Results Here, we describe the construction of a BAC-based integrated genetic-physical map of the T. cacao cultivar Matina 1-6 which is designed to augment and enhance these sequencing efforts. Three BAC libraries, each comprised of 10× coverage, were constructed and fingerprinted. 230 genetic markers from a high-resolution genetic recombination map and 96 Arabidopsis-derived conserved ortholog set (COS II markers were anchored using pooled overgo hybridization. A dense tile path consisting of 29,383 BACs was selected and end-sequenced. The physical map consists of 154 contigs and 4,268 singletons. Forty-nine contigs are genetically anchored and ordered to chromosomes for a total span of 307.2 Mbp. The unanchored contigs (105 span 67.4 Mbp and therefore the estimated genome size of T. cacao is 374.6 Mbp. A comparative analysis with A. thaliana, V. vinifera, and P. trichocarpa suggests that comparisons of the genome assemblies of these distantly related species could provide insights into genome structure, evolutionary history, conservation of functional sites, and improvements in physical map
Potencial de actividad antioxidante de extractos fenólicos de Theobroma cacao L. (cacao)
Quiñones Gálvez, Janet; Trujillo Sánchez, Reinaldo; Capdesuñer Ruiz, Yanelis; Quirós Molina, Yemeys; Hernández de la Torre, Martha
2013-01-01
Introducción: Theobroma cacao L. (cacao), familia Sterculiaceae, es una planta rica en fenoles, los cuales en las plantas son de especial interés por su potente actividad antioxidante, dada esencialmente por sus propiedades redox, que pueden desempeñar un papel importante en la absorción y neutralización de los radicales libres. Objetivos: seleccionar un clon promisorio en la producción de compuestos fenólicos, determinar los órganos con mayor contenido de fenoles, establecer el cultivo in vi...
Dawoe, Evans; Asante, Winston; Acheampong, Emmanuel; Bosu, Paul
2016-12-01
The promotion of cacao agroforestry is one of the ways of diversifying farmer income and creating incentives through their inclusion in REDD+ interventions. We estimated the aboveground carbon stocks in cacao and shade trees, determined the floristic diversity of shade trees and explored the possibility of implementing REDD+ interventions in cacao landscapes. Using replicated multi-site transect approach, data were collected from nine 1-ha plots established on 5 km long transects in ten cacao growing districts in Ghana West Africa. Biomass of cacao and shade trees was determined using allometric equations. One thousand four hundred and one (1401) shade trees comprising 109 species from 33 families were recorded. Total number of species ranged from 34 to 49. Newbouldia laevis (Bignoniacea) was the most frequently occurring specie and constituted 43.2 % of all shade trees. The most predominant families were Sterculiaceae and Moraceae (10 species each), followed by Meliaceae and Mimosaceae (8 species each) and Caesalpiniacaea (6 species). Shannon diversity indices (H', H max and J') and species richness were low compared to other similar studies. Shade tree densities ranged from 16.2 ± 3.0 to 22.8 ± 1.7 stems ha -1 and differed significantly between sites. Carbon stocks of shade trees differed between sites but were similar in cacao trees. The average C stock in cacao trees was 7.45 ± 0.41 Mg C ha -1 compared with 8.32 ± 1.15 Mg C ha -1 in the shade trees. Cacao landscapes in Ghana have the potential of contributing to forest carbon stocks enhancement by increasing the stocking density of shade trees to recommended levels.
Association mapping of fruit, seed and disease resistance traits in Theobroma cacao L
An association mapping approach was employed to find markers for color, size, girth and mass of fruits; seed number and butterfat content; and resistance to black pod and witches’ broom diseases in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms...
Theobroma cacao is a tree cultivated in the tropics around the world for its seeds that are the source of both chocolate and cocoa butter. The cacao genome sequencing project initiated as a collaboration between USDA, Mars, Inc. and IBM has generated a great deal of transcriptome and genome sequenc...
Making a chocolate chip: development and evaluation of a 6K SNP array for Theobroma cacao.
Livingstone, Donald; Royaert, Stefan; Stack, Conrad; Mockaitis, Keithanne; May, Greg; Farmer, Andrew; Saski, Christopher; Schnell, Ray; Kuhn, David; Motamayor, Juan Carlos
2015-08-01
Theobroma cacao, the key ingredient in chocolate production, is one of the world's most important tree fruit crops, with ∼4,000,000 metric tons produced across 50 countries. To move towards gene discovery and marker-assisted breeding in cacao, a single-nucleotide polymorphism (SNP) identification project was undertaken using RNAseq data from 16 diverse cacao cultivars. RNA sequences were aligned to the assembled transcriptome of the cultivar Matina 1-6, and 330,000 SNPs within coding regions were identified. From these SNPs, a subset of 6,000 high-quality SNPs were selected for inclusion on an Illumina Infinium SNP array: the Cacao6kSNP array. Using Cacao6KSNP array data from over 1,000 cacao samples, we demonstrate that our custom array produces a saturated genetic map and can be used to distinguish among even closely related genotypes. Our study enhances and expands the genetic resources available to the cacao research community, and provides the genome-scale set of tools that are critical for advancing breeding with molecular markers in an agricultural species with high genetic diversity. © The Author 2015. Published by Oxford University Press on behalf of Kazusa DNA Research Institute.
Falque, M.; Lesdalons, C.; Eskes, A.B.
1996-01-01
We compared the influence of pollination intensity (PI) on fruit set and seed number per pod in two cacao (Theobroma cacao L.) clones, IFC5 (Forastero Lower-Amazon Amelonado), which is self-compatible and known to produce a high number of seeds per pod under open pollination, and SCA6 (Forastero
Cocoa Bean (Theobroma cacao L.Drying Kinetics Cinética del Secado de Cocoa (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Ndukwu MacManus Chinenye
2010-12-01
Full Text Available Cocoa (Theobroma cacao L. is widely produced in West Africa and South America and is a great economic tree crop, with so many industrial uses. In this work, the experimental drying kinetics of foreign species was investigated, and the experiments were carried out under isothermal conditions, using heated batch drier at 55, 70 and 81 ºC. The moisture ratio data obtained from change of moisture content with the drying time was fit to two thin layer drying model with good results. A faster drying process was observed at a higher drying temperature resulting in higher drying rates which is advantageous when evaluating costs. Fick’s second law of diffusion was used to predict effective diffusivity using experimental data assuming that the variation of diffusivity with temperature can be expressed by an Arrhenius type function, and the values of diffusivity obtained ranged from 6.137 x 10-10 to 2.1855 x 10-9 m2 s-1 for the temperature used. The Arrhenius constant (D is predicted at 8.64 x 10-4 m2 s-1 while the activation energy was predicted at 39.94 kJ mol-1.El cacao (Theobroma cacao L. es ampliamente producido en el Oeste de África y Sudamérica y es un cultivo de gran importancia económica, con muchos usos industriales. En este trabajo se investigó la cinética del secado experimental de especies foráneas, y se realizaron experimentos bajo condiciones isotérmicas, usando un secador discontinuo en caliente a 55, 70 y 81 °C. Los datos de relación de humedad obtenidos desde el cambio de contenido de humedad con el tiempo de secado se ajustaron a un modelo de secado de dos capas delgadas con buenos resultados. Se observó un proceso de secado más rápido a una temperatura de secado mayor resultando en mayores tasas de secado, lo que es ventajoso al evaluar costos. La segunda ley de difusión de Fick se usó para predecir difusividad efectiva usando datos experimentales, asumiendo que la variación de difusividad con la temperatura puede ser
Energy Technology Data Exchange (ETDEWEB)
Sena Gomes, A.R.
1987-01-01
Relative humidity, flooding, temperature, wind, and SO/sub 2/ variously influenced physiological processes and growth of tropical woody plants, with emphasis on three Theobroma cacao varieties and three Hevea brasiliensis families. Stomata were smaller and more numerous in Theobroma than in Hevea. In Theobroma, but not Heavea, stomatal frequency decreased from the leaf base to the apex and from the midrib outward. Stomata of Theobroma cacao var. Catongo opened in high relative humidity (RH) and closed in low RH. The more open stomata in high RH were associated with high rates of photosynthesis, low leaf water potential, high water use efficiency (WUE), and low transpiration rate (TR). Variations in TR and WUE were correlated with changes in vapor pressure deficit. Other responses included stomatal closure, decreased chlorophyll content, leaf epinasty, production of hypertrophied lenticels and adventitious roots, and acceleration of ethylene production. Responses to flooding varied with species, Theobroma varieties and Hevea families. Effects of temperature regimes on growth varied with species, varieties and families, plant parts, growth parameters, and time of harvesting. Optimal temperatures for dry weight increase of stems or roots of Theobroma cacao var. Comum were 22.2 C; and 33.3 C for dry weight increase or relative growth rates of leaves or seedlings. Optimal temperatures for growth varied for Hevea families. Wind injured leaves of Theobroma cacao, with more injury by wind of 6.0 than 3.0 m s/sup -1/. Stomata were more open on windy than on calm days, but tended to close at high wind speeds. Wind lowered transpiration rate but the reduction was not correlated with leaf dehydration. SO/sub 2/ at 0.5, 1.0, or 1.5 ppm for 24 h did not injure Theobroma leaves but reduced dry weight increment of leaves of var. Catongo but not Catongo/Sial.
Association mapping of seed and disease resistance traits in Theobroma cacao L.
Motilal, Lambert A; Zhang, Dapeng; Mischke, Sue; Meinhardt, Lyndel W; Boccara, Michel; Fouet, Olivier; Lanaud, Claire; Umaharan, Pathmanathan
2016-12-01
Microsatellite and single nucleotide polymorphism markers that could be used in marker assisted breeding of cacao were identified for number of filled seeds, black pod resistance and witches' broom disease resistance. An association mapping approach was employed to identify markers for seed number and resistance to black pod and witches' broom disease (WBD) in cacao (Theobroma cacao L.). Ninety-five microsatellites (SSRs) and 775 single nucleotide polymorphisms (SNPs) were assessed on 483 unique trees in the International Cocoa Genebank Trinidad (ICGT). Linkage disequilibrium (LD) and association mapping studies were conducted to identify markers to tag the phenotypic traits. Decay of LD occurred over an average 9.3 cM for chromosomes 1-9 and 2.5 cM for chromosome 10. Marker/trait associations were generally identified based on general linear models (GLMs) that incorporated principal components from molecular information on relatedness factor. Seven markers (mTcCIR 8, 66, 126, 212; TcSNP368, 697, 1370) on chromosomes 1 and 9 were identified for number of filled seeds (NSEED). A single marker was found for black pod resistance (mTcCIR280) on chromosome 3, whereas six markers on chromosomes 4, 5, 6, 8, and 10 were detected for WBD (mTcCIR91, 183; TcSNP375, 720, 1230 and 1374). It is expected that this association mapping study in cacao would contribute to the knowledge of the genetic determinism of cocoa traits and that the markers identified herein would prove useful in marker assisted breeding of cacao.
Soil microbial communities under cacao agroforestry and cover crop systems in Peru
Cacao (Theobroma cacao) trees are grown in tropical regions worldwide for chocolate production. We studied the effects of agroforestry management systems and cover cropping on soil microbial communities under cacao in two different replicated field experiments in Peru. Two agroforestry systems, Imp...
Seng, John; Herrera, Geovanny; Vaughan, Christopher S; McCoy, Michael B
2014-09-01
Cacao (Theobroma cacao) is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthllora roreri, known commonly as "monilia", has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Thichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia) at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma). Each treatment was applied to four trees of each clone. We monitored the incidence of monilia infection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p ≤ 0.05) in only 35d, as compared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1,500 kg dried beans/ha by 198 kg/ha up to 1,698 kg/ha or by a total increase over the whole 110 ha plantation by 21,780 kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days) would decrease infection incidence even more. Application of this fungal control
Molecular genetic diversity in a core of cocoa ( Theobroma cacao L ...
African Journals Online (AJOL)
This study aimed to assess the genetic variability in groups of 11 clones of Theobroma cacao L., from different geographical regions, based on microsatellite markers, with the interest to characterize germplasm for breeding. The products of the amplification of these materials with 15 simple sequence repeat (SSR) markers ...
Baharum, Zainal; Akim, Abdah Md; Hin, Taufiq Yap Yun; Hamid, Roslida Abdul; Kasran, Rosmin
2016-01-01
Plants have been a good source of therapeutic agents for thousands of years; an impressive number of modern drugs used for treating human diseases are derived from natural sources. The Theobroma cacao tree, or cocoa, has recently garnered increasing attention and become the subject of research due to its antioxidant properties, which are related to potential anti-cancer effects. In the past few years, identifying and developing active compounds or extracts from the cocoa bean that might exert anti-cancer effects have become an important area of health- and biomedicine-related research. This review provides an updated overview of T. cacao in terms of its potential anti-cancer compounds and their extraction, in vitro bioassay, purification, and identification. This article also discusses the advantages and disadvantages of the techniques described and reviews the processes for future perspectives of analytical methods from the viewpoint of anti-cancer compound discovery. PMID:27019680
Presencia de metales pesados en cultivo de cacao (Theobroma cacao L. orgánico
Directory of Open Access Journals (Sweden)
Hugo Alfredo Huamaní-Yupanqui
2012-12-01
Full Text Available La presencia de metales pesados en el cultivo de cacao (Theobroma cacao L. es actualmente un grave problema para agricultores y cooperativas de las regiones Huánuco y Ucayali, Perú. En el presente trabajo se evaluaron los contenidos de cadmio y plomo en suelos y hojas del cacao en estas regiones. Para el efecto se recolectaron y analizaron en laboratorio muestras tomadas en 22 parcelas con cultivos orgánicos de esta especie, 17 en la región Huánuco y cinco en la región Ucayali. Se realizaron análisis de correlación de Pearson entre los contenidos de plomo y cadmio disponibles en el suelo con variables foliares (P, Mg, Ca, Zn, Cd, Pb y del suelo (arena, arcilla y K. En los suelos, sólo en el caso de potasio se presentan deficiencias; mientras que en el tejido foliar se presentaron deficiencias de N, P, K, Mg y Zn. Los valores promedio de cadmio y plomo disponible en los suelos fueron 0.53 y 3.02 ppm y en las hojas de cacao de 0.21 y 0.58 ppm respectivamente.
Fertilisation minérale du cacaoyer ( Theobroma cacao L.) en Côte d ...
African Journals Online (AJOL)
En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point ...
Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire
2012-01-01
Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative ...
Sveinsson, Saemundur; Gill, Navdeep; Kane, Nolan C; Cronk, Quentin
2013-07-24
Transposable elements (TEs) and other repetitive elements are a large and dynamically evolving part of eukaryotic genomes, especially in plants where they can account for a significant proportion of genome size. Their dynamic nature gives them the potential for use in identifying and characterizing crop germplasm. However, their repetitive nature makes them challenging to study using conventional methods of molecular biology. Next generation sequencing and new computational tools have greatly facilitated the investigation of TE variation within species and among closely related species. (i) We generated low-coverage Illumina whole genome shotgun sequencing reads for multiple individuals of cacao (Theobroma cacao) and related species. These reads were analysed using both an alignment/mapping approach and a de novo (graph based clustering) approach. (ii) A standard set of ultra-conserved orthologous sequences (UCOS) standardized TE data between samples and provided phylogenetic information on the relatedness of samples. (iii) The mapping approach proved highly effective within the reference species but underestimated TE abundance in interspecific comparisons relative to the de novo methods. (iv) Individual T. cacao accessions have unique patterns of TE abundance indicating that the TE composition of the genome is evolving actively within this species. (v) LTR/Gypsy elements are the most abundant, comprising c.10% of the genome. (vi) Within T. cacao the retroelement families show an order of magnitude greater sequence variability than the DNA transposon families. (vii) Theobroma grandiflorum has a similar TE composition to T. cacao, but the related genus Herrania is rather different, with LTRs making up a lower proportion of the genome, perhaps because of a massive presence (c. 20%) of distinctive low complexity satellite-like repeats in this genome. (i) Short read alignment/mapping to reference TE contigs provides a simple and effective method of investigating
Actividad antibacteriana de la cáscara de cacao, Theobroma cacao L
Directory of Open Access Journals (Sweden)
Oscar Cuéllar G.
2012-12-01
Full Text Available Objetivo. Evaluar la actividad antibacteriana de diferentes fracciones de la cáscara de cacao (Theobroma cacao L.. Materiales y métodos. Se evaluó la actividad antibacteriana mediante el método de difusión en agar de diferentes fracciones de la cáscara de cacao, empleando cepas autóctonas y de referencia ATCC. Posteriormente, se hizo un análisis de estas fracciones por cromatografía líquida de alta eficiencia y cromatografía de gases acoplada a espectrometría de masas. Resultados. La fracción clorofórmica presentó actividad antibacteriana frente a Bacillus cereus ATCC 11778 y Streptococcus agalactiae (autóctona, con porcentajes de inhibición de 34.90% (100 μg/μl y 52.40% (100 μg/μl respectivamente. También se evidenció una concentración mínima inhibitoria de 512 μg/ml frente a Bacillus cereus ATCC 11778 y de 128 μg/ml frente a Streptococcus agalactiae. Conclusiones. Este trabajo es el primer reporte a saber en Colombia sobre actividad antibacteriana in vitro de la cáscara de cacao, el cual resulta ser un avance importante para esta agroindustria. Esta investigación abre paso a otros estudios relacionados para establecer el espectro de inhibición frente a otros microorganismos.
Directory of Open Access Journals (Sweden)
John Seng
2014-09-01
Full Text Available Cacao (Theobroma cacao is an important cash crop in tropical climates such as that of Latin America. Over the past several decades, the infection of cultivated cacao by Moniliophthora roreri, known commonly as “monilia”, has significantly hindered cacao production in Latin America. Studies have proposed the use of Trichoderma sp. Fungi in biocontrol treatments to prevent and reduce monilia infection, yet tests of Trichoderma-containing spray treatments on cacao agroforests have produced mixed results. Researchers and agricultural workers have suggested that addition of soil, fly ash, or other carbon sources to a Trichoderma spray may improve its efficacy in fighting monilia. To test these suggestions, we designed a series of spray mixtures including Trichoderma cultures, soil, and all necessary controls. We applied the spray mixtures to 80 cacao trees (20 trees for each of four resistant-selected clones to monilia at the FINMAC organic cacao plantation in Pueblo Nuevo de Guacimo, Limón Province, in northeastern Costa Rica in March-April 2013. Five treatments were applied (control, water, water plus sterilized soil, water plus Trichoderma, and water plus sterilized soil plus Trichoderma. Each treatment was applied to four trees of each clone. We monitored the incidence of moniliainfection under each spray treatment over the course of 35d. We found that spraying entire cacao trees two times with a mixture containing Trichoderma and sterilized soil significantly reduced the incidence of monilia infection by 11% (p<0.05 in only 35d, ascompared to the control. This reduction in loss of cacao pods translates into an increase of plantation mean productivity of 1 500kg dried beans/ha by 198kg/ha up to 1 698kg/ha or by a total increase over the whole 110ha plantation by 21 780kg. We propose that using such an antifungal spray over the whole course of a crop cycle (120 days would decrease infection incidence even more. Application of this fungal
Cacao (Theobroma cacao L.) is a native crop of the Americas; however severe losses due to frosty pod (FP) [Moniliophthora roreri (Cif. and Par.)], and black pod (BP) [Phytophthora palmivora (Butl.) Butl.] have reduced cacao in the Americas to only 13.0% of world production. Agronomic practices to co...
Florez, Sergio L; Erwin, Rachel L; Maximova, Siela N; Guiltinan, Mark J; Curtis, Wayne R
2015-05-16
Theobroma cacao, the chocolate tree, is an important economic crop in East Africa, South East Asia, and South and Central America. Propagation of elite varieties has been achieved through somatic embryogenesis (SE) but low efficiencies and genotype dependence still presents a significant limitation for its propagation at commercial scales. Manipulation of transcription factors has been used to enhance the formation of SEs in several other plant species. This work describes the use of the transcription factor Baby Boom (BBM) to promote the transition of somatic cacao cells from the vegetative to embryonic state. An ortholog of the Arabidopsis thaliana BBM gene (AtBBM) was characterized in T. cacao (TcBBM). TcBBM expression was observed throughout embryo development and was expressed at higher levels during SE as compared to zygotic embryogenesis (ZE). TcBBM overexpression in A. thaliana and T. cacao led to phenotypes associated with SE that did not require exogenous hormones. While transient ectopic expression of TcBBM provided only moderate enhancements in embryogenic potential, constitutive overexpression dramatically increased SE proliferation but also appeared to inhibit subsequent development. Our work provides validation that TcBBM is an ortholog to AtBBM and has a specific role in both somatic and zygotic embryogenesis. Furthermore, our studies revealed that TcBBM transcript levels could serve as a biomarker for embryogenesis in cacao tissue. Results from transient expression of TcBBM provide confirmation that transcription factors can be used to enhance SE without compromising plant development and avoiding GMO plant production. This strategy could compliment a hormone-based method of reprogramming somatic cells and lead to more precise manipulation of SE at the regulatory level of transcription factors. The technology would benefit the propagation of elite varieties with low regeneration potential as well as the production of transgenic plants, which
Fister, Andrew S; Landherr, Lena; Maximova, Siela N; Guiltinan, Mark J
2018-01-01
Theobroma cacao , the source of cocoa, suffers significant losses to a variety of pathogens resulting in reduced incomes for millions of farmers in developing countries. Development of disease resistant cacao varieties is an essential strategy to combat this threat, but is limited by sources of genetic resistance and the slow generation time of this tropical tree crop. In this study, we present the first application of genome editing technology in cacao, using Agrobacterium-mediated transient transformation to introduce CRISPR/Cas9 components into cacao leaves and cotyledon cells. As a first proof of concept, we targeted the cacao Non-Expressor of Pathogenesis-Related 3 (TcNPR3) gene, a suppressor of the defense response. After demonstrating activity of designed single-guide RNAs (sgRNA) in vitro , we used Agrobacterium to introduce a CRISPR/Cas9 system into leaf tissue, and identified the presence of deletions in 27% of TcNPR3 copies in the treated tissues. The edited tissue exhibited an increased resistance to infection with the cacao pathogen Phytophthora tropicalis and elevated expression of downstream defense genes. Analysis of off-target mutagenesis in sequences similar to sgRNA target sites using high-throughput sequencing did not reveal mutations above background sequencing error rates. These results confirm the function of NPR3 as a repressor of the cacao immune system and demonstrate the application of CRISPR/Cas9 as a powerful functional genomics tool for cacao. Several stably transformed and genome edited somatic embryos were obtained via Agrobacterium -mediated transformation, and ongoing work will test the effectiveness of this approach at a whole plant level.
Maximova, Siela N; Florez, Sergio; Shen, Xiangling; Niemenak, Nicolas; Zhang, Yufan; Curtis, Wayne; Guiltinan, Mark J
2014-07-16
Theobroma cacao L. is a tropical fruit tree, the seeds of which are used to create chocolate. In vitro somatic embryogenesis (SE) of cacao is a propagation system useful for rapid mass-multiplication to accelerate breeding programs and to provide plants directly to farmers. Two major limitations of cacao SE remain: the efficiency of embryo production is highly genotype dependent and the lack of full cotyledon development results in low embryo to plant conversion rates. With the goal to better understand SE development and to improve the efficiency of SE conversion we examined gene expression differences between zygotic and somatic embryos using a whole genome microarray. The expression of 28,752 genes was determined at 4 developmental time points during zygotic embryogenesis (ZE) and 2 time points during cacao somatic embryogenesis (SE). Within the ZE time course, 10,288 differentially expressed genes were enriched for functions related to responses to abiotic and biotic stimulus, metabolic and cellular processes. A comparison ZE and SE expression profiles identified 10,175 differentially expressed genes. Many TF genes, putatively involved in ethylene metabolism and response, were more strongly expressed in SEs as compared to ZEs. Expression levels of genes involved in fatty acid metabolism, flavonoid biosynthesis and seed storage protein genes were also differentially expressed in the two types of embryos. Large numbers of genes were differentially regulated during various stages of both ZE and SE development in cacao. The relatively higher expression of ethylene and flavonoid related genes during SE suggests that the developing tissues may be experiencing high levels of stress during SE maturation caused by the in vitro environment. The expression of genes involved in the synthesis of auxin, polyunsaturated fatty acids and secondary metabolites was higher in SEs relative to ZEs despite lack of lipid and metabolite accumulation. These differences in gene
Leal, Gildemberg Amorim; Gomes, Luiz Humberto; Efraim, Priscilla; de Almeida Tavares, Flavio Cesar; Figueira, Antonio
2008-08-01
Fermentation of Theobroma cacao (cacao) seeds is an absolute requirement for the full development of chocolate flavor precursors. An adequate aeration of the fermenting cacao seed mass is a fundamental prerequisite for a satisfactory fermentation. Here, we evaluated whether a controlled inoculation of cacao seed fermentation using a Kluyveromyces marxianus hybrid yeast strain, with an increased pectinolytic activity, would improve an earlier liquid drainage ('sweatings') from the fermentation mass, developing a superior final product quality. Inoculation with K. marxianus increased by one third the volume of drained liquid and affected the microorganism population structure during fermentation, which was detectable up to the end of the process. Introduction of the hybrid yeast affected the profile of total seed protein degradation evaluated by polyacrylamide gel electrophoresis, with improved seed protein degradation, and reduction of titrable acidity. Sensorial evaluation of the chocolate obtained from beans fermented with the K. marxianus inoculation was more accepted by analysts in comparison with the one from cocoa obtained through natural fermentation. The increase in mass aeration during the first 24 h seemed to be fundamental for the improvement of fermentation quality, demonstrating the potential application of this improved hybrid yeast strain with superior exogenous pectinolytic activity.
Rodríguez López, Carlos M; Wetten, Andrew C; Wilkinson, Michael J
2010-06-01
*Relatively little is known about the timing of genetic and epigenetic forms of somaclonal variation arising from callus growth. We surveyed for both types of change in cocoa (Theobroma cacao) plants regenerated from calli of various ages, and also between tissues from the source trees. *For genetic change, we used 15 single sequence repeat (SSR) markers from four source trees and from 233 regenerated plants. For epigenetic change, we used 386 methylation-sensitive amplified polymorphism (MSAP) markers on leaf and explant (staminode) DNA from two source trees and on leaf DNA from 114 regenerants. *Genetic variation within source trees was limited to one slippage mutation in one leaf. Regenerants were far more variable, with 35% exhibiting at least one mutation. Genetic variation initially accumulated with culture age but subsequently declined. MSAP (epigenetic) profiles diverged between leaf and staminode samples from source trees. Multivariate analysis revealed that leaves from regenerants occupied intermediate eigenspace between leaves and staminodes of source plants but became progressively more similar to source tree leaves with culture age. *Statistical analysis confirmed this rather counterintuitive finding that leaves of 'late regenerants' exhibited significantly less genetic and epigenetic divergence from source leaves than those exposed to short periods of callus growth.
The current USDA ARS Tropical Agriculture Research Station’s (TARS) cacao (Theobroma cacao L.) collection in Mayaguez, Puerto Rico, consists of 262 clonally propagated accessions. Each accession is represented by six individual trees grafted onto a common ‘Amelonado’ seedling rootstock and planted ...
Directory of Open Access Journals (Sweden)
Yuli Yetri
2016-11-01
Full Text Available Efek inhibisi korosi dan sifat-sifat adsorpsi oleh ekstrak kulit buah kakao (Theobroma cacao pada baja lunak (mild steel dalam larutan asam 1,5M HCl telah dipelajari menggunakan teknik konvensional metode berat hilang pada variasi waktu, konsentrasi dan suhu. Parameter-parameter termodinamika seperti energi aktivasi, entalpi, entropi dan perubahan energi bebas dihitung. Polarisasi elektrokimia telah dievaluasi untuk memastikan jenis inhibitor. Spektra infrared dan GCMS dilakukan untuk mengetahui senyawa ekstrak yang berperan dalam proses inhibisi. Morfologi permukaan sampel diamati dengan menggunakan scanning electro microscopy dengan energy dispersive X-ray spectroscopy (SEM-EDX . Keseluruhan hasil penelitian menunjukkan bahwa ekstrak polar kulit buah coklat dapat digunakan sebagai inhibitor korosi yang efektif pada baja karbon di lingkungan 1,5M HCl dengan pencapaian efisiensi inhibisi terkorosi sebesar 96.26% (weight loss dan 92.08% (Tafel pada konsentrasi ekstrak 2,5% selama768 jam. Mekanisme inhibisi adalah adsorpsi chemiadsorpsi berdasar tingginya nilai entalpi dan energi bebas.Effisiensi Inhibisi diketahui meningkat dengan peningkatan konsentrasi dari ekstrak serta menurun dengan peningkatan suhu. Kurva polarisasi menunjukkan inhibitor ini berperilaku sebagai inhibitor campuran dengan dominan pada inhibisi katodik. Ekstrak diadsorpsi oleh permukaan mild steel mengikuti model adsorpsi isotherm Langmuir. Kondisi permukaan mild steel menunjukan terjadinya adsorpsi di permukaan membentuk lapisan tipis di permukaan logam. Penambahan ekstrak kulit buah kakao ke dalam larutan HCl sangat efektif untuk mengurangi serangan korosi di permukaan mild steel. Kata kunci: Korosi, Inhibitor, Theobroma cacao, Mild steel, Potensiodinamik Corrosion Inhibition Efficiency Mild Steel in Acid Media with Inhibitor Peels Extract of Cacao (Theobroma cacaoABSTRACT Inhibition and adsorption properties of Theobroma cacao peel polar extract
Fister, Andrew S; Mejia, Luis C; Zhang, Yufan; Herre, Edward Allen; Maximova, Siela N; Guiltinan, Mark J
2016-05-17
The pathogenesis-related (PR) group of proteins are operationally defined as polypeptides that increase in concentration in plant tissues upon contact with a pathogen. To date, 17 classes of highly divergent proteins have been described that act through multiple mechanisms of pathogen resistance. Characterizing these families in cacao, an economically important tree crop, and comparing the families to those in other species, is an important step in understanding cacao's immune response. Using publically available resources, all members of the 17 recognized pathogenesis-related gene families in the genome of Theobroma cacao were identified and annotated resulting in a set of ~350 members in both published cacao genomes. Approximately 50 % of these genes are organized in tandem arrays scattered throughout the genome. This feature was observed in five additional plant taxa (three dicots and two monocots), suggesting that tandem duplication has played an important role in the evolution of the PR genes in higher plants. Expression profiling captured the dynamics and complexity of PR genes expression at basal levels and after induction by two cacao pathogens (the oomycete, Phytophthora palmivora, and the fungus, Colletotrichum theobromicola), identifying specific genes within families that are more responsive to pathogen challenge. Subsequent qRT-PCR validated the induction of several PR-1, PR-3, PR-4, and PR-10 family members, with greater than 1000 fold induction detected for specific genes. We describe candidate genes that are likely to be involved in cacao's defense against Phytophthora and Colletotrichum infection and could be potentially useful for marker-assisted selection for breeding of disease resistant cacao varieties. The data presented here, along with existing cacao-omics resources, will enable targeted functional genetic screening of defense genes likely to play critical functions in cacao's defense against its pathogens.
Efombagn, Mousseni Ives Bruno; Sounigo, Olivier; Courtois, Brigitte; Fouet, Olivier; Jeanneau, Mélanie; Lemainque, Arnaud; Pavek, Sylvana; Lanaud, Claire
2016-01-01
Phytophthora pod rot (PPR) caused by the specie Phytophthora megakarya is an important disease of cacao tree. Association mapping identified markers linked to PPR resistance in a cacao population of 260 trees planted under high disease pressure in a single plantation in a farmer's field. These cacao trees were derived from both selfing and full-sib progenies. The resistance traits were assessed through field observations of the natural pod attacks of the disease on the trunk (PRTnk) or the ca...
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-03-01
Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.Kata kunci: Theobroma cacao L., polifenol, embrio somatik, kalus, flavonoid, katekin, in vitro recalcitance
Muslimin; Wijayanti, W.; Anshary, A.; Basri, Z.; Cruz, A. F.; Suwastika, I. N.; Shiina, T.
2018-04-01
Cacao (Theobroma cacao L.) is one major agricultural commodity from central Sulawesi, which is significantly affected by a range of pest and diseases including Cacao Pod Borer (CPB), Pod Rod Diseases (PRD), and Vascular Streak Dieback (VSD). Intensive and extensive approaches, including introduction of various new superior cultivars/clones, and development of eco-friendly agricultural system were implemented in order to overtake that problem. Here, we observed the performance of three different clones (namely: Sulawesi 1, MCC01, and Tadulako-1) in two different locations (Parigi and Poso-which located along east coast of central Sulawesi province), and under two different Agricultural management system (echo-friendly-intensive and Non-Intensive). All clones tested showed their well-adapted and suitable to local conditions. The performance of each clone can be improved by intensive management system. Based on all observed parameters (number of wet bean per pot, bean count, fat and shell percentage, and percentage of infection) it convincingly showed that intensive management system was working well in improving the quality and quantity of cacao beans production, and it fit to commercial requirements. The highest rate of infection was by Phytophthora, and no significant differences on the overall performances. Clones of Sulawesi-1 and MCC01 most likely was better than Tadulako-1.
Lifescience Database Archive (English)
Full Text Available Theobroma cacao ... 2n=20 ... 2011 Sanger (WGS), Roche/454 , Illumina 26 Gb 326 Mb 16.7x... Newbler 4,792 25,912 EUGene following specific training for T. cacao 28,798 CIRAD; http://cocoagendb.cirad.fr Dec2010 Dec2010 10.1038/ng.736 21186351 ...
Helliwell, Emily E; Vega-Arreguín, Julio; Shi, Zi; Bailey, Bryan; Xiao, Shunyuan; Maximova, Siela N; Tyler, Brett M; Guiltinan, Mark J
2016-03-01
The internalization of some oomycete and fungal pathogen effectors into host plant cells has been reported to be blocked by proteins that bind to the effectors' cell entry receptor, phosphatidylinositol-3-phosphate (PI3P). This finding suggested a novel strategy for disease control by engineering plants to secrete PI3P-binding proteins. In this study, we tested this strategy using the chocolate tree Theobroma cacao. Transient expression and secretion of four different PI3P-binding proteins in detached leaves of T. cacao greatly reduced infection by two oomycete pathogens, Phytophthora tropicalis and Phytophthora palmivora, which cause black pod disease. Lesion size and pathogen growth were reduced by up to 85%. Resistance was not conferred by proteins lacking a secretory leader, by proteins with mutations in their PI3P-binding site, or by a secreted PI4P-binding protein. Stably transformed, transgenic T. cacao plants expressing two different PI3P-binding proteins showed substantially enhanced resistance to both P. tropicalis and P. palmivora, as well as to the fungal pathogen Colletotrichum theobromicola. These results demonstrate that secretion of PI3P-binding proteins is an effective way to increase disease resistance in T. cacao, and potentially in other plants, against a broad spectrum of pathogens. © 2015 Society for Experimental Biology, Association of Applied Biologists and John Wiley & Sons Ltd.
Where it occurs in South and Central America, M. roreri (Mr) causes a destructive pod disease (frosty pod rot) on Theobroma cacao (cacao). Hand pollinated cacao pods were inoculated with Mr spores in the field and assessed for disease symptoms over a 90 day period. On average, pods showed symptoms o...
TcNPR3 from Theobroma cacao functions as a repressor of the pathogen defense response.
Shi, Zi; Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J
2013-12-06
Arabidopsis thaliana (Arabidopsis) NON-EXPRESSOR OF PR1 (NPR1) is a transcription coactivator that plays a central role in regulating the transcriptional response to plant pathogens. Developing flowers of homozygous npr3 mutants are dramatically more resistant to infection by the pathogenic bacterium Pseudomonas syringae, suggesting a role of NPR3 as a repressor of NPR1-mediated defense response with a novel role in flower development. We report here the characterization of a putative NPR3 gene from the tropical tree species Theobroma cacao (TcNPR3). Like in Arabidopsis, TcNPR3 was constitutively expressed across a wide range of tissue types and developmental stages but with some differences in relative levels compared to Arabidopsis. To test the function of TcNPR3, we performed transgenic complementation analysis by introducing a constitutively expressing putative TcNPR3 transgene into an Arabidopsis npr3 mutant. TcNPR3 expressing Arabidopsis plants were partially restored to the WT pathogen phenotype (immature flowers susceptible to bacterial infection). To test TcNPR3 function directly in cacao tissues, a synthetic microRNA targeting TcNPR3 mRNA was transiently expressed in cacao leaves using an Agrobacterium-infiltration method. TcNPR3 knock down leaf tissues were dramatically more resistance to infection with Phytophthora capsici in a leaf bioassay, showing smaller lesion sizes and reduced pathogen replication. We conclude that TcNPR3 functions similar to the Arabidopsis NPR3 gene in the regulation of the cacao defense response. Since TcNPR3 did not show a perfect complementation of the Arabidopsis NPR3 mutation, the possibility remains that other functions of TcNPR3 remain to be found. This novel knowledge can contribute to the breeding of resistant cacao varieties against pathogens through molecular markers based approaches or biotechnological strategies.
Characterization of the legumains encoded by the genome of Theobroma cacao L.
Santana, Juliano Oliveira; Freire, Laís; de Sousa, Aurizangela Oliveira; Fontes Soares, Virgínia Lúcia; Gramacho, Karina Peres; Pirovani, Carlos Priminho
2016-01-01
Legumains are cysteine proteases related to plant development, protein degradation, programmed cell death, and defense against pathogens. In this study, we have identified and characterized three legumains encoded by Theobroma cacao genome through in silico analyses, three-dimensional modeling, genetic expression pattern in different tissues and as a response to the inoculation of Moniliophthora perniciosa fungus. The three proteins were named TcLEG3, TcLEG6, and TcLEG9. Histidine and cysteine residue which are part of the catalytic site were conserved among the proteins, and they remained parallel in the loop region in the 3D modeling. Three-dimensional modeling showed that the propeptide, which is located in the terminal C region of legumains blocks the catalytic cleft. Comparing dendrogram data with the relative expression analysis, indicated that TcLEG3 is related to the seed legumain group, TcLEG6 is related with the group of embryogenesis activities, and protein TcLEG9, with processes regarding the vegetative group. Furthermore, the expression analyses proposes a significant role for the three legumains during the development of Theobroma cacao and in its interaction with M. perniciosa. Copyright © 2015 Universidade Estadual de Santa Cruz, CNPJ: 40738999/0001-95. Published by Elsevier Masson SAS.. All rights reserved.
CACAO TO COCOA TO CHOCOLATE: HEALTHY FOOD?
ROYA KELISHADI
2010-01-01
ABSTRACT Chocolate is derived from cocoa beans - the fruit of the cacao tree or Theobroma cacao (the latin term: food of the gods). Recent published articles demonstrate that the quality and quantity of the antioxidants in cocoa and chocolate are very high and their flavonoids are believed to reduce the number of free radicals in the body that contribute to medical problems, such as cardiovascular disease and cancer and also to offer some anti-aging health benefits. Cocoa can lower the leukot...
Frosty pod rot (FPR), caused by Moniliophthora roreri is responsible for significant losses in Theobroma cacao. Due to the limited options for FPR management, biological control methods using Trichoderma are being studied. Combinations of three formulations and two Trichoderma isolates were studied ...
DuVal, Ashley; Gezan, Salvador A.; Mustiga, Guiliana; Stack, Conrad; Marelli, Jean-Philippe; Chaparro, José; Livingstone, Donald; Royaert, Stefan; Motamayor, Juan C.
2017-01-01
Breeding programs of cacao (Theobroma cacao L.) trees share the many challenges of breeding long-living perennial crops, and genetic progress is further constrained by both the limited understanding of the inheritance of complex traits and the prevalence of technical issues, such as mislabeled individuals (off-types). To better understand the genetic architecture of cacao, in this study, 13 years of phenotypic data collected from four progeny trials in Bahia, Brazil were analyzed jointly in a multisite analysis. Three separate analyses (multisite, single site with and without off-types) were performed to estimate genetic parameters from statistical models fitted on nine important agronomic traits (yield, seed index, pod index, % healthy pods, % pods infected with witches broom, % of pods other loss, vegetative brooms, diameter, and tree height). Genetic parameters were estimated along with variance components and heritabilities from the multisite analysis, and a trial was fingerprinted with low-density SNP markers to determine the impact of off-types on estimations. Heritabilities ranged from 0.37 to 0.64 for yield and its components and from 0.03 to 0.16 for disease resistance traits. A weighted index was used to make selections for clonal evaluation, and breeding values estimated for the parental selection and estimation of genetic gain. The impact of off-types to breeding progress in cacao was assessed for the first time. Even when present at <5% of the total population, off-types altered selections by 48%, and impacted heritability estimations for all nine of the traits analyzed, including a 41% difference in estimated heritability for yield. These results show that in a mixed model analysis, even a low level of pedigree error can significantly alter estimations of genetic parameters and selections in a breeding program. PMID:29250097
Theobroma cacao seedlings from the genotype CCN 51 were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16 and 32 mg Cu L-1) in nutrient solution. When doses were equal or higher than 8 mg Cu L-1, after 24 h of treatment application, leaf gas exch...
Samuels, Gary J; Ismaiel, Adnan; Rosmana, Ade; Junaid, Muhammad; Guest, David; McMahon, Peter; Keane, Philip; Purwantara, Agus; Lambert, Smilja; Rodriguez-Carres, Marianela; Cubeta, Marc A
2012-01-01
Vascular Streak Dieback (VSD) disease of cacao (Theobroma cacao) in Southeast Asia and Melanesia is caused by a basidiomycete (Ceratobasidiales) fungus Oncobasidium theobromae (syn. =Thanatephorus theobromae). The most characteristic symptoms of the disease are green-spotted leaf chlorosis or, commonly since about 2004, necrotic blotches, followed by senescence of leaves beginning on the second or third flush behind the shoot apex, and blackening of infected xylem in the vascular traces at the leaf scars resulting from the abscission of infected leaves. Eventually the shoot apex is killed and infected branches die. In susceptible cacao the fungus may grow through the xylem down into the main stem and kill a mature cacao tree. Infections in the stem of young plants prior to the formation of the first 3-4 lateral branches usually kill the plant. Basidiospores released from corticioid basidiomata developed on leaf scars or along cracks in the main vein of infected leaves infect young leaves. The pathogen commonly infects cacao but there are rare reports from avocado. As both crops are introduced to the region, the pathogen is suspected to occur asymptomatically in native vegetation. The pathogen is readily isolated but cultures cannot be maintained. In this study, DNA was extracted from pure cultures of O. theobromae obtained from infected cacao plants sampled from Indonesia. The internal transcribed spacer region (ITS), consisting of ITS1, 5.8S ribosomal RNA and ITS2, and a portion of nuclear large subunit (LSU) were sequenced. Phylogenetic analysis of ITS sequences placed O. theobromae sister to Ceratobasidium anastomosis groups AG-A, AG-Bo, and AG-K with high posterior probability. Therefore the new combination Ceratobasidium theobromae is proposed. A PCR-based protocol was developed to detect and identify C. theobromae in plant tissue of cacao enabling early detection of the pathogen in plants. A second species of Ceratobasidium, Ceratobasidium ramicola
Hanada, Rogério E; de Jorge Souza, T; Pomella, Alan W V; Hebbar, K Prakash; Pereira, José O; Ismaiel, Adnan; Samuels, Gary J
2008-11-01
The new species Trichoderma martiale was isolated as an endophyte from sapwood in trunks of Theobroma cacao (cacao, Malvaceae) in Brazil. Based on sequences of translation-elongation factor 1-alpha (tef1) and RNA polymerase II subunit (rpb2) T. martiale is a close relative of, and morphologically similar to, T. viride, but differs in the production of discrete pustules on corn meal-dextrose agar (CMD) and SNA, in having a faster rate of growth, and in being a tropical endophyte. This new species was shown, in small-scale, in situ field assays, to limit black pod rot of cacao caused by Phytophthora palmivora, the cause of black pod disease.
Silva, D V; Branco, S M J; Holanda, I S A; Royaert, S; Motamayor, J C; Marelli, J P; Corrêa, R X
2016-03-04
Theobroma cacao is a species of great economic importance with its beans used for chocolate production. The tree has been a target of various molecular studies. It contains many polyphenols, which complicate the extraction of nucleic acids with the extraction protocols requiring a large amount of plant material. These issues, therefore, necessitate the optimization of the protocols. The aim of the present study was to evaluate different methods for extraction of total RNA from shoot apical meristems of T. cacao 'CCN 51' and to assess the influence of storage conditions for the meristems on the extraction. The study also aimed to identify the most efficient protocol for RNA extraction using a small amount of plant material. Four different protocols were evaluated for RNA extraction using one shoot apical meristem per sample. Among these protocols, one that was more efficient was then tested to extract RNA using four different numbers of shoot apical meristems, subjected to three different storage conditions. The best protocol was tested for cDNA amplification using reverse transcription-polymerase chain reaction; the cDNA quality was determined to be satisfactory for molecular analyses. The study revealed that with the best RNA extraction protocol, one shoot apical meristem was sufficient for extraction of high-quality total RNA. The results obtained might enable advances in genetic analyses and molecular studies using reduced amount of plant material.
Thomas, Evert; van Zonneveld, Maarten; Loo, Judy; Hodgkin, Toby; Galluzzi, Gea; van Etten, Jacob
2012-01-01
Cacao (Theobroma cacao L.) is indigenous to the Amazon basin, but is generally believed to have been domesticated in Mesoamerica for the production of chocolate beverage. However, cacao's distribution of genetic diversity in South America is also likely to reflect pre-Columbian human influences that were superimposed on natural processes of genetic differentiation. Here we present the results of a spatial analysis of the intra-specific diversity of cacao in Latin America, drawing on a dataset of 939 cacao trees genotypically characterized by means of 96 SSR markers. To assess continental diversity patterns we performed grid-based calculations of allelic richness, Shannon diversity and Nei gene diversity, and distinguished different spatially coherent genetic groups by means of cluster analysis. The highest levels of genetic diversity were observed in the Upper Amazon areas from southern Peru to the Ecuadorian Amazon and the border areas between Colombia, Peru and Brazil. On the assumption that the last glaciation (22,000-13,000 BP) had the greatest pre-human impact on the current distribution and diversity of cacao, we modeled the species' Pleistocene niche suitability and overlaid this with present-day diversity maps. The results suggest that cacao was already widely distributed in the Western Amazon before the onset of glaciation. During glaciations, cacao populations were likely to have been restricted to several refugia where they probably underwent genetic differentiation, resulting in a number of genetic clusters which are representative for, or closest related to, the original wild cacao populations. The analyses also suggested that genetic differentiation and geographical distribution of a number of other clusters seem to have been significantly affected by processes of human management and accompanying genetic bottlenecks. We discuss the implications of these results for future germplasm collection and in situ, on farm and ex situ conservation of cacao.
Directory of Open Access Journals (Sweden)
Jaime Morante-Carriel
2017-12-01
Full Text Available En Ecuador, las plantaciones de cacao presentan bajos promedios de producción debido a la diversidad de patógenos, especialmente a la infección por Moniliophthora roreri (monilia. Se cree que existe una relación entre el ataque del hongo y el aumento de los niveles de expresión de genes codificantes de polifenol oxidasas (PPOs como mecanismo de defensa ante patógenos y herbívoros en diferentes plantas. Para la identificación de genes que codifican para PPOs, se seleccionaron hojas de cacao Nacional, provenientes de plantas resistentes y susceptibles a monilia, ubicadas en la Finca Experimental La Represa, propiedad de la Universidad Técnica Estatal de Quevedo. Se afinó un protocolo de extracción de ARN total de alta calidad para hojas de cacao recalcitrantes. Después de su retrotranscripción a ADNc, se realizaron ensayos de amplificación por PCR con diferentes primers, diseñados a partir de secuencias conservadas de PPOs. Los productos de amplificación permitieron la identificación de un gen de 961 pb, similar a un gen que codifica para la PPO predictiva de Theobroma cacao depositada en NCBI (XP_017978715.1 La identificación de este gen, es fundamental para evaluar a futuro los niveles de expresión y cuantificación en diferentes estados de desarrollo del fruto. Dicha cuantificación permitirá proponer herramientas de control para monilia y construir las bases para el mejoramiento genético del cacao Nacional.
SALAS LINARES, MARY JULISSA
2015-01-01
THEOBROMA CACAO GENERALIDADES DESCRIPCIÓN ORIGEN Y EXTENSIÓN CLASIFICACIÓN CIENTÍFICA VARIEDADES DEL CACAO DISTRIBUCIÓN USOS MEDICINALES EFECTO ANTICARIOGÉNICO GEL CARIES DENTAL FACTORES DE RIESGO MICROORGANISMOS IMPLICADOS EN LA CARIES DENTAL CARIES EN EL ESMALTE CLASIFICACIÓN DE LA CARIES MÉTODOS DE DETECCIÓN DE CARIES CRITERIOS ICDAS
Directory of Open Access Journals (Sweden)
Yacenia Morillo C.
2014-12-01
Full Text Available Random amplified microsatellite (RAMs markers six were used to characterize 93 genotypes of cocoa in Tumaco (Colombia. Hundred twenty seven bands were generated. The number of polymorphic loci varied between 11 and 25 for the AG and TG primers, respectively. This study differentiated the 93 genotypes into six groups with a 0.53 similarity, 0.28 mean heterozygosity (He for the population, and 0.12±0.02 genetic differentiation coefficient or Fst. A significant level of genetic diversity was evident in the T. cacao genotypes. This resource would benefit selection programs of individual trees or plant breeding programs. The genotypes clustered in a large proportion in accordance with the collection zone. This characteristic was associated with collection zones and along the rivers in the municipality of Tumaco. The RAM technique proved to be a useful tool for the determination of genetic diversity in Theobroma species.
Factors controlling phenol content on Theobroma cacao callus culture
International Nuclear Information System (INIS)
Quiñones-Galvez, Janet; HernándezTorre, Martha de la; Quirós Molina, Yemeys; Capdesuñer Ruiz, Yanelis; Trujillo Sánchez, Reinaldo
2016-01-01
Theobroma cacao L. is known in folk medicine as an antiseptic, diuretic and antiparasitic. Foods derived from this plant are rich in natural products of high added value, including phenolic compounds. As in vitro cultivation handle is an alternative source for the production of these metabolites. The present study was conducted to obtain phenolic compounds from callus culture with embryogenic structures. Culture conditions (agitation, light and glucose) were established to increase the concentration of phenols in calluses and elicitors to achieve the increase in callus and excretion into the culture area. The accumulation of phenolic compounds was favored with the additional supplement of glucose, growth in agitation and darkness. The addition of random hydroxylated cyclodextrins allowed the increase in the specific yield of phenols and biomass. (author)
Vázquez-Ovando, J A; Molina-Freaner, F; Nuñez-Farfán, J; Ovando-Medina, I; Salvador-Figueroa, M
2014-12-12
Criollo-type cacao trees are an important pool of genes with potential to be used in cacao breeding and selection programs. For that reason, we assessed the diversity and population structure of Criollo-type trees (108 cultivars with Criollo phenotypic characteristics and 10 Criollo references) using 12 simple sequence repeat (SSR) markers. Cultivars were selected from 7 demes in the Soconusco region of southern Mexico. SSRs amplified 74 alleles with an average of 3.6 alleles per population. The overall populations showed an average observed heterozygosity of 0.28, indicating heterozygote deficiency (average fixation index F = 0.50). However, moderate allelic diversity was found within populations (Shannon index for all populations I = 0.97). Bayesian method analysis determined 2 genetic clusters (K = 2) within individuals. In concordance, an assignment test grouped 37 multilocus genotypes (including 10 references) into a first cluster (Criollo), 54 into a second (presumably Amelonado), and 27 admixed individuals unassigned at the 90% threshold likely corresponding to the Trinitario genotype. This classification was supported by the principal coordinate analysis and analysis of molecular variance, which showed 12% of variation among populations (FST = 0.123, P cocoa.
Directory of Open Access Journals (Sweden)
Jaime A. Osorio-Guarín
2017-11-01
Full Text Available Beans of the species Theobroma cacao L., also known as cacao, are the raw material to produce chocolate. Colombian cacao has been classified as a fine flavor cacao that represents the 5% of cacao world’s production. Colombian genetic resources from this species are conserved in ex situ and in-field germplasm banks, since T. cacao has recalcitrant seeds to desication and long-term storage. Currently, the collection of T. cacao of the Colombian Corporation of Agricultural Research (CORPOICA has approximately 700 germplasm accessions. We conducted a molecular analysis of Corpoica’s cacao collection and a morphological characterization of some accessions with the goal to study its genetic diversity and population structure and, to select interesting accessions for the cacao’s breeding program. Phenotypic evaluation was performed based on 18 morphological traits and 4 biochemical traits. PCA analysis of morphological traits explained 60.6% of the total variation in seven components and 100% of the total variation of biochemical traits in four components, grouping the collection in 4 clusters for both variables. We explored 565 accessions from Corpoica’s germplasm and 252 accessions from reference populations using 96 single nucleotide polymorphism (SNP molecular markers. Molecular patterns of cacao Corpoica’s collection were obtained amplifying specific alleles in a Fluidigm platform that used integrated circuits of fluids. Corpoica’s collection showed highest genetic diversity [Expected Heterozygosity (HE = 0.314, Observed Heterozygosity (HO = 0.353] that is reduced when reference populations were included in the dataset (HE = 0.294, HO = 0.261. The collection was divided into four clusters based on population structure analysis. Cacao accessions from distinct groups showed some taxonomic concordance and reflected their geographic origins. For instance, accessions classified as Criollo were clearly differentiated in one group and we
The cocoa tree, Theobroma cacao L., suffers large yield losses in Aceh Indonesia to the disease black pod rot, caused by Phytophthora spp. Despite having the largest area under cacao production in Sumatra, farmers in the Aceh region have low overall production because of losses to insect pests and b...
Gidoin, Cynthia; Babin, Régis; Bagny Beilhe, Leïla; Cilas, Christian; ten Hoopen, Gerben Martijn; Bieng, Marie Ange Ngo
2014-01-01
Combining crop plants with other plant species in agro-ecosystems is one way to enhance ecological pest and disease regulation mechanisms. Resource availability and microclimatic variation mechanisms affect processes related to pest and pathogen life cycles. These mechanisms are supported both by empirical research and by epidemiological models, yet their relative importance in a real complex agro-ecosystem is still not known. Our aim was thus to assess the independent effects and the relative importance of different variables related to resource availability and microclimatic variation that explain pest and disease occurrence at the plot scale in real complex agro-ecosystems. The study was conducted in cacao (Theobroma cacao) agroforests in Cameroon, where cocoa production is mainly impacted by the mirid bug, Sahlbergella singularis, and black pod disease, caused by Phytophthora megakarya. Vegetation composition and spatial structure, resource availability and pest and disease occurrence were characterized in 20 real agroforest plots. Hierarchical partitioning was used to identify the causal variables that explain mirid density and black pod prevalence. The results of this study show that cacao agroforests can be differentiated on the basis of vegetation composition and spatial structure. This original approach revealed that mirid density decreased when a minimum number of randomly distributed forest trees were present compared with the aggregated distribution of forest trees, or when forest tree density was low. Moreover, a decrease in mirid density was also related to decreased availability of sensitive tissue, independently of the effect of forest tree structure. Contrary to expectations, black pod prevalence decreased with increasing cacao tree abundance. By revealing the effects of vegetation composition and spatial structure on mirids and black pod, this study opens new perspectives for the joint agro-ecological management of cacao pests and diseases at the
1H NMR study of fermented cocoa (Theobroma cacao L.) beans.
Caligiani, Augusta; Acquotti, Domenico; Cirlini, Martina; Palla, Gerardo
2010-12-08
This study reports for the first time the metabolic profile of cocoa (Theobroma cacao L.) beans using the (1)H NMR technique applied to polar extracts of fermented cocoa beans. The simultaneous detection and quantification of amino acids, polyalcohols, organic acids, sugars, methylxanthines, catechins, and phenols were obtained by assigning the major signals of the spectra for different varieties of cocoa beans (Forastero, Criollo, and Trinitario) from different countries (Ecuador, Ghana, Grenada, and Trinidad). The data set obtained, representative of all classes of soluble compounds of cocoa, was useful to characterize the fermented cocoa beans as a function of the variety and geographic origin.
Kang, Heerim; Lee, Chang Hyung; Kim, Jong Rhan; Kwon, Jung Yeon; Son, Myoung-Jin; Kim, Jong-Eun; Lee, Ki Won
2017-02-01
Cacao beans from Theobroma cacao are an abundant source of polyphenols, particularly flavonoids. Previous studies demonstrated that cacao flavanols decrease pro-inflammatory cytokines resulting in the alleviation of allergic symptoms. We sought to investigate the effects of cacao extract (CE) on Dermatophagoides farinae extract (DFE)-induced atopic dermatitis (AD)-like symptoms. CE attenuated DFE-induced AD-like symptoms as assessed by skin lesion analyses, dermatitis score, and skin thickness. Histopathological analysis revealed that CE suppressed DFE-induced immune cell infiltration into the skin. These observations occurred concomitantly with the downregulation of inflammatory markers including serum immunoglobulin (Ig) E, chemokine; thymus and activation-regulated chemokine and macrophage-derived chemokine as well as the skin-derived cytokines interleukin (IL)-4, IL-5, and interferon-γ. CE also significantly alleviated transepidermal water loss and increased skin hydration. These results suggest that CE, a natural phytochemical-rich food, has potential therapeutic efficacy for the treatment of AD. Copyright © 2016. Published by Elsevier Ltd.
Tree diversity and canopy cover in cocoa systems in Ghana
DEFF Research Database (Denmark)
Asare, Richard; Ræbild, Anders
2016-01-01
Cocoa (Theobroma cacao L.) growing systems in Ghana and West Africa consist of diverse tree species and densities.This study was conducted to determine factors that influence tree species configurations and how tree characteristics affect canopy cover in cocoa farms. Eighty-six farmers...
Directory of Open Access Journals (Sweden)
Amiyatun Naini
2011-11-01
Full Text Available Nylon thermoplastic resin is material of choice for the making of flexible. This denture do not use wire retention, but has the physical properties of water absorption. In the oral cavity, it will always be in contact with food and beverages consumed. One of the foods that are consumed by the public is chocolate. This study aimed to determine the effect of cocoa (Theobroma cacao L on color stability of the thermoplastic nylon denture base. The study sample was thermoplastic nylon (valplast with a size of 10x10x2 mm soaked in the chocolate solution for 7 and 14 days. As the control, the sample soaked with distilled water. The color testing stability used was densitometer. There were significant differences between the control group (distilled water and the chocolate solution. This was due to dissolved components/tannin having a capillary flow diffusion into thermoplastic nylons that causing discoloration. The conclusion of this study, there was the effect of cocoa (Theobroma cacao L against the color stability of the nylon thermoplastic denture base. The longer time of immersion of nylon thermoplastic the greater the change in color.
Study of Seed Germination by Soaking Methode of Cacao (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2014-12-01
Full Text Available Study of germination methods conduct to get information about seed viability based on germination rate, percentage of germination and vigority. Germination methods was studied to get the efficiency and effectivity of germination, easy to handle, low costs with high vigority. Sand and gunny sack methods for germination, need extensive place and 3-4 days germination period after planting. This research will study the alternative of germination method with soaking. This method can be accelerating germination rate and effectively place usage without decreasing the quality of cacao seedling.The research was done at Kaliwining Experimental Station, Indonesian Coffee and Cocoa Research Institue. This research consist of two experiment was arranged based on factorial completely random design. First experiment will observed to compared germination rate and the second experiment will observed seedling quality between soaking and wet gunny sack germination method.The results showed that length of radicel on soaking method longer than wet gunny sack method. Growth of radicel started from 2 hours after soaking, moreover length of radicel at 4 hours after soaking have significant different value with gunny sack method. On 24 hours after soaking have 3,69 mm and 0,681 mm on wet gunny sack treatment. Except lengt of hipocotyl, there is not different condition between seedling that out came from soaking and wet gunny sack method. Length of hipocotyl on 36 hours after soaking have 9,15 cm and significant different between wet gunny sack germination method that have 5,40 cm. Keywords : seed germination, soaking method, Theobroma cacao L., cocoa seedlings
Directory of Open Access Journals (Sweden)
Johana Andrea Guzmán Duque
2014-12-01
Full Text Available El departamento de Bolívar (Colombia presenta condiciones aptas tanto agrícolas como culturales para el desarrollo productivo de cacao de fino aroma. Esta actividad ofrece una oportunidad conveniente para su desarrollo sostenible, económico y de proyección social. La presente investigación evaluó las características sensoriales del cacao Theobroma cacao L. en seis municipios del sur de Bolívar para determinar atributos propios y diferencias significativas entre estas regiones; para esto se realizó un muestreo de granos secos y mazorcas de cacao, de los clones más representativos de cada municipio. El proceso se llevó a cabo con 18 jueces capacitados para detectar, describir y discriminar propiedades sensoriales en el cacao, quienes evaluaron las muestras a través de cuatro pruebas sensoriales específicas diseñadas para realizar la caracterización organoléptica del cacao de Bolívar, seleccionando para este fin las pruebas descriptivas de perfil de sabor y análisis cuantitativo y las pruebas discriminativas de ordenamiento y escalar de control. El análisis físico y sensorial del grano reveló la correlación entre las condiciones agroecológicas y tecnológicas (especialmente aquellos que tienen que ver con las operaciones de fermentación y/o beneficio con las cualidades sensoriales que éste posee en sus atributos de sabor y aroma.
Amorim, Juliana C; Vriesmann, Lucia Cristina; Petkowicz, Carmen L O; Martinez, Glaucia Regina; Noleto, Guilhermina R
2016-11-01
In vitro effects of acetylated pectin (OP) isolated from cacao pod husks (Theobroma cacao L.), its partially deacetylated and de-esterified form (MOP), and a commercial homogalacturonan (PG) were investigated on murine peritoneal macrophages. MOP stood out among the studied pectins. After 48h of incubation, compared with the control group, it was able to promote significant macrophage morphological differentiation from resident to activated stage and also stimulated nitric oxide production, which reached a level of 85% of that of LPS stimulus. In the presence of the highest tested concentration of MOP (200μg·mL -1 ), the levels of the cytokines TNF-α (6h) and IL-12 and IL-10 (48h) increased substantially in relation to untreated cells. Our results show that the partial deacetylation and de-esterification of pectin extracted from cacao pod husks (T. cacao L.) produced a polymer with greater ability than its native form to activate macrophages to a cytotoxic phenotype. Like this, they provide the possibility of a therapeutic application to MOP, which could lead to a decreased susceptibility to microbial infection besides antitumor activity. Additionally, the present results also corroborate with the proposition of that the chemical modifications of the biopolymers can result in an improved molecule with new possibilities of application. Copyright © 2016 Elsevier B.V. All rights reserved.
Acebo-Guerrero, Y; Hernández-Rodríguez, A; Vandeputte, O; Miguélez-Sierra, Y; Heydrich-Pérez, M; Ye, L; Cornelis, P; Bertin, P; El Jaziri, M
2015-10-01
To isolate and characterize rhizobacteria from Theobroma cacao with antagonistic activity against Phytophthora palmivora, the causal agent of the black pod rot, which is one of the most important diseases of T. cacao. Among 127 rhizobacteria isolated from cacao rhizosphere, three isolates (CP07, CP24 and CP30) identified as Pseudomonas chlororaphis, showed in vitro antagonistic activity against P. palmivora. Direct antagonism tested in cacao detached leaves revealed that the isolated rhizobacteria were able to reduce symptom severity upon infection with P. palmivora Mab1, with Ps. chlororaphis CP07 standing out as a potential biocontrol agent. Besides, reduced symptom severity on leaves was also observed in planta where cacao root system was pretreated with the isolated rhizobacteria followed by leaf infection with P. palmivora Mab1. The production of lytic enzymes, siderophores, biosurfactants and HCN, as well as the detection of genes encoding antibiotics, the formation of biofilm, and bacterial motility were also assessed for all three rhizobacterial strains. By using a mutant impaired in viscosin production, derived from CP07, it was found that this particular biosurfactant turned out to be crucial for both motility and biofilm formation, but not for the in vitro antagonism against Phytophthora, although it may contribute to the bioprotection of T. cacao. In the rhizosphere of T. cacao, there are rhizobacteria, such as Ps. chlororaphis, able to protect plants against P. palmivora. This study provides a theoretical basis for the potential use of Ps. chlororaphis CP07 as a biocontrol agent for the protection of cacao plants from P. palmivora infection. © 2015 The Society for Applied Microbiology.
Liu, Yi; Shi, Zi; Maximova, Siela; Payne, Mark J; Guiltinan, Mark J
2013-12-05
The proanthocyanidins (PAs), a subgroup of flavonoids, accumulate to levels of approximately 10% total dry weight of cacao seeds. PAs have been associated with human health benefits and also play important roles in pest and disease defense throughout the plant. To dissect the genetic basis of PA biosynthetic pathway in cacao (Theobroma cacao), we have isolated three genes encoding key PA synthesis enzymes, anthocyanidin synthase (ANS), anthocyanidin reductase (ANR) and leucoanthocyanidin reductase (LAR). We measured the expression levels of TcANR, TcANS and TcLAR and PA content in cacao leaves, flowers, pod exocarp and seeds. In all tissues examined, all three genes were abundantly expressed and well correlated with PA accumulation levels, suggesting their active roles in PA synthesis. Overexpression of TcANR in an Arabidopsis ban mutant complemented the PA deficient phenotype in seeds and resulted in reduced anthocyanidin levels in hypocotyls. Overexpression of TcANS in tobacco resulted in increased content of both anthocyanidins and PAs in flower petals. Overexpression of TcANS in an Arabidopsis ldox mutant complemented its PA deficient phenotype in seeds. Recombinant TcLAR protein converted leucoanthocyanidin to catechin in vitro. Transgenic tobacco overexpressing TcLAR had decreased amounts of anthocyanidins and increased PAs. Overexpressing TcLAR in Arabidopsis ldox mutant also resulted in elevated synthesis of not only catechin but also epicatechin. Our results confirm the in vivo function of cacao ANS and ANR predicted based on sequence homology to previously characterized enzymes from other species. In addition, our results provide a clear functional analysis of a LAR gene in vivo.
Aime, M C; Phillips-Mora, W
2005-01-01
The two most devastating diseases of cacao (Theobroma cacao)--the source of chocolate--in tropical America are caused by the fungi Crinipellis perniciosa (witches' broom disease) and Moniliophthora roreri (frosty pod rot or moniliasis disease). Despite the agricultural, socio-economic and environmental impact of these fungi, most aspects of their life cycles are unknown, and the phylogenetic relationships of M. roreri have yet to be conclusively established. In this paper, extensive phylogenetic analyses of five nuclear gene regions (28S rDNA, 18S rDNA, ITS, RPB1, and EF1-alpha) confirm that C. perniciosa and M. roreri are sister taxa that belong in the Marasmiaceae (euagarics). Furthermore, these taxa form part of a separate and distinct lineage within the family. This lineage includes the biotrophic fungi Moniliophthora perniciosa comb. nov. and M. roreri, as well as one undescribed endophytic species. The sister genera to Moniliophthora are Marasmius, Crinipellis and Chaetocalathus, which consist mainly of saprotrophic litter fungi.
Li, Fupeng; Hao, Chaoyun; Yan, Lin; Wu, Baoduo; Qin, Xiaowei; Lai, Jianxiong; Song, Yinghui
2015-09-01
In higher plants, sucrose synthase (Sus, EC 2.4.1.13) is widely considered as a key enzyme involved in sucrose metabolism. Although, several paralogous genes encoding different isozymes of Sus have been identified and characterized in multiple plant genomes, to date detailed information about the Sus genes is lacking for cacao. This study reports the identification of six novel Sus genes from economically important cacao tree. Analyses of the gene structure and phylogeny of the Sus genes demonstrated evolutionary conservation in the Sus family across cacao and other plant species. The expression of cacao Sus genes was investigated via real-time PCR in various tissues, different developmental phases of leaf, flower bud and pod. The Sus genes exhibited distinct but partially redundant expression profiles in cacao, with TcSus1, TcSus5 and TcSus6, being the predominant genes in the bark with phloem, TcSus2 predominantly expressing in the seed during the stereotype stage. TcSus3 and TcSus4 were significantly detected more in the pod husk and seed coat along the pod development, and showed development dependent expression profiles in the cacao pod. These results provide new insights into the evolution, and basic information that will assist in elucidating the functions of cacao Sus gene family.
Nygren, Pekka; Leblanc, Humberto A
2015-02-01
Natural abundance of (15)N (δ (15)N) was determined in bulk soil, rhizospheric soil and vegetation in an organically managed cacao (Theobroma cacao L.) plantation with Inga edulis Mart. legume trees (inga) as the principal shade for studying the nitrogen (N) cycle in the system. Cacao without contact with legumes in an adjacent plantation was used as the reference for N2 fixation and direct N transfer calculations. Bulk and rhizospheric soils contained 72 and 20%, respectively, of whole- system N. No vegetation effect on δ (15)N in rhizospheric soil was detected, probably due to the high native soil N pool. Fine roots of the cacaos associated with inga contained ∼35% of N fixed from the atmosphere (Nf) out of the total N. Leaves of all species had significantly higher δ (15)N than fine roots. Twenty percent of system Nf was found in cacao suggesting direct N transfer from inga via a common mycelial network of mycorrhizal fungi or recycling of N-rich root exudates of inga. Inga had accumulated 98 kg [Nf] ha(-1) during the 14-year history of the plantation. The conservative estimate of current N2 fixation rate was 41 kg [Nf] ha(-1) year(-1) based on inga biomass only and 50 kg [Nf] ha(-1) year(-1) based on inga and associated trees. © The Author 2015. Published by Oxford University Press. All rights reserved. For Permissions, please email: journals.permissions@oup.com.
Directory of Open Access Journals (Sweden)
Adriana Zulay Argüello-Navarro
2014-09-01
Full Text Available La adaptabilidad del cacao (Theobroma cacao L. en condiciones adversas permite sugerir que la microbiota asociada con la rizosfera desempeña una función importante para la nutrición y el desarrollo de la planta. En el trabajo se evaluó el potencial biofertilizante de bacterias fijadoras de nitrógeno (diazótrofas aisladas de suelos cacaoteros por la técnica de diluciones seriadas. Las bacterias se aislaron en medios semiselectivos (NFb, JMV, LGI, JNFb. Los aislados puros se caracterizaron morfológica y bioquímicamente y complementariamente se evaluó la capacidad de fijación biológica de nitrógeno (FBN por el método de Micro-Kjeldahl. Los aislados con mejor capacidad de fijación de nitrógeno fueron seleccionados para evaluar su potencial promotor de crecimiento durante 120 días en plantas de cacao clon CCN 51 establecidas a partir de semillas. El análisis de datos mostró que las plantas de cacao respondieron efectivamente a los tratamientos con bacterias donde las variables de crecimiento y N (% foliar incrementaron significativamente, en comparación con el testigo. Se destacó el aporte de los aislados DKA2J24, DKB3J73 presuntamente del género Burkholderia sp. y DKA1L3 semejante al género Gluconacetobacter sp., todos con un gran potencial como biofertilizantes en la prueba de bioensayo.
Genetic variation in bioaccumulation and partitioning of cadmium in Theobroma cacao L.
Lewis, Caleb; Lennon, Adrian M; Eudoxie, Gaius; Umaharan, Pathmanathan
2018-06-02
Cadmium (Cd) is a non-essential heavy metal that is toxic to both plants and animals and chocolates have been identified as a contributor to the human dietary Cd intake. One hundred accessions representing the various genetic groups and hybrid populations in Theobroma cacao L. held at the International Cocoa Genebank, Trinidad were evaluated for leaf and bean cadmium levels with three tree replications. Representative samples of soil from the drip zone around each tree were evaluated for bioavailable cadmium. Although there were significant differences (P ≤ 0.05) among genetic groups for leaf and bean Cd much of the variation was between accessions. There was a 13-fold variation in bean Cd and a 7-fold variation in leaf Cd between accessions despite the bioavailable Cd in the soil being uniform. There were differences in the level of partitioning into beans evident by significant variation (P ≤ 0.05) in bean Cd as a percentage of the cumulative leaf and bean Cd concentration (15-52%) between accessions. Although in general there was a higher concentration of cadmium in the testa than the cotyledon of the cocoa bean there was considerable genetic variation. These results point to the potential of using a genetic strategy to mitigate cadmium within cocoa beans either through breeding or through the use of low cadmium uptake rootstocks in grafting. The results will fuel further work into the understanding of mechanisms and genetics of cadmium uptake and partitioning in cocoa. Copyright © 2018. Published by Elsevier B.V.
Cacao (Theobroma cacao) is a very important crop in southern Bahia, Brazil, which needs good climate and soil conditions and management for great productivity. In this region, the culture is developed in a large variety of soils, which indicates differentiated products. The aim of this study was to ...
Directory of Open Access Journals (Sweden)
Thiago Édson Ribeiro da Silva
2008-10-01
Full Text Available The objective of this work was to evaluated a procedure for somatic embryogenesis and regeneration of cacao (Theobroma cacao L. elite clones. Petal explants from cacao clones TSH 565 and TSH 1188 were cultured on PCG and SCG-2 media, for calli growth. Somatic embryos were formed on the surface of embryogenic calli after transfer to embryo development (ED medium. Clone TSH 565 showed a higher embryogenic potential than TSH 1188. The best combination of carbon source for embryo induction in ED medium was genotype-specific. Embryogenic callus formations increased in micropore tape-sealed Petri dishes, irrespective of cacao genotype. Mature somatic embryos were successfully converted into plantlets.O objetivo deste trabalho foi avaliar um procedimento para embriogênese somática e regeneração de clones elite de cacau. Pétalas dos clones de cacau TSH 565 e TSH 1188 foram cultivadas em meios PCG e SCG-2 para o crescimento de calos. Embriões somáticos desenvolveram-se na superfície dos calos embriogênicos, após a transferência para o meio ED. O clone TSH 565 apresentou maior potencial embriogênico do que o TSH 1188. A melhor combinação de fonte de carbono quanto à indução de embriões em meio ED foi específica do genótipo. A formação de calos embriogênicos foi superior em placas de Petri seladas com fita hipoalergênica, independentemente do genótipo. Embriões maduros de ambos os genótipos foram convertidos em plântulas.
McElroy, Michel S; Navarro, Alberto J R; Mustiga, Guiliana; Stack, Conrad; Gezan, Salvador; Peña, Geover; Sarabia, Widem; Saquicela, Diego; Sotomayor, Ignacio; Douglas, Gavin M; Migicovsky, Zoë; Amores, Freddy; Tarqui, Omar; Myles, Sean; Motamayor, Juan C
2018-01-01
Cacao ( Theobroma cacao ) is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches' broom disease (WBD) and frosty pod rot disease (FPRD), are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri , respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS) and genomic selection (GS) provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS) and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP) microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod), one of FPRD (monilia pod) and two productivity traits (total fresh weight of pods and % healthy pods produced). GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families), varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom) to 0.15 (monilia pod), and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds
Directory of Open Access Journals (Sweden)
Michel S. McElroy
2018-03-01
Full Text Available Cacao (Theobroma cacao is a globally important crop, and its yield is severely restricted by disease. Two of the most damaging diseases, witches’ broom disease (WBD and frosty pod rot disease (FPRD, are caused by a pair of related fungi: Moniliophthora perniciosa and Moniliophthora roreri, respectively. Resistant cultivars are the most effective long-term strategy to address Moniliophthora diseases, but efficiently generating resistant and productive new cultivars will require robust methods for screening germplasm before field testing. Marker-assisted selection (MAS and genomic selection (GS provide two potential avenues for predicting the performance of new genotypes, potentially increasing the selection gain per unit time. To test the effectiveness of these two approaches, we performed a genome-wide association study (GWAS and GS on three related populations of cacao in Ecuador genotyped with a 15K single nucleotide polymorphism (SNP microarray for three measures of WBD infection (vegetative broom, cushion broom, and chirimoya pod, one of FPRD (monilia pod and two productivity traits (total fresh weight of pods and % healthy pods produced. GWAS yielded several SNPs associated with disease resistance in each population, but none were significantly correlated with the same trait in other populations. Genomic selection, using one population as a training set to estimate the phenotypes of the remaining two (composed of different families, varied among traits, from a mean prediction accuracy of 0.46 (vegetative broom to 0.15 (monilia pod, and varied between training populations. Simulations demonstrated that selecting seedlings using GWAS markers alone generates no improvement over selecting at random, but that GS improves the selection process significantly. Our results suggest that the GWAS markers discovered here are not sufficiently predictive across diverse germplasm to be useful for MAS, but that using all markers in a GS framework holds
Aldave Palacios, Gladis Josefina
2016-01-01
Estudia las variedades de cacao (Theobroma cacao L.) CCN-51 e ICS-6, procedentes del distrito de Uchiza, provincia de Tocache, departamento de San Martín, en Perú. Efectúa el tratamiento térmico de tostado a las temperaturas de 120 y 130 °C por 40 y 50 minutos, los nibs de cacao (granos de cacao tostados y pelados) son evaluados sensorialmente por seis jueces entrenados. La evaluación estadística mediante la prueba no paramétrica de Wilcoxon no halla diferencia significativa entre los tratami...
Physiological responses of Theobroma cacao L. to water soil available in nursery stage
Directory of Open Access Journals (Sweden)
Jairo Garcia Lozano
2016-01-01
Full Text Available In the locality of El Espinal, Tolima, the effect of water stress on leaf water potential and gas exchange of plants three clones of cacao (Theobroma cacao L was evaluated. The experiment was established in a split plot design in randomized block arrangement. The main plot was four levels of available soil water, subplot grafted seedlings to three months of three clones with five repetitions. The results showed highly significant differences (P <0.01 in content of soil water, but no differences between the materials evaluated. The loss of water in the soil decreases leaf water potential (Ψf and causes stomatal closure altering gas exchange and vapor pressure deficit (DPV accentuates mainly at noon with increasing evapotranspiration. The magnitude of impact of water deficit depends on climatic variations throughout the day. The climatic variables that affect plant development, are temperature and relative humidity in the form of DPV. Net photosynthesis and growth of cocoa seedlings are physiological variables very sensitive to excess and especially to water deficit.
Biosynthesis, accumulation and degradation of theobromine in developing Theobroma cacao fruits.
Zheng, Xin-Qiang; Koyama, Yoko; Nagai, Chifumi; Ashihara, Hiroshi
2004-04-01
We have studied the purine alkaloid content and purine metabolism in Theobroma cacao fruits at differing growth stages: Stage A (young small fruit, fresh weight, ca. 2 g); stage B (medium size fruit, fresh weight, ca. 100 g) and stage C (large size, fresh weight, ca. 500 g). The major purine alkaloid in stage A fruits (mainly pericarp) was theobromine (0.7 micromol g(-1) fresh weight), followed by caffeine (0.09 micromol g(-1) fresh weight). The theobromine content of the pericarp decreased sharply with tissue age, and the caffeine content decreased gradually. A large amount of theobromine (22 micromol g(-1) fresh weight) had accumulated in seeds (mainly cotyledons) of stage C fruits. Theobromine was found also in the seed coat and placenta. Tracer experiments with [8-(14)C]adenine show that the major sites of theobromine synthesis are the young pericarp and cotyledons of T. cacao fruits. Limited amounts of purine alkaloids may be transported from the pericarp to seed tissue, but most purine alkaloids that accumulated in seeds appeared to be synthesised in cotyledons. Degradation of [8-(14)C]theobromine and [8-(14)C]caffeine to CO2 via 3-methylxanthine and ureides (allantoin and allantoic acid) was detected only in the pericarp of stage C fruits.
Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães
2014-11-01
Witches' broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen's transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. © 2014 American Society of Plant Biologists. All rights reserved.
Fatima Cerqueira Alvim
2009-01-01
Resumo: O fungo basidiomiceto hemibiotrófico Moniliophthora perniciosa, agente causal da doença vassoura-de-bruxa (VB) em Theobroma cacao, é o principal patógeno da lavoura cacaueira nas Américas e no Caribe. O presente trabalho apresentou como objetivo primordial identificar proteínas relacionadas com a patogenicidade deste fungo. No primeiro capítulo desta tese foi demonstrado o efeito de diferentes fontes de carbono sobre a morfologia e fisiologia do M, perniciosa. O fungo foi crescido em ...
Characterization of the Proteome of Theobroma cacao Beans by Nano-UHPLC-ESI MS/MS.
Scollo, Emanuele; Neville, David; Oruna-Concha, M Jose; Trotin, Martine; Cramer, Rainer
2018-02-01
Cocoa seed storage proteins play an important role in flavour development as aroma precursors are formed from their degradation during fermentation. Major proteins in the beans of Theobroma cacao are the storage proteins belonging to the vicilin and albumin classes. Although both these classes of proteins have been extensively characterized, there is still limited information on the expression and abundance of other proteins present in cocoa beans. This work is the first attempt to characterize the whole cocoa bean proteome by nano-UHPLC-ESI MS/MS analysis using tryptic digests of cocoa bean protein extracts. The results of this analysis show that >1000 proteins could be identified using a species-specific Theobroma cacao database. The majority of the identified proteins were involved with metabolism and energy. Additionally, a significant number of the identified proteins were linked to protein synthesis and processing. Several proteins were also involved with plant response to stress conditions and defence. Albumin and vicilin storage proteins showed the highest intensity values among all detected proteins, although only seven entries were identified as storage proteins. A comparison of MS/MS data searches carried out against larger non-specific databases confirmed that using a species-specific database can increase the number of identified proteins, and at the same time reduce the number of false positives. The results of this work will be useful in developing tools that can allow the comparison of the proteomic profile of cocoa beans from different genotypes and geographic origins. Data are available via ProteomeXchange with identifier PXD005586. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Martínez-Márquez, Ascensión; Morante-Carriel, Jaime Alfredo; Bru-Martínez, Roque
2017-01-01
Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B) of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the ...
Suwastika, I. Nengah; Pakawaru, Nurul Aisyah; Rifka, Rahmansyah, Muslimin, Ishizaki, Yoko; Cruz, André Freire; Basri, Zainuddin; Shiina, Takashi
2017-02-01
Chloroplast genomes typically range in size from 120 to 170 kilo base pairs (kb), which relatively conserved among plant species. Recent evaluation on several species, certain unique regions showed high variability which can be utilized in the phylogenetic analysis. Many fragments of coding regions, introns, and intergenic spacers, such as atpB-rbcL, ndhF, rbcL, rpl16, trnH-psbA, trnL-F, trnS-G, etc., have been used for phylogenetic reconstructions at various taxonomic levels. Based on that status, we would like to analysis the diversity of chloroplast genome within species of local cacao (Theobroma cacao L.) from Central Sulawesi. Our recent data showed, there were more than 20 clones from local farming in Central Sulawesi, and it can be detected based on phenotypic and nuclear-genome-based characterization (RAPD- Random Amplified Polymorphic DNA and SSR- Simple Sequences Repeat) markers. In developing DNA marker for this local cacao, here we also included analysis based on the variation of chloroplast genome. At least several regions such as rpl32-TurnL, it can be considered as chloroplast markers on our local clone of cocoa. Furthermore, we could develop phylogenetic analysis in between clones of cocoa.
Baharum, Zainal; Akim, Abdah Md; Taufiq-Yap, Yun Hin; Hamid, Roslida Abdul; Kasran, Rosmin
2014-11-10
The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH), thiobarbituric acid-reactive substances (TBARS), and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT) assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50) was 358.3±7.0 µg/mL and total phenolic content was 22.0±1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4%±1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50)=41.4±3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.
Directory of Open Access Journals (Sweden)
Zainal Baharum
2014-11-01
Full Text Available The aims of this study were to determine the antioxidant and antiproliferative activity of the following Theobroma cacao plant part methanolic extracts: leaf, bark, husk, fermented and unfermented shell, pith, root, and cherelle. Antioxidant activity was determined using 2,2-diphenyl-2-picrylhydrazyl (DPPH, thiobarbituric acid-reactive substances (TBARS, and Folin-Ciocalteu assays; the 3-[4,5-dimethylthiazol-2-yl]-2,5-diphenyltetrazolium (MTT assay was used to determine antiproliferative activity. The root extract had the highest antioxidant activity; its median effective dose (EC50 was 358.3 ± 7.0 µg/mL and total phenolic content was 22.0 ± 1.1 g GAE/100 g extract as compared to the other methanolic plant part extracts. Only the cherelle extract demonstrated 10.4% ± 1.1% inhibition activity in the lipid peroxidation assay. The MTT assay revealed that the leaf extract had the highest antiproliferative activity against MCF-7 cells [median inhibitory concentration (IC50 = 41.4 ± 3.3 µg/mL]. Given the overall high IC50 for the normal liver cell line WRL-68, this study indicates that T. cacao methanolic extracts have a cytotoxic effect in cancer cells, but not in normal cells. Planned future investigations will involve the purification, identification, determination of the mechanisms of action, and molecular assay of T. cacao plant extracts.
Cryopreservation of cocoa (Theobroma cacao L.) somatic embryos by vitrification.
Adu-Gyamfi, Raphael; Wetten, Andy
2012-01-01
Losses of cultivated cocoa (Theobroma cacao L.) due to diseases and continued depletion of forests that harbour the wild progenitors of the crop make ex situ conservation of cocoa germplasm of paramount importance. In order to enhance security of in situ germplasm collections, 2-3 mm floral-derived secondary somatic embryos were cryopreserved by vitrification. This work demonstrates the most uncomplicated clonal cocoa cryopreservation. Optimal post-cryostorage survival (74.5 percent) was achieved by 5 d preculture of SSEs on 0.5 M sucrose medium followed by 60 min dehydration in cold PVS2. To minimise free radical related cryo-injury, cation sources were removed from the embryo development solution and/or the recovery medium, the former treatment resulting in a significant benefit. After optimisation with cocoa genotype AMAZ 15, the same protocol was effective across all five additional cocoa genotypes tested. For the multiplication of clones, embryos regenerated following cryopreservation were used as explant sources, and vitrification was found to maintain their embryogenic potential.
Zhang, Yufan; Smith, Philip; Maximova, Siela N; Guiltinan, Mark J
2015-01-01
Previous work has implicated glycerol-3-phosphate (G3P) as a mobile inducer of systemic immunity in plants. We tested the hypothesis that the exogenous application of glycerol as a foliar spray might enhance the disease resistance of Theobroma cacao through the modulation of endogenous G3P levels. We found that exogenous application of glycerol to cacao leaves over a period of 4 days increased the endogenous level of G3P and decreased the level of oleic acid (18:1). Reactive oxygen species (ROS) were produced (a marker of defence activation) and the expression of many pathogenesis-related genes was induced. Notably, the effects of glycerol application on G3P and 18:1 fatty acid content, and gene expression levels, in cacao leaves were dosage dependent. A 100 mm glycerol spray application was sufficient to stimulate the defence response without causing any observable damage, and resulted in a significantly decreased lesion formation by the cacao pathogen Phytophthora capsici; however, a 500 mm glycerol treatment led to chlorosis and cell death. The effects of glycerol treatment on the level of 18:1 and ROS were constrained to the locally treated leaves without affecting distal tissues. The mechanism of the glycerol-mediated defence response in cacao and its potential use as part of a sustainable farming system are discussed. © 2014 BSPP AND JOHN WILEY & SONS LTD.
Directory of Open Access Journals (Sweden)
Carolina Osorio-Solano
2012-04-01
Full Text Available Moniliophthora perniciosa, agente causante de la ‘escoba de bruja’ en cacao (Theobroma cacao, presenta una elevada variabilidad genética y discrepancias en su taxonomía y es una de las enfermedades más importantes en plantaciones cacaoteras que ocasiona pérdidas económicas a nivel mundial cercanas a 70%, y de 40% a nivel nacional. La caracterización de la diversidad genética de los biotipos es importante para la ejecución de proyectos encaminados al manejo de este patógeno y el desarrollo de materiales resistentes de cacao. En este estudio se analizaron 12 aislamientos del hongo obtenidos de diferentes materiales de cacao. Cada una de las muestras se evaluó con marcadores moleculares que tienen como blanco una región del ADN ribosomal (ADNr nuclear conocida como ITS (Internal Transcribed Spacer, una región intergénica (IGS-1 y cinco secuencias simples repetidas (SSR. El marcador IGS-1 permitió la determinación del biotipo C, no obstante se encontró una variabilidad genética evidente dentro de este biotipo, aún no registrada. El análisis de la diversidad genética de M. perniciosa por medio de marcadores microsatélite arrojó un valor total de 0.4260, una heterocigosidad total de 0.6143 y un índice de información polimórfica (PIC de 0.3407, valores considerados de rango medio a alto para los aislamientos estudiados y que estiman la variabilidad genética presente en M. perniciosa.Moniliophthora perniciosa, the founder agent of the ‘witch’s broom’ on cocoa (Theobroma cacao L. is one of the most important diseases in cocoa plantations, causing economic losses close to 70% worldwide and 40% nationwide. It shows a high genetic variability and discrepancies in its taxonomy. Characterization of the genetic diversity of biotypes is important for projects aimed towards the handling of this pathogen and the development of resistant cocoa materials. Twelve isolations of the fungus were analyzed in this study from different
Review of vegetative propagation of cacao ( Theobroma cacao L ...
African Journals Online (AJOL)
Parmi les facteurs physiologiques influençant la propagation de cacao par les boutures de cacao, les différences du clonage, la surface foliaire, l'âge physiologique, les traits anatomiques, les facteurs nutritionnels et biochimiques exercent la plus forte influence. Les clones d'Upper Amazon et de Trinitario prennent les ...
Ogunmefun, O. T.; Fasola, T. R.; Saba, A. B.; Akinyemi, A. J.
2015-01-01
Evidence in both experimental and clinical studies has shown the participation of oxidative stress in the development and progression of diabetes mellitus. This study therefore, sought to investigate the inhibitory effect of methanolic extract of Phragmanthera incana leaves, a mistletoe species harvested from Cocoa (Theobroma cacao) and Kolanut (Cola nitida) on FeSO4 induced lipid peroxidation in rat pancreas, liver, kidney, heart and brain in vitro. The methanolic extract was prepared with 90% methanol (v/v); subsequently, the antioxidant properties and inhibitory effect of the extract on Fe2+ induced lipid peroxidation in some rat tissues were determined in vitro. Incubation of the different rat tissues homogenate in the presence of Fe caused a significant increase in the malondialdehyde (MDA) contents of the tissues. However, the methanolic extracts of Phragmanthera incana leaves harvested from both Cocoa and Kolanut trees caused a significant decrease in the MDA contents of all the tissues tested in a dose-dependent manner. However, the extract of Phragmanthera incana leaves harvested from kolanut trees had a better inhibitory effect on Fe2+- induced lipid peroxidation in the rat tissues homogenates than that of Phragmanthera incana leaves harvested from cocoa trees. This higher inhibitory effect could be attributed to its significantly higher antioxidant properties as typified by their phenolic content, DPPH radical scavenging ability and reducing power. Therefore, oxidative stress associated with diabetes and its other complications could be potentially managed/prevented by harnessing Phragmanthera incana leaves as cheap nutraceuticals. However, Phragmanthera incana leaves harvested from kolanut trees exhibited better antioxidant properties.
Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire
2008-10-30
Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species.Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories.A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database.To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection.A large collection of new genetic markers was provided by this ESTs collection. This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high density gene map of T. cacao
Directory of Open Access Journals (Sweden)
Ruiz Manuel
2008-10-01
Full Text Available Abstract Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow
Argout, Xavier; Fouet, Olivier; Wincker, Patrick; Gramacho, Karina; Legavre, Thierry; Sabau, Xavier; Risterucci, Ange Marie; Da Silva, Corinne; Cascardo, Julio; Allegre, Mathilde; Kuhn, David; Verica, Joseph; Courtois, Brigitte; Loor, Gaston; Babin, Regis; Sounigo, Olivier; Ducamp, Michel; Guiltinan, Mark J; Ruiz, Manuel; Alemanno, Laurence; Machado, Regina; Phillips, Wilberth; Schnell, Ray; Gilmour, Martin; Rosenquist, Eric; Butler, David; Maximova, Siela; Lanaud, Claire
2008-01-01
Background Theobroma cacao L., is a tree originated from the tropical rainforest of South America. It is one of the major cash crops for many tropical countries. T. cacao is mainly produced on smallholdings, providing resources for 14 million farmers. Disease resistance and T. cacao quality improvement are two important challenges for all actors of cocoa and chocolate production. T. cacao is seriously affected by pests and fungal diseases, responsible for more than 40% yield losses and quality improvement, nutritional and organoleptic, is also important for consumers. An international collaboration was formed to develop an EST genomic resource database for cacao. Results Fifty-six cDNA libraries were constructed from different organs, different genotypes and different environmental conditions. A total of 149,650 valid EST sequences were generated corresponding to 48,594 unigenes, 12,692 contigs and 35,902 singletons. A total of 29,849 unigenes shared significant homology with public sequences from other species. Gene Ontology (GO) annotation was applied to distribute the ESTs among the main GO categories. A specific information system (ESTtik) was constructed to process, store and manage this EST collection allowing the user to query a database. To check the representativeness of our EST collection, we looked for the genes known to be involved in two different metabolic pathways extensively studied in other plant species and important for T. cacao qualities: the flavonoid and the terpene pathways. Most of the enzymes described in other crops for these two metabolic pathways were found in our EST collection. A large collection of new genetic markers was provided by this ESTs collection. Conclusion This EST collection displays a good representation of the T. cacao transcriptome, suitable for analysis of biochemical pathways based on oligonucleotide microarrays derived from these ESTs. It will provide numerous genetic markers that will allow the construction of a high
Horticultural traits associated with cacao accessions recommended for Puerto Rico
Cacao (Theobroma cacao L.) is an important agricultural product from which the international chocolate industry is based upon. Increasing demand for chocolate, especially in emerging markets in Asia, coupled with reduced worldwide production has led to shortfalls in cacao ‘bean’ supplies. Deficits...
Review of vegetative propagation of cacao ( Theobroma cacao L ...
African Journals Online (AJOL)
Cet article fait une révision de facteurs environnementaux favorables et les diffecultés techniques qui ont limité l'utilisation extensive de propagation végétative pour la multiplication de cacao. Inclus dans les facteurs extérieurs importante influençcant l'enracinement de boutures de cacao saont: la lumière, la température, ...
Tree spacing impacts the individual incidence of Moniliophthora roreri disease in cacao agroforests.
Ngo Bieng, Marie Ange; Alem, Laudine; Curtet, Chloé; Tixier, Philippe
2017-11-01
Using conventional pesticides in crop protection has raised serious environmental concerns and there is therefore a need for integrated pest management (IPM) methods. In this paper, we found that the spacing of trees can impact disease, which could result in a reduction in pesticide applications and may act as a potential IPM method. We studied Frosty Pod Rot (FPR) in 20 cacao agroforests in Costa Rica (Upala region). Using a generalized linear mixed model, we analyzed the impact of the neighborhood composition and distance from a studied cacao individual on its individual FPR incidence. We found that the number of cacao tree neighbors in a radius of 3.7 m and the number of fruit trees in a radius of 4.3 m had a significant negative influence on the incidence of FPR on individual cacao trees. Moreover, cacao tree neighbors had the most significant local influence compared to the neighborhood of other taller categories such as fruit or forest trees. The mechanisms involved are related to the barrier effect, due to the effectiveness of the cacao tree's architecture as an efficient barrier against FPR spore dispersal. This paper provides new insights into optimization of the spatial environment around each host as an original IPM method. © 2017 Society of Chemical Industry. © 2017 Society of Chemical Industry.
Phytophthora megakarya (Pmeg) and Phytophthora palmivora (Ppal) cause black pod rot of Theobroma cacao. Of these two clade 4 species; Pmeg is more virulent and is displacing Ppal on cacao in many cacao production areas in Africa. To understand the advantages Pmeg has over Ppal, we compared symptom...
Teixeira, Paulo José Pereira Lima; Thomazella, Daniela Paula de Toledo; Reis, Osvaldo; do Prado, Paula Favoretti Vital; do Rio, Maria Carolina Scatolin; Fiorin, Gabriel Lorencini; José, Juliana; Costa, Gustavo Gilson Lacerda; Negri, Victor Augusti; Mondego, Jorge Maurício Costa; Mieczkowski, Piotr; Pereira, Gonçalo Amarante Guimarães
2014-01-01
Witches’ broom disease (WBD), caused by the hemibiotrophic fungus Moniliophthora perniciosa, is one of the most devastating diseases of Theobroma cacao, the chocolate tree. In contrast to other hemibiotrophic interactions, the WBD biotrophic stage lasts for months and is responsible for the most distinctive symptoms of the disease, which comprise drastic morphological changes in the infected shoots. Here, we used the dual RNA-seq approach to simultaneously assess the transcriptomes of cacao and M. perniciosa during their peculiar biotrophic interaction. Infection with M. perniciosa triggers massive metabolic reprogramming in the diseased tissues. Although apparently vigorous, the infected shoots are energetically expensive structures characterized by the induction of ineffective defense responses and by a clear carbon deprivation signature. Remarkably, the infection culminates in the establishment of a senescence process in the host, which signals the end of the WBD biotrophic stage. We analyzed the pathogen’s transcriptome in unprecedented detail and thereby characterized the fungal nutritional and infection strategies during WBD and identified putative virulence effectors. Interestingly, M. perniciosa biotrophic mycelia develop as long-term parasites that orchestrate changes in plant metabolism to increase the availability of soluble nutrients before plant death. Collectively, our results provide unique insight into an intriguing tropical disease and advance our understanding of the development of (hemi)biotrophic plant-pathogen interactions. PMID:25371547
DEFF Research Database (Denmark)
Tetens, Inge
Following a request from the European Commission, the Panel on Dietetic Products, Nutrition and Allergies was asked to provide a scientific opinion on a list of health claims pursuant to Article 13 of Regulation (EC) No 1924/2006. This opinion addresses the scientific substantiation of health...... claims in relation to caffeine and theobromine in cocoa (Theobroma cacao L.) and enhancement of mood. The scientific substantiation is based on the information provided by the Member States in the consolidated list of Article 13 health claims and references that EFSA has received from Member States...... or directly from stakeholders. The food that is the subject of the health claim is cocoa (Theobroma cacao L.). The Panel considers that whereas the food, cocoa (Theobroma cacao L.), is not sufficiently characterised in relation to the claimed effect evaluated in this opinion, the food constituents, caffeine...
Coffee vs. Cacao: A Case Study from the Vietnamese Central Highlands
Ha, Dang Thanh; Shively, Gerald
2005-01-01
Mr. Nam, the vice chair of a village in Dak Lak province of Vietnam, was keen to protect farmers in his village from the sharp decline in prices of coffee ("Coffea canephora" Pierre ex Froehner). He did this by encouraging farmers in his village to plant cacao ("Theobroma cacao" L. subsp. "cacao"). Cacao was suitable…
Directory of Open Access Journals (Sweden)
Jesús Arturo Ramírez Sulvarán
2014-03-01
Full Text Available The cocoa (Theobroma cacao L. based economyhas been considered a valid alternative to support sustainable development in northeastern Colombia. However, there is a lack of information about the cocoa production systems in the region which is needed for the implementation of effective plans to improve their performance and sustainability. Four of the main cocoa producing municipalities in the Norte de Santanderdepartment were considered for this study: Teorama, Bucarasica, Cúcuta and San Calixto. These entities were selected due to their adequate security conditions, availability of field assistants and departmental representativeness in cocoa production. The objective was to obtain basic information for local, specific and participatory actions for the sustainability of the cocoa production systems and to improve the living conditions of farmers. The methodology used was based on the farming system approach, considering the socioeconomic, technological and agro-ecologicalcomponents, and their relationships, and evaluating themaccording to the principles of sustainable agriculture. The phases covered were: (1 analysis of secondary data, (2 formulation and evaluation of sustainability indicators, (3 design, implementation and analysis of survey data and (4 validation by the farmers of the obtained information and the prioritization of problems. The results indicate that there is only one cocoa production system of a family-mercantile type, with low technology. Most farmers havelow incomes and basic needs such as health, education and public services are not met. They do not employ the agronomic and postharvest practices recommended by specialists. The water and soil resources are being degraded. In general, the farming system leans towards unsustainability and it is vital that integrative actions be taken to change this situation. / Se considera que el desarrollo de una economía basada en el cacao (Theobroma cacao L
Directory of Open Access Journals (Sweden)
Omar Miguel Tarqui Freire
2017-07-01
Full Text Available El Programa de Mejoramiento del Cacao y el Café en el INIAP EET-Pichilingue ha estado estudiando, durante varios años, los genotipos de cacao más altos (Theobroma cacao L. caracterizados por la resistencia genética a las principales enfermedades, especialmente la escoba de brujas (Moniliophthora perniciosa Factor limitante para su cultivo en varios países de América Central y del Sur. El objetivo de la investigación fue identificar y seleccionar los clones de cacao con una baja incidencia de la enfermedad de la escoba de brujas. Se probaron 21 genotipos (14 resultantes de Amazonas x Amazonas y (4 de Amazonas x Cruces Nacionales. Entre la población derivada de cruces nacionales vs. nacionales, no se encontraron genotipos mostrando resistencia a la enfermedad. Además, se seleccionó INIAPT 074 del cruce entre CCN 51 x B 60 y TIP 1 y TAP 6 como clones de control. Se evaluaron las siguientes características: Número de mazorcas sanas (MS, Peso fresco (PF, Número de mazorcas enfermas (ME, Número de escobas vegetativas (EBveg, Número de escobas portadoras (EBcojin y Número de chirimoyas. Un análisis de componentes principales y un análisis de conglomerados se realizaron utilizando el método de Ward y se construyó un dendrograma para determinar la similitud entre las características productivas y sanitarias. Se determinó que los genotipos resultantes del cruce amazónico x amazónico: INIAPT 527, INIAPT 560 e INIAPT 526 presentaron menor incidencia de escobas y se identificaron como fuentes de resistencia genética a Moniliophthora perniciosa.
Souza, Vânia L; de Almeida, Alex-Alan F; Souza, Jadiel de S; Mangabeira, Pedro A O; de Jesus, Raildo M; Pirovani, Carlos P; Ahnert, Dário; Baligar, Virupax C; Loguercio, Leandro L
2014-01-01
Seedlings of Theobroma cacao CCN 51 genotype were grown under greenhouse conditions and exposed to increasing concentrations of Cu (0.005, 1, 2, 4, 8, 16, and 32 mg Cu L(-1)) in nutrient solution. When doses were equal or higher than 8 mg Cu L(-1), after 24 h of treatment application, leaf gas exchange was highly affected and changes in chloroplasts thylakoids of leaf mesophyll cells and plasmolysis of cells from the root cortical region were observed. In addition, cell membranes of roots and leaves were damaged. In leaves, 96 h after treatments started, increases in the percentage of electrolyte leakage through membranes were observed with increases of Cu in the nutrient solution. Moreover, there was an increase in the concentration of thiobarbituric acid-reactive substances in roots due to lipid peroxidation of membranes. Chemical analysis showed that increases in Cu concentrations in vegetative organs of T. cacao increased with the increase of the metal in the nutrient solution, but there was a greater accumulation of Cu in roots than in shoots. The excess of Cu interfered in the levels of Mn, Zn, Fe, Mg, K, and Ca in different organs of T. cacao. Analysis of gene expression via RTq-PCR showed increased levels of MT2b, SODCyt, and PER-1 expression in roots and of MT2b, PSBA, PSBO, SODCyt, and SODChI in leaves. Hence, it was concluded that Cu in nutrient solution at doses equal or above 8 mg L(-1) significantly affected leaf gas exchange, cell ultrastructure, and transport of mineral nutrients in seedlings of this T. cacao genotype.
Directory of Open Access Journals (Sweden)
Jorge Antonio Freile Almeida
2018-01-01
Full Text Available El objetivo de la presente investigación fue analizar la relación de los microorganismos del suelo y las principales enfermedades que afectan los clones promisorios de cacao (Theobroma cacao L. en la Amazonía Ecuatoriana. Se evaluaron los clones EET-95, EET-96, EET-103 y CCN-51, respectivamente, éste último utilizado como control, para ello, se determinó la cantidad de bacterias, hongos y actinomicetos totales, expresados en unidades formadoras de colonias (UFC por gramo de suelo, presentes en la rizósfera de los tres clones de cacao, así como la aparición de las principales enfermedades que atacan al cultivo del cacao. Los datos fueron analizados estadísticamente mediante ANOVA de un factor y prueba HSD de Tukey p≤0,05. Las bacterias fueron los microorganismos de mayor asociación a los clones en este estudio, seguido de actinomicetos y hongos. El clon CCN-51 presentó la mayor cantidad de bacterias, los clones EET-96 y EET-103, presentaron mayor incidencia de actinomicetos y el clon EET-103, la mayor presencia de hongos. La enfermedad escoba de bruja, cuyo agente causal es Cripinellis perniciosa Sthael Singer., afectó en menor medida a los clones EET-103 y CCN-51, mientras que la moniliasis causada por el hongo Moniliophthora roreri (Cif & Par Evans et al., puso en evidencia al clon EET-103 con la mayor incidencia de esta enfermedad y conversivamente al clon CCN-51 con la menor incidencia del patógeno.
Packaging of Post Acclimatized Somatic Embryogenesis Cocoa Plantlet (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Soedarsianto Soedarsianto
2009-05-01
Full Text Available Clonal plants that produced by somatic embryogenesis technique is one of the best choice to produce supperior clonal cacao (Theobroma cacao L. planting materials. The somatic embryogenesis technique is a possible way for massive propagation, the outcome is true to type plants, the architecture similarity that the seedlings but there is not segregation like seedlings plants. At present mass production started of plantlets production until post-acclimatized plantlets of somatic embryogenesis cocoa was done at Indonesian Coffee and Cocoa Research Institute. Distribution system of the planting materials to whole areas in form of as up-rooted post-acclimatized plantlet. Some problems identified to reduce probability of decreasing viability of up-rooted post-acclimatized plantlets and one of them is extreme internal water deficit. This research investigate of the influece storage condition (air tight and non-air tight and box storage (mica plastic and cardboardbox. The first experiment result show, there is no significant different between mica plastic and cardboard box usage for storage of post-acclimatized cocoa pantlet. Viability of up-rooted post acclimatized cocoa plantlet influenced exactly by air tight and non-air tight storage condition. Air tight storage condition have better viability of up-rooted post acclimatised (81,58% than non-air tight storage condition (65,00%. Leaf sanasence on air tight storage condition (10,33% lower than non-air tight storage (32,58%. There is not significantly on volume storage per plantlet between 4.416 cm3 and 12.600 cm3. Relationship between fallen leaves and cocoa planlet viability follow negative linear correlation y = -1,4719x + 104,88 (R2 = 0,9772. The second experiment treatment showed that maximal storage periode of post cclimatized cocoa plantlet just until 6 days stored (97% and not significant with 3 days one. Viability of post acclimatized cocoa plantlet decreased after 6 days storage period
Trichoderma theobromicola and T. paucisporum: two new species isolated from cacao in South America.
Samuels, Gary J; Suarez, Carmen; Solis, Karina; Holmes, Keith A; Thomas, Sarah E; Ismaiel, Adnan; Evans, Harry C
2006-04-01
Trichoderma theobromicola and T. paucisporum spp. nov. are described. Trichoderma theobromicola was isolated as an endophyte from the trunk of a healthy cacao tree (Theobroma cacao, Malvaceae) in Amazonian Peru; it sporulates profusely on common mycological media. Trichoderma paucisporum is represented by two cultures that were obtained in Ecuador from cacao pods partially infected with frosty pod rot, Moniliophthora roreri; it sporulates sporadically and most cultures remain sterile on common media and autoclaved rice. It sporulates more reliably on synthetic low-nutrient agar (SNA) but produces few conidia. Trichoderma theobromicola was reintroduced into cacao seedlings through shoot inoculation and was recovered from stems but not from leaves, indicating that it is an endophytic species. Both produced a volatile/diffusable antibiotic that inhibited development of M. roreri in vitro and on-pod trials. Neither species demonstrated significant direct in vitro mycoparasitic activity against M. roreri.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-04-01
Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.
A physiological production model for cacao : results of model simulations
Zuidema, P.A.; Leffelaar, P.A.
2002-01-01
CASE2 is a physiological model for cocoa (Theobroma cacao L.) growth and yield. This report introduces the CAcao Simulation Engine for water-limited production in a non-technical way and presents simulation results obtained with the model.
Abou Rajab, Yasmin; Leuschner, Christoph; Barus, Henry; Tjoa, Aiyen; Hertel, Dietrich
2016-01-01
One of the main drivers of tropical forest loss is their conversion to oil palm, soy or cacao plantations with low biodiversity and greatly reduced carbon storage. Southeast Asian cacao plantations are often established under shade tree cover, but are later converted to non-shaded monocultures to avoid resource competition. We compared three co-occurring cacao cultivation systems (3 replicate stands each) with different shade intensity (non-shaded monoculture, cacao with the legume Gliricidia sepium shade trees, and cacao with several shade tree species) in Sulawesi (Indonesia) with respect to above- and belowground biomass and productivity, and cacao bean yield. Total biomass C stocks (above- and belowground) increased fivefold from the monoculture to the multi-shade tree system (from 11 to 57 Mg ha-1), total net primary production rose twofold (from 9 to 18 Mg C ha-1 yr-1). This increase was associated with a 6fold increase in aboveground biomass, but only a 3.5fold increase in root biomass, indicating a clear shift in C allocation to aboveground tree organs with increasing shade for both cacao and shade trees. Despite a canopy cover increase from 50 to 93%, cacao bean yield remained invariant across the systems (variation: 1.1-1.2 Mg C ha-1 yr-1). The monocultures had a twice as rapid leaf turnover suggesting that shading reduces the exposure of cacao to atmospheric drought, probably resulting in greater leaf longevity. Thus, contrary to general belief, cacao bean yield does not necessarily decrease under shading which seems to reduce physical stress. If planned properly, cacao plantations under a shade tree cover allow combining high yield with benefits for carbon sequestration and storage, production system stability under stress, and higher levels of animal and plant diversity.
Arévalo-Gardini, Enrique; Arévalo-Hernández, Cesar O; Baligar, Virupax C; He, Zhenli L
2017-12-15
Peru is one of the leading exporters of organic cacao beans in the world. However, the accumulation of heavy metals in cacao beans represents a problem for cocoa bean export and chocolate quality. The aim of this study was to investigate the distribution and accumulation of heavy metals in cacao leaves and cocoa beans in three major cacao growing regions of Peru. The study was conducted in cacao plantations of 10 to 15years old in three regions of Peru: North (Regions of Tumbes, Piura, Cajamarca, and Amazonas); Center (Regions of Huánuco and San Martin) and South (Junin and Cuzco). Samples of leaf and cacao beans were collected from 70 cacao plantations, and the nature of cacao clone or genotype sampled was recorded. The concentrations of heavy metals such as Cd, Cr, Cu, Fe, Mn, Ni, Pb and Zn in leaves and beans were determined using atomic absorption spectrophotometer. Overall, concentrations of heavy metals were below the critical limits; however, the presence of high levels of Cd in cacao grown in Amazonas, Piura, and Tumbes regions is of primary concern. Plantations of cacao with different cacao clones show differences in Cd accumulation both in leaves and cocoa beans. Therefore, it is promising to screen low Cd accumulator cacao genotypes for safe production of cacao on lightly to moderately Cd contaminated soils. Also, synergism between Zn and Cd present both in plant and soil suggests that Zn has a direct effect on Cd accumulation in cacao. Copyright © 2017 Elsevier B.V. All rights reserved.
Britto, Dahyana Santos; Pirovani, Carlos Priminho; Andrade, Bruno Silva; Dos Santos, Tassiara Pereira; Pungartnik, Cristina; Cascardo, Júlio Cezar M; Micheli, Fabienne; Gesteira, Abelmon S
2013-09-01
In this work, we identified a gene from Theobroma cacao L. genome and cDNA libraries, named TcGlu2, that encodes a β-1,3-1,4-glucanase. The TcGlu2 ORF was 720 bp in length and encoded a polypeptide of 239 amino acids with a molecular mass of 25.58 kDa. TcGlu2 contains a conserved domain characteristic of β-1,3-1,4-glucanases and presented high protein identity with β-1,3-1,4-glucanases from other plant species. Molecular modeling of TcGlu2 showed an active site of 13 amino acids typical of glucanase with β-1,3 and 1,4 action mode. The recombinant cDNA TcGlu2 obtained by heterologous expression in Escherichia coli and whose sequence was confirmed by mass spectrometry, has a molecular mass of about 22 kDa (with His-Tag) and showed antifungal activity against the fungus Moniliophthora perniciosa, causal agent of the witches' broom disease in cacao. The integrity of the hyphae membranes of M. perniciosa, incubated with protein TcGlu2, was analyzed with propidium iodide. After 1 h of incubation, a strong fluorescence emitted by the hyphae indicating the hydrolysis of the membrane by TcGlu2, was observed. To our knowledge, this is the first study of a cacao β-1,3-1,4-glucanase expression in heterologous system and the first analysis showing the antifungal activity of a β-1,3-1,4-glucanase, in particular against M. perniciosa.
Gattward, James N; Almeida, Alex-Alan F; Souza, José O; Gomes, Fábio P; Kronzucker, Herbert J
2012-11-01
In ecological setting, sodium (Na(+)) can be beneficial or toxic, depending on plant species and the Na(+) level in the soil. While its effects are more frequently studied at high saline levels, Na(+) has also been shown to be of potential benefit to some species at lower levels of supply, especially in C4 species. Here, clonal plants of the major tropical C3 crop Theobroma cacao (cacao) were grown in soil where potassium (K(+)) was partially replaced (at six levels, up to 50% replacement) by Na(+), at two concentrations (2.5 and 4.0 mmol(c) dm(-3)). At both concentrations, net photosynthesis per unit leaf area (A) increased more than twofold with increasing substitution of K(+) by Na(+). Concomitantly, instantaneous (A/E) and intrinsic (A/g(s)) water-use efficiency (WUE) more than doubled. Stomatal conductance (g(s)) and transpiration rate (E) exhibited a decline at 2.5 mmol dm(-3), but remained unchanged at 4 mmol dm(-3). Leaf nitrogen content was not impacted by Na(+) supplementation, whereas sulfur (S), calcium (Ca(2+)), magnesium (Mg(2+)) and zinc (Zn(2+)) contents were maximized at 2.5 mmol dm(-3) and intermediate (30-40%) replacement levels. Leaf K(+) did not decline significantly. In contrast, leaf Na(+) content increased steadily. The resultant elevated Na(+)/K(+) ratios in tissue correlated with increased, not decreased, plant performance. The results show that Na(+) can partially replace K(+) in the nutrition of clonal cacao, with significant beneficial effects on photosynthesis, WUE and mineral nutrition in this major perennial C3 crop. Copyright © Physiologia Plantarum 2012.
Cacao (Theobroma cacao L.) is native to the South American rainforest but it was domesticated in Mesoamerica. The relic Criollo cocoa in Belize has been well known in the premium chocolate market for its high-quality. Knowledge of genetic diversity in this variety is essential for efficient conserva...
Origin, dispersal and current global distribution of cacao genetic diversity
Cacao (Theobroma cacao L.) is cultivated globally as the unique source of cocoa butter and powder for the confectionery industries. In spite of its economical importance, cocoa was and continues to be dominantly produced in low-input and low-output systems. Production constraints, including depletio...
Infection of non-host model plant species with the narrow-host-range Cacao swollen shoot virus.
Friscina, Arianna; Chiappetta, Laura; Jacquemond, Mireille; Tepfer, Mark
2017-02-01
Cacao swollen shoot virus (CSSV) is a major pathogen of cacao (Theobroma cacao) in Africa, and long-standing efforts to limit its spread by the culling of infected trees have had very limited success. CSSV is a particularly difficult virus to study, as it has a very narrow host range, limited to several tropical tree species. Furthermore, the virus is not mechanically transmissible, and its insect vector can only be used with difficulty. Thus, the only efficient means to infect cacao plants that have been experimentally described so far are by particle bombardment or the agroinoculation of cacao plants with an infectious clone. We have genetically transformed three non-host species with an infectious form of the CSSV genome: two experimental hosts widely used in plant virology (Nicotiana tabacum and N. benthamiana) and the model species Arabidopsis thaliana. In transformed plants of all three species, the CSSV genome was able to replicate, and, in tobacco, CSSV particles could be observed by immunosorbent electron microscopy, demonstrating that the complete virus cycle could be completed in a non-host plant. These results will greatly facilitate the preliminary testing of CSSV control strategies using plants that are easy to raise and to transform genetically. © 2016 BSPP AND JOHN WILEY & SONS LTD.
Elevated plant-available cadmium (Cd) in soils results in contamination to cacao (Theobroma cacao L) beans. Effectiveness of vermicompost and zeolite in reducing available Cd in three cacao-growing soils was studied under laboratory conditions. Sorption-desorption experiments were conducted in soils...
Soil physical and chemical properties of cacao farms in the south western region of cameroon
The low macro nutrient content (K, Ca and Mg) in soils under cacao is one of the major causes of the poor cacao (Theobroma cacao L) yields. Efforts were made to assess the major physical and chemical properties of soils from some important cacao zones of the South West Region of Cameroon in order t...
Esatbeyoglu, Tuba; Wray, Victor; Winterhalter, Peter
2015-07-15
The main procyanidins, including dimeric B2 and B5, trimeric C1, tetrameric and pentameric procyanidins, were isolated from unroasted cocoa beans (Theobroma cacao L.) using various techniques of countercurrent chromatography, such as high-speed countercurrent chromatography (HSCCC), low-speed rotary countercurrent chromatography (LSRCCC) and spiral-coil LSRCCC. Furthermore, dimeric procyanidins B1 and B7, which are not present naturally in the analysed cocoa beans, were obtained after semisynthesis of cocoa bean polymers with (+)-catechin as nucleophile and separated by countercurrent chromatography. In this way, the isolation of dimeric procyanidin B1 in considerable amounts (500mg, purity>97%) was possible in a single run. This is the first report concerning the isolation and semisynthesis of dimeric to pentameric procyanidins from T. cacao by countercurrent chromatography. Additionally, the chemical structures of tetrameric (cinnamtannin A2) and pentameric procyanidins (cinnamtannin A3) were elucidated on the basis of (1)H NMR spectroscopy. Interflavanoid linkage was determined by NOE-correlations, for the first time. Copyright © 2015 Elsevier Ltd. All rights reserved.
Inhibition of Acetylcholinesterase and Fatty Acid Composition in Theobroma grandiflorum Seeds
Directory of Open Access Journals (Sweden)
Casandra Valentina Itriago
2017-07-01
Full Text Available Theobroma grandiflorum is an important fruit tree from Sterculiaceae family, native to the Brazilian Amazon, known in the region as cupuaçu. The seeds have a high fat content (24% with characteristics that resemble those of cocoa (Theobroma cacao butter with potential applications in the cosmetic, pharmaceutical and food industries. The main objective of this work was to explore the seed fats from T. grandiflorum that were analyzed for fatty acid composition by Gas Chromatography with Flame Ionization Detector (GC-FID and to analyze their activity for acetylcholinesterase inhibition. Chromatographic analysis provided detection of nine fatty acids. The major fatty acids found in the species were oleic (40.0%, stearic (32.7%, arachidic (10.4% and palmitic (8.0%. The acetylcholinesterase inhibition by fats from seeds was over 40.48%. DOI: http://dx.doi.org/10.17807/orbital.v0i0.894
Cacao swollen shoot virus (CSSV) [Badnavirus, Caulimoviridae] causes swollen shoot disease of Theobroma cacao L. in West Africa. Since ~2000, various diagnostic tests have failed to detect CSSV in ~50-70% of symptomatic cacao plants, suggesting the possible emergence of new, previously uncharacteriz...
Directory of Open Access Journals (Sweden)
Yánez Yánez Wilfrido
2016-11-01
Full Text Available The research was conducted at the Center for Research, Graduate Studies and Amazon Conservation (CIPA of the Amazon State University, Ecuador. The purpose was to assess the effect of enriched compost Germination, day and day’s emergency transplantation two species of tropical origin and breadfruit Theobroma cacao. The experimental field is located in the province of Napo, 16'-1 and S and 77º 36'' 58'y 76'' W, at an altitude of 556 meters, with temperature between 18 and 32oC, average annual precipitation above 3000mm and relative humidity between 87 and 89%. An experimental design with five treatments in a randomized complete block design with three replications was applied. Treatments consisted of compost (1 MS, (2 lactic acid bacteria, (3 commercial yeast, (4 a combination thereof and (5 only compost, witness. It was determined that the compost mixture (T4 as a whole, has the greatest effect on the parameters of the seeds. Germination was found that in two of the T3 and T4 treatments significantly decreased the number of days to germination, in relation to the witness, 33 days and 13 days Artocarpus altilis, Theobroma cacao. The number of emerged plants, increase in both species with the addition of EM, lactic acid bacteria and commercial yeast (T4. a reduction is also reported in the days to transplant species studied to be significant particularly in cocoa. It was also determined that most bioburden corresponded to bacteria.
Directory of Open Access Journals (Sweden)
Van Tang Nguyen
2017-04-01
Full Text Available The aims of this study were to determine the proximate composition of cacao pod husk as well as the optimal conditions for extraction and purification of theobromine from cacao pod husk. The results indicated that cacao pod husk had high contents of moisture and carbohydrate (87.06% and 11.03% by fresh weight, respectively, but low contents of crude protein, crude lipid, and ash (0.31%, 0.12%, and 1.48% by fresh weight, respectively. The optimal conditions for extraction of theobromine from cacao pod husk were of 70% ethanol, with an extraction time of 90 min, and 1 as the number of extractions. A concentration of 10% by volume of 10% lead acetate solution was the best selection for purification of the crude extracts containing theobromine from cacao pod husk. Under these optimal conditions, theobromine content obtained from cacao pod husk was 6.79 mg/100 g dry weight. The finding from this study is a valuable contribution for obtaining theobromine from an abundant, inexpensive, renewable, and sustainable source for potential application in the nutraceutical, medical, and pharmaceutical industries.
Karyotype variation in cultivars and spontaneous cocoa mutants (Theobroma cacao L.).
Figueiredo, G S F; Melo, C A F; Souza, M M; Araújo, I S; Zaidan, H A; Pires, J L; Ahnert, D
2013-10-18
Four mutant cocoa accessions with morphological changes and a cultivar sample were karyomorphologically characterized. Slides were prepared by enzymatic digestion of the root meristem and squashed in 45% acetic acid, followed by 2% Giemsa staining. The chromosome number of 2n = 20 was seen in all accessions. The karyotype formula for Cacau Comum and Cacau Rui was 2n = 20m. Submetacentric chromosomes were observed in Cacau Pucala and Cacau Jaca, both with 2n = 18m + 2sm, but the karyotype formula for Cacau Sem Vidro was 2n = 16m + 4sm. Satellites were located on the long arm of the 1st and 2nd chromosome pairs of Cacau Comum, whereas Cacau Pucala had satellites on the 6th chromosome pair. Greater karyotypic variation in Cacau Sem Vidro was found, whose 1st and 2nd chromosome pairs had satellites on the long arm and 6th and 10th pairs had satellites on the short arm. Analysis revealed a lower average chromosome length in Cacau Comum (1.53 ± 0.026 µm) and a higher length in Cacau Sem Vidro (2.26 ± 0.038 µm). ANOVA revealed significant difference (P Theobroma cacao.
Concentration of Cadmium in Cacao Beans and its Relationship with Soil Cadmium in Southern Ecuador
The concentration of cadmium (Cd) in cacao (Theobroma cacao, L.) beans above a critical level (0.6 mg kg-1 established by the European Union) has raised concerns of safety in the consumption of cacao-based chocolate (dark chocolate). Currently, little is available regarding Cd concentration in soil,...
Bertolde, F Z; Almeida, A-A F; Silva, F A C; Oliveira, T M; Pirovani, C P
2014-07-04
Theobroma cacao is a woody and recalcitrant plant with a very high level of interfering compounds. Standard protocols for protein extraction were proposed for various types of samples, but the presence of interfering compounds in many samples prevented the isolation of proteins suitable for two-dimensional gel electrophoresis (2-DE). An efficient method to extract root proteins for 2-DE was established to overcome these problems. The main features of this protocol are: i) precipitation with trichloroacetic acid/acetone overnight to prepare the acetone dry powder (ADP), ii) several additional steps of sonication in the ADP preparation and extractions with dense sodium dodecyl sulfate and phenol, and iii) adding two stages of phenol extractions. Proteins were extracted from roots using this new protocol (Method B) and a protocol described in the literature for T. cacao leaves and meristems (Method A). Using these methods, we obtained a protein yield of about 0.7 and 2.5 mg per 1.0 g lyophilized root, and a total of 60 and 400 spots could be separated, respectively. Through Method B, it was possible to isolate high-quality protein and a high yield of roots from T. cacao for high-quality 2-DE gels. To demonstrate the quality of the extracted proteins from roots of T. cacao using Method B, several protein spots were cut from the 2-DE gels, analyzed by tandem mass spectrometry, and identified. Method B was further tested on Citrus roots, with a protein yield of about 2.7 mg per 1.0 g lyophilized root and 800 detected spots.
Sulphur depletion altered somatic embryogenesis in Theobroma ...
African Journals Online (AJOL)
Somatic embryogenesis is a useful tool for Theobroma cacao improvement and propagation. Depending on culture medium composition, different morphogenetic structures (including somatic embryo) occur in response to alteration of genes expression patterns and biochemical changes. The effect of SO42- ion deficiency ...
Impact of soils and cropping systems on composition of mineral elements of dry cacao beans
In view of its high economic value, cacao (Theobroma cacao L.) researchers are seeking technological innovations that increase production and improve the quality of cacao beans. The objective of this study was to characterize the mineral (P, K, Ca, Mg, Si, Fe, Mn, Zn, Cu, Cd, Ba) composition of caca...
Araujo Abad, Lourdes Salomé
2016-01-01
The objective of this work was to verify the performance parameters of the analytical method of atomic absorption spectroscopy with graphite furnace for quantification of cadmium in cocoa (Theobroma cacao) almond, for which a protocol was prepared, analyzes were performed on the certified reference material (MRC), the concentration of cadmium in dry cocoa beans four farms (Farm A, B, C and D) located in the cocoa zone of the country, Flavio Alfaro Manabí, was determined an...
Assa, A.; Noor, A.; Yunus, M. R.; Misnawi; Djide, M. N.
2018-03-01
Concentrations of some heavy metals (Pb, Cu, Cd, As and Hg) were assessed for cocoa beans (Theobroma cacao L) originating from East Luwu, South Sulawesi, Indonesia after five-day fermentation. Consisting of PB 123, BR 25, and MCC 02 cocoa clones, the spectrophotometric analysis showed that concentrations of Pb, Cd, As and Hg in the cocoa beans over the three clones was below the detection limits of 0.100; 0.050, 0.010 and 0.005 mg/kg. For Cu, they were 19.343; 10.391, and 18.594 mg/kg respectively, but still below the maximum critical levels, established by the European Food Safety Authority (EFSA). Concentrations of those five heavy metals in the bean shells were found to be parallel to those in the cocoa beans, except for Pb.
Unique haplotypes of cacao trees as revealed by trnH-psbA chloroplast DNA
Directory of Open Access Journals (Sweden)
Nidia Gutiérrez-López
2016-04-01
Full Text Available Cacao trees have been cultivated in Mesoamerica for at least 4,000 years. In this study, we analyzed sequence variation in the chloroplast DNA trnH-psbA intergenic spacer from 28 cacao trees from different farms in the Soconusco region in southern Mexico. Genetic relationships were established by two analysis approaches based on geographic origin (five populations and genetic origin (based on a previous study. We identified six polymorphic sites, including five insertion/deletion (indels types and one transversion. The overall nucleotide diversity was low for both approaches (geographic = 0.0032 and genetic = 0.0038. Conversely, we obtained moderate to high haplotype diversity (0.66 and 0.80 with 10 and 12 haplotypes, respectively. The common haplotype (H1 for both networks included cacao trees from all geographic locations (geographic approach and four genetic groups (genetic approach. This common haplotype (ancient derived a set of intermediate haplotypes and singletons interconnected by one or two mutational steps, which suggested directional selection and event purification from the expansion of narrow populations. Cacao trees from Soconusco region were grouped into one cluster without any evidence of subclustering based on AMOVA (FST = 0 and SAMOVA (FST = 0.04393 results. One population (Mazatán showed a high haplotype frequency; thus, this population could be considered an important reservoir of genetic material. The indels located in the trnH-psbA intergenic spacer of cacao trees could be useful as markers for the development of DNA barcoding.
Better chocolate through genomics
Theobroma cacao, the cacao or chocolate tree, is a tropical understory tree whose seeds are used to make chocolate. And like any important crop, cacao is the subject of much research. On September 15, 2010, scientists publicly released a preliminary sequence of the cacao genome--which contains all o...
Thomas, Sarah E; Crozier, Jayne; Catherine Aime, M; Evans, Harry C; Holmes, Keith A
2008-07-01
Fungal endophytes were isolated from healthy stems and pods of Theobroma gileri, an alternative host of the frosty pod rot pathogen of cacao. Non-sporulating isolates were grouped into 46 different morphological species according to their colony morphology. Many of these morphospecies were assumed to be basidiomycetes and, therefore, were of particular interest. Basidiomycetous endophytes have received far less attention than ascomycetes and also have potential as biological control agents of the basidiomycetous pathogens of T. cacao: Moniliophthora roreri (frosty pod rot pathogen) and M. perniciosa (witches' broom disease). The morphospecies were further characterised by molecular analyses. Amplification of the nuLSU was undertaken for phylogenetic placement of these non-sporulating cultures and revealed a total of 31 different taxa of which 15 were basidiomycetes belonging to the class Agaricomycetes, and 16 ascomycetes primarily belonging to the Sordariomycetes.
International Nuclear Information System (INIS)
Ahenkorah, Y.
1975-01-01
Both 32 P labelled phosphate solution and superphosphate were used in studying 1) in situ root distribution and activity of twenty year old Amelonado cacao (Theobroma Cacao L.) during wet and dry seasons, and 2) the efficiency of fertilizer utilization by the cacao plantation. The 32 P content of the leaves was used to determine patterns of root activity. Uptake of 32 P was greatest during the wet season and root activity highest within the upper 3 cm soil layer in both wet and dry seasons. Highest 32 P activity was obtained at a distance of 120-160 cm, and lowest at 91 cm from the base of the tree. For maximum utilization of phosphate fertilizer by a plantation of twenty year old Amelonado cacao, planted at 240 cm x 240 cm spacing, the fertilizer should be broadcast during the wet season. Under low soil moisture conditions, the placement of 32 P labelled superphosphate provides information on the relative availability of fertilizer or soil phosphorus and does not necessarily reflect the activity of the root profile. Active roots of cacao tend to be more extensive and are capable of exploring a much larger area than hitherto expected
Directory of Open Access Journals (Sweden)
Rita de Cássia Trindade
1999-01-01
Full Text Available The alternative use of cocoa (Theobroma cacao for wine production was tested. The pulp samples, obtained from Formosa farm, Itacaré, Brazil, were diluted, homogenized and inoculated on Sabouraud dextrose agar medium (SDA and incubated at 28º C for 5-8 days. Selected colonies were tested for the ability to ferment cocoa pulp and divided into fermentative, non-fermentative and weak/late fermentative species. Isolates characterized as fermentative were further tested in a small-scale wine production plant and identified. Species from the genus Brettanomyces constituted the main fermentative yeasts, with the exception of two Kloeckera apis samples. The final wine product was normally pale or clear, making clarification unnecessary, and with a sweet or dry pleasant flavor. The predominance of Brettanomyces species in cocoa pulp indicated its ecological importance in this environment and pointed to an active role of Brettanomyces in the deterioration process of the processed cocoa pulp.O uso alternativo de cacau (Theobroma cacao para produção de vinho foi testado. A polpa de cacau foi obtida da Fazenda Formosa, Itacaré, Brasil. As amostras de polpa foram diluídas, homogeneizadas e inoculadas em meio de Sabouraud dextrose e incubadas a 28°C por 5-8 dias. Colônias selecionadas foram testadas quanto à habilidade de fermentar a polpa de cacau e divididas em fermentadoras, não-fermentadoras e fermentadoras lentas. As amostras fermentadoras foram identificadas e testadas para produção de vinho de cacau em escala piloto. A maioria das amostras fermentadoras pertencem ao gênero Brettanomyces, com exceção de duas amostras de Kloeckera apis. O vinho obtido apresentou coloração fraca e clara, tornando a clarificação desnecessária, além de sabor doce e agradável. A predominância de espécies de Brettanomyces na polpa de cacau poderia indicar sua importância ecológica neste ambiente e sugere uma participação ativa dessas leveduras nos
Liu, Yi; Shi, Zi; Maximova, Siela N; Payne, Mark J; Guiltinan, Mark J
2015-06-25
The flavan-3-ols catechin and epicatechin, and their polymerized oligomers, the proanthocyanidins (PAs, also called condensed tannins), accumulate to levels of up to 15 % of the total weight of dry seeds of Theobroma cacao L. These compounds have been associated with several health benefits in humans. They also play important roles in pest and disease defense throughout the plant. In Arabidopsis, the R2R3 type MYB transcription factor TT2 regulates the major genes leading to the synthesis of PA. To explore the transcriptional regulation of the PA synthesis pathway in cacao, we isolated and characterized an R2R3 type MYB transcription factor MYBPA from cacao. We examined the spatial and temporal gene expression patterns of the Tc-MYBPA gene and found it to be developmentally expressed in a manner consistent with its involvement in PAs and anthocyanin synthesis. Functional complementation of an Arabidopsis tt2 mutant with Tc-MYBPA suggested that it can functionally substitute the Arabidopsis TT2 gene. Interestingly, in addition to PA accumulation in seeds of the Tc-MYBPA expressing plants, we also observed an obvious increase of anthocyanidin accumulation in hypocotyls. We observed that overexpression of the Tc-MYBPA gene resulted in increased expression of several key genes encoding the major structural enzymes of the PA and anthocyanidin pathway, including DFR (dihydroflavanol reductase), LDOX (leucoanthocyanidin dioxygenase) and BAN (ANR, anthocyanidin reductase). We conclude that the Tc-MYBPA gene that encodes an R2R3 type MYB transcription factor is an Arabidopsis TT2 like transcription factor, and may be involved in the regulation of both anthocyanin and PA synthesis in cacao. This research may provide molecular tools for breeding of cacao varieties with improved disease resistance and enhanced flavonoid profiles for nutritional and pharmaceutical applications.
Moniliophthora roreri, causal agent of cacao frosty pod rot.
Bailey, Bryan A; Evans, Harry C; Phillips-Mora, Wilbert; Ali, Shahin S; Meinhardt, Lyndel W
2017-12-01
Taxonomy: Moniliophthora roreri (Cif.) H.C. Evans et al. ; Phylum Basidiomycota; Class Agaricomycetes; Order Agaricales; Family Marasmiaceae; Genus Moniliophthora. Biology: Moniliophthora roreri attacks Theobroma and Herrania species causing frosty pod rot. Theobroma cacao (cacao) is the host of major economic concern. Moniliophthora roreri is a hemibiotroph with a long biotrophic phase (45-90 days). Spore masses, of apparent asexual origin, are produced on the pod surface after initiation of the necrotrophic phase. Spores are spread by wind, rain and human activity. Symptoms of the biotrophic phase can include necrotic flecks and, in some cases, pod malformation, but pods otherwise remain asymptomatic. Relationship to Moniliophthora perniciosa: Moniliophthora roreri and Moniliophthora perniciosa, causal agent of witches' broom disease of cacao, are closely related. Their genomes are similar, including many of the genes they carry which are considered to be important in the disease process. Moniliophthora perniciosa, also a hemibiotroph, has a typical basidiomycete lifestyle and morphology, forming clamp connections and producing mushrooms. Basidiospores infect meristematic tissues including flower cushions, stem tips and pods. Moniliophthora roreri does not form clamp connections or mushrooms and infects pods only. Both pathogens are limited to the Western Hemisphere and are a threat to cacao production around the world. Agronomic importance: Disease losses caused by frosty pod rot can reach 90% and result in field abandonment. Moniliophthora roreri remains in the invasive phase in the Western Hemisphere, not having reached Brazil, some islands within the Caribbean and a few specific regions within otherwise invaded countries. The disease can be managed by a combination of cultural (for example, maintenance of tree height and removal of infected pods) and chemical methods. These methods benefit from regional application, but can be cost prohibitive. Breeding for
Cacao diseases: important threats to chocolate production worldwide.
Ploetz, Randy C
2007-12-01
ABSTRACT Theobroma cacao, cacao, is an ancient, neotropical domesticate. It is now grown throughout the humid, lowland tropics and is the basis of a multibillion dollar confectionary trade. Diverse diseases impact production of the crop. They reduce yields by ca. 20%, but could cause far greater losses if certain highly damaging diseases were to become more widely distributed. Among the most potentially dangerous of these diseases are frosty pod, caused by Moniliophthora roreri, and witches' broom, caused by M. perniciosa (previously Crinipellis perniciosa). These two diseases occur only in the Western Hemisphere, and severe losses would follow their introduction to West Africa and Asia, where ca. 86% of all cacao production occurs. Elsewhere, Cacao swollen shoot virus and the damaging black pod agent, Phytophthora megakarya, are found in Western Africa; whereas vascular streak dieback, caused by Oncobasidium theobromae, is present only in Asia. Breeding programs are challenged by minimal resistance to some of the diseases. Progress that has been made is threatened by the "emergence" of other serious diseases, such as Ceratocystis wilt (Ceratocystis cacaofunesta). During this symposium, new insights are discussed on the biology, origins, pathology and phylogeny of the pathogens; as well as the biological, chemical and genetic management of the diseases that they cause.
Confocal observations of late-acting self-incompatibility in Theobroma cacao L.
Ford, Caroline S; Wilkinson, Mike J
2012-09-01
Cocoa (Theobroma cacao) has an idiosyncratic form of late-acting self-incompatibility that operates through the non-fusion of incompatible gametes. Here, we used high-resolution confocal microscopy to define fine level changes to the embryo sac of the strongly self-incompatible cocoa genotype SCA 24 in the absence of pollination, and following compatible and incompatible pollination. All sperm nuclei had fused with the female nuclei by 48 h following compatible pollinations. However, following incompatible pollinations, we observed divergence in the behaviour of sperm nuclei following release into the embryo sac. Incomplete sperm nucleus migration occurred in approximately half of the embryo sacs, where the sperm nuclei had so far failed to reach the female gamete nuclei. Sperm nuclei reached but did not fuse with the female gamete nuclei in the residual cases. We argue that the cellular mechanisms governing sperm nucleus migration to the egg nucleus and those controlling subsequent nuclear fusion are likely to differ and should be considered independently. Accordingly, we recommend that future efforts to characterise the genetic basis of LSI in cocoa should take care to differentiate between these two events, both of which contribute to failed karyogamy. Implications of these results for continuing efforts to gain better understanding of the genetic control of LSI in cocoa are discussed.
Gabbay Alves, Taís Vanessa; Silva da Costa, Russany; Aliakbarian, Bahar; Casazza, Alessandro Alberto; Perego, Patrizia; Carréra Silva Júnior, José Otávio; Ribeiro Costa, Roseane Maria; Converti, Attilio
2017-03-01
The cocoa extract (Theobroma cacao L.) has a significant amount of polyphenols (TP) with potent antioxidant activity (AA). This study aims to optimise microencapsulation of the extract of cocoa waste using chitosan and maltodextrin. Microencapsulation tests were performed according to a Box-Behnken factorial design, and the results were evaluated by response surface methodology with temperature, maltodextrin concentration (MD) and extract flowrate (EF) as independent variables, and the fraction of encapsulated TP, TP encapsulation yield, AA, yield of drying and solubility index as responses. The optimum conditions were: inlet temperature of 170 °C, MD of 5% and EF of 2.5 mL/min. HPLC analysis identified epicatechin as the major component of both the extract and microparticles. TP release was faster at pH 3.5 than in water. These results as a whole suggest that microencapsulation was successful and the final product can be used as a nutrient source for aquatic animal feed. Highlights Microencapsulation is optimised according to a factorial design of the Box-Behnken type. Epicatechin is the major component of both the extract and microcapsules. The release of polyphenols from microcapsules is faster at pH 3.5 than in water.
Nitrogen forms and levels influence on growth and nutrition of cacao
Ammonium and nitrate are the major forms of N present in tropical soils. A climatically controlled growth chamber experiment was conducted to assess the influence of forms (NO3-, NH4+, and mix of NO3- + NH4+) and levels (1.5 to 12.0 mM) of N on the growth and nutrition of cacao (Theobroma cacao L). ...
Cacao (Theobroma cacao L.) is an important tropical crop since it is the source of cocoa butter and powder for the confectionery industry. Production and marketing of premium high-value fine flavored cacao provide opportunities for cacao growers, the chocolate industry and consumers. The higher far...
Cacao (Theobroma cacao L.) is the source of cocoa powder and butter used for chocolate and this species originated in the rainforests of South America. Indonesia is the 3rd largest cacao producer in the world with an annual cacao output of 0.55 million tons. Knowledge of on-farm genetic diversity is...
Cacao (Theobroma cacao L.) is an important economic crop for many of the tropical countries. Adequate levels of soil K are essential for good growth and achieving high cocoa bean yields. Soils under cacao invariably have low levels of plant available K to support good cacao growth. Growth chamber ex...
Allegre, Mathilde; Argout, Xavier; Boccara, Michel; Fouet, Olivier; Roguet, Yolande; Bérard, Aurélie; Thévenin, Jean Marc; Chauveau, Aurélie; Rivallan, Ronan; Clement, Didier; Courtois, Brigitte; Gramacho, Karina; Boland-Augé, Anne; Tahi, Mathias; Umaharan, Pathmanathan; Brunel, Dominique; Lanaud, Claire
2012-01-01
Theobroma cacao is an economically important tree of several tropical countries. Its genetic improvement is essential to provide protection against major diseases and improve chocolate quality. We discovered and mapped new expressed sequence tag-single nucleotide polymorphism (EST-SNP) and simple sequence repeat (SSR) markers and constructed a high-density genetic map. By screening 149 650 ESTs, 5246 SNPs were detected in silico, of which 1536 corresponded to genes with a putative function, while 851 had a clear polymorphic pattern across a collection of genetic resources. In addition, 409 new SSR markers were detected on the Criollo genome. Lastly, 681 new EST-SNPs and 163 new SSRs were added to the pre-existing 418 co-dominant markers to construct a large consensus genetic map. This high-density map and the set of new genetic markers identified in this study are a milestone in cocoa genomics and for marker-assisted breeding. The data are available at http://tropgenedb.cirad.fr. PMID:22210604
Gidoin, Cynthia; Avelino, Jacques; Deheuvels, Olivier; Cilas, Christian; Bieng, Marie Ange Ngo
2014-03-01
Vegetation composition and plant spatial structure affect disease intensity through resource and microclimatic variation effects. The aim of this study was to evaluate the independent effect and relative importance of host composition and plant spatial structure variables in explaining disease intensity at the plot scale. For that purpose, frosty pod rot intensity, a disease caused by Moniliophthora roreri on cacao pods, was monitored in 36 cacao agroforests in Costa Rica in order to assess the vegetation composition and spatial structure variables conducive to the disease. Hierarchical partitioning was used to identify the most causal factors. Firstly, pod production, cacao tree density and shade tree spatial structure had significant independent effects on disease intensity. In our case study, the amount of susceptible tissue was the most relevant host composition variable for explaining disease intensity by resource dilution. Indeed, cacao tree density probably affected disease intensity more by the creation of self-shading rather than by host dilution. Lastly, only regularly distributed forest trees, and not aggregated or randomly distributed forest trees, reduced disease intensity in comparison to plots with a low forest tree density. A regular spatial structure is probably crucial to the creation of moderate and uniform shade as recommended for frosty pod rot management. As pod production is an important service expected from these agroforests, shade tree spatial structure may be a lever for integrated management of frosty pod rot in cacao agroforests.
Argout, X; Martin, G; Droc, G; Fouet, O; Labadie, K; Rivals, E; Aury, J M; Lanaud, C
2017-09-15
Theobroma cacao L., native to the Amazonian basin of South America, is an economically important fruit tree crop for tropical countries as a source of chocolate. The first draft genome of the species, from a Criollo cultivar, was published in 2011. Although a useful resource, some improvements are possible, including identifying misassemblies, reducing the number of scaffolds and gaps, and anchoring un-anchored sequences to the 10 chromosomes. We used a NGS-based approach to significantly improve the assembly of the Belizian Criollo B97-61/B2 genome. We combined four Illumina large insert size mate paired libraries with 52x of Pacific Biosciences long reads to correct misassembled regions and reduced the number of scaffolds. We then used genotyping by sequencing (GBS) methods to increase the proportion of the assembly anchored to chromosomes. The scaffold number decreased from 4,792 in assembly V1 to 554 in V2 while the scaffold N50 size has increased from 0.47 Mb in V1 to 6.5 Mb in V2. A total of 96.7% of the assembly was anchored to the 10 chromosomes compared to 66.8% in the previous version. Unknown sites (Ns) were reduced from 10.8% to 5.7%. In addition, we updated the functional annotations and performed a new RefSeq structural annotation based on RNAseq evidence. Theobroma cacao Criollo genome version 2 will be a valuable resource for the investigation of complex traits at the genomic level and for future comparative genomics and genetics studies in cacao tree. New functional tools and annotations are available on the Cocoa Genome Hub ( http://cocoa-genome-hub.southgreen.fr ).
Reacción a Moniliophthora roreri en Theobroma spp. en Caquetá, Colombia
Directory of Open Access Journals (Sweden)
Armando Sterling Cuéllar
2015-09-01
Full Text Available El objetivo de este estudio fue evaluar in situ la reacción de 50 materiales genéticos de tres especies de Theobroma(T. cacao, T. grandiflorum y T. bicolor a la inoculación controlada de tres aislados autóctonos de Moniliophthora roreri (agente causal de la moniliasis del cacao en el Departamento de Caquetá (Amazonia colombiana. Las variables incidencia de la enfermedad (IMr, severidad externa (SE y severidad interna (SI, se evaluaron nueve semanas después de la inoculación de mazorcas de 2 a 3 meses de edad con una suspensión de esporas de 1,2 x 105 esporas/mL. La enfermedad se evidenció en las tres especies de Theobroma, sin embargo, ésta no se presentó en 13 de los 50 materiales genéticos evaluados, representados así: seis T. grandiflorum, cinco T. bicolor y dos T. cacao. Los materiales genéticos de T. bicolor y T. grandiflorum fueron los menos afectados comparados con los de T. cacao. Se encontraron diferencias significativas para IMr, SE y SI entre las tres especies de Theobroma y entre los 50 materiales genéticos. Diferencias significativas entre los aislados solo ocurrieron para SE. La incidencia y la severidad de la enfermedad entre materiales genéticos, fueron influenciadas por el patógeno aislado. Los materiales genéticos con menor reacción a M. roreri pueden ser utilizados en programas de mejoramiento por resistencia a la moniliasis.
Zhang, Yufan; Clemens, Adam; Maximova, Siela N; Guiltinan, Mark J
2014-04-24
The Arabidopsis thaliana LEC2 gene encodes a B3 domain transcription factor, which plays critical roles during both zygotic and somatic embryogenesis. LEC2 exerts significant impacts on determining embryogenic potential and various metabolic processes through a complicated genetic regulatory network. An ortholog of the Arabidopsis Leafy Cotyledon 2 gene (AtLEC2) was characterized in Theobroma cacao (TcLEC2). TcLEC2 encodes a B3 domain transcription factor preferentially expressed during early and late zygotic embryo development. The expression of TcLEC2 was higher in dedifferentiated cells competent for somatic embryogenesis (embryogenic calli), compared to non-embryogenic calli. Transient overexpression of TcLEC2 in immature zygotic embryos resulted in changes in gene expression profiles and fatty acid composition. Ectopic expression of TcLEC2 in cacao leaves changed the expression levels of several seed related genes. The overexpression of TcLEC2 in cacao explants greatly increased the frequency of regeneration of stably transformed somatic embryos. TcLEC2 overexpressing cotyledon explants exhibited a very high level of embryogenic competency and when cultured on hormone free medium, exhibited an iterative embryogenic chain-reaction. Our study revealed essential roles of TcLEC2 during both zygotic and somatic embryo development. Collectively, our evidence supports the conclusion that TcLEC2 is a functional ortholog of AtLEC2 and that it is involved in similar genetic regulatory networks during cacao somatic embryogenesis. To our knowledge, this is the first detailed report of the functional analysis of a LEC2 ortholog in a species other then Arabidopsis. TcLEC2 could potentially be used as a biomarker for the improvement of the SE process and screen for elite varieties in cacao germplasm.
Rosmana, Ade; Nasaruddin, Nasaruddin; Hendarto, Hendarto; Hakkar, Andi Akbar; Agriansyah, Nursalim
2016-09-01
Trichoderma species are able to persist on living sapwood and leaves of cacao ( Theobroma cacao ) in an endophytic relationship. In this research, we evaluated the ability of Trichodema asperellum introduced at the incision site in the bark for side grafting with the concentration of 4 g/10 mL, 4 g/100 mL, and 4 g/1,000 mL (suspended in water) in suppressing vascular streak dieback (VSD) incidence and promoting growth of side grafts in the field. The incidence of VSD in two local clones of cacao, MCC1 and M04, without application of T. asperellum was 71.2% and 70.1% at 21 wk after grafting, respectively. However, when the two clones were treated with a concentration of 4 g/10 mL T. asperellum , the incidence was 20.6% and 21.7%, respectively, compared to 29.1% and 20.9% at 4 g/100 mL and 18.2% and 15.6% at 4 g/1,000 mL. By comparing to the control, the treatment with the same concentrations of T. asperellum listed above, the total number of stomata in MCC1 decreased by 41.9%, 30.2%, and 14.0% and in M04 by 30.5%, 21.9%, and -2.5% (exception), respectively. Otherwise, the total area of stomata opening increased by 91.4%, 99.7%, and 28.6% in MCC1 and by 203.8%, 253.5%, and 35.9% in M04, respectively. Furthermore, the number of buds and branches treated with a mixture concentration on the the two clones increased by 90.7% and 21.7%, respectively. These data showed that the application of T. asperellum to cacao scions while grafting can decrease VSD incidence in side grafts and increase growth of grafts in addition to decreasing total number of stomata, increasing total area of opened stomata, and increasing number of buds and branches.
Frosty pod of cacao: a disease with a limited geographic range but unlimited potential for damage.
Phillips-Mora, W; Wilkinson, M J
2007-12-01
ABSTRACT Moniliophthora roreri, the cause of frosty pod rot (FP), is a specialized fungal pathogen (family Marasmiaceae) that invades only actively growing pods of cacao, Theobroma cacao, and related species of Theobroma and Herrania. FP damages pods and the commercially important seeds that some of these species produce. M. roreri was confined to northwestern South America until the 1950s. Its appearance in Panama in 1956 signaled a change in its geographic distribution. Now, it is found in 11 countries in tropical America. The fungus is currently in an active dispersal phase, possibly due to an increase in human-mediated spread. FP is more destructive than black pod (Phytophthora spp.) and more dangerous and difficult to control than witches' broom, caused by Moniliophthora (Crinipellis) perniciosa. The aggressiveness of M. roreri, its capacity to survive different environmental conditions, its rapid natural dispersal, its propensity for man-mediated dispersal, and the susceptibility of most commercial cacao genotypes, all indicate that FP presents a substantial threat to cacao cultivation worldwide.
Directory of Open Access Journals (Sweden)
Rosma Hasibuan
2014-08-01
Full Text Available Impact of Permethrin-Insecticide Application on Mirid Pest of Cocoa Helopeltis spp. (Hemiptera: Miridae and on Non-target Arthropods in Cocoa Plantations (Theobroma cacao L.. Cocoa mirid bugs, Helopeltis spp., (Hemiptera: Miridae are the most important pest of cocoa in Indonesia. A field study was conducted to investigate the effect of permethrin on cocoa mirids and non-target arthropods at a cocoa plantation in specific place. A randomized complete block design was used in which each of four blocks consisted of 5 treatments (4 concentrations of permethrin; 50; 100; 200; and 250 ppm and control. The results indicated that the application of permethrin significantly increased the cocoa mirids mortaliiy throughout all sprayed cocoa trees (up to 100% 72 h after application. Even at 1 h after application, the percentage of Cocoa mirids mortality 29.2% - 53.9% on cocoa trees sprayed with permethrin at concentrations of 50 - 250 ppm was significantly higher than that on control plant (3.6%. At 72 h after treatments, application of permethrin at concentrations of 200 and 250 ppm caused a complete kill (mortalty of 100% in the test mirids. Meanwhile, ground cloths caught at least 22 fanilies of abore-ground arthropods that were found killed by permethrin applications. Moreover, the number of non-target arthropods killed by permethrin at concentrations of 100 - 250 ppm (27.3 - 85.3 individuals/ground cloth were signifcantly higher than that on control trees. These results demonstrated that despite high efficacy of permethrin in controlling of cocoa mirids (Hetopeltis spp., its application also had adverse effects on non-target arthropods incocoa plantations.
Directory of Open Access Journals (Sweden)
Mercedes Susana Carranza Patiño
2008-06-01
Full Text Available El presente estudio consistió en determinar la diversidad genética basada en los marcadores RAPD´s (Random Amplification of Polymorphic DNA de 20 accesiones de cacao (Theobroma cacao L.de la variedad Nacional, con características de productividad, y niveles de resistencia, susceptibilidad y tolerancia a las rincipales enfermedades causadas por hongos como Ceratocistys fimbriata, Moniliophtora roreri y Crinipelis perniciosa. Este germoplasma de cacao se encuentra localizado en el Centro de Cacao de Aroma Tenguel, en la Finca Experimental “La Buseta” propiedad de la Universidad Técnica Estatal de Quevedo. La extracción de ADN se la realizó utilizando el protocolo de Doyle & Doyle (1990 con algunas modificaciones. 14 oligonucleótidos fueron utilizados para la obtención de marcadores RAPD´s, de los cuales 9 amplificaron productos reproducibles OPA-15, OPC-07, OPC-9, OPC-4, OPC-3, OPC-1, OPA-12 OPC-13 y OPA-7. Los productos de amplificación fueron migrados en geles de agarosa al 1.2% a 90 voltios por una hora. Los marcadores moleculares fueron analizados por medio de una matriz de datos binarios para calcular las distancias genéticas. Los nueve cebadores utilizados generaron 67 bandas de las cuales 59 (88% fueron polimórficas. El dendrograma mostró dos grupos A y B, en el grupo A se incluyo dos accesiones, y en el grupo B se encuentran los 18 restantes el cual incluye 2 subgrupos B1 y B2 en el subgrupo B1 se incluye la accesión (L-22-H-40, y en el subgrupo B2 están incluidas las accesiones que poseen características de productividad. El nivel de diversidad más alto se obtuvo con los oligonucleótidos OPC 04 (0.80, OPC 07 (0.82. El cebador OPC 01 (0.37 reportó el nivel más bajo. Las accesiones (L-22-H-40 (O.75, (L-34-H-07 (0.86 y el (L-42-H-60 (0.72 presentaron los niveles de variabilidad más altos, siendo los valores más bajos los mostrados por las accesiones (L-26-H-64 (O.48 y (L-23-H63 (O.47. El valor de la diversidad
Cacao (Theobroma cacao) has great potential as a component of a small tropical farming system. It adapts to a wide range of soils of climatic conditions, grows well under minimum tillage, adapts to temporary intercropping, has the potential of being sold in local and export markets and the pods are ...
Genetic diversity of naturalized cacao (Theobroma cacao L.) in Puerto Rico
Identification of genetically diverse cacao with disease resistance, high productivity and desirable organoleptic traits is vitally important to the agricultural crop’s long-term sustainability. Environmental changes, pests and diseases as well as nation’s sovereign property rights have led to a de...
Pengaruh Kadar Air dan Persamaan Model Bet untuk Prediksi Masa Simpan Kakao (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Rita Hayati
2017-04-01
Full Text Available Effect of moisture content and BET equation to the shelf life of cocoa (Theobroma cacao L. has been conducted. Increasing the quality of cocoa beans is with proper post-harvest handling, including how the harvest, the level of ripeness, curing, fermenting, drying up storage. The purpose of this study was to determine the water content and the appropriate levels of critical in determining the shelf life of cocoa. The benefits of this research are as information for farmers in determining the shelf life of cocoa in order to design a storage area corresponding to the respiratory system owned by cocoa. The results showed that the effect of fermentation facilitator (Staphilococcus cerevisiae and drying temperature on water content showed that the fermentation facilitator (Staphilococcus cerevisiae highly significant effect on water content. The drying temperature is also highly significant effect on water content. BET equation obtained was Y = 2,912x + 1.238 (R2 = 0.965, Y = 2,897x + 1.353 (R2 = 0.968 and Y = 2,806x + 1.89 (R2 = 0.954.
Andrušíková, Petra
2016-01-01
Bachelor thesis contains characteristic of species Theobroma cacao. In this work is described origin and history, processing and world market with cocoa beans. In work is compared cultivation at plantation in agroforestry and monoculture systems. There is compared the benefits and disadvantages of usage of this systems. In the work is mentioned some informations about world organization, which are interested in agroforestry and also agroforestry certification.
Carbon and water fluxes above a cacao plantation in Sulawesi, Indonesia
Falk, U.; Ibrom, A.
2003-04-01
The investigation of interactions between biosphere and atmosphere of the major land use types of the tropical rain forest margin area in South East Asia and quantification of the impact that land use change from undisturbed primary rain forest to pasture has on these interactions is task of subprogramme B1 within the DFG-funded project STORMA (Stability of Rain Forest Margins). In order to fulfill the projects tasks the different major land use types have to be investigated and each ecosystem characterized one by one and compared to a reference site in an undisturbed primary rain forest, to see the changes in the atmosphere-biospheric interactions, i. e. in water and carbon household, with land use change and thus the impact on regional climate. One of the major land use types in the valleys around the Lore Lindu National Park on Sulawesi are Cacao plantations, Theobroma cacao. A site in the Palolo valley near the village Nopu was chosen as research site since the area there is covered with small Cacao fields which form to one big area of Cacao and matches the requirements of the applied research approach. Since Cacao trees need to be shaded especially when younger, shadow trees had been planted and trees of the former forest had been left standing to serve as wind breaks and sun shades. The plantations in Nopu, Palolo valley, consist not only of fields of cultivated Cacao, but also serve as environment and home to the farmers and their families. The whole area of Cacao plantation is interspersed with wooden farm houses, which are also sources of carbon dioxide due to cooking or small power plants etc. and thus have to be taken into account when looking at the carbon household of this specific ecosystem. An estimation of the components of the carbon and water household and the contribution of the humans living within this environment to the carbon household of Cacao plantations of this ecosystem is subject of this presentation. From December 2001 until April 2002
Cacao usage by the earliest Maya civilization.
Hurst, W Jeffrey; Tarka, Stanley M; Powis, Terry G; Valdez, Fred; Hester, Thomas R
2002-07-18
The Maya archaeological site at Colha in northern Belize, Central America, has yielded several spouted ceramic vessels that contain residues from the preparation of food and beverages. Here we analyse dry residue samples by using high-performance liquid chromatography coupled to atmospheric-pressure chemical-ionization mass spectrometry, and show that chocolate (Theobroma cacao) was consumed by the Preclassic Maya as early as 600 bc, pushing back the earliest chemical evidence of cacao use by some 1,000 years. Our application of this new and highly sensitive analytical technique could be extended to the identification of other ancient foods and beverages.
Bertolde, Fabiana Z; Almeida, Alex-Alan F; Pirovani, Carlos P
2014-01-01
Soil flooding causes changes in gene transcription, synthesis and degradation of proteins and cell metabolism. The main objective of this study was to understand the biological events of Theobroma cacao during soil flooding-induced stress, using the analyses of gene expression and activity of key enzymes involved in fermentation, as well as the identification of differentially expressed proteins by mass spectrometry in two contrasting genotypes for flooding tolerance (tolerant - TSA-792 and susceptible - TSH-774). Soil anoxia caused by flooding has led to changes in the expression pattern of genes associated with the biosynthesis of alcohol dehydrogenase (ADH), pyruvate decarboxylase (PDC) and lactate dehydrogenase (LDH) in leaves and roots of the two evaluated genotypes. Significant differences were observed between the enzyme activities of the two genotypes. Leaves and roots of the TSA-792 genotype showed higher ADH activity as compared to the TSH-774 genotype, whereas the activities of PDC and LDH have varied over the 96 h of soil flooding, being higher for TSA-792 genotype, at the initial stage, and TSH-774 genotype, at the final stage. Some of the identified proteins are those typical of the anaerobic metabolism-involved in glycolysis and alcoholic fermentation-and different proteins associated with photosynthesis, protein metabolism and oxidative stress. The ability to maintain glycolysis and induce fermentation was observed to play an important role in anoxia tolerance in cacao and may also serve to distinguish tolerant and susceptible genotypes in relation to this stressor.
Directory of Open Access Journals (Sweden)
J. Alberto Romero Navarro
2017-11-01
Full Text Available Chocolate is a highly valued and palatable confectionery product. Chocolate is primarily made from the processed seeds of the tree species Theobroma cacao. Cacao cultivation is highly relevant for small-holder farmers throughout the tropics, yet its productivity remains limited by low yields and widespread pathogens. A panel of 148 improved cacao clones was assembled based on productivity and disease resistance, and phenotypic single-tree replicated clonal evaluation was performed for 8 years. Using high-density markers, the diversity of clones was expressed relative to 10 known ancestral cacao populations, and significant effects of ancestry were observed in productivity and disease resistance. Genome-wide association (GWA was performed, and six markers were significantly associated with frosty pod disease resistance. In addition, genomic selection was performed, and consistent with the observed extensive linkage disequilibrium, high predictive ability was observed at low marker densities for all traits. Finally, quantitative trait locus mapping and differential expression analysis of two cultivars with contrasting disease phenotypes were performed to identify genes underlying frosty pod disease resistance, identifying a significant quantitative trait locus and 35 differentially expressed genes using two independent differential expression analyses. These results indicate that in breeding populations of heterozygous and recently admixed individuals, mapping approaches can be used for low complexity traits like pod color cacao, or in other species single gene disease resistance, however genomic selection for quantitative traits remains highly effective relative to mapping. Our results can help guide the breeding process for sustainable improved cacao productivity.
Carrada Figueroa, Georgina Del Carmen; Leal Ascencio, Víctor Javier; Jiménez Sastré, Alejandro; López Álvarez, Jorge
2014-01-01
Tabasco is the Mexican state that reported the highest number (37.4%) of patients with leishmaniasis during 1990-2011. Close to 90% of these patients lived in Chontalpa, where the municipality of Cunduacán accounted for the majority of the cases. One of the characteristics of this region is that houses are located within cacao plantations. To determine if cacao plantations are a risk factor for leishmaniasis transmission in locations of Cunduacán, Tabasco. We performed an analytical and retrospective study of 115 locations in Cunduacán, analyzing the number of localities with or without patients with leishmaniasis registered between 2000-2011 and, additionally, if they had cacao plantations, using a map where different crops were georeferenced. We measured the magnitude of the association (odds ratio, 95% CI). During the period 2000-2011, cases of leishmaniasis were reported in 77 (67.0%) Cunduacán locations, of these, 55 (71.4%) had cocoa plantations, five (6.5%) of banana, five (6.5%) of cane, and 12 (15.6%) had no crops georeferenced. We found that cocoa crops are a risk factor for the transmission of leishmaniasis (OR: 3.438; 95% CI: 1,526-7,742). The probability of transmission of leishmaniasis in areas with cocoa crops is greater than in communities without this crop.
da Silva, Rangeline Azevedo; Souza, Gustavo; Lemos, Lívia Santos Lima; Lopes, Uilson Vanderlei; Patrocínio, Nara Geórgia Ribeiro Braz; Alves, Rafael Moysés; Marcellino, Lucília Helena; Clement, Didier; Micheli, Fabienne
2017-01-01
The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR) of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI− bands). The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC) ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted. PMID:28187131
Directory of Open Access Journals (Sweden)
Rangeline Azevedo da Silva
Full Text Available The genus Theobroma comprises several trees species native to the Amazon. Theobroma cacao L. plays a key economic role mainly in the chocolate industry. Both cultivated and wild forms are described within the genus. Variations in genome size and chromosome number have been used for prediction purposes including the frequency of interspecific hybridization or inference about evolutionary relationships. In this study, the nuclear DNA content, karyotype and genetic diversity using functional microsatellites (EST-SSR of seven Theobroma species were characterized. The nuclear content of DNA for all analyzed Theobroma species was 1C = ~ 0.46 pg. These species presented 2n = 20 with small chromosomes and only one pair of terminal heterochromatic bands positively stained (CMA+/DAPI- bands. The small size of Theobroma ssp. genomes was equivalent to other Byttnerioideae species, suggesting that the basal lineage of Malvaceae have smaller genomes and that there was an expansion of 2C values in the more specialized family clades. A set of 20 EST-SSR primers were characterized for related species of Theobroma, in which 12 loci were polymorphic. The polymorphism information content (PIC ranged from 0.23 to 0.65, indicating a high level of information per locus. Combined results of flow cytometry, cytogenetic data and EST-SSRs markers will contribute to better describe the species and infer about the evolutionary relationships among Theobroma species. In addition, the importance of a core collection for conservation purposes is highlighted.
Estado legal mundial del cadmio en cacao (Theobroma cacao): fantasía o realidad
Jiménez Tobón, Claudia Stella
2015-01-01
Colombian cacao is well positioned in the international markets, given its taste and aroma. There is, however, a concern under contamination terms at a national level, because there is cadmium in the seeds. This metal, in case of being accumulated in the human body, is the cause of several and serious diseases that slowly deteriorate it. Even though the fact that in 2019 the European Community will start to demand a maximum level of the cadmium allowed in the cacao and its derivat...
Motamayor, Juan C; Mockaitis, Keithanne; Schmutz, Jeremy; Haiminen, Niina; Livingstone, Donald; Cornejo, Omar; Findley, Seth D; Zheng, Ping; Utro, Filippo; Royaert, Stefan; Saski, Christopher; Jenkins, Jerry; Podicheti, Ram; Zhao, Meixia; Scheffler, Brian E; Stack, Joseph C; Feltus, Frank A; Mustiga, Guiliana M; Amores, Freddy; Phillips, Wilbert; Marelli, Jean Philippe; May, Gregory D; Shapiro, Howard; Ma, Jianxin; Bustamante, Carlos D; Schnell, Raymond J; Main, Dorrie; Gilbert, Don; Parida, Laxmi; Kuhn, David N
2013-06-03
Theobroma cacao L. cultivar Matina 1-6 belongs to the most cultivated cacao type. The availability of its genome sequence and methods for identifying genes responsible for important cacao traits will aid cacao researchers and breeders. We describe the sequencing and assembly of the genome of Theobroma cacao L. cultivar Matina 1-6. The genome of the Matina 1-6 cultivar is 445 Mbp, which is significantly larger than a sequenced Criollo cultivar, and more typical of other cultivars. The chromosome-scale assembly, version 1.1, contains 711 scaffolds covering 346.0 Mbp, with a contig N50 of 84.4 kbp, a scaffold N50 of 34.4 Mbp, and an evidence-based gene set of 29,408 loci. Version 1.1 has 10x the scaffold N50 and 4x the contig N50 as Criollo, and includes 111 Mb more anchored sequence. The version 1.1 assembly has 4.4% gap sequence, while Criollo has 10.9%. Through a combination of haplotype, association mapping and gene expression analyses, we leverage this robust reference genome to identify a promising candidate gene responsible for pod color variation. We demonstrate that green/red pod color in cacao is likely regulated by the R2R3 MYB transcription factor TcMYB113, homologs of which determine pigmentation in Rosaceae, Solanaceae, and Brassicaceae. One SNP within the target site for a highly conserved trans-acting siRNA in dicots, found within TcMYB113, seems to affect transcript levels of this gene and therefore pod color variation. We report a high-quality sequence and annotation of Theobroma cacao L. and demonstrate its utility in identifying candidate genes regulating traits.
Fertilizer requirements of cacao (Theobroma cacao L.) in South-Western Nigeria
Wessel, M.
1971-01-01
The studies reported on were conducted in the period 1961-1970 when the author was employed by the Cocoa Research Institute of Nigeria at Ibadan, formerly a sub-station of the West African Cocoa Research Institute.In the first three chapters information is given on the cacao industry and onEstado legal mundial del cadmio en cacao (Theobroma cacao): fantasía o realidad
Jiménez Tobón, Claudia Stella
2015-01-01
El cacao colombiano está bien posicionado en el mercado internacional por su sabor y aroma; sin embargo, en materia de contaminantes, existe a una preocupación a escala nacional debido a la presencia de cadmio en las semillas. Este metal, cuando se acumula en el organismo, es el responsable de serias enfermedades que lo deterioran lentamente. Aunque se conoce que a partir del 2019, la Comunidad Europea comenzará a exigir al cacao y sus derivados unos niveles máximos de cadmio, no es bien cono...
Wetten, Andy; Campbell, Colin; Allainguillaume, Joël
2016-03-01
Mealybugs (Hemiptera: Coccoidea: Pseudococcidae) are key vectors of badnaviruses, including Cacao swollen shoot virus (CSSV), the most damaging virus affecting cacao (Theobroma cacao L.). The effectiveness of mealybugs as virus vectors is species dependent, and it is therefore vital that CSSV resistance breeding programmes in cacao incorporate accurate mealybug identification. In this work, the efficacy of a CO1-based DNA barcoding approach to species identification was evaluated by screening a range of mealybugs collected from cacao in seven countries. Morphologically similar adult females were characterised by scanning electron microscopy, and then, following DNA extraction, were screened with CO1 barcoding markers. A high degree of CO1 sequence homology was observed for all 11 individual haplotypes, including those accessions from distinct geographical regions. This has allowed the design of a high-resolution melt (HRM) assay capable of rapid identification of the commonly encountered mealybug pests of cacao. HRM analysis readily differentiated between mealybug pests of cacao that cannot necessarily be identified by conventional morphological analysis. This new approach, therefore, has potential to facilitate breeding for resistance to CSSV and other mealybug-transmitted diseases. © 2015 Society of Chemical Industry.
Villagarcía, Hernán Gonzalo; González Arbeláez, Luisa Fernanda; Castro, María Cecilia; Ríos, José Luis; Massa, María Laura; Schinella, Guillermo Raúl; Francini, Flavio
2016-01-01
Existe una creciente evidencia de que el consumo de ciertos alimentos, suplementos alimenticios o bebidas tradicionales puede reducir el daño oxidativo en diferentes sistemas biológicos. Alimentos derivados del cacao, tales como polvos de cacao, chocolate y otros productos relacionado con el cacao son alimentos ricos en polifenoles derivados de las semillas fermentadas, tostados y procesados industrialmente de Theobroma cacao L. (Sterculiaceae). Estos productos, consumidos en todo el mundo...
Loor Solorzano, Rey Gaston; Fouet, Olivier; Lemainque, Arnaud; Pavek, Sylvana; Boccara, Michel; Argout, Xavier; Amores, Freddy; Courtois, Brigitte; Risterucci, Ange Marie; Lanaud, Claire
2012-01-01
Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR) markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.
Peru is one of the leading exporters of organic cocoa beans in the world. However, the accumulation of heavy metals in cacao beans represents a considerable quality problem. The aim of this study was to investigate the distribution and accumulation of heavy metals in cacao plants grown at three dif...
2013-01-01
Background Theobroma cacao L. cultivar Matina 1-6 belongs to the most cultivated cacao type. The availability of its genome sequence and methods for identifying genes responsible for important cacao traits will aid cacao researchers and breeders. Results We describe the sequencing and assembly of the genome of Theobroma cacao L. cultivar Matina 1-6. The genome of the Matina 1-6 cultivar is 445 Mbp, which is significantly larger than a sequenced Criollo cultivar, and more typical of other cultivars. The chromosome-scale assembly, version 1.1, contains 711 scaffolds covering 346.0 Mbp, with a contig N50 of 84.4 kbp, a scaffold N50 of 34.4 Mbp, and an evidence-based gene set of 29,408 loci. Version 1.1 has 10x the scaffold N50 and 4x the contig N50 as Criollo, and includes 111 Mb more anchored sequence. The version 1.1 assembly has 4.4% gap sequence, while Criollo has 10.9%. Through a combination of haplotype, association mapping and gene expression analyses, we leverage this robust reference genome to identify a promising candidate gene responsible for pod color variation. We demonstrate that green/red pod color in cacao is likely regulated by the R2R3 MYB transcription factor TcMYB113, homologs of which determine pigmentation in Rosaceae, Solanaceae, and Brassicaceae. One SNP within the target site for a highly conserved trans-acting siRNA in dicots, found within TcMYB113, seems to affect transcript levels of this gene and therefore pod color variation. Conclusions We report a high-quality sequence and annotation of Theobroma cacao L. and demonstrate its utility in identifying candidate genes regulating traits. PMID:23731509
Bailey, B A; Bae, H; Strem, M D; Roberts, D P; Thomas, S E; Crozier, J; Samuels, G J; Choi, Ik-Young; Holmes, K A
2006-11-01
Endophytic isolates of Trichoderma species are being considered as biocontrol agents for diseases of Theobroma cacao (cacao). Gene expression was studied during the interaction between cacao seedlings and four endophytic Trichoderma isolates, T. ovalisporum-DIS 70a, T. hamatum-DIS 219b, T. harzianum-DIS 219f, and Trichoderma sp.-DIS 172ai. Isolates DIS 70a, DIS 219b, and DIS 219f were mycoparasitic on the pathogen Moniliophthora roreri, and DIS 172ai produced metabolites that inhibited growth of M. roreri in culture. ESTs (116) responsive to endophytic colonization of cacao were identified using differential display and their expression analyzed using macroarrays. Nineteen cacao ESTs and 17 Trichoderma ESTs were chosen for real-time quantitative PCR analysis. Seven cacao ESTs were induced during colonization by the Trichoderma isolates. These included putative genes for ornithine decarboxylase (P1), GST-like proteins (P4), zinc finger protein (P13), wound-induced protein (P26), EF-calcium-binding protein (P29), carbohydrate oxidase (P59), and an unknown protein (U4). Two plant ESTs, extensin-like protein (P12) and major intrinsic protein (P31), were repressed due to colonization. The plant gene expression profile was dependent on the Trichoderma isolate colonizing the cacao seedling. The fungal ESTs induced in colonized cacao seedlings also varied with the Trichoderma isolate used. The most highly induced fungal ESTs were putative glucosyl hydrolase family 2 (F3), glucosyl hydrolase family 7 (F7), serine protease (F11), and alcohol oxidase (F19). The pattern of altered gene expression suggests a complex system of genetic cross talk occurs between the cacao tree and Trichoderma isolates during the establishment of the endophytic association.
Path analysis of phenotypic traits in young cacao plants under drought conditions.
Santos, Emerson Alves Dos; Almeida, Alex-Alan Furtado de; Branco, Marcia Christina da Silva; Santos, Ivanildes Conceição Dos; Ahnert, Dario; Baligar, Virupax C; Valle, Raúl René
2018-01-01
Drought is worldwide considered one of the most limiting factors of Theobroma cacao production, which can be intensified by global climate changes. In this study, we aimed to investigate the phenotypic correlation among morphological characteristics of cacao progenies submitted to irrigation and drought conditions and their partitions into direct and indirect effects. Path analysis with phenotypic plasticity index was used as criteria for estimation of basic and explanatory variables. The experiment was conducted in a greenhouse at the Cacao Research Center (CEPEC), Ilhéus, Bahia, Brazil, in a randomized block 21 x 2 factorial arrangement [21 cacao progenies obtained from complete diallel crosses and two water regimes (control and drought)] and six replications. In general, drought conditions influenced biomass production in most progenies, causing significant reductions in total leaf area, leaf number, leaf biomass, fine-roots length (diameter cacao progenies drought tolerant.
Ferraz Dos Santos, Lucas; Moreira Fregapani, Roberta; Falcão, Loeni Ludke; Togawa, Roberto Coiti; Costa, Marcos Mota do Carmo; Lopes, Uilson Vanderlei; Peres Gramacho, Karina; Alves, Rafael Moyses; Micheli, Fabienne; Marcellino, Lucilia Helena
2016-01-01
The cupuassu tree (Theobroma grandiflorum) (Willd. ex Spreng.) Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified). The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches' broom disease, as well as to pulp quality (SST/ATT values). Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively.
Directory of Open Access Journals (Sweden)
Lucas Ferraz Dos Santos
Full Text Available The cupuassu tree (Theobroma grandiflorum (Willd. ex Spreng. Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified. The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches' broom disease, as well as to pulp quality (SST/ATT values. Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively.
Ferraz dos Santos, Lucas; Moreira Fregapani, Roberta; Falcão, Loeni Ludke; Togawa, Roberto Coiti; Costa, Marcos Mota do Carmo; Lopes, Uilson Vanderlei; Peres Gramacho, Karina; Alves, Rafael Moyses
2016-01-01
The cupuassu tree (Theobroma grandiflorum) (Willd. ex Spreng.) Schum. is a fruitful species from the Amazon with great economical potential, due to the multiple uses of its fruit´s pulp and seeds in the food and cosmetic industries, including the production of cupulate, an alternative to chocolate. In order to support the cupuassu breeding program and to select plants presenting both pulp/seed quality and fungal disease resistance, SSRs from Next Generation Sequencing ESTs were obtained and used in diversity analysis. From 8,330 ESTs, 1,517 contained one or more SSRs (1,899 SSRs identified). The most abundant motifs identified in the EST-SSRs were hepta- and trinucleotides, and they were found with a minimum and maximum of 2 and 19 repeats, respectively. From the 1,517 ESTs containing SSRs, 70 ESTs were selected based on their functional annotation, focusing on pulp and seed quality, as well as resistance to pathogens. The 70 ESTs selected contained 77 SSRs, and among which, 11 were polymorphic in cupuassu genotypes. These EST-SSRs were able to discriminate the cupuassu genotype in relation to resistance/susceptibility to witches’ broom disease, as well as to pulp quality (SST/ATT values). Finally, we showed that these markers were transferable to cacao genotypes, and that genome availability might be used as a predictive tool for polymorphism detection and primer design useful for both Theobroma species. To our knowledge, this is the first report involving EST-SSRs from cupuassu and is also a pioneer in the analysis of marker transferability from cupuassu to cacao. Moreover, these markers might contribute to develop or saturate the cupuassu and cacao genetic maps, respectively. PMID:26949967
Moniliophthora roreri (Cif y Par) Evans et al. en el cultivo de cacao
Sánchez Mora, Fernando David; Garcés Fiallos, Felipe Rafael
2012-01-01
More than a century, cacao (Theobroma cacao L.) in Ecuador has been an important source of income for farmers and currency for the country, becoming one of the biggest exporters worldwide. Then, gradually lost that status due to the attack of diseases, including moniliasis caused by [Moniliophthora roreri (Cif and Par) Evans et al.]. It can cause damage of up to 80% in production. Currently there is little scientific date information on its occurrence, symptoms, etiology, epidemiology, life c...
Castro, Andressa V; de Almeida, Alex-Alan F; Pirovani, Carlos P; Reis, Graciele S M; Almeida, Nicolle M; Mangabeira, Pedro A O
2015-05-01
Seeds from Theobroma cacao progenies derived from the self-pollination of 'Catongo'×'Catongo' and the crossing between CCN-10×SCA-6 were immersed for 24h in different Cd solutions (2; 4; 8; 16 and 32 mgL(-1)) along with the control treatment (without Cd). Shortly after, the seeds were sown in plastic tubes containing organic substrate and were grown in a greenhouse for 60 days. The treatment with Cd was observed to cause morphological, biochemical, molecular and ultrastructural changes in both progenies of T. cacao. There has been deformation in chloroplasts, nuclear chromatin condensation, and reduction in thickness of the mesophyll. As for 'Catongo'×'Catongo', a decrease in thickness of the epidermis was noted on the abaxial face. There has been increased guaiacol peroxidase activity in the roots of CCN-10×SCA-6, as well as in the''Catongo'×'Catongo' leaves. In the presence of Cd, CCN-10×SCA-6 showed increased expression of the genes associated with the biosynthesis of phytochelatin (PCS-1) and class III peroxidases (PER-1) in leaves, and metallothionein (MT2b), in roots. In 'Catongo'×'Catongo', there has been an increase in the expression of genes associated with the biosynthesis of PER-1 and cytosolic superoxide dismutase dependent on copper and zinc (Cu-Zn SODCyt) in leaves and from MT2b and PCS-1 and roots. There was higher accumulation of Cd in the aerial parts of seedlings from both progenies, whereas the most pronounced accumulation was seen in''Catongo'×'Catongo'. The increase in Cd concentration has led to lower Zn and Fe levels in both progenies. Hence, one may conclude that the different survival strategies used by CCN-10×SCA-6 made such progeny more tolerant to Cd stress when compared to''Catongo'×'Catongo'. Copyright © 2015. Published by Elsevier Inc.
Directory of Open Access Journals (Sweden)
Rey Gaston Loor Solorzano
Full Text Available Ecuador's economic history has been closely linked to Theobroma cacao L cultivation, and specifically to the native fine flavour Nacional cocoa variety. The original Nacional cocoa trees are presently in danger of extinction due to foreign germplasm introductions. In a previous work, a few non-introgressed Nacional types were identified as potential founders of the modern Ecuadorian cocoa population, but so far their origin could not be formally identified. In order to determine the putative centre of origin of Nacional and trace its domestication history, we used 80 simple sequence repeat (SSR markers to analyse the relationships between these potential Nacional founders and 169 wild and cultivated cocoa accessions from South and Central America. The highest genetic similarity was observed between the Nacional pool and some wild genotypes from the southern Amazonian region of Ecuador, sampled along the Yacuambi, Nangaritza and Zamora rivers in Zamora Chinchipe province. This result was confirmed by a parentage analysis. Based on our results and on data about pre-Columbian civilization and Spanish colonization history of Ecuador, we determined, for the first time, the possible centre of origin and migration events of the Nacional variety from the Amazonian area until its arrival in the coastal provinces. As large unexplored forest areas still exist in the southern part of the Ecuadorian Amazonian region, our findings could provide clues as to where precious new genetic resources could be collected, and subsequently used to improve the flavour and disease resistance of modern Ecuadorian cocoa varieties.
Rahayu, Budi; Baktiyani, Siti Candra Windu; Nurdiana, Nurdiana
2016-01-01
This study aims to investigate whether an ethanolic extract of Theobroma cacao bean is able to increase cell viability and decrease IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Endothelial cells were obtained from human umbilical vascular endothelial cells. At confluency, endothelial cells were divided into six groups, which included control (untreated), endothelial cells exposed to plasma from normal pregnancy, endothelial cells exposed to 2% plasma from preeclamptic patients (PP), endothelial cells exposed to PP in the presence of ethanolic extract of T. cacao (PP+TC) at the following three doses: 25, 50, and 100 ppm. The analysis was performed in silico using the Hex 8.0, LigPlus and LigandScout 3.1 software. Analysis on IL-6 and sVCAM-1 levels were done by enzyme linked immunosorbent assay (ELISA). We found that seven of them could bind to the protein NFκB (catechin, leucoanthocyanidin, niacin, phenylethylamine, theobromine, theophylline, and thiamin). This increase in IL-6 was significantly (Pcacao extract. Plasma from PP significantly increased sVCAM-1 levels compared to untreated cells. This increase in sVCAM-1 was significantly attenuated by all doses of the extract. In conclusion, T. cacao extract prohibits the increase in IL-6 and sVCAM-1 in endothelial cells induced by plasma from preeclamptic patients. Therefore this may provide a herbal therapy for attenuating the endothelial dysfunction found in preeclampsia. Copyright © 2016 International Society for the Study of Hypertension in Pregnancy. Published by Elsevier B.V. All rights reserved.
Directory of Open Access Journals (Sweden)
Karina Carrera-Sánchez
2014-07-01
Full Text Available Moniliophthora roreri is a pathogen of cocoa (Theobroma cacao L. that causes high economic losses in Ecuador. This paper is intended to present a protocol for the isolation of the pathogen from cocoa fruits cv. `National', showing signs and symptoms of disease. The fruits were collected on farms of Napo (Ecuador. By wet chamber, it was able to induce profusely, sporulation on the surface of selected lesions. The isolations were performed from conidia directly located on the surface of fruits with brown powdery appearance. Isolation procedures and suggested of possible applications are presented. Key words: amazonia, basidiomycetes, fungi, moniliasis, Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Wilmer Figueroa Medina
2013-07-01
Full Text Available El pasador del fruto, Carmenta foraseminis Eichlin, es un insecto que ha acentuado su ataque en cultivos de cacao (Theobroma cacao L. en los últimos años en Norte de Santander (Colombia. El objetivo de este estudio fue evaluar la patogenicidad de las cepas nativas Giav-3 Paecilomyces sp. y Giav-4 Lecanicillium sp. sobre larvas de C. foraseminis. Para el efecto, se realizaron aislamientos a partir de muestras de suelo recolectadas en el municipio de Tibú, Norte de Santander. Después de obtenidos los cultivos puros se procedió a la caracterización macroscópica y microscópica para la identificación del género de los aislados mediante claves taxonómicas. La infección fue realizada mediante inmersión de larvas en las suspensiones de los aislados en concentraciones de 0, 10(6, 10(7 y 10(8 conidios/ml. En ambos aislados se observó una tendencia lineal respecto a la mortalidad, la cual fue directamente proporcional a las concentraciones del inóculo. La CL50 y CL90 para Giav-3 fue de 10(6.95 y 10(8.70 conidios/ml y para Giav-4 de 10(6.6 y 10(8.04 conidios/ml, respectivamente. Lo cual indica que esta última requirió la menor concentración de inóculo para eliminar el 50% y 90% de la población tratada, lo que supone una mayor efectividad contra las larvas.
A comparison of tissue preparation methods for protein extraction of cocoa (Theobroma cacao L. pod
Directory of Open Access Journals (Sweden)
Ascensión Martínez-Márquez
2017-04-01
Full Text Available Cocoa, Theobroma cacao L. is one of the main tropical industrial crops. Cocoa has a very high level of interfering substances, such as polysaccharides and phenolic compounds that could prevent the isolation of suitable protein. Efficient methods of protein extraction are a priority to successfully apply proteomic analyses. We compared and evaluated two methods (A and B of tissue preparation for total protein extract by phenol/SDS extraction protocol. The difference in the application of the two methods was that extensively washed dry powder of pod tissue were made in Method A, whereas that crude extract were prepared Method B. Extracted proteins were examined using one-dimensional electrophoresis (1-D. Results show that each extraction method isolated a unique subset of cocoa pod proteome. Principal component analysis showed little variation in the data obtained using Method A, while that in Methods B showed no low reproducibility, thus demonstrating that Method A is a reliable for preparing cocoa pod proteins. The protocol is expected to be applicable to other recalcitrant plant tissues and to be of interest to laboratories involved in plant proteomics analyses. A combination of extraction approaches is recommended for increasing proteome coverage when using gel-based isolation techniques.
There is abundant evidence that consumption of cacao and dark chocolate promotes human health and that the main cacao components contributing positive health effects are polyphenols. The polyphenols in cacao bean constitute 12–18% dry weight of the whole bean and are predominantly catechins (37% w/w...
Abscisic Acid and the Maturation of Cacao Embryos in Vitro 1
Pence, Valerie Creaser
1992-01-01
Abscisic acid (ABA) was tested for its ability to affect development of immature zygotic embryos of cacao (Theobroma cacao) in vitro, by adding exogenous ABA, fluridone, or mefluidide to cultured embryos. Endogenous ABA levels, measured by enzyme-linked immunosorbent assay, were increased by exogenous ABA or by culture on sucrose increasing to 21%, and were decreased by fluridone and, to a lesser extent, by mefluidide. The effects of these on maturation were measured as effects on anthocyanins, lipids, and fatty acid saturation, all of which increase with maturation of the cacao embryo. Maturation was stimulated by increasing sucrose and, to a lesser degree, the addition of ABA, but decreasing endogenous ABA by treating with fluridone significantly inhibited all maturation parameters. Although desiccation tolerance does not develop in cacao embryos, these results suggest that ABA and sucrose are both needed for the initiation of events associated with maturation in vitro. PMID:16668805
Lima, Milena Campelo Freitas de
2013-01-01
Theobroma grandiflorum ? uma esp?cie nativa da Amaz?nia com elevado potencial econ?mico, que pertence ao mesmo g?nero que o cacau (Theobroma cacao). Seu fruto, conhecido como cupua?u, ? o maior no g?nero Theobroma, chegando a atingir at? 4 kg em massa. A base econ?mica dessa esp?cie concentra-se no mesocarpo (polpa), bastante conhecido e comercializado para a produ??o de sucos, n?ctares, sorvetes entre outros. No processo de obten??o da polpa do cupua?u s?o gerados subprodutos que corresponde...
Variación de las propiedades físicas de la grasa de cacao con la temperatura
de Dios Alvarado, Juan
1994-01-01
Values of physical properties determined at different temperatures in fat extracted from fresh cacao seeds (Theobroma cacao) are presented. Linear relationships define the effect of temperature on the refraction index, density and surface tension, a logarithmic function was established for viscosity. The values of density and viscosity are used to determine the coefficient of volumetric thermal expansion and activation energy, respectively. Data of specific heat, thermal diffusivity and therm...
[Cocoa (Theobroma cacao L.) hulls: a posible commercial source of pectins].
Barazarte, Humberto; Sangronis, Elba; Unai, Emaldi
2008-03-01
Commercial exploitation of cocoa (Theobroma cacao L.) generates a volume of hulls that could be used in the production of pectins on an industrial scale. Therefore, pectins from cocoa hulls were extracted at different pH and temperature conditions, and their main chemical characteristics were evaluated. EDTA at 0.5% was used for the extraction at pHs 3, 4 and 5 and temperatures of 60, 75 and 90 degrees C, under a 3 2 factorial design. The response variables were yield, content of anhydrous galacturonic acid (AGA), content of metoxil, degree of esterification and equivalent weight of the pectins extracted. The strength of the pectic gel was determined with a TA-XT2 texturometer. Strawberry jam was made with the pectin extracted, and its acceptability was determined using a 7-point hedonic scale. The results obtained were as follows: an extraction yield from 2.64 to 4.69 g/100 g; an AGA content between 49.8 and 64.06 g/100 g; a content of metoxil between 4.72 and 7.18 g/100 g; a degree of esterification between 37.94 and 52.20%; an equivalent weight from 385.47 to 464.61 g/equivalent of H+, and a degree of gelation between 28.64 and 806.03 g force. The pectin extracted at pH 4 and 90 degrees C showed a gelation power of 422.16 g force, purity 62.26 g/100 g of AGA, and a yield of extraction of 3.89 g/100 g and allowed to prepare ajam with an average level of liking of "like moderately". Pectins from cocoa hulls show potential application in the food industry, but it is necessary to optimize the extraction parameters to increase its yield.
Krishnamoorthy, C; Rajamani, K
2013-12-15
A field experiment to study the influence of fertigation of N, P and K fertilizers on biometric characters of cocoa (Theobroma cacao L.) was conducted at the Department of Spices and Plantation Crops, Horticultural College and Research Institute, Tamil Nadu Agricultural University, Coimbatore during January 2010 to December 2011. The experiment was laid out with thirteen treatments replicated three times in a randomized block design. A phenomenal increase in growth parameters such as trunk girth, canopy spread and weight of the pruned branches removed, leaf fresh weight and leaf dry weight was observed with increasing levels of NPK as well as methods of fertilizer application in this study. Among the various treatments, fertigation with 125% 'Recommended Dose of Fertilizers' (125:50:175 g NPK plant year(-1)) as Water Soluble Fertilizers (WSF) through drip irrigation increased all vegetative growth parameters like trunk girth increment (1.62 cm), canopy spread increment (66.79 cm), leaf fresh weight (3.949 g), leaf dry weight (2.039 g), weight of the pruned branches removed (fresh weight 7.628 kg plant(-1)) and dry weight (4.650 kg plant(-1)).
Proteome analysis during pod, zygotic and somatic embryo maturation of Theobroma cacao.
Niemenak, Nicolas; Kaiser, Edward; Maximova, Siela N; Laremore, Tatiana; Guiltinan, Mark J
2015-05-15
Two dimensional electrophoresis and nano-LC-MS were performed in order to identify alterations in protein abundance that correlate with maturation of cacao zygotic and somatic embryos. The cacao pod proteome was also characterized during development. The recently published cacao genome sequence was used to create a predicted proteolytic fragment database. Several hundred protein spots were resolved on each tissue analysis, of which 72 variable spots were subjected to MS analysis, resulting in 49 identifications. The identified proteins represent an array of functional categories, including seed storage, stress response, photosynthesis and translation factors. The seed storage protein was strongly accumulated in cacao zygotic embryos compared to their somatic counterpart. However, sucrose treatment (60 g L(-1)) allows up-regulation of storage protein in SE. A high similarity in the profiles of acidic proteins was observed in mature zygotic and somatic embryos. Differential expression in both tissues was observed in proteins having high pI. Several proteins were detected exclusively in fruit tissues, including a chitinase and a 14-3-3 protein. We also identified a novel cacao protein related to known mabinlin type sweet storage proteins. Moreover, the specific presence of thaumatin-like protein, another sweet protein, was also detected in fruit tissue. We discuss our observed correlations between protein expression profiles, developmental stage and stress responses. Copyright © 2015 Elsevier GmbH. All rights reserved.
Cacao (Theobroma cacao L.), the tree from which cocoa butter and chocolate is derived, is conserved in field genebanks. The largest of these ex situ collections in the public domain is the International Cocoa Genebank, Trinidad (ICG,T). Reduction of genetic redundancy is essential to improve the acc...
Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population ma...
Arévalo-Gardini, Enrique; Canto, Manuel; Alegre, Julio; Loli, Oscar; Julca, Alberto; Baligar, Virupax
2015-01-01
Growing cacao (Theobroma cacao L.) in an agroforestry system generates a productive use of the land, preserves the best conditions for physical, chemical and biological properties of tropical soils, and plays an important role in improving cacao production and fertility of degraded tropical soils. The aim of this study was to evaluate the impact of two long term agroforestry systems of cacao management on soil physical and chemical properties in an area originally inhabited by 30 years old native secondary forest (SF). The two agroforestry systems adapted were: improved natural agroforestry system (INAS) where trees without economic value were selectively removed to provide 50% shade and improved traditional agroforestry system (ITAS) where all native trees were cut and burnt in the location. For evaluation of the changes of soil physical and chemical properties with time due to the imposed cacao management systems, plots of 10 cacao genotypes (ICS95, UF613, CCN51, ICT1112, ICT1026, ICT2162, ICT2171, ICT2142, H35, U30) and one plot with a spontaneous hybrid were selected. Soil samples were taken at 0-20, 20-40 and 40-60 cm depths before the installation of the management systems (2004), and then followed at two years intervals. Bulk density, porosity, field capacity and wilting point varied significantly during the years of assessment in the different soil depths and under the systems assessed. Soil pH, CEC, exchangeable Mg and sum of the bases were higher in the INAS than the ITAS. In both systems, SOM, Ext. P, K and Fe, exch. K, Mg and Al+H decreased with years of cultivation; these changes were more evident in the 0-20 cm soil depth. Overall improvement of SOM and soil nutrient status was much higher in the ITAS than INAS. The levels of physical and chemical properties of soil under cacao genotypes showed a marked difference in both systems.
Zhang, Yufan; Maximova, Siela N; Guiltinan, Mark J
2015-01-01
In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance.
Carbon Storage in Soil Size Fractions Under Two Cacao Agroforestry Systems in Bahia, Brazil
Gama-Rodrigues, Emanuela F.; Ramachandran Nair, P. K.; Nair, Vimala D.; Gama-Rodrigues, Antonio C.; Baligar, Virupax C.; Machado, Regina C. R.
2010-02-01
Shaded perennial agroforestry systems contain relatively high quantities of soil carbon (C) resulting from continuous deposition of plant residues; however, the extent to which the C is sequestered in soil will depend on the extent of physical protection of soil organic C (SOC). The main objective of this study was to characterize SOC storage in relation to soil fraction-size classes in cacao ( Theobroma cacao L.) agroforestry systems (AFSs). Two shaded cacao systems and an adjacent natural forest in reddish-yellow Oxisols in Bahia, Brazil were selected. Soil samples were collected from four depth classes to 1 m depth and separated by wet-sieving into three fraction-size classes (>250 μm, 250-53 μm, and cacao AFSs, the C contained in the macroaggregate fraction might become stabilized in the soil. The study shows the role of cacao AFSs in mitigating greenhouse gas (GHG) emission through accumulation and retention of high amounts of organic C in the soils and suggests the potential benefit of this environmental service to the nearly 6 million cacao farmers worldwide.
Biotechnology for cocoa pod borer resistance in cocoa
Chaidamsari, T.
2005-01-01
The cocoa tree ( Theobroma cacao L.) produces the beans that are the source of cacao, the basis for chocolate production, and an important commodity crop in South America, West Africa, and Southeast Asia.Cocoa Pod
International Nuclear Information System (INIS)
Farag, M.F.S.; Darwish, M.M.
2016-01-01
Man is exposed to natural radiations either from cosmic or terrestrial origins. Furthermore, it is well known that the gamma irradiation of animals induce biochemical alterations which depend mostly on oxidative stress. This work aimed at evaluating the radioprotective efficiency of Cocoa (Theobroma cacao L.) against whole body γ-irradiation of rats. The virtue of cocoa aqueous extract (CAE) was given to rats at a dose of 1 g/ kg for 6 weeks to determine changes in hepatic marker enzymes, lipid profile and antioxidant status. The animals exposed to γ-rays exhibited a pronounced increment in serum aspartate transaminase (AST), alanine transaminase (ALT), alkaline phosphatase (ALP) and gamma glutamyl transpeptidase (γ GT), total cholesterol (TC), triglycerides (TG), low density lipoprotein cholesterol (LDL-C) and liver thiobarbituric acid reactive substance (TBARS). On the other hand, a significant decline was demonstrated in high density lipoprotein cholesterol (HDL-C). A decrease of hepatic reduced glutathione (GSH) content, superoxides dismutase (SOD) and catalase (CAT) activities was sustained. The CAE administered orally to rats has significantly modulated all the radiation-induced biochemical alterations. These findings revealed that cocoa would exert radio-protective properties
Rachmat, Devita; Johar Mawarani, Lizda; Dewi Risanti, Doty
2018-01-01
Cocoa pod husk (Theobroma cacao l.) is a waste from cocoa beans processing. In this research we employ cocoa pod husk as activated carbon to decrease the value of FFA (Free Fatty Acid) in waste cooking oil and as K2CO3 catalyst in biodiesel production process from waste cooking oil. Cocoa pod husk was crusched and grounded into powder that passed thorugh 60 mesh-screen. As activated carbon, cocoa pod husk was firstly carbonized at three variant temperatures i.e 250°C, 300°C and 350°C. The activation process was done using HCl 2M as activator. Based on the results of XRD and FTIR, the carbonization at all variant temperatures does not cause a significant changes in terms of crystallite structure and water content. The pore of activated carbon started to form in sample that was carbonized at 350°C resulting in pore diameter of 5.14644 nm. This result was supported by the fact that the ability of this activated carbon in reducing the FFA of waste cooking oil was the most pronounced one, i.e. up to 86.7% of FFA. It was found that the performance of cocoa pod husk’s activated carbon in reducing FFA is more effective than esterification using H2SO4 which can only decrease 80.8%. On the other hand, the utilization as K2CO3 catalyst was carried out by carbonization at temperature 650°C and extraction using aquadest solvent. The extraction of cocoa pod husk produced 7.067% K2CO3 catalyst. According to RD results the fraction of K2CO3 compound from the green catalysts is the same as the commercial (SAP, 99%) that is ≥ 60%. From the obtained results, the best yield percentage was obtained using K2CO3 catalyst from cacao pod husk extract, i.e. 73-85%. To cope with biodiesel conversion efficiency, a two-step process consisting pretreatment with activated carbon carbonized at 350°C and esterification with K2CO3 from cocoa pod husk catalyst was developed. This two-step process could reach a high conversion of 85%. From the results it was clear that the produced
Camillo, Luciana Rodrigues; Filadelfo, Ciro Ribeiro; Monzani, Paulo Sérgio; Corrêa, Ronan Xavier; Gramacho, Karina Peres; Micheli, Fabienne; Pirovani, Carlos Priminho
2013-12-01
The level of hydrogen peroxide (H2O2) in plants signalizes the induction of several genes, including that of ascorbate peroxidase (APX-EC 1.11.1.11). APX isoenzymes play a central role in the elimination of intracellular H2O2 and contribute to plant responses to diverse stresses. During the infection process in Theobroma cacao by Moniliophthora perniciosa oxidative stress is generated and the APX action recruited from the plant. The present work aimed to characterize the T. cacao APX involved in the molecular interaction of T. cacao-M. perniciosa. The peroxidase activity was analyzed in protein extracts from cocoa plants infected by M. perniciosa and showed the induction of peroxidases like APX in resistant cocoa plants. The cytosolic protein of T. cacao (GenBank: ABR68691.2) was phylogenetically analyzed in relation to other peroxidases from the cocoa genome and eight genes encoding APX proteins with conserved domains were also analyzed. The cDNA from cytosolic APX was cloned in pET28a and the recombinant protein expressed and purified (rTc-cAPX). The secondary structure of the protein was analyzed by Circular Dichroism (CD) displaying high proportion of α-helices when folded. The enzymatic assay shows stable activity using ascorbate and guaiacol as an electron donor for H2O2 reduction. The pH 7.5 is the optimum for enzyme activity. Chromatographic analysis suggests that rTc-cAPX is a homodimer in solution. Results indicate that the rTc-cAPX is correctly folded, stable and biochemically active. The purified rTc-cAPX presented biotechnological potential and is adequate for future structural and functional studies. Copyright © 2013 The Authors. Published by Elsevier Masson SAS.. All rights reserved.
Molecular and metabolic changes of cherelle wilt of cacao and its effect on Moniliophthora roreri
The seeds of Theobroma cacao L. pods are processed into cocoa products. Cherelle wilt is physiological thinning of young pods that result in loss of potential pods. Cherelle wilt first occurs 50 days after pollination (DAP) and a second thinning occurs around 70 DAP. Cherelles are also highly sus...
Zhang, Yufan; Maximova, Siela N.; Guiltinan, Mark J.
2015-01-01
In plants, the conversion of stearoyl-ACP to oleoyol-ACP is catalyzed by a plastid-localized soluble stearoyl-acyl carrier protein (ACP) desaturase (SAD). The activity of SAD significantly impacts the ratio of saturated and unsaturated fatty acids, and is thus a major determinant of fatty acid composition. The cacao genome contains eight putative SAD isoforms with high amino acid sequence similarities and functional domain conservation with SAD genes from other species. Sequence variation in known functional domains between different SAD family members suggested that these eight SAD isoforms might have distinct functions in plant development, a hypothesis supported by their diverse expression patterns in various cacao tissues. Notably, TcSAD1 is universally expressed across all the tissues, and its expression pattern in seeds is highly correlated with the dramatic change in fatty acid composition during seed maturation. Interestingly, TcSAD3 and TcSAD4 appear to be exclusively and highly expressed in flowers, functions of which remain unknown. To test the function of TcSAD1 in vivo, transgenic complementation of the Arabidopsis ssi2 mutant was performed, demonstrating that TcSAD1 successfully rescued all AtSSI2 related phenotypes further supporting the functional orthology between these two genes. The identification of the major SAD gene responsible for cocoa butter biosynthesis provides new strategies for screening for novel genotypes with desirable fatty acid compositions, and for use in breeding programs to help pyramid genes for quality and other traits such as disease resistance. PMID:25926841
Kotowska, Martyna M; Hertel, Dietrich; Rajab, Yasmin Abou; Barus, Henry; Schuldt, Bernhard
2015-01-01
For decades it has been assumed that the largest vessels are generally found in roots and that vessel size and corresponding sapwood area-specific hydraulic conductivity are acropetally decreasing toward the distal twigs. However, recent studies from the perhumid tropics revealed a hump-shaped vessel size distribution. Worldwide tropical perhumid forests are extensively replaced by agroforestry systems often using introduced species of various biogeographical and climatic origins. Nonetheless, it is unknown so far what kind of hydraulic architectural patterns are developed in those agroforestry tree species and which impact this exerts regarding important tree functional traits, such as stem growth, hydraulic efficiency and wood density (WD). We investigated wood anatomical and hydraulic properties of the root, stem and branch wood in Theobroma cacao and five common shade tree species in agroforestry systems on Sulawesi (Indonesia); three of these were strictly perhumid tree species, and the other three tree species are tolerating seasonal drought. The overall goal of our study was to relate these properties to stem growth and other tree functional traits such as foliar nitrogen content and sapwood to leaf area ratio. Our results confirmed a hump-shaped vessel size distribution in nearly all species. Drought-adapted species showed divergent patterns of hydraulic conductivity, vessel density, and relative vessel lumen area between root, stem and branch wood compared to wet forest species. Confirming findings from natural old-growth forests in the same region, WD showed no relationship to specific conductivity. Overall, aboveground growth performance was better predicted by specific hydraulic conductivity than by foliar traits and WD. Our study results suggest that future research on conceptual trade-offs of tree hydraulic architecture should consider biogeographical patterns underlining the importance of anatomical adaptation mechanisms to environment.
Directory of Open Access Journals (Sweden)
Martyna Malgorzata Kotowska
2015-03-01
Full Text Available For decades it has been assumed that the largest vessels are generally found in roots and that vessel size and corresponding sapwood area-specific hydraulic conductivity are acropetally decreasing towards the distal twigs. However, recent studies from the perhumid tropics revealed a hump-shaped vessel size distribution. Worldwide tropical perhumid forests are extensively replaced by agroforestry systems often using introduced species of various biogeographical and climatic origins. Nonetheless, it is unknown so far what kind of hydraulic architectural patterns are developed in those agroforestry tree species and which impact this exerts regarding important tree functional traits, such as stem growth, hydraulic efficiency and wood density. We investigated wood anatomical and hydraulic properties of the root, stem and branch wood in Theobroma cacao and five common shade tree species in agroforestry systems on Sulawesi (Indonesia; three of these were strictly perhumid tree species, and the other three tree species are tolerating seasonal drought. The overall goal of our study was to relate these properties to stem growth and other tree functional traits such as foliar nitrogen content and sapwood to leaf area ratio. Our results confirmed a hump-shaped vessel size distribution in nearly all species. Drought-adapted species showed divergent patterns of hydraulic conductivity, vessel density and relative vessel lumen area between root, stem and branch wood compared to wet forest species. Confirming findings from natural old-growth forests in the same region, wood density showed no relationship to specific conductivity. Overall, aboveground growth performance was better predicted by specific hydraulic conductivity than by foliar traits and wood density. Our study results suggest that future research on conceptual trade-offs of tree hydraulic architecture should consider biogeographical patterns underlining the importance of anatomical adaptation
Directory of Open Access Journals (Sweden)
A.M. Kosoko
2017-07-01
Full Text Available 80 rats, randomly selected, were divided into 3 treatment groups: pre-, co- and post-treatment; consisting of 6 sub-groups each (5 rats per sub-group: baseline, normal saline (2 mL, α-lipoic acid (20 mg/kg body weight, 200 mg/kg, 400 mg/kg or 800 mg/kg body weight Theobroma cacao stem bark aqueous extract (TCAE. All rats except for baseline group were intoxicated with 20 mg/kg body weight doxorubicin (DOX intraperitoneally. The animals in pre- or post-treatment group received a single dose of DOX (20 mg/kg body weight intraperitoneally 24 h before or after 7 days’ oral administration with TCAE respectively while those in co-treatment group were co-administered 2.86 mg/kg body weight of DOX with either normal saline, α- lipoic acid or TCAE orally for 7 days. Animals were sacrificed (pre- and post- treatment groups were sacrificed on the ninth day while the co-treatment group sacrificed on the 8th day. Brain and heart tissue samples were harvested for enzyme markers of toxicity, oxidative stress and histopathological examinations. DOX intoxication caused significant decrease in activities of LDH and ACP, and increase in γGT and ALP activities in brain tissues while causing a significant increase in LDH, ACP, γGT activities and decrease in ALP activity in the cardiac tissues. DOX intoxication caused a significant increase in concentrations of H2O2 generated, MDA and PC, XO, MPx and NOX activities with concomitant decrease in CAT, SOD, GPx and GST activities, and in concentrations of GSH, AsA and α-Toc in brain and cardiac tissues. Pre-, co- and post-treatment with TCAE at either 200 mg/kg, 400 mg/kg or 800 mg/kg body weight significantly reversed the oxidative damage to the organs induced by DOX-intoxication. The result affirmed that T. cacao stem bark aqueous extract protected against DOX induced oxidative damage in brain and cardiac tissues of experimental rats.
How dark chocolate is processed
This month’s column will continue the theme of “How Is It Processed?” The column will focus on dark chocolate. The botanical name for the cacao tree is Theobroma cacao, which literally means “food of the Gods.” Dark chocolate is both delicious and nutritious. Production of dark chocolate will be des...
Silva Monteiro de Almeida, Dayanne; Oliveira Jordão do Amaral, Daniel; Del-Bem, Luiz-Eduardo; Bronze Dos Santos, Emily; Santana Silva, Raner José; Peres Gramacho, Karina; Vincentz, Michel; Micheli, Fabienne
2017-01-01
Transcriptional regulation, led by transcription factors (TFs) such as those of the WRKY family, is a mechanism used by the organism to enhance or repress gene expression in response to stimuli. Here, we report on the genome-wide analysis of the Theobroma cacao WRKY TF family and also investigate the expression of WRKY genes in cacao infected by the fungus Moniliophthora perniciosa. In the cacao genome, 61 non-redundant WRKY sequences were found and classified in three groups (I to III) according to the WRKY and zinc-finger motif types. The 61 putative WRKY sequences were distributed on the 10 cacao chromosomes and 24 of them came from duplication events. The sequences were phylogenetically organized according to the general WRKY groups. The phylogenetic analysis revealed that subgroups IIa and IIb are sister groups and share a common ancestor, as well as subgroups IId and IIe. The most divergent groups according to the plant origin were IIc and III. According to the phylogenetic analysis, 7 TcWRKY genes were selected and analyzed by RT-qPCR in susceptible and resistant cacao plants infected (or not) with M. perniciosa. Some TcWRKY genes presented interesting responses to M. perniciosa such as Tc01_p014750/Tc06_p013130/AtWRKY28, Tc09_p001530/Tc06_p004420/AtWRKY40, Tc04_p016130/AtWRKY54 and Tc10_p016570/ AtWRKY70. Our results can help to select appropriate candidate genes for further characterization in cacao or in other Theobroma species.
Silva Monteiro de Almeida, Dayanne; Oliveira Jordão do Amaral, Daniel; Del-Bem, Luiz-Eduardo; Bronze dos Santos, Emily; Santana Silva, Raner José; Peres Gramacho, Karina; Vincentz, Michel
2017-01-01
Transcriptional regulation, led by transcription factors (TFs) such as those of the WRKY family, is a mechanism used by the organism to enhance or repress gene expression in response to stimuli. Here, we report on the genome-wide analysis of the Theobroma cacao WRKY TF family and also investigate the expression of WRKY genes in cacao infected by the fungus Moniliophthora perniciosa. In the cacao genome, 61 non-redundant WRKY sequences were found and classified in three groups (I to III) according to the WRKY and zinc-finger motif types. The 61 putative WRKY sequences were distributed on the 10 cacao chromosomes and 24 of them came from duplication events. The sequences were phylogenetically organized according to the general WRKY groups. The phylogenetic analysis revealed that subgroups IIa and IIb are sister groups and share a common ancestor, as well as subgroups IId and IIe. The most divergent groups according to the plant origin were IIc and III. According to the phylogenetic analysis, 7 TcWRKY genes were selected and analyzed by RT-qPCR in susceptible and resistant cacao plants infected (or not) with M. perniciosa. Some TcWRKY genes presented interesting responses to M. perniciosa such as Tc01_p014750/Tc06_p013130/AtWRKY28, Tc09_p001530/Tc06_p004420/AtWRKY40, Tc04_p016130/AtWRKY54 and Tc10_p016570/ AtWRKY70. Our results can help to select appropriate candidate genes for further characterization in cacao or in other Theobroma species. PMID:29084273
Directory of Open Access Journals (Sweden)
Eddyn Solórzano Chavez
2015-12-01
Full Text Available La presente investigación tuvo como objetivo comparar el perfil sensorial de muestras de cacao de varias zonas productoras del país. Con este propósito el Laboratorio de Calidad Integral de Cacao y Chocolate de la Estación Experimental Tropical Pichilingue del INIAP, recibió muestras de 11 asociaciones de productores. Un panel de cinco miembros con experiencia en degustación de pasta de cacao (licor produjo datos para los siguientes componentes del sabor: cacao, acidez, amargor, astringencia, caramelo, floral, frutal, nuez y verde. El análisis comparativo de las muestras se llevó a cabo mediante la prueba no paramétrica de Kruskal & Wallis. El grado de asociación de distintos pares de variables se examinó mediante un análisis correlacional. La relación entre muestras también se exploró mediante el análisis multivariado de componentes principales. Este análisis condujo a la identificación de las variables originales que más aportaron a la varianza de los dos primeros componentes principales. Diferencias estadísticamente significativas entre muestras se detectaron solo para el sabor a cacao. Las correlaciónes más altas se dieron entre las variables frutal y verde, frutal y astringencia, frutal y amargor, y frutal y nuez, la mayoría de signo negativo. Las variables con más aportación a la varianza (35.20% del primer componente principal fueron frutal, verde y amargor. Acidez, floral y nuez hicieron la mayor aportación al segundo componente principal. La aparente estructuración de dos grupos muestrales en el plano definido sugiere semejanzas y diferencias en su perfil sensorial.
Leite, Hianna Almeida Câmara; Silva, Anderson Barbosa; Gomes, Fábio Pinto; Gramacho, Karina Peres; Faria, José Cláudio; de Souza, Jorge Teodoro; Loguercio, Leandro Lopes
2013-03-01
Clonal genotypes resistant to fungal diseases are an important component of the cocoa production system in southeastern Bahia state (Brazil), so that technologies for faster production of stronger and healthier plantlets are highly desirable. In this study, the effects of inoculated bacterial endophytes isolated from healthy adult cacao plants on seedlings, and aspects related to inoculation methods, colonization patterns, and photosynthesis were investigated. Sequencing of 16S rRNA, hsp-60, and rpo-B genes placed the wild-type isolates within the species Enterobacter cloacae (isolates 341 and 344) and Bacillus subtilis (isolate 629). Spontaneous rifampicin-resistant (rif(R)) variants for 344 were also produced and tested. Endophytic application was either by immersion of surface sterilized seeds in bacterial suspensions or direct inoculation into soil, 20 days after planting non-inoculated seeds into pots. Results from in vitro recovery of inoculated isolates showed that the wild-type endophytes and rif(R) variants systemically colonized the entire cacao seedlings in 15-20 days, regardless of the inoculation method. Some endophytic treatments showed significant increases in seedlings' height, number of leaves, and dry matter. Inoculation methods affected the combined application of endophytes, which maintained the growth-promotion effects, but not in the same manner as in single applications. Interestingly, the 344-3.2 rif(R) variant showed improved performance in relation to both the wild type and another related variant. Photosynthetic rates and stomatal conductance increased significantly for some endophytic treatments, being partially associated with effects on growth and affected by the inoculation method. The results suggest that E. cloacae and B. subtilis endophytes from healthy adult plants (not transmitted by seeds) were able to promote vegetative growth on cacao seedlings. The development of products for large-scale use in seedlings
Physico-chemical properties of topsoil under indigenous and exotic ...
African Journals Online (AJOL)
This study evaluated selected physico-chemical properties of topsoil under monoculture plantation of an indigenous tree species - Nauclea diderrichii, and those of four exotic tree species – Theobroma cacao, Gmelina arborea, Pinus caribaea and Tectona grandis, located in Omo Biosphere Reserve, Ogun State, Nigeria.
Variación de las propiedades físicas de la grasa de cacao con la temperatura
Directory of Open Access Journals (Sweden)
de Dios Alvarado, Juan
1994-10-01
Full Text Available Values of physical properties determined at different temperatures in fat extracted from fresh cacao seeds (Theobroma cacao are presented. Linear relationships define the effect of temperature on the refraction index, density and surface tension, a logarithmic function was established for viscosity. The values of density and viscosity are used to determine the coefficient of volumetric thermal expansion and activation energy, respectively. Data of specific heat, thermal diffusivity and thermal conductivity are included. In addition a melting and solidification points. The information can be used at ambient temperatures or greater current in the elaboration of chocolate and other cocoa products.
Se presentan los valores experimentales de varias propiedades físicas determinadas en grasa obtenida de semillas de cacao (Theobroma cacao a diferentes temperaturas. El efecto de la temperatura sobre el índice de refracción, la densidad y la tensión superficial, es descrito en forma satisfactoria por ecuaciones lineales, en el caso de la viscosidad esta relación inversa es logarítmica. Los datos de la densidad se utilizan para determinar el coeficiente volumétrico de expansión térmica y los de la viscosidad para cuantificar la energía de activación.
Se incluyen los datos del calor específico, de la difusividad térmica y de la conductividad térmica, conjuntamente con los puntos de fusión y de solidificación.
Estos datos técnicos pueden ser utilizados a temperaturas ambientales y superiores que son comunes durante la elaboración de chocolates u otras tecnologías que utilizan cacao.
Latifah, S.; Afifuddin, Y.; Widya, S.
2018-02-01
Agroforestry is the management and integration of trees, crops and/or livestock on the same plot of land and can be an integral component of productive agriculture. It may include existing native forests and forests established by landholders. The study was conducted in Mekar Sari Raya village, Panei sub, Simalungun regency, North Sumatera. This study aims to gain the ability to use agroforestry in suren crops and cocoa that provides benefits to farmers and the feasibility of the model farm. The study site has Net Present Value (NPV) is 2,670,306,905 ( IDR) for 15 of year, Gross B/C Ratio (BCR) is 2.3; Internal Rate of Return ( IRR) is 28 %; and Payback Period (PP) for 5 years 4 months 24 days. Agroforestry using commodities cacao and suren crops are financially feasible to be cultivated and developed.
Almeida, D S M; Gramacho, K P; Cardoso, T H S; Micheli, F; Alvim, F C; Pirovani, C P
2017-07-01
The phylloplane is the first contact surface between Theobroma cacao and the fungus Moniliophthora perniciosa, which causes witches' broom disease (WBD). We evaluated the index of short glandular trichomes (SGT) in the cacao phylloplane and the effect of irrigation on the disease index of cacao genotypes with or without resistance to WBD, and identified proteins present in the phylloplane. The resistant genotype CCN51 and susceptible Catongo presented a mean index of 1,600 and 700 SGT cm -2 , respectively. The disease index in plants under drip irrigation was reduced by approximately 30% compared with plants under sprinkler irrigation prior to inoculation. Leaf water wash (LWW) of the cacao inhibited the germination of spores by up to 98%. Proteins from the LWW of CCN51 were analyzed by two-dimensional sodium dodecyl sulfate polyacrylamide gel electrophoresis followed by tandem mass spectrometry. The gel showed 71 spots and identified a total of 42 proteins (28 from the plant and 14 from bacteria). Proteins related to defense and synthesis of defense metabolites and involved in nucleic acid metabolism were identified. The results support the hypothesis that the proteins and water-soluble compounds secreted to the cacao phylloplane participate in the defense against pathogens. They also suggest that SGT can contribute to the resistance of cacao.
CACAO TO COCOA TO CHOCOLATE: HEALTHY FOOD?
Directory of Open Access Journals (Sweden)
ROYA KELISHADI
2010-12-01
Full Text Available ABSTRACT Chocolate is derived from cocoa beans - the fruit of the cacao tree or Theobroma cacao (the latin term: food of the gods. Recent published articles demonstrate that the quality and quantity of the antioxidants in cocoa and chocolate are very high and their flavonoids are believed to reduce the number of free radicals in the body that contribute to medical problems, such as cardiovascular disease and cancer and also to offer some anti-aging health benefits. Cocoa can lower the leukotriene/ prostacyclin ratio and is shown to have beneficial effects on platelets and possibly inflammation and vessel dilation. They inhibit low-density lipoprotein (LDL oxidation, raise the high-density lipoprotein (HDL level and reduce the thrombotic tendency. Their antioxidant catechin content is four times that of tea. They help the body process nitric oxide. Their flavanols and procyanidins have inhibitory effects on hemolysis, they can also attribute as a defense against reactive oxygen species (ROS and can inhibit their carcinogenic processes. Also they are shown to inhibit growth and polyamine biosynthesis of human colonic cancer cells. They contain tryptophan and anandamide, which lessen anxiety, promote relaxation and trigger the production of endorphins. Cocoa can prevent dental caries and may play a regulating role in the function of the immune system and prevent infectious and autoimmune diseases. It stimulates lactase enzyme activity. Although caffeine may be harmful in large dose, chocolate contains it in small amount in comparison to coffee and tea. Negative effects of chocolate on childhood hyperactivity and migraine as well as tension headaches are controversial. Since the theobromine content of chocolate relaxes the esophageal sphincter, patients suffering from heartburn should avoid it. Cocoa can trigger some allergic reactions such as atopic dermatitis. This article reviews the potential health benefits and disadvantages of cocoa
Fang, Wanping; Meinhardt, Lyndel W; Mischke, Sue; Bellato, Cláudia M; Motilal, Lambert; Zhang, Dapeng
2014-01-15
Cacao (Theobroma cacao L.), the source of cocoa, is an economically important tropical crop. One problem with the premium cacao market is contamination with off-types adulterating raw premium material. Accurate determination of the genetic identity of single cacao beans is essential for ensuring cocoa authentication. Using nanofluidic single nucleotide polymorphism (SNP) genotyping with 48 SNP markers, we generated SNP fingerprints for small quantities of DNA extracted from the seed coat of single cacao beans. On the basis of the SNP profiles, we identified an assumed adulterant variety, which was unambiguously distinguished from the authentic beans by multilocus matching. Assignment tests based on both Bayesian clustering analysis and allele frequency clearly separated all 30 authentic samples from the non-authentic samples. Distance-based principle coordinate analysis further supported these results. The nanofluidic SNP protocol, together with forensic statistical tools, is sufficiently robust to establish authentication and to verify gourmet cacao varieties. This method shows significant potential for practical application.
Lares Amaiz, Mary; Pérez Sira, Elevina; Álvarez Fernández, Clímaco; Perozo González, José; El Khori, Sandra
2013-01-01
El beneficio del cacao Theobroma cacao, en Venezuela, cambia de una región a otra y está influenciado por las condiciones ambientales de la región, lo cual trae consigo variaciones en la calidad de los productos finales y poco se ha reportado en relación a esto. Es por ello, que el objetivo del presente trabajo fue caracterizar las propiedades fisicoquímicas y el perfil de ácidos grasos de los granos de cacao de la cosecha denominada “San Juanera” en la región de Chuao y en diferentes etapas ...
The effect of 2,4 dichlorophenoxyacetic acid on in vitro callogenesis of cocoa (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Sulistyani Pancaningtyas
2015-08-01
Full Text Available Cocoa (Theobroma cacao L. development using modern breeding techniques can be facilitated by propagation of planting material through somatic embryogenesis. Various factors that may affect embryogenesis are the composition of culture medium and culture condition. Hormone commonly used to initiate the formation of callus is auxin with type 2.4-D (2.4 Dichlorophenoxy acetic acid. The aim of this study was to determine the effect of the addition of 2.4 -D hormoneson the process of cocoa embryogenesis. The treatments were arragged in factorial combination in completely randomized design, which consisted of two factors. Thefirst factor was the concentration of auxin 2,4-D 25 %, 50 %, 75 %, and 100 %; and the second factor was cocoa clones; Sulawesi 01 and Sulawesi 02. The resultshowed that the addition of 2.4-D hormone up to 100% on somatic embryogenesis of cocoa for Sulawesi 01 clone was not significantly different from Sulawesi 02 clone for all parameters. While on the addition of 2.4-D, there was significant difference between Sulawesi 01 and 02. Cocoa embryogenic callus using the addition of 2.4-D (25%-100% was significantly different from control. Increased concentrations of 2,4-D hormone which is applied onto media would inhibit the formation of the somatic embryo. Addition of 2.4 D 25%, encouraged towards non-embryogenic callus. Keywords: 2.4 Dichlorophenoxy acetic acid, embryogenic callus, somatic embryos, cocoa, medium culture, hormone
El consumo de cacao en Venezuela y en el Mundo desde una perspectiva sostenible (1960-2014)
Quintero Rizzuto, Liliana; Anido R., José Daniel; Azuaje, Antonio
2017-01-01
Con origen probable en la cuenca amazónica, el consumo del Theobroma cacao L. se difundió rápidamente al resto de América, de Europa y del mundo. A partir de estadísticas oficiales y otras fuentes bibliográficas y hemerográficas, el objetivo de este artículo es caracterizar el consumo de cacao y de sus productos derivados, tanto al nivel mundial (a partir de la década de 1960) como de Venezuela (a partir de 1949), desde una perspectiva sostenible. Es una investigación documental, ...
Biotechnology for cocoa pod borer resistance in cocoa
Chaidamsari, T.
2005-01-01
The cocoa tree ( Theobroma cacao L.) produces the beans that are the source of cacao, the basis for chocolate production, and an important commodity crop in South America, West Africa, and Southeast Asia.Cocoa Pod Borer (CPB,( Conopomorpha cramerella)has been the single most important limiting factor for cacao production in Southeast Asia.So far, there has been no single cost effective and environmentally safe way to control this pest.This thesis describes the first steps in a biotechnologica...
Cacao seeds are a "Super Fruit": A comparative analysis of various fruit powders and products.
Crozier, Stephen J; Preston, Amy G; Hurst, Jeffrey W; Payne, Mark J; Mann, Julie; Hainly, Larry; Miller, Debra L
2011-02-07
Numerous popular media sources have developed lists of "Super Foods" and, more recently, "Super Fruits". Such distinctions often are based on the antioxidant capacity and content of naturally occurring compounds such as polyphenols within those whole fruits or juices of the fruit which may be linked to potential health benefits. Cocoa powder and chocolate are made from an extract of the seeds of the fruit of the Theobroma cacao tree. In this study, we compared cocoa powder and cocoa products to powders and juices derived from fruits commonly considered "Super Fruits". Various fruit powders and retail fruit products were obtained and analyzed for antioxidant capacity (ORAC (μM TE/g)), total polyphenol content (TP (mg/g)), and total flavanol content (TF (mg/g)). Among the various powders that were tested, cocoa powder was the most concentrated source of ORAC and TF. Similarly, dark chocolate was a significantly more concentrated source of ORAC and TF than the fruit juices. Cocoa powder and dark chocolate had equivalent or significantly greater ORAC, TP, and TF values compared to the other fruit powders and juices tested, respectively. Cacao seeds thus provide nutritive value beyond that derived from their macronutrient composition and appear to meet the popular media's definition of a "Super Fruit".
Cacao seeds are a "Super Fruit": A comparative analysis of various fruit powders and products
2011-01-01
Background Numerous popular media sources have developed lists of "Super Foods" and, more recently, "Super Fruits". Such distinctions often are based on the antioxidant capacity and content of naturally occurring compounds such as polyphenols within those whole fruits or juices of the fruit which may be linked to potential health benefits. Cocoa powder and chocolate are made from an extract of the seeds of the fruit of the Theobroma cacao tree. In this study, we compared cocoa powder and cocoa products to powders and juices derived from fruits commonly considered "Super Fruits". Results Various fruit powders and retail fruit products were obtained and analyzed for antioxidant capacity (ORAC (μM TE/g)), total polyphenol content (TP (mg/g)), and total flavanol content (TF (mg/g)). Among the various powders that were tested, cocoa powder was the most concentrated source of ORAC and TF. Similarly, dark chocolate was a significantly more concentrated source of ORAC and TF than the fruit juices. Conclusions Cocoa powder and dark chocolate had equivalent or significantly greater ORAC, TP, and TF values compared to the other fruit powders and juices tested, respectively. Cacao seeds thus provide nutritive value beyond that derived from their macronutrient composition and appear to meet the popular media's definition of a "Super Fruit". PMID:21299842
Cacao seeds are a "Super Fruit": A comparative analysis of various fruit powders and products
Directory of Open Access Journals (Sweden)
Mann Julie
2011-02-01
Full Text Available Abstract Background Numerous popular media sources have developed lists of "Super Foods" and, more recently, "Super Fruits". Such distinctions often are based on the antioxidant capacity and content of naturally occurring compounds such as polyphenols within those whole fruits or juices of the fruit which may be linked to potential health benefits. Cocoa powder and chocolate are made from an extract of the seeds of the fruit of the Theobroma cacao tree. In this study, we compared cocoa powder and cocoa products to powders and juices derived from fruits commonly considered "Super Fruits". Results Various fruit powders and retail fruit products were obtained and analyzed for antioxidant capacity (ORAC (μM TE/g, total polyphenol content (TP (mg/g, and total flavanol content (TF (mg/g. Among the various powders that were tested, cocoa powder was the most concentrated source of ORAC and TF. Similarly, dark chocolate was a significantly more concentrated source of ORAC and TF than the fruit juices. Conclusions Cocoa powder and dark chocolate had equivalent or significantly greater ORAC, TP, and TF values compared to the other fruit powders and juices tested, respectively. Cacao seeds thus provide nutritive value beyond that derived from their macronutrient composition and appear to meet the popular media's definition of a "Super Fruit".
The Relationship between On-Farm Shade Trees and Cocoa Yields in Ghana
DEFF Research Database (Denmark)
Asare, Richard
Cocoa (Theobroma cacao L.) is a crop that is widely cultivated across West Africa with Côte d’Ivoire, Cameroon, Ghana and Nigeria contributing about 70% of the global production. In Ghana cocoa contributes significantly to the national economy as over 20% of the world’s cocoa production comes from...... the country, making it the world’s second largest producer with an annual production level of over 700,000 metric tons, and an estimated cultivation area of ca. 1.6 million ha. Cocoa is mostly cultivated by smallholder farmers either as a monocrop or in association with other food crops, tree crops and under...... the cover of shade trees – cocoa agroforestry. This thesis hypothesizes that canopy cover of shade trees in low input (low-to-no fertilizer application) cocoa growing systems can contribute to cocoa yield improvements. The main theme deals with shade trees diversity and its effects on cocoa production...
Respon Pertumbuhan Bibit Kakao (Theobroma Cacao L.) TerhadapPemberian Pupuk Guano Dan KCl
Rajagukguk, Pispa; Siagian, Balonggu; Rosanty Lahay, Ratna
2015-01-01
Addition of guano in cultivation of cacao seedling is the one step to use organic fertilizer thatcomes from animal feces and it is used to add soil nutrient for the growth of cocoa seedlings, aswell addition of KCl is used to add soil nutrient too. For that purpose addition guano and KCl aimsto increase growth of cacao in cultivation of seedling. This research had been conducted atexperimental field of agriculture fakulty University of North Sumatera in October 2013 - January2014 using factor...
Respon pertumbuhan bibit kakao (Theobroma cacao L.) terhadap pemberian pupuk guano dan KCl
Rajagukguk, Pispa
2015-01-01
Addition of Guano in Cultivation of Cacao Seedling is the one of step to use organic fertilizer that comes from animal feces in the world. For that purpose addition guano aims to increase growth of Cacao in Cultivation of Seedling. This research had been conducted at experimental field of Fakultas Pertanian USU in October 2013 - January 2014 using factorial randomized block design with two factor, i.e. addition dose of Guano (0, 75 , 150 , 225 g/polibag) and dose of KCl (0 , ...
Cacao biotechnology: current status and future prospects.
Wickramasuriya, Anushka M; Dunwell, Jim M
2018-01-01
Theobroma cacao-The Food of the Gods, provides the raw material for the multibillion dollar chocolate industry and is also the main source of income for about 6 million smallholders around the world. Additionally, cocoa beans have a number of other nonfood uses in the pharmaceutical and cosmetic industries. Specifically, the potential health benefits of cocoa have received increasing attention as it is rich in polyphenols, particularly flavonoids. At present, the demand for cocoa and cocoa-based products in Asia is growing particularly rapidly and chocolate manufacturers are increasing investment in this region. However, in many Asian countries, cocoa production is hampered due to many reasons including technological, political and socio-economic issues. This review provides an overview of the present status of global cocoa production and recent advances in biotechnological applications for cacao improvement, with special emphasis on genetics/genomics, in vitro embryogenesis and genetic transformation. In addition, in order to obtain an insight into the latest innovations in the commercial sector, a survey was conducted on granted patents relating to T. cacao biotechnology. © 2017 The Authors. Plant Biotechnology Journal published by Society for Experimental Biology and The Association of Applied Biologists and John Wiley & Sons Ltd.
Directory of Open Access Journals (Sweden)
Guilherme Amorim Homem de Abreu Loureiro
2017-09-01
Full Text Available Los desafíos técnicos y cientícos actuales para el cultivo del cacao implican la necesidad de evaluar múltiples atributos relacionados con la producción primaria y con los criterios de calidad. El estudio se realizó con el clon de cacao PH-16 en la zona húmeda de la región cacaotera de Bahia, Brasil. El objetivo fue conocer la inuencia del sitio de cultivo sobre las variables físicas y químicas antes y después de la fermentación de los granos de cacao. Las variables químicas más inuenciadas por el medio ambiente fueron el pH y la acidez total de los granos con mucílago, y el pH, acidez total e índice de pigmentos de los granos fermentados. El sitio de cultivo que corresponde al Argisol Amarillo Distróco latosólico, en el sistema agroforestal Cabruca con densidad media de 35 árboles de sombra por hectárea, presentó los granos con mejores atributos de calidad.
NONLINEAR MODELS FOR DESCRIPTION OF CACAO FRUIT GROWTH WITH ASSUMPTION VIOLATIONS
Directory of Open Access Journals (Sweden)
JOEL AUGUSTO MUNIZ
2017-01-01
Full Text Available Cacao (Theobroma cacao L. is an important fruit in the Brazilian economy, which is mainly cultivated in the southern State of Bahia. The optimal stage for harvesting is a major factor for fruit quality and the knowledge on its growth curves can help, especially in identifying the ideal maturation stage for harvesting. Nonlinear regression models have been widely used for description of growth curves. However, several studies in this subject do not consider the residual analysis, the existence of a possible dependence between longitudinal observations, or the sample variance heterogeneity, compromising the modeling quality. The objective of this work was to compare the fit of nonlinear regression models, considering residual analysis and assumption violations, in the description of the cacao (clone Sial-105 fruit growth. The data evaluated were extracted from Brito and Silva (1983, who conducted the experiment in the Cacao Research Center, Ilheus, State of Bahia. The variables fruit length, diameter and volume as a function of fruit age were studied. The use of weighting and incorporation of residual dependencies was efficient, since the modeling became more consistent, improving the model fit. Considering the first-order autoregressive structure, when needed, leads to significant reduction in the residual standard deviation, making the estimates more reliable. The Logistic model was the most efficient for the description of the cacao fruit growth.
Cacao diseases: a global perspective from an industry point of view.
Hebbar, Prakash K
2007-12-01
ABSTRACT Diseases of cacao, Theobroma cacao, account for losses of more than 30% of the potential crop. These losses have caused a steady decline in production and a reduction in bean quality in almost all the cacao-producing areas in the world, especially in small-holder farms in Latin America and West Africa. The most significant diseases are witches' broom, caused by Moniliophthora perniciosa, which occurs mainly in South America; frosty pod rot, caused by M. roreri, which occurs mainly in Central and northern South America; and black pod disease, caused by several species of Phytophthora, which are distributed throughout the tropics. In view of the threat that these diseases pose to the sustainability of the cacao crop, Mars Inc. and their industry partners have funded collaborative research involving cacao research institutes and governmental and nongovernmental agencies. The objective of this global initiative is to develop short- to medium-term, low-cost, environmentally friendly disease-management strategies until disease tolerant varieties are widely available. These include good farming practices, biological control and the rational or minimal use of chemicals that could be used for integrated pest management (IPM). Farmer field schools are used to get these technologies to growers. This paper describes some of the key collaborative partners and projects that are underway in South America and West Africa.
Clément, D; Lanaud, C; Sabau, X; Fouet, O; Le Cunff, L; Ruiz, E; Risterucci, A M; Glaszmann, J C; Piffanelli, P
2004-05-01
We have constructed and validated the first cocoa ( Theobroma cacao L.) BAC library, with the aim of developing molecular resources to study the structure and evolution of the genome of this perennial crop. This library contains 36,864 clones with an average insert size of 120 kb, representing approximately ten haploid genome equivalents. It was constructed from the genotype Scavina-6 (Sca-6), a Forastero clone highly resistant to cocoa pathogens and a parent of existing mapping populations. Validation of the BAC library was carried out with a set of 13 genetically-anchored single copy and one duplicated markers. An average of nine BAC clones per probe was identified, giving an initial experimental estimation of the genome coverage represented in the library. Screening of the library with a set of resistance gene analogues (RGAs), previously mapped in cocoa and co-localizing with QTL for resistance to Phytophthora traits, confirmed at the physical level the tight clustering of RGAs in the cocoa genome and provided the first insights into the relationships between genetic and physical distances in the cocoa genome. This library represents an available BAC resource for structural genomic studies or map-based cloning of genes corresponding to important QTLs for agronomic traits such as resistance genes to major cocoa pathogens like Phytophthora spp ( palmivora and megakarya), Crinipellis perniciosa and Moniliophthora roreri.
Trognitz, Bodo; Cros, Emile; Assemat, Sophie; Davrieux, Fabrice; Forestier-Chiron, Nelly; Ayestas, Eusebio; Kuant, Aldo; Scheldeman, Xavier; Hermann, Michael
2013-01-01
The sensory quality and the contents of quality-determining chemical compounds in unfermented and fermented cocoa from 100 cacao trees (individual genotypes) representing groups of nine genotype spectra (GG), grown at smallholder plantings in the municipality of Waslala, Nicaragua, were evaluated for two successive harvest periods. Cocoa samples were fermented using a technique mimicking recommended on-farm practices. The sensory cocoa quality was assessed by experienced tasters, and seven major chemical taste compounds were quantified by near infrared spectrometry (NIRS). The association of the nine, partially admixed, genotype spectra with the analytical and sensory quality parameters was tested. The individual parameters were analyzed as a function of the factors GG and harvest (including the date of fermentation), individual trees within a single GG were used as replications. In fermented cocoa, significant GG-specific differences were observed for methylxanthines, theobromine-to-caffeine (T/C) ratio, total fat, procyanidin B5 and epicatechin, as well as the sensory attributes global score, astringency, and dry fruit aroma, but differences related to harvest were also apparent. The potential cocoa yield was also highly determined by the individual GG, although there was significant tree-to-tree variation within every single GG. Non-fermented samples showed large harvest-to-harvest variation of their chemical composition, while differences between GG were insignificant. These results suggest that selection by the genetic background, represented here by groups of partially admixed genotype spectra, would be a useful strategy toward enhancing quality and yield of cocoa in Nicaragua. Selection by the GG within the local, genetically segregating populations of seed-propagated cacao, followed by clonal propagation of best-performing individuals of the selected GG could be a viable alternative to traditional propagation of cacao by seed from open pollination. Fast and
Directory of Open Access Journals (Sweden)
Bodo Trognitz
Full Text Available The sensory quality and the contents of quality-determining chemical compounds in unfermented and fermented cocoa from 100 cacao trees (individual genotypes representing groups of nine genotype spectra (GG, grown at smallholder plantings in the municipality of Waslala, Nicaragua, were evaluated for two successive harvest periods. Cocoa samples were fermented using a technique mimicking recommended on-farm practices. The sensory cocoa quality was assessed by experienced tasters, and seven major chemical taste compounds were quantified by near infrared spectrometry (NIRS. The association of the nine, partially admixed, genotype spectra with the analytical and sensory quality parameters was tested. The individual parameters were analyzed as a function of the factors GG and harvest (including the date of fermentation, individual trees within a single GG were used as replications. In fermented cocoa, significant GG-specific differences were observed for methylxanthines, theobromine-to-caffeine (T/C ratio, total fat, procyanidin B5 and epicatechin, as well as the sensory attributes global score, astringency, and dry fruit aroma, but differences related to harvest were also apparent. The potential cocoa yield was also highly determined by the individual GG, although there was significant tree-to-tree variation within every single GG. Non-fermented samples showed large harvest-to-harvest variation of their chemical composition, while differences between GG were insignificant. These results suggest that selection by the genetic background, represented here by groups of partially admixed genotype spectra, would be a useful strategy toward enhancing quality and yield of cocoa in Nicaragua. Selection by the GG within the local, genetically segregating populations of seed-propagated cacao, followed by clonal propagation of best-performing individuals of the selected GG could be a viable alternative to traditional propagation of cacao by seed from open
Trognitz, Bodo; Cros, Emile; Assemat, Sophie; Davrieux, Fabrice; Forestier-Chiron, Nelly; Ayestas, Eusebio; Kuant, Aldo; Scheldeman, Xavier; Hermann, Michael
2013-01-01
The sensory quality and the contents of quality-determining chemical compounds in unfermented and fermented cocoa from 100 cacao trees (individual genotypes) representing groups of nine genotype spectra (GG), grown at smallholder plantings in the municipality of Waslala, Nicaragua, were evaluated for two successive harvest periods. Cocoa samples were fermented using a technique mimicking recommended on-farm practices. The sensory cocoa quality was assessed by experienced tasters, and seven major chemical taste compounds were quantified by near infrared spectrometry (NIRS). The association of the nine, partially admixed, genotype spectra with the analytical and sensory quality parameters was tested. The individual parameters were analyzed as a function of the factors GG and harvest (including the date of fermentation), individual trees within a single GG were used as replications. In fermented cocoa, significant GG-specific differences were observed for methylxanthines, theobromine-to-caffeine (T/C) ratio, total fat, procyanidin B5 and epicatechin, as well as the sensory attributes global score, astringency, and dry fruit aroma, but differences related to harvest were also apparent. The potential cocoa yield was also highly determined by the individual GG, although there was significant tree-to-tree variation within every single GG. Non-fermented samples showed large harvest-to-harvest variation of their chemical composition, while differences between GG were insignificant. These results suggest that selection by the genetic background, represented here by groups of partially admixed genotype spectra, would be a useful strategy toward enhancing quality and yield of cocoa in Nicaragua. Selection by the GG within the local, genetically segregating populations of seed-propagated cacao, followed by clonal propagation of best-performing individuals of the selected GG could be a viable alternative to traditional propagation of cacao by seed from open pollination. Fast and
Immunomodulatory properties of cacao extracts – potential consequences for medical applications
Becker, Kathrin; Geisler, Simon; Ueberall, Florian; Fuchs, Dietmar; Gostner, Johanna M.
2013-01-01
Anti-inflammatory properties of cacao, fruits of Theobroma cacao L. (Sterculiaceae), are well documented, and therapeutic applications are described for gastrointestinal, nervous, and cardiovascular abnormalities. Most, if not all of these disease conditions involve inflammation or immune activation processes. The pro-inflammatory cytokine interferon-γ (IFN-γ) and related biochemical pathways like tryptophan breakdown by indoleamine 2,3-dioxygenase (IDO) and neopterin formation are deeply involved in their pathogenesis. Neopterin concentrations and the kynurenine to tryptophan ratio (Kyn/Trp, an estimate of IDO activity) are elevated in a significant proportion of patients with virus infections, cancer, autoimmune syndrome, neurodegeneration, and coronary artery disease. Moreover, higher neopterin and Kyn/Trp concentrations are indicative for poor prognosis. When investigating the effect of aqueous or ethanolic extracts of cacao on IFN-γ, neopterin and Kyn/Trp concentrations in mitogen-stimulated human peripheral blood mononuclear cells, breakdown of tryptophan by IDO, and formation of neopterin and IFN-γ were dose-dependently suppressed. The effects observed in the cell-based assays are associated with the antioxidant activity of the cacao extracts as determined by the cell-free oxygen radical absorption capacity assay. The influence of cacao extracts on IDO activity could be of particular relevance for some of the beneficial health effects ascribed to cacao: tryptophan breakdown by IDO is strongly involved in immunoregulation, and the diminished availability of tryptophan limits the biosynthesis of neurotransmitter serotonin. The inhibition of tryptophan breakdown by cacao constituents could thus be relevant not only for immune system restoration in patients, but also contribute to mood elevation and thereby improve quality of life. However, the available data thus far are merely in vitro only and future studies need to investigate the influence of cacao on
Wang, Lei; Nägele, Thomas; Doerfler, Hannes; Fragner, Lena; Chaturvedi, Palak; Nukarinen, Ella; Bellaire, Anke; Huber, Werner; Weiszmann, Jakob; Engelmeier, Doris; Ramsak, Ziva; Gruden, Kristina; Weckwerth, Wolfram
2016-08-01
Theobroma cacao and its popular product, chocolate, are attracting attention due to potential health benefits including antioxidative effects by polyphenols, anti-depressant effects by high serotonin levels, inhibition of platelet aggregation and prevention of obesity-dependent insulin resistance. The development of cacao seeds during fruit ripening is the most crucial process for the accumulation of these compounds. In this study, we analyzed the primary and the secondary metabolome as well as the proteome during Theobroma cacao cv. Forastero seed development by applying an integrative extraction protocol. The combination of multivariate statistics and mathematical modelling revealed a complex consecutive coordination of primary and secondary metabolism and corresponding pathways. Tricarboxylic acid (TCA) cycle and aromatic amino acid metabolism dominated during the early developmental stages (stages 1 and 2; cell division and expansion phase). This was accompanied with a significant shift of proteins from phenylpropanoid metabolism to flavonoid biosynthesis. At stage 3 (reserve accumulation phase), metabolism of sucrose switched from hydrolysis into raffinose synthesis. Lipids as well as proteins involved in lipid metabolism increased whereas amino acids and N-phenylpropenoyl amino acids decreased. Purine alkaloids, polyphenols, and raffinose as well as proteins involved in abiotic and biotic stress accumulated at stage 4 (maturation phase) endowing cacao seeds the characteristic astringent taste and resistance to stress. In summary, metabolic key points of cacao seed development comprise the sequential coordination of primary metabolites, phenylpropanoid, N-phenylpropenoyl amino acid, serotonin, lipid and polyphenol metabolism thereby covering the major compound classes involved in cacao aroma and health benefits. © 2016 The Authors The Plant Journal © 2016 John Wiley & Sons Ltd.
Pod Characteristics of cocoa (Theobroma cacao L. related to rocoa pod borer resistance.
Directory of Open Access Journals (Sweden)
Agung Wahyu Susilo
2015-04-01
Full Text Available The characteristics of cocoa (Theobroma cacao L. pod related to cocoa pod borer resistance (CPB had been identified in a series of study. The objective of this research is to evaluate the characteristics of cocoa pod using more diverse of genetic background to obtain selection criteria. Genetic materials for this studywere 25 cocoa clones planted in Central Sulawesi for resistance evaluation. Field evaluation of the resistance were assessed by using variable of the percentage of unextractable beans, number of larvae entry and exit holes by which the clones were grouped into 5 groups of resistance. A laboratory works were carried out to assess pod characteristics based on the number of trichomes, granules of tannin and thickness the lignified-tissue of sclerotic layer using micro-technique method at the different level of pod maturity (3.0; 3.5; 4.0 months. Correlation between groups of those variables was analyzed using canonical correlation. The result performed a positive association between the thickness of sclerotic layer at the secondary furrow with the number of entry holes and the number of entry holes through sclerotic layer. The thickness performed a higher value of the coefficient in association with the variables of canonical for pod characteristics 0.59; 0.55; 0.43 and the variables of canonical correlation for CPB resistance 0.54; 0.51; 0.39 that would presenting the characteristics of pod related to CPB resistance in 3.0, 3.5 and 4.0 months of pod maturity. Lignification at sclerotic layer was considered as genotypic expressions due to the thickness at the secondary furrow at 3.0, 3.5 and 4.0 months of pod maturity performed high value of broad-sense heritability i.e. 0.75, 0.89 and 0.92 respectively. A qualitative assessment of the lignification clearly differentiated the resistant clones of ARDACIAR 10 with the susceptible clones of ICCRI 04, KW 516, and KW 564.
Directory of Open Access Journals (Sweden)
Blackmon Barbara P
2011-07-01
Full Text Available Abstract Background BAC-based physical maps provide for sequencing across an entire genome or a selected sub-genomic region of biological interest. Such a region can be approached with next-generation whole-genome sequencing and assembly as if it were an independent small genome. Using the minimum tiling path as a guide, specific BAC clones representing the prioritized genomic interval are selected, pooled, and used to prepare a sequencing library. Results This pooled BAC approach was taken to sequence and assemble a QTL-rich region, of ~3 Mbp and represented by twenty-seven BACs, on linkage group 5 of the Theobroma cacao cv. Matina 1-6 genome. Using various mixtures of read coverages from paired-end and linear 454 libraries, multiple assemblies of varied quality were generated. Quality was assessed by comparing the assembly of 454 reads with a subset of ten BACs individually sequenced and assembled using Sanger reads. A mixture of reads optimal for assembly was identified. We found, furthermore, that a quality assembly suitable for serving as a reference genome template could be obtained even with a reduced depth of sequencing coverage. Annotation of the resulting assembly revealed several genes potentially responsible for three T. cacao traits: black pod disease resistance, bean shape index, and pod weight. Conclusions Our results, as with other pooled BAC sequencing reports, suggest that pooling portions of a minimum tiling path derived from a BAC-based physical map is an effective method to target sub-genomic regions for sequencing. While we focused on a single QTL region, other QTL regions of importance could be similarly sequenced allowing for biological discovery to take place before a high quality whole-genome assembly is completed.
Agroforestry systems of timber species and cacao: survival and growth during the early stages
Directory of Open Access Journals (Sweden)
Wilmer Espinoza
2013-08-01
Full Text Available In recent times, increased emphasis has been placed on diversifying the types of trees to shade cacao (Theobromacacao L. and to achieve additional services. Agroforestry systems that include profitable and native timber trees are a viable alternative but it is necessary to understand the growth characteristics of these species under different environmental conditions. Thus, timber tree species selection should be based on plant responses to biotic and abiotic factors. The aims of this study were (1 to evaluate growth rates and leaf area indices of the four commercial timber species: Cordia thaisiana, Cedrela odorata, Swietenia macrophylla and Tabebuia rosea in conjunction with incidence of insect attacks and (2 to compare growth rates of four Venezuelan Criollo cacao cultivars planted under the shade of these four timber species during the first 36 months after establishment. Parameters monitored in timber trees were: survival rates, growth rates expressed as height and diameter at breast height and leaf area index. In the four Cacao cultivars: height and basal diameter. C. thaisiana and C. odorata had the fastest growth and the highest survival rates. Growth rates of timber trees will depend on their susceptibility to insect attacks as well as to total leaf area. All cacao cultivars showed higher growth rates under the shade of C. odorata. Growth rates of timber trees and cacao cultivars suggest that combinations of cacao and timber trees are a feasible agroforestry strategy in Venezuela.
Directory of Open Access Journals (Sweden)
Damayanti Buchori
2013-01-01
Full Text Available Land-use degradation and climate change are well-known drivers of biodiversity loss, but little information is available about their potential interaction. Here, we focus on the effects of land-use and precipitation on ant diversity in cacao agroforestry. In Central Sulawesi, Indonesia, we selected 16 cacao agroforestry plots with a shaded vs. unshaded plot in each of eight villages differing in precipitation (1032–2051 mm annual rainfall. On each plot, 10 cacao trees with similar size and age (7–10 years were selected for hand collection of ants on each cacao tree and the soil surface. In total, we found 80 ant species belonging to five subfamilies. Land-use intensification (removal of shade trees and precipitation had no effect on species richness of ants per cacao tree (alpha diversity and, in an additive partitioning approach, within-plot beta diversity. However, higher precipitation (but not shade significantly increased ant species dissimilarity across cacao trees within a plot, with ant species showing contrasting responses to precipitation. Reduced precipitation causing drought stress appeared to contribute to convergence of ant community structure, presumably via reduced heterogeneity in cacao tree growth. In conclusion, reduced precipitation greatly influenced ant community dissimilarity and appeared to be more important for ant community structure than land-use intensification.
Crecimiento de plántulas de cacao (Theobroma cacao L. en diferentes tamaños de contenedor
Directory of Open Access Journals (Sweden)
Mónica Andrea Osorio G.
2017-12-01
Full Text Available El volumen del contenedor para la propagación del cacao es determinante, ya que su tamaño influye en el crecimiento y desarrollo de las plántulas, siendo un factor definitivo para el establecimiento del cultivo. En este trabajo se comparó el efecto que tienen diferentes tamaños de contenedor 0,01; 0,02 y 0,1m3 (volumen de sustrato y la duración en vivero, sobre el crecimiento de plantas de cacao, además, se evaluaron los cambios en el sustrato confinado. Se sembraron semillas de cacao en contenedores de diferentes alturas: 25, 45 y 70cm. Se midió la temperatura de las hojas y se colectaron plántulas, para cuantificar la biomasa particionada y crecimiento de la raíz principal. Simultáneamente fueron evaluadas la resistencia a la penetración, la temperatura, la humedad y la porosidad del sustrato. Los resultados evidenciaron diferencias significativas (P<0,05 en la acumulación de fitomasa total. En los contenedores de mayor tamaño (0,1m3 hubo mayor biomasa total, mayor longitud de raíces: 62,17cm, el sustrato presentó menor resistencia a la penetración (0,52Kg cm-2 y temperatura. La temperatura de las hojas se relacionó directamente con la temperatura del suelo e inversamente con la humedad del suelo. Se comprobó que el tamaño del contenedor afecta las características físicas del sustrato y el crecimiento de las plantas, lo cual sugiere que con 0,02m2 (con 45cm altura del contenedor las plantas pueden permanecer 180 días en vivero.
Cocoa is (Theobroma cacao L.) is a significant agricultural commodity in Côted’Ivoire which ranks 1st in the world cocoa export. Phytophthora pod rot (Ppr)also call Black pod is the most widespread disease of cocoa. Lost due to this disease depends on the species of the pathogen and vary globally fr...
Langkong, Jumriah
2013-01-01
Lindak cacao beans has polyphenol compounds that has a function as antioxidants which is important for the body to ward off a disease like cancer. The content of polyphenols in cocoa pods, influenced by post-harvest and processing. In addition, also influenced by fruit maturity level of lindak cocoa maturity level A (colored yellow on the entire surface of the fruit), B (yellow on the groove and back fruits), and C (colored yellow on the flow of fruit). The purpose of this study was to ana...
Litholdo, Celso G; Leal, Gildemberg A; Albuquerque, Paulo S B; Figueira, Antonio
2015-10-01
The resistance mechanism of cacao against M. perniciosa is likely to be mediated by JA/ET-signaling pathways due to the preferential TcAOS and TcSAM induction in a resistant genotype. The basidiomycete Moniliophthora perniciosa causes a serious disease in cacao (Theobroma cacao L.), and the use of resistant varieties is the only sustainable long-term solution. Cacao resistance against M. perniciosa is characterized by pathogen growth inhibition with reduced colonization and an attenuation of disease symptoms, suggesting a regulation by jasmonate (JA)/ethylene (ET) signaling pathways. The hypothesis that genes involved in JA biosynthesis would be active in the interaction of T. cacao and M. perniciosa was tested here. The cacao JA-related genes were evaluated for their relative quantitative expression in susceptible and resistant genotypes upon the exogenous application of ET, methyl-jasmonate (MJ), and salicylic acid (SA), or after M. perniciosa inoculation. MJ treatment triggered changes in the expression of genes involved in JA biosynthesis, indicating that the mechanism of positive regulation by exogenous MJ application occurs in cacao. However, a higher induction of these genes was observed in the susceptible genotype. Further, a contrast in JA-related transcriptional expression was detected between susceptible and resistant plants under M. perniciosa infection, with the induction of the allene oxide synthase gene (TcAOS), which encodes a key enzyme in the JA biosynthesis pathway in the resistant genotype. Altogether, this work provides additional evidences that the JA-dependent signaling pathway is modulating the defense response against M. perniciosa in a cacao-resistant genotype.
Antimicrobial properties of two novel peptides derived from Theobroma cacao osmotin.
Falcao, Loeni L; Silva-Werneck, Joseilde O; Ramos, Alessandra de R; Martins, Natalia F; Bresso, Emmanuel; Rodrigues, Magali A; Bemquerer, Marcelo P; Marcellino, Lucilia H
2016-05-01
The osmotin proteins of several plants display antifungal activity, which can play an important role in plant defense against diseases. Thus, this protein can be useful as a source for biotechnological strategies aiming to combat fungal diseases. In this work, we analyzed the antifungal activity of a cacao osmotin-like protein (TcOsm1) and of two osmotin-derived synthetic peptides with antimicrobial features, differing by five amino acids residues at the N-terminus. Antimicrobial tests showed that TcOsm1 expressed in Escherichia coli inhibits the growth of Moniliophthora perniciosa mycelium and Pichia pastoris X-33 in vitro. The TcOsm1-derived peptides, named Osm-pepA (H-RRLDRGGVWNLNVNPGTTGARVWARTK-NH2), located at R23-K49, and Osm-pepB (H-GGVWNLNVNPGTTGARVWARTK-NH2), located at G28-K49, inhibited growth of yeasts (Saccharomyces cerevisiae S288C and Pichia pastoris X-33) and spore germination of the phytopathogenic fungi Fusarium f. sp. glycines and Colletotrichum gossypi. Osm-pepA was more efficient than Osm-pepB for S. cerevisiae (MIC=40μM and MIC=127μM, respectively), as well as for P. pastoris (MIC=20μM and MIC=127μM, respectively). Furthermore, the peptides presented a biphasic performance, promoting S. cerevisiae growth in doses around 5μM and inhibiting it at higher doses. The structural model for these peptides showed that the five amino acids residues, RRLDR at Osm-pepA N-terminus, significantly affect the tertiary structure, indicating that this structure is important for the peptide antimicrobial potency. This is the first report of development of antimicrobial peptides from T. cacao. Taken together, the results indicate that the cacao osmotin and its derived peptides, herein studied, are good candidates for developing biotechnological tools aiming to control phytopathogenic fungi. Copyright © 2016 Elsevier Inc. All rights reserved.
León-Roque, Noemí; Abderrahim, Mohamed; Nuñez-Alejos, Luis; Arribas, Silvia M; Condezo-Hoyos, Luis
2016-12-01
Several procedures are currently used to assess fermentation index (FI) of cocoa beans (Theobroma cacao L.) for quality control. However, all of them present several drawbacks. The aim of the present work was to develop and validate a simple image based quantitative procedure, using color measurement and artificial neural network (ANNs). ANN models based on color measurements were tested to predict fermentation index (FI) of fermented cocoa beans. The RGB values were measured from surface and center region of fermented beans in images obtained by camera and desktop scanner. The FI was defined as the ratio of total free amino acids in fermented versus non-fermented samples. The ANN model that included RGB color measurement of fermented cocoa surface and R/G ratio in cocoa bean of alkaline extracts was able to predict FI with no statistical difference compared with the experimental values. Performance of the ANN model was evaluated by the coefficient of determination, Bland-Altman plot and Passing-Bablok regression analyses. Moreover, in fermented beans, total sugar content and titratable acidity showed a similar pattern to the total free amino acid predicted through the color based ANN model. The results of the present work demonstrate that the proposed ANN model can be adopted as a low-cost and in situ procedure to predict FI in fermented cocoa beans through apps developed for mobile device. Copyright © 2016 Elsevier B.V. All rights reserved.
Cacao in México: Restrictive factors and productivity levels
Directory of Open Access Journals (Sweden)
Julio Díaz-José
2014-12-01
Full Text Available Cacao (Theobroma cacao L. represents one of the most important agricultural crops of the humid Mexican tropics. In the last 10 yr, approximately 23.000 t of this grain were no longer produced per cycle. The objective of this study was to identify characteristics and factors that restrict production in the states of Tabasco and Chiapas. A survey was applied to obtain information about 184 producers and their plantations by two-stage sampling. Descriptive statistics were calculated and multilevel models were adjusted to analyze the information. Results show that there are differences (P < 0.05 in cacao yield between municipalities (380 kg ha-1 + u,o j is the estimated residual for each municipality. Crop productivity levels are higher in the state of Tabasco than in Chiapas (644 and 344 kg ha-1, respectively. Incidence of frosty pod rot of cacoa, also known as moniliasis, induced by Moniliophthora roreri [(Cif H.C. Evans, Stalpers, Samson & Benny 1978] is significantly greater (P < 0.05 in the state of Chiapas (60% than in Tabasco (48%.Producers who carry out more crop management practices increase yields and decrease the pathogen's impact on their plantations. Results suggest the need to apply differentiated public policies to promote production within each region or municipality.
Ali, Shahin S.; Shao, Jonathan; Strem, Mary D.; Phillips-Mora, Wilberth; Zhang, Dapeng; Meinhardt, Lyndel W.; Bailey, Bryan A.
2015-01-01
Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population may allow the population to adapt to changing environmental conditions and adapt to enhanced resistance in the host plant. The present study developed single nucleotide polymorphism (SNP) markers fro...
International Nuclear Information System (INIS)
Sumbu, K.; Mars, J.A.; Gihwala, D.
2013-01-01
Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)
Energy Technology Data Exchange (ETDEWEB)
Sumbu, K. [Department of Chemistry, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa); Mars, J.A.; Gihwala, D. [Department of Biomedical Sciences, Cape Peninsula University of Technology, PO Box 1906, Bellville, 7535 (South Africa)
2013-07-01
Full text: The industrial sector is one of the most dynamic sectors of the economy and is of cardinal importance in economic development and poverty alleviation. Furthermore, economies with low levels of industrialisation are gradually shifting dependence from agriculture to the industrial sector, while developed economies, with a high level of industrialisation, are shifting from the industrial to the service sector [1]. Amongst the various industrial sectors, a substantial portion of effluents containing heavy metals are generated by electroplating (nickel, lead, zinc and copper), tanneries (chrome) and other chemical industries. Many engineering processes have been designed to remove the heavy metals from the polluted parts of the ecosystem. These processes are however highly capital intensive. To establish a less costly means of removal of heavy metal pollution, the dried skins of cocoa (Theobroma cacao) and sweet potato (Ipomoea batatas) were pulverized and used in the absorption of the heavy metals Ni and Pb. After adsorption by the metals, the powders were dried and then pressed into tablets. For quantification of the elemental adsorption, PIXE, using the Geo PIXE computational software, is a versatile multi-element analytical technique, and has minimum detection limits down to concentration ranges as low as 0.1 parts per million [2,3]. To determine the composition of the major elements such as C, O and N, Backscattering Spectrometry, using SimNRA software, [4] was used. In this study we report on the economic viability of using the skins of cocoa and sweet potato in the removal of Ni and Pd from polluted waters. (author)
Directory of Open Access Journals (Sweden)
Norman Javier Saballos
2018-02-01
Full Text Available Se identificó los factores relacionados a la competitividad de las organizaciones de productores que comercializaron cacao durante el 2014, en la región sureste de Nicaragua. Para identificar los factores relacionados a la competitividad, se estudiaron a través de la “Cadena de Valor” cada una de las actividades primarias y de apoyo, así los indicadores de la competitividad; la productividad, calidad del producto, costos, cuota de mercado, permanencia en el mercado y la rentabilidad. El estudio se realizó mediante encuestas a representantes de siete organizaciones.
Trichoderma species from the cacao agroecosystem with biocontrol potential of Moniliophthora roreri
Directory of Open Access Journals (Sweden)
Omar Reyes-Figueroa
2016-01-01
Full Text Available La moniliasis del cacao ( Moniliophthora roreri es la principal limitante parasítica de la producción de cacao ( Theobroma cacao en México. Una alternativa sostenible para el control de la enfermedad es el uso del hongo Trichoderma . El objetivo del presente estudio fue seleccionar aislamientos nativos de Trichoderma con las mejores características antagónicas y fisiológicas in vitro, para el control de M. roreri . Para ello, se caracterizaron 50 aislamientos de Trichoderma , obtenidos del agroecosistema cacao. El crecimiento micelial y la producción de conidios a 25, 30 y 35 °C se consideraron variables fisiológicas. El micoparasitismo, antibiosis y antagonismo potencial fueron las variables antagónicas. Se encontraron diferencias significativas ( P = 0.0001 en todas las variables evaluadas . El intervalo de temperatura óptima para el crecimiento micelial y producción de conidios fue de 25 a 30 °C. El micoparasitismo varió de 0 a 100 % y solo los aislamientos de seis especies mostraron esta característica. La antibiosis osciló entre 6.8 y 55.5 %, y el antagonismo potencial varió de 3.4 a 69 %. Trichoderma virens (TTC017 y T. harzianum (TTC090, TTC039, TTC073 mostraron el mejor biocontrol potencial in vitro , por lo que son cepas prometedoras para futuras investigaciones sobre control biológico de la moniliasis del cacao.
Verification of genetic identity of introduced cacao germplasm in ...
African Journals Online (AJOL)
In the present study, high-throughput genotyping with SNP markers was used to fingerprint 160 cacao trees in the germplasm collection at the Cocoa Research Institute of Ghana (CRIG). ... Keywords: Cacao, conservation, chocolate, DNA fingerprint, molecular marker, tropical plant, off-type, true-to-type, West Africa.
Directory of Open Access Journals (Sweden)
Juan Manuel Cevallos-Cevallos
2018-01-01
Full Text Available Chocolate is one of the most consumed foods worldwide and cacao fermentation contributes to the unique sensory characteristics of chocolate products. However, comparative changes in volatiles occurring during fermentation of Criollo, Forastero, and Nacional cacao—three of the most representative cultivars worldwide—have not been reported. Beans of each cultivar were fermented for five days and samples were taken every 24 hours. Volatiles from each sample were adsorbed into a solid phase microextraction fiber and analyzed by gas chromatography-mass spectrometry. Aroma potential of each compound was determined using available databases. Multivariate data analyses showed partial clustering of samples according to cultivars at the start of the fermentation but complete clustering was observed at the end of the fermentation. The Criollo cacao produced floral, fruity, and woody aroma volatiles including linalool, epoxylinalool, benzeneethanol, pentanol acetate, germacrene, α-copaene, aromadendrene, 3,6-heptanedione, butanal, 1-phenyl ethenone, 2-nonanone, and 2-pentanone. Nacional cacao produced fruity, green, and woody aroma volatiles including 2-nonanone, 3-octen-1-ol, 2-octanol acetate, 2-undecanone, valencene, and aromadendrene. The Forastero cacao yielded floral and sweet aroma volatiles such as epoxylinalool, pentanoic acid, benzeneacetaldehyde, and benzaldehyde. This is the first report of volatiles produced during fermentation of Criollo, Forastero, and Nacional cacao from the same origin.
Ramírez González, Martha Beatriz; Cely Niño, Víctor Hugo; Ramírez, Sandra Isabel
2013-01-01
Objetivo: determinar la capacidad antioxidante y contenido de grasa de clones de cacao, provenientes de especies nativas del Estado de Chiapas, México. Materiales y métodos: en extractos de 34 muestras semillas de cacao diluidas en metanol al 95% y clasificadas según pH en tres grupos: I (5,52-5,90), II (5,91- 6,28) y III (6,29-6,67), se realizaron ensayos analíticos de variables físicas y químicas. Se evaluó la inhibición de radicales 2,2-difenil-2-picrilhidrazil (DPPH) a 517 nm, el contenid...
Dos Santos, Emerson Alves; Almeida, Alex-Alan Furtado de; Ahnert, Dario; Branco, Marcia Christina da Silva; Valle, Raúl René; Baligar, Virupax C
2016-01-01
This study aimed to estimate the combining ability, of T. cacao genotypes preselected for drought tolerance through diallel crosses. The experiment was conducted under greenhouse conditions at the Cacao Research Center (CEPEC), Ilhéus, Bahia, Brazil, in a completely randomized block design, in an experimental arrangement 21 x 2 [21 complete diallel crosses and two water regimes (control and stressed)]. In the control, soil moisture was kept close to field capacity, with predawn leaf water potential (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought regime, the soil moisture was reduced gradually by decreasing the amount of water application until ΨWL reached -2.0 to -2.5 MPa. Significant differences (p cacao crosses, except for SCA-6 x IMC-67, Catongo x SCA, MOC-01 x Catongo, Catongo x IMC-67 and RB-40 x Catongo. Multivariate analysis showed that stem diameter (CD), total leaf area (TLA), leaf dry biomass (LDB), stem dry biomass (SDB), root dry biomass (RDB), total dry biomass (TDB), root length (RL), root volume (RV), root diameter (RD) cacao genotypes in to tolerant and intolerant to soil water deficit.
Moniliophthora roreri (Cif y Par Evans et al. en el cultivo de cacao
Directory of Open Access Journals (Sweden)
Fernando David Sánchez Mora
2012-01-01
Full Text Available Más de un siglo, el cacao (Theobroma cacaoL. en el Ecuador ha sido fuente importante de ingresos para losagricultoresy de divisas para el país, llegando a ser uno de los exportadores más grandes a nivel mundial.Posteriormente, perdió paulatinamente ese estatus debido al ataque de enfermedades, entre ellas la moniliasiscausada por [Moniliophthoraroreri(Cif y ParEvanset al.]. Esta enfermedad puede causar daños hasta del80% en la producción. Actualmente no existe mucha información actualizada y científica, sobre su ocurrencia,sintomatología, etiología, epidemiología, ciclo de vida y manejo o estrategias de controlde la mencionadaenfermedad, por la tanto se realiza esta revisión con estos tópicos importantes, aportando con esto a esta áreadel conocimiento.
Directory of Open Access Journals (Sweden)
Anthony Ifechukwude ODIWE
2012-02-01
Full Text Available The forest lands conversion into tree crops plantations plays a major role in the loss of biodiversity. Therefore, understanding the impacts of land-use change on species diversity is very critical for ecosystem functioning and stability. This study was carried out to evaluate the effect of land-use changes on under storey species diversity in the Theobroma cacao and Citrus sinensis plantations. Two, 25 m 25 m plots were sampled in each plantation and a nearby undisturbed secondary rainforest for comparison. The diameters (dbh-1.3 m of all trees at breast height >10 cm were measured in each plot. Five line transect were systematically laid and a quadrat of 50 cm 50 cm placed at every 1 m point to identify the under storey species (herbaceous, shrubs, tree saplings and climbers present in each plot. Percentage canopy, species diversity using Shannon-Wiener, Simpsons index and Evenness were determined, while species similarity was determined using the Jaccards similarity index. Results indicate that woody basal area and stem density in Theobroma cacao were significantly (P
Bastos, Valdeci S; Santos, Maria Fs; Gomes, Laidson P; Leite, Analy Mo; Flosi Paschoalin, Vânia M; Del Aguila, Eduardo M
2018-03-25
Cocoa bean fermentation is a spontaneous process involving a succession of microbial activities, yeasts, lactic acid, and acetic acid bacteria. The spontaneous fermentation of cocoa beans by Theobroma cacao TSH565 clonal variety, a highly productive hybrid resistant to Moniliophthora perniciosa and Phytophthora spp., was investigated. The natural cocobiota involved in the spontaneous fermentation of this hybrid in southern Brazil, was investigated by using both a culture-dependent microbiological analysis and a molecular analysis. The changes in the physicochemical characteristics and the kinetics of substrate utilization and metabolite production during fermentation were also evaluated. Yeasts (178) and bacteria (244) isolated during fermentation were identified by partial sequencing of the ITS and 16S rDNAs, respectively. After 144 h of fermentation, the indigenous yeast community was composed of Hanseniaspora spp., Saccharomyces spp., and Pichia spp. The bacterial population comprised Lactococcus spp., Staphylococcus spp., Acetobacter spp. and Lactobacilli strains. The kinetics of substrate transformation reflected the dynamic composition of the cocobiota. Substrates such as glucose, fructose, sucrose, and citric acid, present at the beginning of fermentation, were metabolized to produce ethanol, acetic acid, and lactic acid. The results described here provide new insights into microbial diversity in cocoa bean-pulp mass fermentation and the kinetics of metabolites synthesis, and pave the way for the selection of starter cultures to increase efficiency and consistency to obtain homogeneous and best quality cocoa products. © 2018 Society of Chemical Industry. © 2018 Society of Chemical Industry.
Directory of Open Access Journals (Sweden)
Adriana Zulay Argüello Navarro
2016-07-01
Full Text Available The objective of this research was to quantify diazotrophic bacteria and compare physicochemically rhizospheric soils of three cocoa plantations (Theobroma cacao L. in Norte de Santander Department, Colombia; for which they were characterized, differing in cultivated area, agronomic management and crop age. From serial dilutions of the samples and using the technique of Most Probable Number (MPN, In semisolid culture media (NFb, JMV, LGI, JNFb, the diazotrophs were quantified, evaluating as positive the formation of a subsurface film in the medium contained in sealed vials; equal samples were sent to the Bioambiental laboratory (UNET for physicochemical analyzes. As a result, the evaluated samples showed deficiencies in the percentage of organic matter and elements such as Potassium, Phosphorus and Magnesium. Statistically highly significant differences in MPN were reported. The highest quantification of diazotrophs was reported in the Florilandia farm, which was characterized by drip irrigation. The highest quantification of diazotrophs was recorded in the media NFb and JMV, demonstrating a greater presence of the presumed genera Azospirillum sp. and Burkholderia sp. which are easily isolated from rhizospheric soils, unlike the genera Herbaspirillum sp. and Gluconacetobacter sp. which by their endophytic character tend to be less predominant in this type of samples. It is also concluded that the physicochemical characteristics of the soil, humidity and climatic relationships at the moment of sampling, condition the amount of root exudates and therefore are factors that conditioned the presence of diazotrophs in the samples.
Directory of Open Access Journals (Sweden)
Sandra Ramírez González
2011-05-01
Full Text Available El cacao es severamente afectado por el hongo Moniliophthora roreri (Cif & Par. Evans et al., el cual daña los frutos y puede ocasionar pérdidas totales y su control es principalmente cultural. El objetivo del trabajo es determinar la efectividad del polisulfuro de calcio (PC como alternativa para su manejo. El patógeno fue aislado y cultivado in vitro y se evaluó el efecto del PC sobre la germinación y formación de conidias; en el campo, sobre frutos se asperjó PC antes y después de la inoculación con M. roreri y se determinó la incidencia e índices de severidad interna y externa. En una plantación de cacao se asperjó PC y se determinó su incidencia y producción. El PC in vitro inhibió el crecimiento y la formación de conidias; la aplicación de PC antes o después de la inoculación artificial con M. roreri sobre frutos inhibe completamente el desarrollo de la enfermedad; con aspersiones de PC en plantaciones de cacao la incidencia de la enfermedad fue de 0,53%, mientras que fue de 21% con manejo cultural y del 69,6% con testigo de inoculación natural; la producción de cacao seco/año fue de un 90,6% más con PC que en el testigo de inoculación natural, por lo que resulta viable integrar PC en el manejo deM. roreri.
Zeng, Huawu; Locatelli, Monica; Bardelli, Claudio; Amoruso, Angela; Coisson, Jean Daniel; Travaglia, Fabiano; Arlorio, Marco; Brunelleschi, Sandra
2011-05-25
There is a great interest in the potential health benefits of biologically active phenolic compounds in cocoa (Theobroma cacao) and dark chocolate. We investigated the anti-inflammatory potential of clovamide (a N-phenylpropenoyl-L-amino acid amide present in cocoa beans) and two phenolic extracts from unroasted and roasted cocoa beans, by evaluating superoxide anion (O(2)(-)) production, cytokine release, and NF-κB activation in human monocytes stimulated by phorbol 12-myristate 13-acetate (PMA). The effects of rosmarinic acid are shown for comparison. Clovamide and rosmarinic acid inhibited PMA-induced O(2)(-) production and cytokine release (with a bell-shaped curve and maximal inhibition at 10-100 nM), as well as PMA-induced NF-κB activation; the two cocoa extracts were less effective. In all tests, clovamide was the most potent compound and also enhanced peroxisome proliferator-activated receptor-γ (PPARγ) activity, which may exert anti-inflammatory effects. These findings indicate clovamide as a possible bioactive compound with anti-inflammatory activity in human cells.
Carbon storage in soil size fractions under two cacao agroforestry systems in Bahia, Brazil.
Gama-Rodrigues, Emanuela F; Ramachandran Nair, P K; Nair, Vimala D; Gama-Rodrigues, Antonio C; Baligar, Virupax C; Machado, Regina C R
2010-02-01
Shaded perennial agroforestry systems contain relatively high quantities of soil carbon (C) resulting from continuous deposition of plant residues; however, the extent to which the C is sequestered in soil will depend on the extent of physical protection of soil organic C (SOC). The main objective of this study was to characterize SOC storage in relation to soil fraction-size classes in cacao (Theobroma cacao L.) agroforestry systems (AFSs). Two shaded cacao systems and an adjacent natural forest in reddish-yellow Oxisols in Bahia, Brazil were selected. Soil samples were collected from four depth classes to 1 m depth and separated by wet-sieving into three fraction-size classes (>250 microm, 250-53 microm, and <53 microm)-corresponding to macroaggregate, microaggregate, and silt-and-clay size fractions-and analyzed for C content. The total SOC stock did not vary among systems (mean: 302 Mg/ha). On average, 72% of SOC was in macroaggregate-size, 20% in microaggregate-size, and 8% in silt-and-clay size fractions in soil. Sonication of aggregates showed that occlusion of C in soil aggregates could be a major mechanism of C protection in these soils. Considering the low level of soil disturbances in cacao AFSs, the C contained in the macroaggregate fraction might become stabilized in the soil. The study shows the role of cacao AFSs in mitigating greenhouse gas (GHG) emission through accumulation and retention of high amounts of organic C in the soils and suggests the potential benefit of this environmental service to the nearly 6 million cacao farmers worldwide.
Novel receptor-like kinases in cacao contain PR-1 extracellular domains.
Teixeira, Paulo José Pereira Lima; Costa, Gustavo Gilson Lacerda; Fiorin, Gabriel Lorencini; Pereira, Gonçalo Amarante Guimarães; Mondego, Jorge Maurício Costa
2013-08-01
Members of the pathogenesis-related protein 1 (PR-1) family are well-known markers of plant defence responses, forming part of the arsenal of the secreted proteins produced on pathogen recognition. Here, we report the identification of two cacao (Theobroma cacao L.) PR-1s that are fused to transmembrane regions and serine/threonine kinase domains, in a manner characteristic of receptor-like kinases (RLKs). These proteins (TcPR-1f and TcPR-1g) were named PR-1 receptor kinases (PR-1RKs). Phylogenetic analysis of RLKs and PR-1 proteins from cacao indicated that PR-1RKs originated from a fusion between sequences encoding PR-1 and the kinase domain of a LecRLK (Lectin Receptor-Like Kinase). Retrotransposition marks surround TcPR-1f, suggesting that retrotransposition was involved in the origin of PR-1RKs. Genes with a similar domain architecture to cacao PR-1RKs were found in rice (Oryza sativa), barrel medic (Medicago truncatula) and a nonphototrophic bacterium (Herpetosiphon aurantiacus). However, their kinase domains differed from those found in LecRLKs, indicating the occurrence of convergent evolution. TcPR-1g expression was up-regulated in the biotrophic stage of witches' broom disease, suggesting a role for PR-1RKs during cacao defence responses. We hypothesize that PR-1RKs transduce a defence signal by interacting with a PR-1 ligand. © 2013 BSPP AND JOHN WILEY & SONS LTD.
Cacao diseases-the trilogy revisited.
Evans, Harry C
2007-12-01
ABSTRACT This paper reviews the significant advances by the diseases themselves, as well as by the scientists, in the intervening period since the disease trilogy was first delimited in 1989. The impact of these diseases, black pod, witches' broom, and frosty pod rot, has increased dramatically. In addition, there have been radical changes in the taxonomic profiles of these pathogens, which have been based on both traditional (morphological, cytological) and modern (molecular) approaches. Black pod is caused by a complex of Phytophthora species, in which P. palmivora still is the most important worldwide. However, recent invasion of the principal cacao-growing countries of West Africa by the more virulent P. megakarya has been cause for concern. The latter evolved in the ancient forests straddling the Cameroon-Nigerian border as a primary coloniser of fallen fruit. Conversely, frosty pod rot, caused by Moniliophthora roreri, and witches' broom, caused by M. (Crinipellis) perniciosa, both neotropical diseases, are hemibiotrophic, coevolved pathogens. Respectively, M. roreri arose on Theobroma gileri in submontane forests on the north-western slopes of the Andes, whereas M. perniciosa developed as a complex of pathotypes with a considerably wider geographic and host range within South America; the cacao pathotype evolved on that host in the Amazon basin. The inter-relationships of these vicariant species and their recent spread are discussed, together with control strategies.
Directory of Open Access Journals (Sweden)
Faver Álvarez Carrillo
2015-07-01
Full Text Available The impact of organic fertilizing schemes on the cocoa (Theobroma cacao L. growth and production under agroforestry systems (AFS has been scarcely studied. In this sense, in Rivera (Huila-Colombia, the effect of different management strategies for amendment application in cocoa under agroforestry systems was evaluated. Four treatments were considered: i conventional fertilizing or farmer fertilizing (chemical, T1; ii Potassium sulfate (chemical, T2; iii eco-cocoa + Super 4 (ECO-S4 (organical, T3; and iv the mixture of among the treatments with potassium sulfate + eco-cocoa (SP-ECO (chemical + organical, T4. Variance analysis, Fisher test (p<0.05 and principal components analysis (PCA were used for data comparisons. For the height of cocoa plants, there was an average increase of 22.5 cm, while for stem diameter was 4.71 cm, with significant differences between the treatments. In general, an effect of the fertilizing scheme on the agronomic parameters of cocoa evaluated was found —especially for some important variables such as number of grains per pod and average weight of the grain—. There were similar parameters between the chemical and the organic treatments. This demonstrates that organic schemes of fertilizing could be an important alternative for improving cocoa production.
Mass Loss and Nutrient Release through Leaching in Tectona ...
African Journals Online (AJOL)
Tectona grandis and Theobroma cacao are common plantation tree crops planted to replace natural forest in Nigeria because of their faster growth rate and economic values. The changes in land use have marked effects on the soil nutrients and organic matter stock, thereby affecting physical, chemical properties and soil ...
van Straaten, Oliver; Corre, Marife D; Wolf, Katrin; Tchienkoua, Martin; Cuellar, Eloy; Matthews, Robin B; Veldkamp, Edzo
2015-08-11
Tropical deforestation for the establishment of tree cash crop plantations causes significant alterations to soil organic carbon (SOC) dynamics. Despite this recognition, the current Intergovernmental Panel on Climate Change (IPCC) tier 1 method has a SOC change factor of 1 (no SOC loss) for conversion of forests to perennial tree crops, because of scarcity of SOC data. In this pantropic study, conducted in active deforestation regions of Indonesia, Cameroon, and Peru, we quantified the impact of forest conversion to oil palm (Elaeis guineensis), rubber (Hevea brasiliensis), and cacao (Theobroma cacao) agroforestry plantations on SOC stocks within 3-m depth in deeply weathered mineral soils. We also investigated the underlying biophysical controls regulating SOC stock changes. Using a space-for-time substitution approach, we compared SOC stocks from paired forests (n = 32) and adjacent plantations (n = 54). Our study showed that deforestation for tree plantations decreased SOC stocks by up to 50%. The key variable that predicted SOC changes across plantations was the amount of SOC present in the forest before conversion--the higher the initial SOC, the higher the loss. Decreases in SOC stocks were most pronounced in the topsoil, although older plantations showed considerable SOC losses below 1-m depth. Our results suggest that (i) the IPCC tier 1 method should be revised from its current SOC change factor of 1 to 0.6 ± 0.1 for oil palm and cacao agroforestry plantations and 0.8 ± 0.3 for rubber plantations in the humid tropics; and (ii) land use management policies should protect natural forests on carbon-rich mineral soils to minimize SOC losses.
van Straaten, Oliver; Corre, Marife D.; Wolf, Katrin; Tchienkoua, Martin; Cuellar, Eloy; Matthews, Robin B.; Veldkamp, Edzo
2015-01-01
Tropical deforestation for the establishment of tree cash crop plantations causes significant alterations to soil organic carbon (SOC) dynamics. Despite this recognition, the current Intergovernmental Panel on Climate Change (IPCC) tier 1 method has a SOC change factor of 1 (no SOC loss) for conversion of forests to perennial tree crops, because of scarcity of SOC data. In this pantropic study, conducted in active deforestation regions of Indonesia, Cameroon, and Peru, we quantified the impact of forest conversion to oil palm (Elaeis guineensis), rubber (Hevea brasiliensis), and cacao (Theobroma cacao) agroforestry plantations on SOC stocks within 3-m depth in deeply weathered mineral soils. We also investigated the underlying biophysical controls regulating SOC stock changes. Using a space-for-time substitution approach, we compared SOC stocks from paired forests (n = 32) and adjacent plantations (n = 54). Our study showed that deforestation for tree plantations decreased SOC stocks by up to 50%. The key variable that predicted SOC changes across plantations was the amount of SOC present in the forest before conversion—the higher the initial SOC, the higher the loss. Decreases in SOC stocks were most pronounced in the topsoil, although older plantations showed considerable SOC losses below 1-m depth. Our results suggest that (i) the IPCC tier 1 method should be revised from its current SOC change factor of 1 to 0.6 ± 0.1 for oil palm and cacao agroforestry plantations and 0.8 ± 0.3 for rubber plantations in the humid tropics; and (ii) land use management policies should protect natural forests on carbon-rich mineral soils to minimize SOC losses. PMID:26217000
Mardiyani, S. A.; Sunawan; Pawestri, A. E.
2018-03-01
Cocoa seeds are recalcitrant (the water content is more than 40%) that require special handling. The use of adsorbent media to reduce the decrease in the quality of cocoa seeds and extend their shelf life in this storage has not been widely done. Local adsorbent media such as sawdust, sand and ash have the potential to maintain the viability of cocoa seeds. The objective of this research was to determine the interaction of the application of neem (Azadirachta indica) as biological pesticides and the use of various natural adsorbent media in the storage of cocoa seeds (Theobroma cacao). It was an experimental study with a factorial design composed of three factors. The first factor was the medium adsorbent type for the storage of cocoa seed, which consists of three levels (river sand, ash, and sawdust). The second factor was the concentration of neem leaves for pre-storage treatment with three levels (10, 20, and 30%). The third factor was the storage time (10 and 20 days). The results of the study indicated that the combination of the three factors showed a significant interaction in the height of the plant and the diameter of the stem of the seedling at 28 days after sowing. The fresh weight of the seedlings of the seeds that were stored in ash media gave a better result than the seedlings of seeds that had been stored in the river sand and the sawdust as adsorbent media. The application of 20% extract of neem leaves gave the best influence for the seeds that were stored for 20 days.
Stark, Timo; Lang, Roman; Keller, Daniela; Hensel, Andreas; Hofmann, Thomas
2008-10-01
Besides flavan-3-ols, a family of N-phenylpropenoyl-L-amino acids (NPAs) has been recently identified as polyphenol/amino acid conjugates in the seeds of Theobroma cacao as well as in a variety of herbal drugs. Stimulated by reports on their biological activity, the purpose of this study was to investigate if these amides are absorbed by healthy volunteers after administration of a cocoa drink. For the first time, 12 NPAs were quantified in human urine by means of a stable isotope dilution analysis with LC-MS/MS (MRM) detection. A maximum amount was found in the urine taken 2 h after the cocoa consumption. The highest absolute amount of NPAs excreted with the urine was found for N-[4'-hydroxy-(E)-cinnamoyl]-L-aspartic acid (5), but the highest recovery rate (57.3 and 22.8%), that means the percentage amount of ingested amides excreted with the urine, were determined for N-[4'-hydroxy-(E)-cinnamoyl]-L-glutamic acid (6) and N-[4'-hydroxy-3'-methoxy-(E)-cinnamoyl]-L-tyrosine (13). In order to gain first insights into the NPA metabolism in vivo, urine samples were analyzed by LC-MS/MS before and after beta-glucuronidase/sulfatase treatment. As independent of the enzyme treatment the same NPA amounts were found in urine, there is strong evidence that these amides are metabolized neither via their O-glucuronides nor their O-sulfates. In order to screen for caffeic acid O-glucuronides as potential NPA metabolites, urine samples were screened by means of LC-MS/MS for caffeic acid 3-O-beta-D-glucuronide and 4-O-beta-D-glucuronide. But not even trace amounts of one of these glucuronides were detectable, thus excluding them as major NPA metabolites and underlining the importance of future investigations on a potential O-methylation or reduction of the N-phenylpropenoyl moiety in NPAs.
Indonesia is the 3rd largest cocoa producing countries in the world, with an annual cacao bean production of 572,000 tons. The currently cultivated cacao varieties in Indonesia were inter-hybrids of various clones introduced from the Americas since the 16th century. Among them, “Java cocoa” is a wel...
Marseglia, Angela
2015-01-01
Il cacao (Theobroma cacao L.) e il cioccolato sono fra i prodotti alimentari più apprezzati nel mondo. Il nome 'Theobroma' significa 'cibo degli dei', sottolineando le quasi divine qualità nutritive del cacao e del cioccolato. I prodotti a base di cacao sono ottenuti a partire dalle fave di cacao, che rappresentano i semi della pianta del cacao, la quale cresce in una zona geografica limitata, di circa 20 gradi a nord e a sud dell'equatore. I prodotti a base di cioccolato sono ottenuti con un...
Directory of Open Access Journals (Sweden)
Román Jiménez Vera
2010-07-01
Full Text Available El pozol es una bebida de maíz que se consume en el sureste de México y en algunos países de Centroamérica. Se puede consumir recién elaborado o fermentado. Tradicionalmente se consume solo (pozol blanco, aunque también es común agregarle cacao o coco. En este trabajo se evaluaron cambios microbiológicos durante la fermentación natural a temperatura ambiental, de tres tipos de pozol: blanco, con cacao y coco. La concentración de bacterias coliformes disminuyó a partir del tercer día de fermentación y a los 12 días se obtuvo una concentración de 2,20 log UFC/g. En las bacterias lácticas se observó el mayor crecimiento; ellas alcanzaron una concentración de 8,00 log UFC/g a los 3 días de fermentación que se mantuvo durante los 9 días siguientes. Se realizaron pruebas de nivel de agrado y preferencia con 31 jueces consumidores. La adición de ingredientes como el cacao o el coco no mejoraron el nivel de agrado entre los consumidores evaluados (p > 0,05. El pozol blanco y fresco fue el preferido (32 %. En el futuro, estos resultados pueden ser utilizados para clasificar al pozol como una bebida funcional, debido a la presencia de bacterias lácticas en concentración similar a la encontrada en el yogur.
Directory of Open Access Journals (Sweden)
Bernardo Santos
2012-03-01
Full Text Available A survey of Trigonalidae from cacao (Theobroma cacao L. agroforestry systems in southern Bahia, northeastern Brazil, is conducted. A total of 65 specimens were studied, and three species are recognized. Trigonalys melanoleuca Westwood is diagnosed and illustrated. Two new species are described and illustrated. Trigonalys erythrocephala sp. n. has most of head reddish brown; metasomal armature in sternum III conspicuous, Y-shaped; supra-antennal elevation conspicuous; hind coxa with sharp lateral angles, its dorso-mesal portion strigate; legs entirely dark brown; and fore wing lightly infuscate, darker towards anterior margin. Trigonalys gotica sp. n. with body blackish or dark brown and with pale yellow marks; mesopleuron with an oblique mark; female armature absent; frons and vertex punctate-areolate; supra-antennal elevation subtle; propodeal foramen V-shaped; and fore wing vein M arising distinctly basad to 1cu-a.
Energy Technology Data Exchange (ETDEWEB)
Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de [Universidade Federal, Rio de Janeiro, RJ (Brazil). Inst. de Quimica]. E-mail: ladetec@iq.gov.br; Cabral, Jose Augusto; Ferreira, Carlos Alberto Cid [Instituto Nacional de Pesquisas da Amazonia (INPA), Manaus, AM (Brazil); Simoneit, Bernd R.T. [Oregon State Univ., Corvallis, OR (United States). College of Oceanic and Atmospheric Sciences. Petroleum and Environmental Geochemistry Group; Elias, Vladimir O. [Analytical Solution, Rio de Janeiro, RJ (Brazil)
2003-10-01
The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ({sup 1}H and {sup 13}C NMR, IR). (author)
Determination of high molecular mass compounds from Amazonian plant's leaves
International Nuclear Information System (INIS)
Siqueira, Denilson Soares de; Pereira, Alberto dos Santos; Aquino Neto, Francisco Radler de; Simoneit, Bernd R.T.
2003-01-01
The fractions of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae), caapi (Banisteriopsis caapi - Malpighiaceae), cocoa (Theobroma cacao - Sterculiaceae), Brazil nut (Bertholletia excelsa - Lecytidaceae), cupuacu (Theobroma grandiflorum - Sterculiaceae), marupa (Simaruba amara - Simaroubaceae) and rubber tree (Hevea brasiliensis - Euphorbiaceae), were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data ( 1 H and 13 C NMR, IR). (author)
Mares, Joise Hander; Gramacho, Karina Peres; Santos, Everton Cruz; da Silva Santiago, André; Santana, Juliano Oliveira; de Sousa, Aurizângela Oliveira; Alvim, Fátima Cerqueira; Pirovani, Carlos Priminho
2017-08-17
Moniliophthora perniciosa is a phytopathogenic fungus responsible for witches' broom disease of cacao trees (Theobroma cacao L.). Understanding the molecular events during germination of the pathogen may enable the development of strategies for disease control in these economically important plants. In this study, we determined a comparative proteomic profile of M. perniciosa basidiospores during germination by two-dimensional SDS-PAGE and mass spectrometry. A total of 316 proteins were identified. Molecular changes during the development of the germinative tube were identified by a hierarchical clustering analysis based on the differential accumulation of proteins. Proteins associated with fungal filamentation, such as septin and kinesin, were detected only 4 h after germination (hag). A transcription factor related to biosynthesis of the secondary metabolite fumagillin, which can form hybrids with polyketides, was induced 2 hag, and polyketide synthase was observed 4 hag. The accumulation of ATP synthase, binding immunoglobulin protein (BiP), and catalase was validated by western blotting. In this study, we showed variations in protein expression during the early germination stages of fungus M. perniciosa. Proteins associated with fungal filamentation, and consequently with virulence, were detected in basidiospores 4 hag., for example, septin and kinesin. We discuss these results and propose a model of the germination of fungus M. perniciosa. This research can help elucidate the mechanisms underlying basic processes of host invasion and to develop strategies for control of the disease.
Fister, Andrew S; O'Neil, Shawn T; Shi, Zi; Zhang, Yufan; Tyler, Brett M; Guiltinan, Mark J; Maximova, Siela N
2015-10-01
Understanding the genetic basis of pathogen susceptibility in various crop plants is crucial to increasing the stability of food, feed, and fuel production. Varietal differences in defence responses provide insights into the mechanisms of resistance and are a key resource for plant breeders. To explore the role of salicylic acid in the regulation of defence in cacao, we demonstrated that SA treatment decreased susceptibility to a pod rot pathogen, Phytophthora tropicalis in two genotypes, Scavina 6 and Imperial College Selection 1, which differ in their resistance to several agriculturally important pathogens. Transient overexpression of TcNPR1, a major transcriptional regulator of the SA-dependent plant immune system, also increased pathogen tolerance in cacao leaves. To explore further the genetic basis of resistance in cacao, we used microarrays to measure gene expression profiles after salicylic acid (SA) treatment in these two cacao genotypes. The two genotypes displayed distinct transcriptional responses to SA. Unexpectedly, the expression profile of the susceptible genotype ICS1 included a larger number of pathogenesis-related genes that were induced by SA at 24h after treatment, whereas genes encoding many chloroplast and mitochondrial proteins implicated in reactive oxygen species production were up-regulated in the resistant genotype, Sca6. Sca6 accumulated significantly more superoxide at 24h after treatment of leaves with SA. These experiments revealed critical insights regarding the molecular differences between cacao varieties, which will allow a better understanding of defence mechanisms to help guide breeding programmes. © The Author 2015. Published by Oxford University Press on behalf of the Society for Experimental Biology.
Lázaro, A. Alejandro; Azpeitia-Morales, A.; Sáenz-Carbonell, L.; Mirafuentes Hernández, F.
2015-01-01
La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS) en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de las fi...
A. Alejandro-Lázaro; A. Azpeitia-Morales; L. Sáenz-Carbonell; F . Mirafuentes Hernández
2015-01-01
La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS) en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de l...
Cacao Crop Management Zones Determination Based on Soil Properties and Crop Yield
Directory of Open Access Journals (Sweden)
Perla Silva Matos de Carvalho
Full Text Available ABSTRACT: The use of management zones has ensured yield success for numerous agricultural crops. In spite of this potential, studies applying precision agricultural techniques to cacao plantations are scarce or almost nonexistent. The aim of the present study was to delineate management zones for cacao crop, create maps combining soil physical properties and cacao tree yield, and identify what combinations best fit within the soil chemical properties. The study was conducted in 2014 on a cacao plantation in a Nitossolo Háplico Eutrófico (Rhodic Paleudult in Bahia, Brazil. Soil samples were collected in a regular sampling grid with 120 sampling points in the 0.00-0.20 m soil layer, and pH(H2O, P, K+, Ca2+, Mg2+, Na+, H+Al, Fe, Zn, Cu, Mn, SB, V, TOC, effective CEC, CEC at pH 7.0, coarse sand, fine sand, clay, and silt were determined. Yield was measured in all the 120 points every month and stratified into annual, harvest, and early-harvest cacao yields. Data were subjected to geostatistical analysis, followed by ordinary kriging interpolation. The management zones were defined through a Fuzzy K-Means algorithm for combinations between soil physical properties and cacao tree yield. Concordance analysis was carried out between the delineated zones and soil chemical properties using Kappa coefficients. The zones that best classified the soil chemical properties were defined from the early-harvest cacao yield map associated with the clay or sand fractions. Silt content proved to be an inadequate variable for defining management zones for cacao production. The delineated management zones described the spatial variability of the soil chemical properties, and are therefore important for site-specific management in the cacao crop.
Extracción de nutrientes por los frutos de cacao en dos localidades en Costa Rica.
Directory of Open Access Journals (Sweden)
Parménides Furcal Beriguete
2016-12-01
Full Text Available El objetivo de la presente investigación fue analizar la extracción de nutrientes en frutos de clones de cacao (Theobroma cacao. El estudio se hizo en plantaciones de cacao de siete años, en las localidades de Katira, Guatuso y el Centro Agronómico Tropical de Investigación y Enseñanza (CATIE, Turrialba, Costa Rica, entre los meses de marzo a agosto del año 2014. El diseño experimental utilizado fue completamente al azar con tres repeticiones; para el análisis se mezclaron por separado las semillas y la cáscara de tres frutos, para formar una repetición de cada uno de los siete clones de cacao seleccionados por el CATIE por su tolerancia a moniliasis (Moniliophthora roreri, calidad y altos rendimientos. Los resultados obtenidos mostraron que de una tonelada de semillas secas de estos clones, incluyendo la cáscara del fruto, se extraen entre 33,45 a 37,80 kg de nitrógeno (N, entre 40,35 y 50,64 kg de potasio (K, y de fósforo (P en un rango de 7,33 a 8,37 kg. El orden de extracción de los nutrientes fue: K>N>P>Mg>Ca>Mn>Fe>Zn>B=Cu.
Santos, Elisa S L; Cerqueira-Silva, Carlos Bernard M; Mori, Gustavo M; Ahnert, Dário; Mello, Durval L N; Pires, José Luis; Corrêa, Ronan X; de Souza, Anete P
2015-01-01
Bahia is the most important cacao-producing state in Brazil, which is currently the sixth-largest country worldwide to produce cacao seeds. In the eighteenth century, the Comum, Pará and Maranhão varieties of cacao were introduced into southern Bahia, and their descendants, which are called 'Bahian cacao' or local Bahian varieties, have been cultivated for over 200 years. Comum plants have been used to start plantations in African countries and extended as far as countries in South Asia and Oceania. In Brazil, two sets of clones selected from Bahian varieties and their mutants, the Agronomic Institute of East (SIAL) and Bahian Cacao Institute (SIC) series, represent the diversity of Bahian cacao in germplasm banks. Because the genetic diversity of Bahian varieties, which is essential for breeding programs, remains unknown, the objective of this work was to assess the genetic structure and diversity of local Bahian varieties collected from farms and germplasm banks. To this end, 30 simple sequence repeat (SSR) markers were used to genotype 279 cacao plants from germplasm and local farms. The results facilitated the identification of 219 cacao plants of Bahian origin, and 51 of these were SIAL or SIC clones. Bahian cacao showed low genetic diversity. It could be verified that SIC and SIAL clones do not represent the true diversity of Bahian cacao, with the greatest amount of diversity found in cacao trees on the farms. Thus, a core collection to aid in prioritizing the plants to be sampled for Bahian cacao diversity is suggested. These results provide information that can be used to conserve Bahian cacao plants and applied in breeding programs to obtain more productive Bahian cacao with superior quality and tolerance to major diseases in tropical cacao plantations worldwide.
Directory of Open Access Journals (Sweden)
Biano Alves de Melo Neto
2013-06-01
Full Text Available Four formulations of mixed açaí (Euterpe oleracea (A and cocoa´s honey (Theobroma cacao (CH jellies were prepared according to the following proportions: T1 (40% A:60% CH, T2 (50% A:50% CH, T3 (60% A: 40% CH and T4 (100% A - control. All formulations were prepared using a rate 60:40 (w/w of sucrose and pulp, plus 0.5% pectin and the products reached to average of 65% soluble solids content. The jellies were analyzed by chemical and physicochemical (titratable acidity, pH, soluble solid content, dry matter, total protein, lipids, vitamin C and calories and sensory characteristics; also were evaluated levels of P, K, Ca, Mg, Fe, Zn, Cu and Mn. It was used a hedonic scale of 7 points to evaluate the attributes: overall impression, spreadability, brightness, flavor, texture and color, and also was verified the purchase intention score. The titratable acidity and pH ranged from 0.46 to 0.64% and 3.35 to 3.64, respectively, that are within the range found at most fruit jellies. The soluble solids content ranged between 65.2 and 65.5 ºBrix. The sensory acceptance results showed that all treatments (T1, T2, T3 and T4 presented means of sensory attributes above 4, demonstrating good acceptance of the product, but the treatment T1 presented the higher scores for the evaluated attributes. Cocoa´s honey added a positive influence on the attributes of color, texture and spreadability.
pH relationship and nutrient availability for cacao in an Entisol from the Colombian Amazon
Directory of Open Access Journals (Sweden)
Gelber Rosas-Patiño
2017-09-01
Full Text Available Liming is a common practice in acid soil manage-ment; however, the information on liming in cacao soils of the Colombian Amazon region is precarious. Incubation curves were built in a highly acid Typic Udorthents cultivated with cacao (Theobroma cacao L. - Malvaceae, for which increasing doses (0 - 1 - 3 - 5 - 7 - 9 -11 Mg/ha of dolomite lime (Ca M g (CO32 and calcium carbonate (CaCO3 were used, in order to establish the type and amount of liming material (ME with better reactivity, and the one that is better favored with the acidity changes: pH, Al3+, H+, total acidity. Models to estimate the ME dose needed to manage the soil in order to obtain the desired pH (≥5.5 were generated. Sub-sequently, the soil was then limed under field conditions and pH, Al3+, Al in solution (Alsol, aluminum saturation (SAI, cation exchange capacity (CEC and N, P, K, Ca, Mg, Zn, Cu, B, Fe and Mn availability were evaluated. The results show that the greatest reaction of liming materials in these soils occurs after 60 days; applications of 7 Mg/ha allowed to raise the pH from 5.5 to 6.0 and decreases Al and Fe levels. These changes improved the CECand nutrient availability (Ca, Mg, P, Zn for cacao without affecting other nutrients such as N and K.
Determinação de compostos de massa molecular alta em folhas de plantas da Amazônia
Directory of Open Access Journals (Sweden)
Siqueira Denilson Soares de
2003-01-01
Full Text Available The fractIons of dichloromethane extracts of leaves from andiroba (Carapa guianensis - Meliaceae, caapi (Banisteriopsis caapi - Malpighiaceae, cocoa (Theobroma cacao - Sterculiaceae, Brazil nut (Bertholletia excelsa - Lecytidaceae, cupuaçu (Theobroma grandiflorum - Sterculiaceae, marupá (Simaruba amara - Simaroubaceae and rubber tree (Hevea brasiliensis - Euphorbiaceae, were analyzed by HT-HRGC and HT-HRGC-MS. Esters of homologous series of fatty acids and long chain alcohols, phytol, amyrines and tocopherols were characterized. The characterization of the compounds was based mainly in mass spectra data and in addition by usual spectrometric data (¹H and 13C NMR, IR.
Hoopen, G Martijn ten; Rees, Robert; Aisa, Philo; Stirrup, Tim; Krauss, Ulrike
2003-05-01
Mycoparasites collected from aerial parts of the cocoa plant (Theobroma cacao) have shown great promise in the control of black pod, caused by Phytophthora palmivora, and moniliasis, caused by Moniliophthora roreri. However, the ecology of epiphytic mycoparasites is still poorly understood although it has a direct bearing on applied biocontrol practices, ranging from the identification and isolation of promising biocontrol candidates to formulation needs and required application frequency. One objective of this study was to determine the natural abundance of mycoparasites on cocoa flowers and pods in relation to crop development stage and cultivar. For this purpose, native mycoparasites were detected on cocoa flowers and pods using the precolonised plate baiting technique. Furthermore, the survival of an applied Clonostachys rosea isolate on cocoa pods on shaded and non-shaded trees was compared as well as the recolonisation patterns of surface-sterilised pods by native mycoparasites under these conditions. Clonostachys spp. were the most commonly isolated native mycoparasites, followed by Fusarium spp. No differences in the occurrence of native, epiphytic mycoparasites were observed between the three main cocoa cultivars, 'Criollo', 'Forastero' and 'Trinitario', nor between clones within these groups. Thus, a single biocontrol inoculum can be suitable for application to cultivar mixtures of cocoa commonly grown together in a field. Different susceptibility classes of segregating F1 populations of hybrids with resistance against M. roreri and P. palmivora supported similar population levels and taxonomic assemblages of mycoparasites. Therefore, we reject the hypothesis that these antagonists mediate resistance. Mycoparasite abundance and genetic disease resistance to black pod and moniliasis are independent phenomena and should lead to additive effects if employed simultaneously in an integrated disease management programme. The survival of applied C. rosea was not
Evaluación del desempeño de un secador solar directo sobre semillas de cacao (Theobroma cacao L.
Directory of Open Access Journals (Sweden)
Enrique Romero Frasca
2016-01-01
Full Text Available Se desarrolló un secador solar directo con un diseño basado en dispositivos deshidratadores rudimentarios de uso regular, en granjas cacaoteras de Tabasco; con el objetivo de evaluar su desempeño en la obtención de cacao seco con- forme a la NMX-F-352-S-1980, mediante una exposición a luz solar durante cuatro días. Re- sultados: disminución paulatina del contenido de humedad hasta en un 7.50%, en promedio, en un producto con valor comercial a insertarse en el mercado.
Release Properties of Paracetamol Granulationa Formulated with ...
African Journals Online (AJOL)
Theobroma cacao gum, TCG was derived as a dry powder from fresh fruits of Theobroma cacao. Various granulations of paracetamol were prepared with TCG at the concentrations of 0.5 – 4% w/w. Similar formulations were prepared using sodium carboxymethyl cellulose, SCMC and acacia gums as standards. In each ...
Reis, Graciele Santos Monteiro; de Almeida, Alex-Alan Furtado; de Almeida, Nicolle Moreira; de Castro, Andressa Vieira; Mangabeira, Pedro Antonio Oliveira; Pirovani, Carlos Priminho
2015-01-01
Pb is a metal which is highly toxic to plants and animals, including humans. High concentrations of Pb have been observed in beans of T. cacao, as well as in its products. In this work, we evaluated the molecular, biochemical, and ultrastructural alterations in mature leaves and primary roots of seedlings of two progenies of T. cacao, obtained from seed germination in different concentrations of Pb (0, 0.05, 0.1, 0.2, 0.4, 0.8 g L(-1)), in the form of Pb(NO3)2. The progenies resulted from self-fertilization of Catongo and a cross of CCN-10 x SCA-6. The Pb, supplied via seminal, caused alterations in the ultrastructures of the mesophyll cells and in the amount of starch grains in the chloroplasts. The dosage of substances reactive to thiobarbituric acid showed that Pb induced lipid peroxidation. The activity of guaiacol peroxidases and the expression of genes associated to synthetase of phytochelatin, SODcyt and PER increased in response to Pb. In addition, there was alteration in the expression of stress-related proteins. The progeny of CCN-10 x SCA-6 was more tolerant to Pb stress when compared to Catongo, since: (i) it accumulated more Pb in the roots, preventing its translocation to the shoot; (ii) it presented higher activity of peroxidases in the roots, which are enzymes involved in the elimination of excess of reactive oxygen species; and (iii) increased expression of the gene in the phytochelatin biosynthesis route. The results of the proteomic analysis were of paramount importance to differentiate the defense mechanisms used by both progenies of T. cacao.
Li, Fupeng; Wu, Baoduo; Qin, Xiaowei; Yan, Lin; Hao, Chaoyun; Tan, Lehe; Lai, Jianxiong
2014-08-10
In this study, we performed cloning and expression analysis of six putative sucrose transporter genes, designated TcSUT1, TcSUT2, TcSUT3, TcSUT4, TcSUT5 and TcSUT6, from the cacao genotype 'TAS-R8'. The combination of cDNA and genomic DNA sequences revealed that the cacao SUT genes contained exon numbers ranging from 1 to 14. The average molecular mass of all six deduced proteins was approximately 56 kDa (range 52 to 66 kDa). All six proteins were predicted to exhibit typical features of sucrose transporters with 12 trans-membrane spanning domains. Phylogenetic analysis revealed that TcSUT2 and TcSUT4 belonged to Group 2 SUT and Group 4 SUT, respectively, and the other TcSUT proteins were belonging to Group 1 SUT. Real-time PCR was conducted to investigate the expression pattern of each member of the SUT family in cacao. Our experiment showed that TcSUT1 was expressed dominantly in pods and that, TcSUT3 and TcSUT4 were highly expressed in both pods and in bark with phloem. Within pods, TcSUT1 and TcSUT4 were expressed more in the seed coat and seed from the pod enlargement stage to the ripening stage. TcSUT5 expression sharply increased to its highest expression level in the seed coat during the ripening stage. Expression pattern analysis indicated that TcSUT genes may be associated with photoassimilate transport into developing seeds and may, therefore, have an impact on seed production. Copyright © 2014 Elsevier B.V. All rights reserved.
Sugimoto, Naotoshi; Miwa, Shinji; Hitomi, Yoshiaki; Nakamura, Hiroyuki; Tsuchiya, Hiroyuki; Yachie, Akihiro
2014-01-01
Theobromine, a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. We previously showed that methylxanthines, including caffeine and theophylline, have antitumor and antiinflammatory effects, which are in part mediated by their inhibition of phosphodiesterase (PDE). A member of the PDE family, PDE4, is widely expressed in and promotes the growth of glioblastoma, the most common type of brain tumor. The purpose of this study was to determine whether theobromine could exert growth inhibitory effects on U87-MG, a cell line derived from human malignant glioma. We show that theobromine treatment elevates intracellular cAMP levels and increases the activity of p38 mitogen-activated protein kinase and c-Jun N-terminal kinase, whereas it attenuates p44/42 extracellular signal-regulated kinase activity and the Akt/mammalian target of rapamycin kinase and nuclear factor-kappa B signal pathways. It also inhibits cell proliferation. These results suggest that foods and beverages containing cocoa bean extracts, including theobromine, might be extremely effective in preventing human glioblastoma.
Cao, Heping; Zhang, Lin; Tan, Xiaofeng; Long, Hongxu; Shockey, Jay M
2014-01-01
Triacylglycerols (TAG) are the major molecules of energy storage in eukaryotes. TAG are packed in subcellular structures called oil bodies or lipid droplets. Oleosins (OLE) are the major proteins in plant oil bodies. Multiple isoforms of OLE are present in plants such as tung tree (Vernicia fordii), whose seeds are rich in novel TAG with a wide range of industrial applications. The objectives of this study were to identify OLE genes, classify OLE proteins and analyze OLE gene expression in tung trees. We identified five tung tree OLE genes coding for small hydrophobic proteins. Genome-wide phylogenetic analysis and multiple sequence alignment demonstrated that the five tung OLE genes represented the five OLE subfamilies and all contained the "proline knot" motif (PX5SPX3P) shared among 65 OLE from 19 tree species, including the sequenced genomes of Prunus persica (peach), Populus trichocarpa (poplar), Ricinus communis (castor bean), Theobroma cacao (cacao) and Vitis vinifera (grapevine). Tung OLE1, OLE2 and OLE3 belong to the S type and OLE4 and OLE5 belong to the SM type of Arabidopsis OLE. TaqMan and SYBR Green qPCR methods were used to study the differential expression of OLE genes in tung tree tissues. Expression results demonstrated that 1) All five OLE genes were expressed in developing tung seeds, leaves and flowers; 2) OLE mRNA levels were much higher in seeds than leaves or flowers; 3) OLE1, OLE2 and OLE3 genes were expressed in tung seeds at much higher levels than OLE4 and OLE5 genes; 4) OLE mRNA levels rapidly increased during seed development; and 5) OLE gene expression was well-coordinated with tung oil accumulation in the seeds. These results suggest that tung OLE genes 1-3 probably play major roles in tung oil accumulation and/or oil body development. Therefore, they might be preferred targets for tung oil engineering in transgenic plants.
Directory of Open Access Journals (Sweden)
Heping Cao
Full Text Available Triacylglycerols (TAG are the major molecules of energy storage in eukaryotes. TAG are packed in subcellular structures called oil bodies or lipid droplets. Oleosins (OLE are the major proteins in plant oil bodies. Multiple isoforms of OLE are present in plants such as tung tree (Vernicia fordii, whose seeds are rich in novel TAG with a wide range of industrial applications. The objectives of this study were to identify OLE genes, classify OLE proteins and analyze OLE gene expression in tung trees. We identified five tung tree OLE genes coding for small hydrophobic proteins. Genome-wide phylogenetic analysis and multiple sequence alignment demonstrated that the five tung OLE genes represented the five OLE subfamilies and all contained the "proline knot" motif (PX5SPX3P shared among 65 OLE from 19 tree species, including the sequenced genomes of Prunus persica (peach, Populus trichocarpa (poplar, Ricinus communis (castor bean, Theobroma cacao (cacao and Vitis vinifera (grapevine. Tung OLE1, OLE2 and OLE3 belong to the S type and OLE4 and OLE5 belong to the SM type of Arabidopsis OLE. TaqMan and SYBR Green qPCR methods were used to study the differential expression of OLE genes in tung tree tissues. Expression results demonstrated that 1 All five OLE genes were expressed in developing tung seeds, leaves and flowers; 2 OLE mRNA levels were much higher in seeds than leaves or flowers; 3 OLE1, OLE2 and OLE3 genes were expressed in tung seeds at much higher levels than OLE4 and OLE5 genes; 4 OLE mRNA levels rapidly increased during seed development; and 5 OLE gene expression was well-coordinated with tung oil accumulation in the seeds. These results suggest that tung OLE genes 1-3 probably play major roles in tung oil accumulation and/or oil body development. Therefore, they might be preferred targets for tung oil engineering in transgenic plants.
Ali, Shahin S; Melnick, Rachel L; Crozier, Jayne; Phillips-Mora, Wilberth; Strem, Mary D; Shao, Jonathan; Zhang, Dapeng; Sicher, Richard; Meinhardt, Lyndel; Bailey, Bryan A
2014-09-01
An understanding of the tolerance mechanisms of Theobroma cacao used against Moniliophthora roreri, the causal agent of frosty pod rot, is important for the generation of stable disease-tolerant clones. A comparative view was obtained of transcript populations of infected pods from two susceptible and two tolerant clones using RNA sequence (RNA-Seq) analysis. A total of 3009 transcripts showed differential expression among clones. KEGG (Kyoto Encyclopedia of Genes and Genomes) pathway analysis of differentially expressed genes indicated shifts in 152 different metabolic pathways between the tolerant and susceptible clones. Real-time quantitative reverse transcription polymerase chain reaction (real-time qRT-PCR) analyses of 36 genes verified the differential expression. Regression analysis validated a uniform progression in gene expression in association with infection levels and fungal loads in the susceptible clones. Expression patterns observed in the susceptible clones diverged in tolerant clones, with many genes showing higher expression at a low level of infection and fungal load. Principal coordinate analyses of real-time qRT-PCR data separated the gene expression patterns between susceptible and tolerant clones for pods showing malformation. Although some genes were constitutively differentially expressed between clones, most results suggested that defence responses were induced at low fungal load in the tolerant clones. Several elicitor-responsive genes were highly expressed in tolerant clones, suggesting rapid recognition of the pathogen and induction of defence genes. Expression patterns suggested that the jasmonic acid-ethylene- and/or salicylic acid-mediated defence pathways were activated in the tolerant clones, being enhanced by reduced brassinosteroid (BR) biosynthesis and catabolic inactivation of both BR and abscisic acids. Finally, several genes associated with hypersensitive response-like cell death were also induced in tolerant clones. © 2014
Genetic Population Structure of Cacao Plantings within a Young Production Area in Nicaragua
Trognitz, Bodo; Scheldeman, Xavier; Hansel-Hohl, Karin; Kuant, Aldo; Grebe, Hans; Hermann, Michael
2011-01-01
Significant cocoa production in the municipality of Waslala, Nicaragua, began in 1961. Since the 1980s, its economic importance to rural smallholders increased, and the region now contributes more than 50% of national cocoa bean production. This research aimed to assist local farmers to develop production of high-value cocoa based on optimal use of cacao biodiversity. Using microsatellite markers, the allelic composition and genetic structure of cacao was assessed from 44 representative plantings and two unmanaged trees. The population at Waslala consists of only three putative founder genotype spectra (lineages). Two (B and R) were introduced during the past 50 years and occur in >95% of all trees sampled, indicating high rates of outcrossing. Based on intermediate allelic diversity, there was large farm-to-farm multilocus genotypic variation. GIS analysis revealed unequal distribution of the genotype spectra, with R being frequent within a 2 km corridor along roads, and B at more remote sites with lower precipitation. The third lineage, Y, was detected in the two forest trees. For explaining the spatial stratification of the genotype spectra, both human intervention and a combination of management and selection driven by environmental conditions, appear responsible. Genotypes of individual trees were highly diverse across plantings, thus enabling selection for farm-specific qualities. On-farm populations can currently be most clearly recognized by the degree of the contribution of the three genotype spectra. Of two possible strategies for future development of cacao in Waslala, i.e. introducing more unrelated germplasm, or working with existing on-site diversity, the latter seems most appropriate. Superior genotypes could be selected by their specific composite genotype spectra as soon as associations with desired quality traits are established, and clonally multiplied. The two Y trees from the forest share a single multilocus genotype, possibly representing the
Chavez, E; He, Z L; Stoffella, P J; Mylavarapu, R; Li, Y; Baligar, V C
2016-09-01
Elevated plant-available cadmium (Cd) in soils results in contamination to cacao (Theobroma cacao L) beans. Effectiveness of vermicompost and zeolite in reducing available Cd in three cacao-growing soils was studied under laboratory conditions. Sorption-desorption experiments were conducted in soils and amendments. Cadmium was added at 0 or 5 mg kg(-1) (spiked), then, amendments were incorporated at 0, 0.5, or 2 %. Amended soils were incubated at room temperature for 28 days. Plant-available Cd was determined using 0.01 M CaCl2 (WSE) and Mehlich 3 (M3) extraction procedures in subsamples taken from individual bags at six time intervals. Soils and amendments displayed different sorption characteristics and a better fit was attained with Freundlich model (R (2) > 0.82). Amendments were ineffective in reducing extractable Cd in non-spiked soils. In Cd-spiked soils, vermicompost at 2 % significantly reduced WSE-Cd (P soils and significantly diminished M3-extractable Cd (P soil. Vermicompost at 0.5 % significantly decreased WSE-Cd (P soils with low sorption capacity for Cd. In contrast, zeolite failed to reduce WSE- or M3-extractable Cd in all studied soils. A negative correlation occurred between soil pH and WSE-Cd (r > -0.89, P soils.
Independent Origins of Yeast Associated with Coffee and Cacao Fermentation.
Ludlow, Catherine L; Cromie, Gareth A; Garmendia-Torres, Cecilia; Sirr, Amy; Hays, Michelle; Field, Colburn; Jeffery, Eric W; Fay, Justin C; Dudley, Aimée M
2016-04-04
Modern transportation networks have facilitated the migration and mingling of previously isolated populations of plants, animals, and insects. Human activities can also influence the global distribution of microorganisms. The best-understood example is yeasts associated with winemaking. Humans began making wine in the Middle East over 9,000 years ago [1, 2]. Selecting favorable fermentation products created specialized strains of Saccharomyces cerevisiae [3, 4] that were transported along with grapevines. Today, S. cerevisiae strains residing in vineyards around the world are genetically similar, and their population structure suggests a common origin that followed the path of human migration [3-7]. Like wine, coffee and cacao depend on microbial fermentation [8, 9] and have been globally dispersed by humans. Theobroma cacao originated in the Amazon and Orinoco basins of Colombia and Venezuela [10], was cultivated in Central America by Mesoamerican peoples, and was introduced to Europeans by Hernán Cortés in 1530 [11]. Coffea, native to Ethiopia, was disseminated by Arab traders throughout the Middle East and North Africa in the 6(th) century and was introduced to European consumers in the 17(th) century [12]. Here, we tested whether the yeasts associated with coffee and cacao are genetically similar, crop-specific populations or genetically diverse, geography-specific populations. Our results uncovered populations that, while defined by niche and geography, also bear signatures of admixture between major populations in events independent of the transport of the plants. Thus, human-associated fermentation and migration may have affected the distribution of yeast involved in the production of coffee and chocolate. Copyright © 2016 Elsevier Ltd. All rights reserved.
Increasing yield, quality and disease resistance are important objectives for cacao breeding programs. Some of the diseases, such as black pod rot (Phytophtora spp), frosty pod (Moniliophthora roreri) and witches’ broom (M. perniciosa), produce significant losses in all or in some of the various pro...
Directory of Open Access Journals (Sweden)
Michele Karina Cotta
2008-12-01
Full Text Available Os objetivos deste trabalho foram quantificar a biomassa vegetal e analisar o potencial de geração de Certificados de Emissões Reduzidas (CERs em um consórcio de seringueira (Hevea brasiliensis M. Arg. aos 34 anos de idade com cacaueiro (Theobroma cacao L. aos 6 anos de idade. O experimento foi realizado nas Fazendas Reunidas Vale do Juliana, em Igrapiúna, Bahia. A quantificação da biomassa arbórea foi feita utilizando-se o método direto e destrutivo de cinco seringueiras e 10 cacaueiros, selecionados em uma área de 2,2 ha. A biomassa da serapilheira foi quantificada por meio da coleta do material sobre o solo. O estoque de carbono no consórcio seringueira-cacau foi de 91,5 Mg C ha-1. Desse total, 84,7 Mg C ha-1 estavam estocados na seringueira, 5,2 Mg C ha-1 no cacaueiro e 1,6 Mg C ha-1 na serapilheira. O carbono contabilizado no consórcio correspondeu a 336 Mg CO2eq. ha-1, que equivalem à geração de 336 CERs ha-1. O consórcio seringueira-cacau apresentou capacidade para estocagem de carbono, podendo trazer grandes contribuições para a redução dos gases de efeito estufa na atmosfera, e isso o credencia como atividade promissora na geração de projetos candidatos ao recebimento de créditos de carbono.The objective of this work were to quantify plant biomass and analyze the potential for generating Emission Reduction Certificates (ERCs of 34-year-old rubber trees (Hevea brasiliensis M.Arg intercropped with 6-year-old cacao (Theobroma cacao L.. The experiment was conducted on the farms Fazendas Reunidas Vale do Juliana, Igrapiúna, BA. Tree biomass quantification was carried out using the direct destructive method by harvesting five rubber trees and ten cocoa trees, in an area of 2.2 ha. Litter biomass was quantified by collecting material from the ground. Total carbon storage in rubber - cacao intercropping was 91.5 Mg C ha-1. Of this, 84.7 Mg C ha-1 were stored in rubber trees, 5.22 Mg C ha-1 in cacao trees and 1.67 Mg C ha
Mazón, Marina; Sánchez-Angarita, Daniel; Díaz, Francisco A; Gutiérrez, Néstor; Jaimez, Ramón
2018-04-20
Agroforestry systems are environment-friendly production systems which help to preserve biodiversity while providing people with a way of earning a living. Cacao is a historically important crop in Venezuela that traditionally has been produced in agroforestry systems. However, few studies have evaluated how different trees used in those systems affect the dynamics and abundance of insects. The present study evaluated the entomofauna assemblages associated with different combinations of four timber-yielding trees and four Criollo cacao cultivars established in a lowland tropical ecosystem in Venezuela. A randomized block design with two replicates was used, each block having 16 plots which included all 16 possible combinations of four native timber trees ( Cordia thaisiana , Cedrela odorata , Swietenia macrophylla , and Tabebuia rosea ) and four Criollo cacao cultivars (Porcelana, Guasare, Lobatera and Criollo Merideño). Insects were collected with yellow pan traps and sorted to order. Coleoptera and parasitoid Hymenoptera were determined to the family level. In total, 49,538 individuals of seven orders were collected, with Hymenoptera, Diptera, and Hemiptera being the most abundant, although only Lepidoptera and Coleoptera abundances were significantly influenced by the timber tree species. Twenty-three families of parasitoid Hymenoptera and 26 of Coleoptera were found. Significant differences in insects’ assemblages were found both in parasitoid Hymenoptera and Coleoptera families associated to every shade tree, with the families Eulophidae and Lycidae being indicators for Cordia , and Chalcididae for Swietenia . The entomofauna relationship with the cacao cultivar was barely significant, although Scydmaenidae and Scarabaeidae were indicators for Lobatera and Merideño, respectively. No significant effects were found for interaction with cacao cultivars and native trees. We concluded that the particular insect assemblages found in Cedrela odorata and Cordia
Directory of Open Access Journals (Sweden)
Marina Mazón
2018-04-01
Full Text Available Agroforestry systems are environment-friendly production systems which help to preserve biodiversity while providing people with a way of earning a living. Cacao is a historically important crop in Venezuela that traditionally has been produced in agroforestry systems. However, few studies have evaluated how different trees used in those systems affect the dynamics and abundance of insects. The present study evaluated the entomofauna assemblages associated with different combinations of four timber-yielding trees and four Criollo cacao cultivars established in a lowland tropical ecosystem in Venezuela. A randomized block design with two replicates was used, each block having 16 plots which included all 16 possible combinations of four native timber trees (Cordia thaisiana, Cedrela odorata, Swietenia macrophylla, and Tabebuia rosea and four Criollo cacao cultivars (Porcelana, Guasare, Lobatera and Criollo Merideño. Insects were collected with yellow pan traps and sorted to order. Coleoptera and parasitoid Hymenoptera were determined to the family level. In total, 49,538 individuals of seven orders were collected, with Hymenoptera, Diptera, and Hemiptera being the most abundant, although only Lepidoptera and Coleoptera abundances were significantly influenced by the timber tree species. Twenty-three families of parasitoid Hymenoptera and 26 of Coleoptera were found. Significant differences in insects’ assemblages were found both in parasitoid Hymenoptera and Coleoptera families associated to every shade tree, with the families Eulophidae and Lycidae being indicators for Cordia, and Chalcididae for Swietenia. The entomofauna relationship with the cacao cultivar was barely significant, although Scydmaenidae and Scarabaeidae were indicators for Lobatera and Merideño, respectively. No significant effects were found for interaction with cacao cultivars and native trees. We concluded that the particular insect assemblages found in Cedrela odorata
Differential gene expression by Moniliophthora roreri while overcoming cacao tolerance in the field.
Bailey, Bryan A; Melnick, Rachel L; Strem, Mary D; Crozier, Jayne; Shao, Jonathan; Sicher, Richard; Phillips-Mora, Wilberth; Ali, Shahin S; Zhang, Dapeng; Meinhardt, Lyndel
2014-09-01
Frosty pod rot (FPR) of Theobroma cacao (cacao) is caused by the hemibiotrophic fungus Moniliophthora roreri. Cacao clones tolerant to FPR are being planted throughout Central America. To determine whether M. roreri shows a differential molecular response during successful infections of tolerant clones, we collected field-infected pods at all stages of symptomatology for two highly susceptible clones (Pound-7 and CATIE-1000) and three tolerant clones (UF-273, CATIE-R7 and CATIE-R4). Metabolite analysis was carried out on clones Pound-7, CATIE-1000, CATIE-R7 and CATIE-R4. As FPR progressed, the concentrations of sugars in pods dropped, whereas the levels of trehalose and mannitol increased. Associations between symptoms and fungal loads and some organic and amino acid concentrations varied depending on the clone. RNA-Seq analysis identified 873 M. roreri genes that were differentially expressed between clones, with the primary difference being whether the clone was susceptible or tolerant. Genes encoding transcription factors, heat shock proteins, transporters, enzymes modifying membranes or cell walls and metabolic enzymes, such as malate synthase and alternative oxidase, were differentially expressed. The differential expression between clones of 43 M. roreri genes was validated by real-time quantitative reverse transcription polymerase chain reaction. The expression profiles of some genes were similar in susceptible and tolerant clones (other than CATIE-R4) and varied with the biotrophic/necrotropic shift. Moniliophthora roreri genes associated with stress metabolism and responses to heat shock and anoxia were induced early in tolerant clones, their expression profiles resembling that of the necrotrophic phase. Moniliophthora roreri stress response genes, induced during the infection of tolerant clones, may benefit the fungus in overcoming cacao defense mechanisms. © 2014 BSPP AND JOHN WILEY & SONS LTD.
Laconi, Erika B; Jayanegara, Anuraga
2015-03-01
Cocoa pod is among the by-products of cocoa (Theobroma cacao) plantations. The aim of this study was to apply a number of treatments in order to improve nutritional quality of cocoa pod for feeding of ruminants. Cocoa pod was subjected to different treatments, i.e. C (cocoa pod without any treatment or control), CAm (cocoa pod+1.5% urea), CMo (cocoa pod+3% molasses), CRu (cocoa pod+3% rumen content) and CPh (cocoa pod+3% molasses+Phanerochaete chrysosporium inoculum). Analysis of proximate and Van Soest's fiber fraction were performed on the respective treatments. The pods were then subjected to an in vitro digestibility evaluation by incubation in rumen fluid-buffer medium, employing a randomized complete block design (n = 3 replicates). Further, an in vivo evaluation of the pods (35% inclusion level in total mixed ration) was conducted by feeding to young Holstein steers (average body weight of 145±3.6 kg) with a 5×5 latin square design arrangement (n = 5 replicates). Each experimental period lasted for 30 d; the first 20 d was for feed adaptation, the next 3 d was for sampling of rumen liquid, and the last 7 d was for measurements of digestibility and N balance. Results revealed that lignin content was reduced significantly when cocoa pod was treated with urea, molasses, rumen content or P. chrysosporium (pCAm>CRu>CMo. Among all treatments, CAm and CPh treatments significantly improved the in vitro dry matter and organic matter digestibility (pcocoa pod. Average daily gain of steers receiving CAm or CPh treatment was significantly higher than that of control (pcocoa pod.
Hipólito-Romero, E; Carcaño-Montiel, M G; Ramos-Prado, J M; Vázquez-Cabañas, E A; López-Reyes, L; Ricaño-Rodríguez, J
Cocoa plant (Theobroma cacao L.) is native from South America and it represents one of the most significant "bio-cultural" resources of Mesoamerica, since it is a region where it was domesticated and had a relevance as ritual drink and as currency in many pre-hispanic cultures until the arrival of the Spaniards who spread its use worldwide, and became it one of the most consumed commodity goods. Through this research, an alternative is proposed to address the problem of cultivars through the introduction of a wide variety of cocoa plants in traditional agroforestry systems, in synergy with the inoculation of nitrogen-fixing and insoluble phosphor solubilizing edaphic bacterial consortia. Four cultivars of improved grafted cocoa plants were introduced in a traditional agroforestry plot and three fertilization treatments were applied: application of biofertilizer, application of chemical fertilizer and control. Measurements of height, stem diameter, number of leaves and branches were recorded at 2 and 12 months after planting and rhizosphere microbial populations were characterized. Growth results showed good potential for all studied cultivars and it was observed that biofertilization foresees significant effects in some of the growth indicators of cocoa plant. Thereby, plant associations in an agroforestry system could be favorable to promote fruit development and resistance to pests and diseases. Copyright © 2017 Asociación Argentina de Microbiología. Publicado por Elsevier España, S.L.U. All rights reserved.
Directory of Open Access Journals (Sweden)
Hugo Alexander Roa Romero
2009-09-01
Full Text Available Se determinó la abundancia, riqueza, importancia, equidad y diversidad de los árboles encontrados en sistemas agroforestales de cacao, del Soconusco, Chiapas, México. La presente investigación, se desarrolló en la región costera del Soconusco, ubicada al sur del estado de Chiapas; se muestrearon los municipios de Huehuetán, Tapachula y Tuxtla Chico, por ser los más representativos en área sembrada de cacao. En cada municipio, se establecieron al azar siete parcelas temporales de 50 x 50 m cada una, lo que suma en total 5,25 hectáreas, en las cuales se registraron variables como el diámetro a la altura del pecho (DAP: 1,3 m sobre el nivel del suelo, área basal, y sombrío en el cacaotal. Se encontraron 46 especies agrupadas en 21 familias, las especies con el mayor valor de importancia fueron Mangifera indica y Pouteria sapota, convirtiéndose en las especies de sombra más frecuentemente encontradas. La composición florística denotó una mayor similitud en los municipios de Tapachula y Huehuetán, como lo muestra el mayor porcentaje del índice de Jaccard y en lo que respecta a diversidad, el municipio de Tuxtla Chico presentó el mayor valor según el índice de Shannon. Este estudio determina la existencia de una cobertura definitiva de preferencia asociada a los árboles frutales.
Directory of Open Access Journals (Sweden)
Oscar Oswaldo Prieto-Benavides
2012-01-01
Full Text Available El objetivo de este trabajo fue aislar e identificar hongos formadores de micorriza arbuscular asociados a sistemas agroforestales con cacao (Theobroma cacao L.. Se muestrearon cinco sistemas ubicados en fincas de la zona central del trópico húmedo ecuatoriano, en la provincia de Los Ríos, en los cantones Quevedo y Valencia: fincas La Represa, La Propiedad, La Unión, Fátima y Mi Recuerdo. Las muestras de suelo y raíces se recolectaron en la época seca entre los meses de junio y diciembre del 2009. Los géneros de hongos micorrízicos arbusculares encontrados fueron los siguientes: Gigaspora, Acaulospora, Glomus y Scutellospora. En todos los sitios muestreados el género con mayor representatividad en cantidad de esporas encontradas por gramo de suelo fue Glomus, mientras que para Gigaspora hubo la menor cantidad de esporas. También se evaluó el porcentaje de colonización micorrízica existente en T. cacao donde el mayor porcentaje de densidad de colonización se encontró en las muestras recolectadas de las fincas Mi Recuerdo y La Unión, y el menor porcentaje en la finca La Propiedad.
Origin and domestication of native Amazonian crops
Clément, R. Charles; De Cristo-Araujo, Michelly; Coppens D'Eeckenbrugge, Géo; Alves Pereira, Allessandro; Picanço-Rodrigues, Doriane
2010-01-01
Molecular analyses are providing new elements to decipher the origin, domestication and dispersal of native Amazonian crops in an expanding archaeological context. Solid molecular data are available for manioc (Manihot esculenta), cacao (Theobroma cacao), pineapple (Ananas comosus), peach palm (Bactris gasipaes) and guaraná (Paullinia cupana), while hot peppers (Capsicum spp.), inga (Inga edulis), Brazil nut (Bertholletia excelsa) and cupuassu (Theobroma grandiflorum) are being studied. Emerg...
Directory of Open Access Journals (Sweden)
Jorge Enrique Villamil Carvajal
2012-06-01
Full Text Available Resumen. La moniliasis, causada por Moniliophthora roreri Cif & Par, se ha convertido en la principal enfermedad limitante de la producción de cacao en Colombia y otros países. Con el objetivo de explorar alternativas para el biocontrol de esta enfermedad, hongos y bacterias aislados de frutos y suelo rizosférico de lotes plantados con cacao fueron evaluados por su antagonismo contra M. roreri. La evaluación se realizó en cajas Petri con PDA, para lo cual se colocó en el centro de las mismas, un disco de 5 mm de diámetro colonizado por el patógeno y a 3 cm del borde, sobre los ejes horizontal y vertical, cada uno de los aislamientos. Los microorganismos nativos que inicialmente mostraron antagonismo fueron posteriormente evaluados in vitro por su capacidad de restringir el crecimiento y esporulación de M. roreri. Los resultados indicaron que de 53 aislamientos de frutos y suelo rizosférico, 7 mostraron antagonismo contra M. roreri y entre ellos los más efectivos fueron los hongos H5 y H20 y la bacteria B3, los hongos para la restricción tanto del crecimiento como de la esporulación y la bacteria para el crecimiento. El hongo H20 inhibió en su totalidad el crecimiento de M. roreri. Estos resultados hacen posible que estos aislamientos sean promisorios para su incorporación al manejo de la enfermedad bajo condiciones de campo. De acuerdo con la caracterización morfológica y las pruebas bioquímicas los hongos pertenecen al género Trichoderma y la bacteria al género Bacillus.Abstract. The moniliasis, caused by Moniliophthora roreri Cif & Par, has become the principal disease limiting cocoa production in Colombia and other countries. With the objective of exploring alternatives for the biocontrol of this disease, fungi and bacteria isolated from cocoa fruits and rhizospheric soil from plots planted to cocoa trees were evaluated for their antagonism against M. roreri. The evaluation was conducted in Petri dishes containing PDA, by
Martínez Botello, Darwin Hernando
2015-01-01
La moniliasis del Cacao producida por Moniliophthora roreri, es un hongo basidiomiceto considerado como la enfermedad potencial más limitante de la producción en el cultivo en Colombia. La respuesta de defensa frente a su infección actualmente es considerada como susceptible en todos los materiales comerciales utilizados para el cultivo en el mundo. En Colombia, recientemente se han identificado algunos materiales regionales con un comportamiento fitosanitario en campo favorabl...
Zhang, Dapeng; Arevalo-Gardini, Enrique; Mischke, Sue; Zúñiga-Cernades, Luis; Barreto-Chavez, Alejandro; Del Aguila, Jorge Adriazola
2006-09-01
Cocoa (Theobroma cacao) is indigenous to the Amazon region of South America, and it is well known that the Peruvian Amazon harbours a large number of diverse cocoa populations. A small fraction of the diversity has been collected and maintained as an ex-situ germplasm repository in Peru. However, incorrect labelling of accessions and lack of information on genetic diversity have hindered efficient conservation and use of this germplasm. This study targeted assessment of genetic diversity and population structure in a managed and a semi-natural population. Using a capillary electrophoresis genotyping system, 105 cocoa accessions collected from the Huallaga and Ucayali valleys of Peru were fingerprinted. Based on 15 loci SSR profiles, genetic identity was examined for each accession and duplicates identified, population structure assessed and genetic diversity analysed in these two populations. Ten synonymous mislabelled groups were identified among the 105 accessions. The germplasm group in the Huallaga valley was clearly separated from the group in Ucayali valley by the Bayesian assignment test. The Huallaga group has lower genetic diversity, both in terms of allelic richness and of gene diversity, than the Ucayali group. Analysis of molecular variance suggested genetic substructure in the Ucayali group. Significant spatial correlation between genetic distance and geographical distances was detected in the Ucayali group by Mantel tests. These results substantiate the hypothesis that the Peruvian Amazon hosts a high level of cocoa genetic diversity, and the diversity has a spatial structure. The introduction of exotic seed populations into the Peruvian Amazon is changing the cocoa germplasm spectrum in this region. The spatial structure of cocoa diversity recorded here highlights the need for additional collecting and conservation measures for natural and semi-natural cocoa populations.
Directory of Open Access Journals (Sweden)
Yina Jazbleidi Puentes-Páramo
2016-06-01
Full Text Available La investigación tuvo como objetivo evaluar la eficiencia fisiológica de N-P-K en clones de cacao de sabor y aroma autocompatible (CCN-51, ICS-95 y autoincompatible: (TSH-565, ICS-39, con la finalidad de determinar la capacidad de producción de grano seco por unidad de nutriente absorbido. Se utilizó un diseño en bloques completos al azar con cinco tratamientos y cuatro repeticiones, los tratamientos fueron diseñados a partir del nivel de fertilidad natural del suelo (TR-Tratamiento de referencia y sobre este el 25, 50, 75 y 100% más de Nitrógeno-Fósforo-Potasio (N-P-K, correspondiente al T1, T2, T3 y T4. Los resultados evidencian que hay diferencias altamente significativas entre clones para los nutrientes N-P-K absorbidos, exhibiendo mayor absorción de nitrógeno, seguido de potasio y por ultimo fósforo, en este sentido, el clon autocompatible CCN-51 mostro mayor habilidad de absorción para la mayoría de nutrientes, excepto fósforo, sin embargo, no es generalizada la mayor habilidad para clones autocompatibles con respecto a clones autoincompatibles. La mayor eficiencia fisiológica de uso de nutrientes N-P-K se presentó en el tratamiento uno y la menor capacidad de producción de grano seco de cacao por unidad de nutriente se presentó con la dosis nutricional más alta en el tratamiento cuatro, lo cual sugiere que a mayor dosis disminuye la eficiencia fisiológica de uso de nitrógeno, fósforo y potasio de los clones.
Mondego, Jorge M C; Carazzolle, Marcelo F; Costa, Gustavo G L; Formighieri, Eduardo F; Parizzi, Lucas P; Rincones, Johana; Cotomacci, Carolina; Carraro, Dirce M; Cunha, Anderson F; Carrer, Helaine; Vidal, Ramon O; Estrela, Raíssa C; García, Odalys; Thomazella, Daniela P T; de Oliveira, Bruno V; Pires, Acássia Bl; Rio, Maria Carolina S; Araújo, Marcos Renato R; de Moraes, Marcos H; Castro, Luis A B; Gramacho, Karina P; Gonçalves, Marilda S; Neto, José P Moura; Neto, Aristóteles Góes; Barbosa, Luciana V; Guiltinan, Mark J; Bailey, Bryan A; Meinhardt, Lyndel W; Cascardo, Julio Cm; Pereira, Gonçalo A G
2008-11-18
The basidiomycete fungus Moniliophthora perniciosa is the causal agent of Witches' Broom Disease (WBD) in cacao (Theobroma cacao). It is a hemibiotrophic pathogen that colonizes the apoplast of cacao's meristematic tissues as a biotrophic pathogen, switching to a saprotrophic lifestyle during later stages of infection. M. perniciosa, together with the related species M. roreri, are pathogens of aerial parts of the plant, an uncommon characteristic in the order Agaricales. A genome survey (1.9x coverage) of M. perniciosa was analyzed to evaluate the overall gene content of this phytopathogen. Genes encoding proteins involved in retrotransposition, reactive oxygen species (ROS) resistance, drug efflux transport and cell wall degradation were identified. The great number of genes encoding cytochrome P450 monooxygenases (1.15% of gene models) indicates that M. perniciosa has a great potential for detoxification, production of toxins and hormones; which may confer a high adaptive ability to the fungus. We have also discovered new genes encoding putative secreted polypeptides rich in cysteine, as well as genes related to methylotrophy and plant hormone biosynthesis (gibberellin and auxin). Analysis of gene families indicated that M. perniciosa have similar amounts of carboxylesterases and repertoires of plant cell wall degrading enzymes as other hemibiotrophic fungi. In addition, an approach for normalization of gene family data using incomplete genome data was developed and applied in M. perniciosa genome survey. This genome survey gives an overview of the M. perniciosa genome, and reveals that a significant portion is involved in stress adaptation and plant necrosis, two necessary characteristics for a hemibiotrophic fungus to fulfill its infection cycle. Our analysis provides new evidence revealing potential adaptive traits that may play major roles in the mechanisms of pathogenicity in the M. perniciosa/cacao pathosystem.
A genome survey of Moniliophthora perniciosa gives new insights into Witches' Broom Disease of cacao
Directory of Open Access Journals (Sweden)
Bailey Bryan A
2008-11-01
Full Text Available Abstract Background The basidiomycete fungus Moniliophthora perniciosa is the causal agent of Witches' Broom Disease (WBD in cacao (Theobroma cacao. It is a hemibiotrophic pathogen that colonizes the apoplast of cacao's meristematic tissues as a biotrophic pathogen, switching to a saprotrophic lifestyle during later stages of infection. M. perniciosa, together with the related species M. roreri, are pathogens of aerial parts of the plant, an uncommon characteristic in the order Agaricales. A genome survey (1.9× coverage of M. perniciosa was analyzed to evaluate the overall gene content of this phytopathogen. Results Genes encoding proteins involved in retrotransposition, reactive oxygen species (ROS resistance, drug efflux transport and cell wall degradation were identified. The great number of genes encoding cytochrome P450 monooxygenases (1.15% of gene models indicates that M. perniciosa has a great potential for detoxification, production of toxins and hormones; which may confer a high adaptive ability to the fungus. We have also discovered new genes encoding putative secreted polypeptides rich in cysteine, as well as genes related to methylotrophy and plant hormone biosynthesis (gibberellin and auxin. Analysis of gene families indicated that M. perniciosa have similar amounts of carboxylesterases and repertoires of plant cell wall degrading enzymes as other hemibiotrophic fungi. In addition, an approach for normalization of gene family data using incomplete genome data was developed and applied in M. perniciosa genome survey. Conclusion This genome survey gives an overview of the M. perniciosa genome, and reveals that a significant portion is involved in stress adaptation and plant necrosis, two necessary characteristics for a hemibiotrophic fungus to fulfill its infection cycle. Our analysis provides new evidence revealing potential adaptive traits that may play major roles in the mechanisms of pathogenicity in the M. perniciosa/cacao
Cocoa/Cotton Comparative Genomics
With genome sequence from two members of the Malvaceae family recently made available, we are exploring syntenic relationships, gene content, and evolutionary trajectories between the cacao and cotton genomes. An assembly of cacao (Theobroma cacao) using Illumina and 454 sequence technology yielded ...
Directory of Open Access Journals (Sweden)
Fazzatul Rahmi
2017-04-01
Full Text Available Abstrak. Fermentasi merupakan kegiatan untuk melepaskan zat lendir dari permukaan kulit biji dan menghasilkan biji mutu dan aroma yang baik. Selain itu fermentasi juga dilakukan untuk menghindari tumbuhnya jamur selama masa penyimpanan. Selama fermentasi berlangsung akan terjadinya perpindahan panas/ suhu di dalam kotak fermentasi. Tujuan yang ingin dicapai dalam penelitian yaitu untuk melihat perubahan suhu selama proses fermentasi, mengetahui pengaruh bahan kotak (kayu dan styrofoam terhadap perpindahan panas di dalam kotak fermentasi dan perpindahan panas dari dalam kotak fermentasi terhadap lingkungan luar. Hasil penelitian yang diperoleh bahwa suhu ideal fermentasi pada kotak kayu dihasilkan pada hari ke-5, sedangkan kotak styrofoam suhu ideal dihasilkan pada hari ke-3. Perpindahan panas pada bahan kayu suhunya lebih tinggi dibandingkan dengan bahan styrofoam. Hal ini disebabkan karena panas pada kotak kayu keluar lebih cepat, sehingga suhu pada proses fermentasi bisa lebih rendah dibandingkan menggunakan kotak styrofoam. Hasil fermentasi biji kakao dengan menggunakan kotak kayu didapatkan biji kakao yang bagus yaitu pada hari ke-5 fermentasi dan kotak styrofoam pada hari ke-5 fermentasi didapatkan biji kakao yang berjamur. Analysis Of Transfer Heat Room Of Cocoa Seed Fermentation (Theobroma cacao L. Using Wood Box and Styrofoam Abstract. Fermentation is an activity to remove mucous substances from the skin surface to produce quality of seed and good aroma. In addition, fermentation also done to avoid the growth of mold during storage period. During fermentation, the heat transfer / temperature will be happen inside the fermentation box. The aim of this study is to observe the changes of temperature during the fermentation process, knowing the effect of packaging materials (wood and styrofoam to heat transfer in the fermentation box and heat transfer from inside of fermentation box to the environment in the outside. The results showed
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.110 Cacao nibs. (a... is “cacao nibs”, “cocoa nibs”, or “cracked cocoa”. (1) When the cacao nibs, or the cacao beans from...
Directory of Open Access Journals (Sweden)
RAMADHANIL PITOPANG
2012-10-01
Full Text Available We presented the structure and composition of vegetation in four (4 different land use types namely undisturbed primary forest, lightly disturbed primary forest, selectively logged forest, and cacao forest garden in tropical rainforest margin of the Lore Lindu National Park, Central Sulawesi Indonesia. Individually all big trees (dbh > 10 cm was numbered with tree tags and their position in the plot mapped, crown diameter and dbh measured, whereas trunk as well as total height measured by Vertex. Additionally, overstorey plants (dbh 2- 9.9 cm were also surveyed in all land use types. Identification of vouchers and additional herbarium specimens was done in the field as well as at Herbarium Celebense (CEB, Tadulako University, and Nationaal Herbarium of Netherland (L Leiden branch, the Netherland. The result showed that the structure and composition of vegetation in studied are was different. Tree species richness was decreased from primary undisturbed forest to cacao plantation, whereas tree diversity and its composition were significantly different among four (4 land use types. Palaquium obovatum, Chionanthus laxiflorus, Castanopsis acuminatissima, Lithocarpus celebicus, Canarium hirsutum, Eonymus acuminifolius and Sarcosperma paniculata being predominant in land use type A, B and C and Coffea robusta, Theobroma cacao, Erythrina subumbrans, Glyricidia sepium, Arenga pinnata, and Syzygium aromaticum in the cacao plantation. At the family level, undisturbed natural forest was dominated by Fagaceae and Sapotaceae disturbed forest by Moraceae, Sapotaceae, Rubiaceae, and agroforestry systems by Sterculiaceae and Fabaceae.
Aspergillus oryzae was isolated as an endophyte from coffee leaves and found to produce kojic acid in culture. When inoculated in cacao seedlings (Theobroma cacao L.), A. oryzae grew endophytically and synthesize kojic acid in planta. Cacao seedlings inoculated with A. oryzae produced higher levels...
Differential expression of the lethal gene Luteus-Pa in cacao of the Parinari series.
Rehem, B C; Almeida, A-A F; Figueiredo, G S F; Gesteira, A S; Santos, S C; Corrêa, R X; Yamada, M M; Valle, R R
2016-02-22
The recessive lethal character Luteus-Pa is found in cacao (Theobroma cacao) genotypes of the Parinari series (Pa) and is characterized by expression of leaf chlorosis and seedling death. Several genotypes of the Pa series are bearers of the gene responsible for the expression of the Luteus-Pa character, which can be used as a tool for determining relationships between genotypes of this group. To evaluate this phenomenon, we analyzed the differential expression of genes between mutant seedlings and wild-type hybrid Pa 30 x 169 seedlings, with the aim of elucidating the possible lethal mechanisms of the homozygous recessive character Luteus-Pa. Plant material was harvested from leaves of wild and mutant seedlings at different periods to construct a subtractive library and perform quantitative analysis using real-time PCR. The 649 sequences obtained from the subtractive library had an average length of 500 bp, forming 409 contigs. The probable proteins encoded were grouped into 10 functional categories. Data from ESTs identified genes associated with Rubisco, peroxidases, and other proteins and enzymes related to carbon assimilation, respiration, and photosystem 2. Mutant seedlings were characterized by synthesizing defective PsbO and PsbA proteins, which were overexpressed from 15 to 20 days after seedling emergence.
Directory of Open Access Journals (Sweden)
Amang, J.
2005-01-01
Full Text Available Feeding Preferences of Sahlbergella singularis Hagl. (Hemiptera: Miridae to some Cocoa (Theobroma cacao L. Clones. The selection of cocoa clones, resistant to Sahlbergella singularis Hagl. was done in the laboratory according to the standardized method of indoor microtests based on the study of mirid feeding preferences. Fourteen cocoa clones were involved. The Sca6 clone was the control. An index (i which expresses the ratio of the number of stings on the clone to that obtained on the control was calculated for each cultivar. Which has enabled to quantify the levels of attractiveness of cocoa clones to S. singularis and to classify these clones in three groups: less attractive clones (i< 1, non different (i= 1 and more attractive (i> 1. The results obtained showed that the mean numbers of feeding stings on the control (tr ranged from 5.49 to 5.62 (5.49≤ tr≤ 5.62 and that obtained on the other clones (tc from 5.29 to 6.18 (5.29≤ tc ≤ 6.18. The Na33 clone had the highest stings mean number (6.18 and IFC 100 the lowest one (5.29. The High Amazonian clone Na33 was the most attractive and the clones ICS100, IFC100, (exotic trinitario, Sca12 (catongo and Na32 (High Amazonian were less attractive. On the other hand the clones IFC1363, IFC1362, IFC1374 (catongo, UPA337, T60/887, ICS1 and IMC60 (High Amazonians and ICS95 (exotic trinitario were non different. The reactivity seemed not depending on the origin of the clone. Save the High Amazonian clone Na33 which was the most attractive there were among non different and less attractive clones as well exotic trinitario, catongo as High Amazonians.
Directory of Open Access Journals (Sweden)
A. Alejandro-Lázaro
2015-01-01
Full Text Available La embriogénesis somática aplicada para la propagación clonal de plantas de cacao, aun es de baja eficiencia, por lo que el objetivo de esta investigación fue evaluar la respuesta de los cotiledones procedentes de embriones somáticos primarios como fuente de explante para inducir embriogénesis somática secundaria (ESS en presencia de fitohormonas y sin estas en el genotipo de cacao inifap 1, asi como describir los eventos de la ESS desde los 30 hasta los 240 días de cultivo. El uso de las fitohormonas ácido 2,4-Diclorofenoxiácetico (2,4-D y thidiazuron (TDZ son importantes para inducir la embriogénesis somática (ES primaria en cacao. Adicionalmente para generar la ESS se han utilizado fitohormonas. En la presente investigación, fueron establecidos cuatro tratamientos con fregmentos de cotiledón, con 2,4-D y TDZ en forma combinada e independiente, incluyendo un testigo sin fitohormonas. Los resultados mostraron, que los fragmentos de cotiledón cultivados sin fitohormonas favorece la ESS, obteniendo un promedio de seis embriones somáticos secundarios (ESs a los 210 días de cultivo contra uno para el tratamiento suplementado con TDZ. El meristemo apical y radicular se presentó en un periodo de 240 días, se observaron embriones somáticos con estructuras externas como: cotiledones, ápices y raíces. Los resultados mostraron que la exclusión del 2,4-D y el thidiazuron no son importantes para inducir la ESS. El mayor número de ESs se encontró en un medio desprovisto de fitohormonas por lo que esta información es relevante, debido a que los explantes de cotiledones procedentes de embriones somáticos primarios, generan mayor número de ESs en esta especie. Estos resultados constituyen el primer reporte de la inducción de la ESs sin fitohormonas.
PRENDIMIENTO DE DOS TIPOS DE INJERTOS EN CACAO EN DISTINTAS FASES LUNARES, SIUNA 2014
Directory of Open Access Journals (Sweden)
Mario Reyes Martínez
2016-05-01
Full Text Available Sin duda, los productores saben de la influencia lunar y sobre el movimiento de la savia en las plantas en determinados momentos, debido a los conocimientos ancestrales y experiencias adquiridas. Sin embargo, en relación al prendimiento de injertos en cacao (Theobroma cacao, existen pocos estudios científicos que demuestren tales efectos. El objetivo principal del estudio fue comparar los efectos de las fases lunares en el prendimiento de dos tipos de injertos en cacao. Para ello se utilizó un diseño completamente al azar con arreglo bifactorial, con tres repeticiones por cada una de las fases y un universo de 576 plantas. La variable de medición únicamente fue el prendimiento de las plantas que se injertaron. Los datos fueron procesados en el programa Statistical Product and Service Solutions (SPSS versión 21 y se sometieron al análisis de varianza ANDEVA con un nivel de confianza del 95%. Los análisis revelan que existen diferencias significativas para las técnicas de injertación (p=0.011<0.05 y se obtuvo mayores prendimientos en los injertos de yema sobre los de bisel. Con respecto al efecto de las fases lunares sobre los dos tipos de injertos no se encontró evidencia estadística (p=0.950>0.05. En base al análisis combinado de varianza no existen diferencias significativas para la interacción fases lunares y técnicas de injertación puesto que (p=0.761>0.05. Summary There is no doubt the producers know of the moon influence and the sap movement in plants at certain moments, due to the ancestral knowledge and experiences gained. However, in relation to the root taking of grafts in cocoa (Theobroma cacao, there are few scientific studies that demonstrate such effects. The main objective of this study was to compare the effects of moon phases in the root taking of two types of grafts in cocoa. To do this we used a complete randomized design with bifactorial order, with three replays for each of the phases and a universe of 576
Influence of gamma irradiation on pollen viability, germination ability ...
African Journals Online (AJOL)
STORAGESEVER
2009-12-15
Dec 15, 2009 ... minor cross-incompatibilities and physiological studies of incompatibility ... campanula shape of the flowers attractive for insect. (bees are ..... irradiation of cacao (Theobroma cacao L.) pollen: Effect on pollen grain viability ...
Quevedo Damián, Isaí
2012-01-01
La moniliasis causada por Moniliophthora roreri, es una de las enfermedades más destructivas del cacao en América. Afecta exclusivamente al fruto en cualquier etapa de desarrollo, causando pérdidas de hasta el 100% de la producción. Las prácticas culturales han sido el método más aplicado para el combate de la enfermedad, por lo que la selección de fungicidas adecuados contra M. roreri que puedan ser incluidos en programas de manejo de la enfermedad. El objetivo de la presente investigación f...
African Journals Online (AJOL)
Mimi
Protein, reducing sugars, non-reducing sugars and total sugars decreased significantly .... The principal factors .... Statgraphics software version 3.0 (STSC, Inc., Rockville, MD, USA) was used to ..... Cervantes E and ME Jaramillo-Flores Dynamics of volatile and non-volatile ... processes using principal components analysis.
African Journals Online (AJOL)
SAM
2014-07-16
Jul 16, 2014 ... 1Laboratory of Plant Physiology, Department of Biological Sciences, Higher Teacher's Training College. P. O. Box 47. Yaounde .... ground material was centrifuged at 6000 g for 20 min. The ..... Coffee, cocoa, tea. 20:97-115.
Oboh, Ganiyu; Ademosun, Ayokunle O; Ademiluyi, Adedayo O; Omojokun, Olasunkanmi S; Nwanna, Esther E; Longe, Kuburat O
2014-01-01
Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.
Directory of Open Access Journals (Sweden)
Ganiyu Oboh
2014-01-01
Full Text Available Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH, 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid (ABTS, hydroxyl (OH, and nitric oxide (NO] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL, α-glucosidase (1.84 ± 0.17 mg/mL, and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart] activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL, NO (6.98 ± 0.886 mg/mL, OH (3.72 ± 0.26 mg/mL, and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension.
Ademosun, Ayokunle O.; Ademiluyi, Adedayo O.; Omojokun, Olasunkanmi S.; Nwanna, Esther E.; Longe, Kuburat O.
2014-01-01
Background. This study sought to investigate the antidiabetic and antihypertensive mechanisms of cocoa (Theobroma cacao) bean through inhibition of α-amylase, α-glucosidase, angiotensin-1 converting enzyme, and oxidative stress. Methodology. The total phenol and flavonoid contents of the water extractable phytochemicals from the powdered cocoa bean were determined and the effects of the extract on α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities were investigated in vitro. Furthermore, the radicals [1,1-diphenyl-2 picrylhydrazyl (DPPH), 2,2..-azino-bis(3-ethylbenzthiazoline-6-sulphonic acid) (ABTS), hydroxyl (OH), and nitric oxide (NO)] scavenging ability and ferric reducing antioxidant property of the extract were assessed. Results. The results revealed that the extract inhibited α-amylase (1.81 ± 0.22 mg/mL), α-glucosidase (1.84 ± 0.17 mg/mL), and angiotensin-1 converting enzyme (0.674 ± 0.06 mg/mL [lungs], 1.006 ± 0.08 mg/mL [heart]) activities in a dose-dependent manner and also showed dose-dependent radicals [DPPH (16.94 ± 1.34 mg/mL), NO (6.98 ± 0.886 mg/mL), OH (3.72 ± 0.26 mg/mL), and ABTS (15.7 ± 1.06 mmol/TEAC·g] scavenging ability. Conclusion. The inhibition of α-amylase, α-glucosidase, and angiotensin-1 converting enzyme activities by the cocoa bean extract could be part of the possible mechanism by which the extract could manage and/or prevent type-2 diabetes and hypertension. PMID:25295218
Ayenor, G.K.; Huis, van A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.
2007-01-01
Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma
Ali, Shahin S.; Shao, Jonathan; Lary, David J.; Strem, Mary D.; Meinhardt, Lyndel W.; Bailey, Bryan A.
2017-01-01
Phytophthora megakarya (Pmeg) and Phytophthora palmivora (Ppal) cause black pod rot of Theobroma cacao L. (cacao). Of these two clade 4 species, Pmeg is more virulent and is displacing Ppal in many cacao production areas in Africa. Symptoms and species specific sporangia production were compared when the two species were co-inoculated onto pod pieces in staggered 24 h time intervals. Pmeg sporangia were predominantly recovered from pod pieces with unwounded surfaces even when inoculated 24 h after Ppal. On wounded surfaces, sporangia of Ppal were predominantly recovered if the two species were simultaneously applied or Ppal was applied first but not if Pmeg was applied first. Pmeg demonstrated an advantage over Ppal when infecting un-wounded surfaces while Ppal had the advantage when infecting wounded surfaces. RNA-Seq was carried out on RNA isolated from control and Pmeg and Ppal infected pod pieces 3 days post inoculation to assess their abilities to alter/suppress cacao defense. Expression of 4,482 and 5,264 cacao genes was altered after Pmeg and Ppal infection, respectively, with most genes responding to both species. Neural network self-organizing map analyses separated the cacao RNA-Seq gene expression profiles into 24 classes, 6 of which were largely induced in response to infection. Using KEGG analysis, subsets of genes composing interrelated pathways leading to phenylpropanoid biosynthesis, ethylene and jasmonic acid biosynthesis and action, plant defense signal transduction, and endocytosis showed induction in response to infection. A large subset of genes encoding putative Pr-proteins also showed differential expression in response to infection. A subset of 36 cacao genes was used to validate the RNA-Seq expression data and compare infection induced gene expression patterns in leaves and wounded and unwounded pod husks. Expression patterns between RNA-Seq and RT-qPCR were generally reproducible. The level and timing of altered gene expression was
Ekstraksi Pektin dari Kulit Kakao (Theobroma cacao L. Menggunakan Amonium Oksalat
Directory of Open Access Journals (Sweden)
Cut Erika
2013-06-01
Full Text Available Cocoa (Theobroma cocoa L is one of the local superior commodities in Aceh Province. The production of cocoa continues to increase significantly every year. Cocoa Pod husk is a waste product of cocoa beans industry, which is containing pectin with concentration ranged between 2-10%. Pectin extraction is one of the potential researches to increase economic value of cocoa pod husks. This study aimed to determine the effect of extraction time and pH on the characteristics of cocoa pod husk pectin. Pectin was extracted from cocoa pod husks using ammonium oxalate, extraction time (60 and 120 min and pH (2.6, 3.6 and 4.6. The use of ammonium oxalate produced high yield of pectin ranged from 6.63 to 12.75%, moisture content was 7,36 to 10,77%, methoxyl content was 5.19 to 5.70%, anhydrogalacturonic acid of 59.84 to 63.14%, the esterification degree was 48.43 to 51.43 % and relative viscosity was 40 – 186,6 cP. The extraction time for 60 minutes at pH 3,6 showed a higher yield compared to 120 min at pH 4,6. Pectin on the extraction time of 60 minutes at pH 3.6 had the highest relative viscosity was 186,6 cP, and the lowest viscosity of pectin obtained at pH 2.6 and extraction time of 60 min which was 40 cP. Keywords: cocoa pod husks, ammonium oxalate, extraction time, pH
Evaluation of fertilizer application on some peasant cocoa farms in ...
African Journals Online (AJOL)
Theobroma cacao L.) on peasant farms in Ghana. The objective of the trial is to evaluate the effect of fertilizer application on yields of cocoa (T. cacao L.) under peasant farmers' management in Ghana with the aim of introducing fertilizers to ...
Cacao breeding in Bahia, Brazil - strategies and results
Directory of Open Access Journals (Sweden)
Uilson Vanderlei Lopes
2011-01-01
Full Text Available Cacao was introduced in Bahia in 1756, becoming later the largest producer state in the country. In order to supportthe planting of cacao in the region, a breeding program was established by CEPEC at the beginning of the 1970s. For a long time,the program consisted in testing new hybrids (full-sibs and releasing a mixture of the best ones to farmers. Lately, particularly afterthe witches´ broom arrival in the region, in 1989, recurrent breeding strategies were implemented, aiming mainly the developmentof clones. From 1993 to 2010, more than 500 progenies, accumulating 30 thousand trees, were developed by crossing many parentswith resistance to witches´ broom, high yield and other traits. In this period, more than 500 clones were put in trials and 39 clonesand 3 hybrids were released to farmers. In this paper the strategies and results achieved by the program are reviewed. Overall theprogram has good interface with pathology and genomic programs.
The Age of Chocolate: a biogeographic history of Theobroma and Malvaceae
Directory of Open Access Journals (Sweden)
James Edward Richardson
2015-11-01
Full Text Available Dated molecular phylogenies of broadly distributed lineages can help to compare patterns of diversification in different parts of the world. An explanation for greater Neotropical diversity compared to other parts of the tropics is that it was an accident of the Andean orogeny. Using dated phylogenies, of chloroplast ndhF and nuclear DNA WRKY sequence datasets, generated using BEAST we demonstrate that the diversification of the genera Theobroma and Herrania occurred from 12.7 (11.6-14.9 [95% HPD] million years ago (Ma and thus coincided with Andean uplift from the mid-Miocene and that this lineage had a faster diversification rate than other major clades in Malvaceae. We also demonstrate that Theobroma cacao, the source of chocolate, diverged from its most recent common ancestor 9.9 (7.7-12.9 95% HPD Ma, in the mid-to late-Miocene, suggesting that this economically important species has had ample time to generate significant within-species genetic diversity that is useful information for a developing chocolate industry. In addition, we address questions related to the latitudinal gradient in species diversity within Malvaceae. A faster diversification rate is an explanation for the greater species diversity at lower latitudes. Alternatively, tropical conditions may have existed for longer and occupied greater areas than temperate ones meaning that tropical lineages have had more time and space in which to diversify. Our dated molecular phylogeny of Malvaceae demonstrated that at least one temperate lineage within the family diverged from tropical ancestors then diversified at a rate comparable with many tropical lineages in the family. These results are consistent with the hypothesis that Malvaceae are more species rich in the tropics because tropical lineages within the family have existed for longer and occupied more space than temperate ones, and not because of differences in diversification rate.
Protein (Viridiplantae): 417622 [PGDBj - Ortholog DB
Lifescience Database Archive (English)
Full Text Available 09 ... 214909:3609 ... 3640:3609 ... 3641:3609 ... Uncharacterized protein TCM_008191 Theobroma cacao MEETSLGLSFTKDENFREWYSEIYFVAVNSEMIECNDISSYYILRSRAISIGRLTCTFPAAVCTPEIKASFNILLRVNDVQ
Pereira Menezes, Sara; de Andrade Silva, Edson Mario; Matos Lima, Eline; Oliveira de Sousa, Aurizângela; Silva Andrade, Bruno; Santos Lima Lemos, Livia; Peres Gramacho, Karina; da Silva Gesteira, Abelmon; Pirovani, Carlos Priminho; Micheli, Fabienne
2014-06-11
The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively.
2014-01-01
Background The production and accumulation of pathogenesis-related proteins (PR proteins) in plants in response to biotic or abiotic stresses is well known and is considered as a crucial mechanism for plant defense. A pathogenesis-related protein 4 cDNA was identified from a cacao-Moniliophthora perniciosa interaction cDNA library and named TcPR-4b. Results TcPR-4b presents a Barwin domain with six conserved cysteine residues, but lacks the chitin-binding site. Molecular modeling of TcPR-4b confirmed the importance of the cysteine residues to maintain the protein structure, and of several conserved amino acids for the catalytic activity. In the cacao genome, TcPR-4b belonged to a small multigene family organized mainly on chromosome 5. TcPR-4b RT-qPCR analysis in resistant and susceptible cacao plants infected by M. perniciosa showed an increase of expression at 48 hours after infection (hai) in both cacao genotypes. After the initial stage (24-72 hai), the TcPR-4b expression was observed at all times in the resistant genotypes, while in the susceptible one the expression was concentrated at the final stages of infection (45-90 days after infection). The recombinant TcPR-4b protein showed RNase, and bivalent ions dependent-DNase activity, but no chitinase activity. Moreover, TcPR-4b presented antifungal action against M. perniciosa, and the reduction of M. perniciosa survival was related to ROS production in fungal hyphae. Conclusion To our knowledge, this is the first report of a PR-4 showing simultaneously RNase, DNase and antifungal properties, but no chitinase activity. Moreover, we showed that the antifungal activity of TcPR-4b is directly related to RNase function. In cacao, TcPR-4b nuclease activities may be related to the establishment and maintenance of resistance, and to the PCD mechanism, in resistant and susceptible cacao genotypes, respectively. PMID:24920373
Directory of Open Access Journals (Sweden)
Bruna Carmo Rehem
2009-09-01
Full Text Available O alagamento do solo pode promover alterações no metabolismo celular e causar desvios nas condições ótimas de crescimento das plantas, gerando uma condição de estresse. Objetivou-se no presente trabalho avaliar os efeitos do alagamento no crescimento e na nutrição mineral de seis clones de T. cacao (CP-49, CCN-10, CP-06, CEPEC-2007, CEPEC-2008 e PS-1319, para elucidar possíveis mecanismos de tolerância ao alagamento. Mudas clonais de T. cacao, com 6 meses de idade, foram submetidas ao alagamento, juntamente com o tratamento-controle (não alagado, por 30 dias. Observou-se, no final desse período, que o alagamento promoveu diminuição nas taxas de crescimento relativo radicular (exceto para CP-06 e de área foliar, acúmulo de matéria seca e incremento nas taxas de crescimento relativo caulinar (exceto para os clones CP-06 e CEPEC-2008 e assimilatória líquida (exceto para o clone alagado PS-1319 e de massa foliar específica para os clones CP-49, CCN-10 e CP-06. Os clones que sobreviveram aos 30 dias de alagamento apresentaram baixos valores de razão de área foliar. De modo geral, o alagamento do substrato acarretou deficiência na absorção de macro e micronutrientes minerais, exceto de Fe. Dentre os clones avaliados, o CP-49 foi tolerante e o CEPEC-2008 não tolerante ao alagamento. Os demais clones ficaram numa posição intermediária. Logo, o clone CP-49 tem grande potencial para ser cultivado em condições de alagamento.Soil flooding can induce changes in cell metabolism and cause deviations in optimum conditions for plant growth, creating a stress condition. The objective of this work was to evaluate the effects of flooding on growth and mineral nutrition of six T. cacao clones (CP-49, CCN-10, CP-06, CEPEC-2007, CEPEC-2008 and PS-1319, aiming to clarify the possible mechanisms of soil flooding tolerance. Plants of T. cacao with 6 months of age were subject to soil flooding, along with the control treatment (not flooded
Effect of pre-budwood collection treatment on budding success in ...
African Journals Online (AJOL)
The inconsistencies in success of budding exercises pose great problem in the rapid multiplication of desirable genotypes for germplasm, clonal plot and seed garden establishment in cacao, Theobroma cacao L. This study was carried out at Cocoa Research Institute of Nigeria, Ibadan to determine the effects of ...
Anti-Oxidative Polyphenolic Compounds of Cocoa.
Nabavi, Seyed F; Sureda, Antoni; Daglia, Maria; Rezaei, Parizad; Nabavi, Seyed M
2015-01-01
Oxidative stress plays a key role in the pathogenesis of different serious chronic diseases such as cancer, diabetes, cardiovascular and neurodegenerative disorders, etc. Recent research has been focused on the beneficial role of dietary antioxidants against oxidative stress both under in vitro and in vivo conditions. Theobroma cacao L. (cacao tree) is an evergreen tree which is native to South America. It is a plant of great economic importance and its seeds are commonly used to produce cocoa powder and chocolate. In addition to its uses in food industry, cocoa is a rich source of polyphenolic antioxidants. There is a plethora of in vitro and in vivo studies that report cocoa antioxidant capacity. The protective activity of cocoa seems to be due to its phytochemical constituents, especially catechins. However, bioavailability of cocoa polyphenolic constituents following oral administration is very low (nanomolar concentrations). In the present paper, we critically reviewed the available literature on the antioxidant and free radical scavenging activities of cocoa and its polyphenolic constituents. In addition to these, we provide brief information about cultivation, phytochemistry, bioavailability and clinical impacts of cocoa.
Directory of Open Access Journals (Sweden)
Shahin S Ali
2015-08-01
Full Text Available Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population may allow the population to adapt to changing environmental conditions and adapt to enhanced resistance in the host plant. The present study developed SNP markers from RNASeq results for 13 M. roreri isolates and validated the markers for their ability to reveal genetic diversity in an international M. roreri collection. The SNP resources reported herein represent the first study of RNASeq-derived SNP validation in M. roreri and demonstrates the utility of RNASeq as an approach for de novo SNP identification in M. roreri. A total of 88 polymorphic SNPs were used to evaluate the genetic diversity of 172 M. roreri cacao isolates resulting in 37 distinct genotypes (including 14 synonymous groups. Absence of heterozygosity for the 88 SNP markers indicates reproduction in M. roreri is clonal and likely due to a homothallic life style. The upper Magdalena Valley of Colombia showed the highest levels of genetic diversity with 20 distinct genotypes of which 13 were limited to this region, and indicates this region as the possible center of origin for M. roreri.
Ali, Shahin S; Shao, Jonathan; Strem, Mary D; Phillips-Mora, Wilberth; Zhang, Dapeng; Meinhardt, Lyndel W; Bailey, Bryan A
2015-01-01
Moniliophthora roreri is the fungal pathogen that causes frosty pod rot (FPR) disease of Theobroma cacao L., the source of chocolate. FPR occurs in most of the cacao producing countries in the Western Hemisphere, causing yield losses up to 80%. Genetic diversity within the FPR pathogen population may allow the population to adapt to changing environmental conditions and adapt to enhanced resistance in the host plant. The present study developed single nucleotide polymorphism (SNP) markers from RNASeq results for 13 M. roreri isolates and validated the markers for their ability to reveal genetic diversity in an international M. roreri collection. The SNP resources reported herein represent the first study of RNA sequencing (RNASeq)-derived SNP validation in M. roreri and demonstrates the utility of RNASeq as an approach for de novo SNP identification in M. roreri. A total of 88 polymorphic SNPs were used to evaluate the genetic diversity of 172 M. roreri cacao isolates resulting in 37 distinct genotypes (including 14 synonymous groups). Absence of heterozygosity for the 88 SNP markers indicates reproduction in M. roreri is clonal and likely due to a homothallic life style. The upper Magdalena Valley of Colombia showed the highest levels of genetic diversity with 20 distinct genotypes of which 13 were limited to this region, and indicates this region as the possible center of origin for M. roreri.
As many of the tolerant cacao clones are slowly losing the tolerance against Frosty pod rot (FPR) caused by Moniliophthora roreri, the knowledge of this tolerance at the molecular level can help to generate more stable tolerant clone against FPR. RNA-Seq analysis was carried out to obtain a comparat...
Variation of β-1,3-Glucanase, Chitinase and Polyphenoloxidase
African Journals Online (AJOL)
Cacao (Theobroma cacao L.) clones that differ in susceptibility to black pod disease were analysed for response to stress induced by pod inoculation with the fungus Phytophthora megakarya Braz. Et Griff. Fungal inoculation significantly stimulated β-1,3-glucanase activity in both soluble and ionically-bound fractions of the ...
Induction of Cocoa Natural Resistancy to Cocoa Pod Borer by Silica Application
Directory of Open Access Journals (Sweden)
Ketut Anom Wijaya
2009-12-01
Full Text Available Cocoa (Theobroma cacao L. like most tropical trees is recalcitrant in tissue culture. Somatic embryogenesis is generally efficient micropropagation technique to multiply elite material. However, Somatic embryogenesis in cocoa is difficult and this species is considered as recalcitrant. One of the factors often considered as a component of in vitro recalsitrance is a high phenolic content and oxidation of these compounds. In cocoa tissue culture accumulate large amounts of poliphenolics compounds which probably impair further development. This study was conducted to investigate the composition of phenolic compounds in cocoa flower and leaves, and their changes troughout the somatic embryogenesis process. Calli were induced in cacao floral and leaves explants on a half-strenght Murashige and Skoog medium containing 30 g/L Glucose and combination of 2,4 dichlorophenoxyacetic acid (2,4 D with kinetin (kin. Total polyphenol content was observed on Sulawesi 1 cocoa clone. Embryogenic and non-embryogenic callus were also compared. The percentage of callus production from flower tissue is 85%, percentage of embryogenic callus 40 %, although the percentage of somatic embryo production from embryogenic callus callus is 70%. The conservation of callus into somatic embryos followed by decline in phenol content and an increase in peroxidase. The synthesis kinetics for these compounds in calli, under different somatic embryogenesis conditions, revealed a higher concentration under non-embryogenic conditions. So that, phenolic compound can influence the production of calli and an absence the phenolic compound can enhance production of somatic embryo.Kata kunci: Theobroma cacao L., polifenol, embrio somatik, kalus, flavonoid, katekin, in vitro recalcitance
Barraza, F; Schreck, E; Lévêque, T; Uzu, G; López, F; Ruales, J; Prunier, J; Marquet, A; Maurice, L
2017-10-01
Cacao from South America is especially used to produce premium quality chocolate. Although the European Food Safety Authority has not established a limit for cadmium (Cd) in chocolate raw material, recent studies demonstrate that Cd concentrations in cacao beans can reach levels higher than the legal limits for dark chocolate (0.8 mg kg -1 , effective January 1st, 2019). Despite the fact that the presence of Cd in agricultural soils is related to contamination by fertilizers, other potential sources must be considered in Ecuador. This field study was conducted to investigate Cd content in soils and cacao cultivated on Ecuadorian farms in areas impacted by oil activities. Soils, cacao leaves, and pod husks were collected from 31 farms in the northern Amazon and Pacific coastal regions exposed to oil production and refining and compared to two control areas. Human gastric bioaccessibility was determined in raw cacao beans and cacao liquor samples in order to assess potential health risks involved. Our results show that topsoils (0-20 cm) have higher Cd concentrations than deeper layers, exceeding the Ecuadorian legislation limit in 39% of the sampling sites. Cacao leaves accumulate more Cd than pod husks or beans but, nevertheless, 50% of the sampled beans have Cd contents above 0.8 mg kg -1 . Root-to-cacao transfer seems to be the main pathway of Cd uptake, which is not only regulated by physico-chemical soil properties but also agricultural practices. Additionally, natural Cd enrichment by volcanic inputs must not be neglected. Finally, Cd in cacao trees cannot be considered as a tracer of oil activities. Assuming that total Cd content and its bioaccessible fraction (up to 90%) in cacao beans and liquor is directly linked to those in chocolate, the health risk associated with Cd exposure varies from low to moderate. Copyright © 2017 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Oscar Ramirez
2011-12-01
Full Text Available The information on ecological behavior of wild sloths is very scarce. In this study we determined the home ranges and resources used by three adult female three-toed sloths (Bradypus variegatus and their four young in an agricultural matrix of cacao (Theobroma cacao, pasture, riparian forests and living fencerows in Costa Rica. Births occurred during November-December and the young became independent at five to seven months of age. Initially, mothers remained fixed in one or a few trees, but expanded their use of resources as young sloths became independent from them. Mothers initially guided the young to preferred food and cover resources, but they gradually left their young in small nucleus areas and colonized new areas for themselves. Home range sizes for young sloths (up to seven months of age varied between 0.04-0.6 hectares, while home range sizes for mothers varied from 0.04-25.0 hectares. During the maternal care period, 22 tree species were used, with the most common being Cecropia obtusifolia (30.9%, Coussapoa villosa (25.6%, Nectandra salicifolia (12.1%, Pterocarpus officinalis (5.8% and Samanea saman (5.4%. However, young sloths used only 20 tree species, with the most common being C. villosa (18.4%, S. saman (18.5 % and N. salicifolia (16.7%. The cacao agroforest was used only by mother sloths and never by their young following separation. However, in the riparian forest, both mother sloths and young used the tree species. A total of 28 tree species were used by the mother sloth; including the food species: C. obtusifolia, C. villosa, N. salicifolia and P. officinalis. However, the young used 18 trees species in this habitat with N. salicifolia and S. saman most commonly used, although they rested and fed during the day in C. obtusifolia, C. villosa and O. sinnuata. The cacao agroforest with adjacent riparian forests and fencerows provides an important habitat type that links the smaller secondary forests and other patches. Rev
The Carbon Sequestration Potential of Tree Crop Plantations
DEFF Research Database (Denmark)
Kongsager, Rico; Napier, Jonas; Mertz, Ole
2013-01-01
-wood products to meet domestic and international market requirements at the same time. Financial compensation for such plantations could potentially be covered by the Clean Development Mechanism under the United Nations Framework Convention on Climate Change (FCCC) Kyoto Protocol, but its suitability has also...... been suggested for integration into REDD+(reducing emissions from deforestation, forest degradation and enhancement of forest C stocks) currently being negotiated under the United Nations FCCC. We assess the aboveground C sequestration potential of four major plantation crops – cocoa (Theobroma cacao......), oil palm (Elaeis guineensis), rubber (Hevea brasiliensis), and orange (Citrus sinesis) – cultivated in the tropics. Measurements were conducted in Ghana and allometric equations were applied to estimate biomass. The largest C potential was found in the rubber plantations (214 tC/ha). Cocoa (65 t...
International Nuclear Information System (INIS)
Barraza, F.; Schreck, E.; Lévêque, T.; Uzu, G.; López, F.; Ruales, J.; Prunier, J.; Marquet, A.; Maurice, L.
2017-01-01
Cacao from South America is especially used to produce premium quality chocolate. Although the European Food Safety Authority has not established a limit for cadmium (Cd) in chocolate raw material, recent studies demonstrate that Cd concentrations in cacao beans can reach levels higher than the legal limits for dark chocolate (0.8 mg kg −1 , effective January 1st, 2019). Despite the fact that the presence of Cd in agricultural soils is related to contamination by fertilizers, other potential sources must be considered in Ecuador. This field study was conducted to investigate Cd content in soils and cacao cultivated on Ecuadorian farms in areas impacted by oil activities. Soils, cacao leaves, and pod husks were collected from 31 farms in the northern Amazon and Pacific coastal regions exposed to oil production and refining and compared to two control areas. Human gastric bioaccessibility was determined in raw cacao beans and cacao liquor samples in order to assess potential health risks involved. Our results show that topsoils (0–20 cm) have higher Cd concentrations than deeper layers, exceeding the Ecuadorian legislation limit in 39% of the sampling sites. Cacao leaves accumulate more Cd than pod husks or beans but, nevertheless, 50% of the sampled beans have Cd contents above 0.8 mg kg −1 . Root-to-cacao transfer seems to be the main pathway of Cd uptake, which is not only regulated by physico-chemical soil properties but also agricultural practices. Additionally, natural Cd enrichment by volcanic inputs must not be neglected. Finally, Cd in cacao trees cannot be considered as a tracer of oil activities. Assuming that total Cd content and its bioaccessible fraction (up to 90%) in cacao beans and liquor is directly linked to those in chocolate, the health risk associated with Cd exposure varies from low to moderate. - Highlights: • Cd in cacao beans is enriched 4 times compared to soils contents. • Cd bioaccumulates in beans mainly through root
Data from proteome analysis of Lasiodiplodia theobromae (Botryosphaeriaceae
Directory of Open Access Journals (Sweden)
Carla C. Uranga
2017-08-01
Full Text Available Trunk disease fungi are a global problem affecting many economically important fruiting trees. The Botryosphaeriaceae are a family of trunk disease fungi that require detailed biochemical characterization in order to gain insight into their pathogenicity. The application of a modified Folch extraction to protein extraction from the Botryosphaeriaceae Lasiodiplodia theobromae generated an unprecedented data set of protein identifications from fragmentation analysis and de novo peptide sequencing of its proteome. This article contains data from protein identifications obtained from a database-dependent fragmentation analysis using three different proteomics algorithms (MSGF, Comet and X! Tandem via the SearchGUI proteomics pipeline program and de novo peptide sequencing. Included are data sets of gene ontology annotations using an all-Uniprot ontology database, as well as a Saccharomyces cerevisiae-only and a Candida albicans-only ontology database, in order to discern between those proteins involved in common functions with S. cerevisiae and those in common with the pathogenic yeast C. albicans. Our results reveal the proteome of L. theobromae contains more ontological categories in common to C. albicans, yet possesses a much wider metabolic repertoire than any of the yeasts studied in this work. Many novel proteins of interest were identified for further biochemical characterization and annotation efforts, as further discussed in the article referencing this article (1. Interactive Cytoscape networks of molecular functions of identified peptides using an all-Uniprot ontological database are included. Data, including raw data, are available via ProteomeXchange with identifier PXD005283.
The mitochondrial genome of Moniliophthora roreri, the frosty pod rot pathogen of cacao.
Costa, Gustavo G L; Cabrera, Odalys G; Tiburcio, Ricardo A; Medrano, Francisco J; Carazzolle, Marcelo F; Thomazella, Daniela P T; Schuster, Stephen C; Carlson, John E; Guiltinan, Mark J; Bailey, Bryan A; Mieczkowski, Piotr; Pereira, Gonçalo A G; Meinhardt, Lyndel W
2012-05-01
In this study, we report the sequence of the mitochondrial (mt) genome of the Basidiomycete fungus Moniliophthora roreri, which is the etiologic agent of frosty pod rot of cacao (Theobroma cacao L.). We also compare it to the mtDNA from the closely-related species Moniliophthora perniciosa, which causes witches' broom disease of cacao. The 94 Kb mtDNA genome of M. roreri has a circular topology and codes for the typical 14 mt genes involved in oxidative phosphorylation. It also codes for both rRNA genes, a ribosomal protein subunit, 13 intronic open reading frames (ORFs), and a full complement of 27 tRNA genes. The conserved genes of M. roreri mtDNA are completely syntenic with homologous genes of the 109 Kb mtDNA of M. perniciosa. As in M. perniciosa, M. roreri mtDNA contains a high number of hypothetical ORFs (28), a remarkable feature that make Moniliophthoras the largest reservoir of hypothetical ORFs among sequenced fungal mtDNA. Additionally, the mt genome of M. roreri has three free invertron-like linear mt plasmids, one of which is very similar to that previously described as integrated into the main M. perniciosa mtDNA molecule. Moniliophthora roreri mtDNA also has a region of suspected plasmid origin containing 15 hypothetical ORFs distributed in both strands. One of these ORFs is similar to an ORF in the mtDNA gene encoding DNA polymerase in Pleurotus ostreatus. The comparison to M. perniciosa showed that the 15 Kb difference in mtDNA sizes is mainly attributed to a lower abundance of repetitive regions in M. roreri (5.8 Kb vs 20.7 Kb). The most notable differences between M. roreri and M. perniciosa mtDNA are attributed to repeats and regions of plasmid origin. These elements might have contributed to the rapid evolution of mtDNA. Since M. roreri is the second species of the genus Moniliophthora whose mtDNA genome has been sequenced, the data presented here contribute valuable information for understanding the evolution of fungal mt genomes among
Directory of Open Access Journals (Sweden)
Cárdenas-Hernández Julián F.
2010-04-01
Full Text Available
Gran parte de los cultivos de cacao en el país son viejos y necesitan ser renovados debido a sus bajos rendimientos. Por esta razón se aborda la producción masiva de plántulas injertadas con materiales de alta productividad, que sin embargo presentan problemas en el prendimiento y desarrollo de las yemas. En el Centro de Investigación Nataima-Corpoica (Espinal, Tolima, plántulas de cacao del clon IMC67 tratadas con desbrote apical fueron injertadas con yemas de los clones CCN51 e ICS95. El ensayo siguió un diseño completamente aleatorizado con siete tratamientos, tres de ellos correspondientes a concentraciones de 5, 10 y 15 mg L-1 de ácido giberélico (AG3, y otros tres aplicando 6-bencilaminopurina (6BAP en las mismas concentraciones, más un testigo sin aplicación de hormonas. Cada 3 días se midieron la altura, el diámetro, la longitud, el número de hojas y el área foliar del injerto, además de su masa fresca y seca al final del experimento, el cual duró 30 días. El AG3 permitió alcanzar los mayores valores en longitud, número de hojas, área foliar y masa fresca y seca del injerto. Para los mismos parámetros, los tratamientos con 6BAP alcanzaron valores similares a los obtenidos con AG3 (con diferencias estadísticas en algunos casos, además de los mayores diámetros del injerto. Dentro de las aplicaciones de AG3, la realizada a una concentración de 10 mg L-1 mostró los mejores resultados en ambos clones. Sin la aplicación de hormonas, las yemas del clon ICS95 desarrollaron una mayor área foliar y alcanzaron mayores valores de masa fresca y seca que las yemas del clon CCN51. Sin embargo, después de aplicar los tratamientos, los dos clones presentaron valores similares.
Sintesis Sabun Lunak Yang Mengandung Polihidroksi Dari Minyak Biji Kakao (Theobroma cacao,L
Directory of Open Access Journals (Sweden)
Chairul Saleh
2016-06-01
Full Text Available The research about synthesis of Soft Soap Containing polyhydroxy from Cocoa seed Oil, beginning with the manufacture of the polyhydroxy compound wherein the polyhydroxy compound is obtained through a process of epoxidation and hydroxylation by reacting oils cocoa beans with peroxide acetic acids (peroxy acetate was obtained from the reaction of glacial acetic acid with hydrogen peroxide with an acid catalyst sulfate followed by oxirane ring opening process (hydrolysis at a temperature of 40-45 oC for 2 hours, the results obtained with the reaction yield of 60 %. In the form of a mixture of soft soap is obtained by saponification of compounds polyhydroxy with Potassium Hydroxide at a temperature 70-75 oC for 1 hour with a yield of 86,45 %. Polyhydroxy compound and soap from the cocoa bean oil was analyzed by FT-IR spectrophotometer. Respectively iodine from the cocoa bean oil 102,93mg I / gram of oil and polyhydroxy compound is 20,21 mg I / gram of oil. HLB of soap Software of oil and polyhydroxy cocoa beans from the cocoa bean oil is determined by titration method and obtained HLB of soft soap from the cocoa bean oil was 8.74 while the polyhydroxy from cacao seed oil is 10,94. Keywords: Cocoa bean oil, Polyhydroxy compound, Soft soap polyhydroxy.
Directory of Open Access Journals (Sweden)
MSc. José Nicasio Quevedo Guerrero
2018-04-01
Full Text Available La investigación se realizó en la Granja Experimental Santa Inés de la Universidad Técnica de Machala, durante el segundo semestre del 2016. El objetivo de la investigación fue comparar la eficiencia los fermentadores más usados por los pequeños productores cacaoteros de El Oro, en el beneficio de los granos de cacao, con un nuevo método denominado rotor de madera, propuesto por los autores del presente trabajo, mediante el análisis de variables físico-químicas y la evaluación sensorial del licor de cacao. El ensayo constó de los tratamientos: saco de yute (T1, rotor de madera (T2, rumo o montón (T3, caja de madera (T4 y balde plástico (T5, los cuales se evaluaron bajo un diseño de bloques al azar con tres repeticiones. El secado se efectuó de forma natural en marquesinas bajo cubierta de plástico calibre 6. El análisis de variables químicas, físicas y sensoriales reveló diferencias significativas (p < 0.05 entre tratamientos. El T2 registró 96% de calidad física del grano y el mejor perfil sensorial con calificaciones altas en sabores cacao, floral, frutal, nuez y caramelo y calificaciones bajas en sabor astringente y amargo. La fermentación se desarrolló dentro de la plantación de cacao, esto permitió la presencia de Drosophila melanogaster M., vector de Saccharomyces cerevisiae y otras levaduras que pudieron haber inferido en la calidad de los granos. Palabras clave: Astringente, pizarrosas, Drosophila melanogaster M., levaduras.
Fungal and Oomycete Diseases of Tropical Tree Fruit Crops.
Drenth, André; Guest, David I
2016-08-04
The tropics produce a range of fruit from tree crops that cannot be grown in colder climates. Bananas, mangos, several nuts, spices, coffee, and cacao are widely traded and much sought after around the world. However, the sustainable production of these tropical tree fruit crops faces significant challenges. Among these, losses due to pests and diseases play a large part in reducing yields, quality, and profitability. Using bananas and cacao as key examples, we outline some of the reasons fungal and oomycete diseases cause such significant losses to tropical tree crops. Cultivation of monocultures derived from limited genetic diversity, environmental conditions conducive for disease development, high levels of disease incidence and severity, a lack of disease resistance in planting materials, shortages of labor, and inadequate infrastructure and investment pose significant challenges, especially for smallholder producers. The expansion of travel and trade has given rise to emerging infectious plant diseases that add further insecurity and pressure. We conclude that holistic actions are needed on multiple fronts to address the growing problem of disease in tropical fruit tree crops.
Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador
International Nuclear Information System (INIS)
Chavez, E.; He, Z.L.; Stoffella, P.J.; Mylavarapu, R.S.; Li, Y.C.; Moyano, B.; Baligar, V.C.
2015-01-01
Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg −1 ) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0–5, 5–15, 15–30, and 30–50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg −1 , respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg −1 . Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg −1 ), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans > shell > > leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg −1 , and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0–5 and 5–15 cm depths (r = 0.80 and 0.82 for M3, and r = 0.78 and 0.82 for HCl; P < 0.01). These results indicate that accumulation of Cd in surface layers results in excessive Cd in cacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils. - Highlights: • > 60% of the studied sites had a Cd content in cacao beans above the critical level. • Bean Cd concentration was closely correlated with available Cd in soil. • Soil Cd contamination is
Concentration of cadmium in cacao beans and its relationship with soil cadmium in southern Ecuador
Energy Technology Data Exchange (ETDEWEB)
Chavez, E. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); He, Z.L., E-mail: zhe@ufl.edu [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Stoffella, P.J. [University of Florida, Institute of Food and Agricultural Science, Indian River Research and Education Center, Fort Pierce, FL 34945 (United States); Mylavarapu, R.S. [University of Florida, Institute of Food and Agricultural Science, Soil and Water Science Department, Gainesville, FL 33611 (United States); Li, Y.C. [University of Florida, Institute of Food and Agricultural Science, Tropical Research and Education Center, Homestead, FL 33031 (United States); Moyano, B. [Escuela Superior Politecnica del Litoral, Centro de Investigaciones Biotecnologicas del Ecuador, Guayaquil, Guayas (Ecuador); Baligar, V.C. [United State Department of Agriculture, ARS, Beltsville, MD 20705 (United States)
2015-11-15
Cadmium (Cd) content in cacao beans above a critical level (0.6 mg kg{sup −1}) has raised concerns in the consumption of cacao-based chocolate. Little is available regarding Cd concentration in soil and cacao in Ecuador. The aim of this study was to determine the status of Cd in both, soils and cacao plants, in southern Ecuador. Soil samples were collected from 19 farms at 0–5, 5–15, 15–30, and 30–50 cm depths, whereas plant samples were taken from four nearby trees. Total recoverable and extractable Cd were measured at the different soil depths. Total recoverable Cd ranged from 0.88 to 2.45 and 0.06 to 2.59, averaged 1.54 and 0.85 mg kg{sup −1}, respectively in the surface and subsurface soils whereas the corresponding values for M3-extractable Cd were 0.08 to 1.27 and 0.02 to 0.33 with mean values of 0.40 and 0.10 mg kg{sup −1}. Surface soil in all sampling sites had total recoverable Cd above the USEPA critical level for agricultural soils (0.43 mg kg{sup −1}), indicating that Cd pollution occurs. Since both total recoverable and M3-extractable Cd significantly decreased depth wise, anthropogenic activities are more likely the source of contamination. Cadmium in cacao tissues decreased in the order of beans > shell > > leaves. Cadmium content in cacao beans ranged from 0.02 to 3.00, averaged 0.94 mg kg{sup −1}, and 12 out of 19 sites had bean Cd content above the critical level. Bean Cd concentration was highly correlated with M3- or HCl-extractable Cd at both the 0–5 and 5–15 cm depths (r = 0.80 and 0.82 for M3, and r = 0.78 and 0.82 for HCl; P < 0.01). These results indicate that accumulation of Cd in surface layers results in excessive Cd in cacao beans and M3- or HCl-extractable Cd are suitable methods for predicting available Cd in the studied soils. - Highlights: • > 60% of the studied sites had a Cd content in cacao beans above the critical level. • Bean Cd concentration was closely correlated with available Cd in soil. • Soil
Cacao use and the San Lorenzo Olmec
Powis, Terry G.; Cyphers, Ann; Gaikwad, Nilesh W.; Grivetti, Louis; Cheong, Kong
2011-01-01
Mesoamerican peoples had a long history of cacao use—spanning more than 34 centuries—as confirmed by previous identification of cacao residues on archaeological pottery from Paso de la Amada on the Pacific Coast and the Olmec site of El Manatí on the Gulf Coast. Until now, comparable evidence from San Lorenzo, the premier Olmec capital, was lacking. The present study of theobromine residues confirms the continuous presence and use of cacao products at San Lorenzo between 1800 and 1000 BCE, and documents assorted vessels forms used in its preparation and consumption. One elite context reveals cacao use as part of a mortuary ritual for sacrificial victims, an event that occurred during the height of San Lorenzo's power. PMID:21555564
ASSESSMENT OF CACAO SEEDS OF “GAPOKTAN” AT LINTAS SEKAYAM SANGGAU WEST KALIMANTAN
Azri
2015-01-01
Cacao seeds price at farmers level in 2013 is IDR 800 per kg. Expected by implementing technology cacao seeds be processed products such as cocoa powder can increase added value for cacao farmers. From aspect of expected processing most cacao must fermented with Indonesian cacao quality standard requirements in accordance with SNI 01-2323-2002 so that quality of cacao Indonesia can be accepted in international market. Cacao seeds done after fermented cacao seeds for three up to...
comparative in vitro antioxidant properties of water juice from ...
African Journals Online (AJOL)
JUICE FROM SELECTED AFRICAN FRUITS CONSUMED IN ... from African star apple (Chrysophyllumafricanum) and cocoa (Theobroma cacao) were significantly (p<0.05) higher .... the formula as given by Chinaka and colleagues, and.
Enraizamiento de Estacas de Cacao Defoliadas (Teobroma Cacao
Directory of Open Access Journals (Sweden)
Delisle A.
1947-06-01
Full Text Available Los factores más importantes que controlan el enraizamiento de estacas de cacao son: adecuada cantidad de humedad y de agua. Para controlar estos factores muchos métodos han empleado con éxito. Es importante hacer notar que uno de los principales inconvenientes relacionados con este problema es el mantenimiento de las hojas en estado verde y sanas en las estacas. Variaciones en la cantidad de sombra y humedad tienden frecuentemente a producir en las hojas amarillamientos y parches negruzcos aun en las bien acondicionadas y generalmente estas estacas acaban por morirse. De acuerdo con Pyke (Second Anual Report on Cacao Research 1932 la caída de las hojas por deficiencia en el sombreado origina principalmente la pérdida de las estacas; esto es, las estas que retienen sus hojas v verdes y sanas enraizan casi siempre.
Directory of Open Access Journals (Sweden)
Fernando Luíz de Oliveira Corrêa
2006-12-01
Full Text Available Objetivou-se com este trabalho avaliar a produção de serapilheira em diferentes coberturas frutíferas e florestais componentes de um sistema agroflorestal multiestratificado localizado no município de Ouro Preto do Oeste, RO, Brasil. As espécies avaliadas foram: mangueira (Mangifera indica L., fruta-pão (Artocarpus altilis (Parkinson Fosberg, cupuaçuzeiro (Theobroma grandiflorum Schum, abacateiro (Persea americana Mill., cacaueiro (Theobroma cacao L. sombreado com gliricídia (Gliricidia sepium (Jacq. Walp. e as espécies florestais, a bandarra (Schizolobium amazonicum Huber ex Ducke e a teca (Tectona grandis L.f.. Como referência foi utilizada uma área de vegetação natural (capoeira, de 8 anos de idade. A deposição anual de serapilheira entre o período de outubro de 2002 e setembro de 2003 foi de 13,38 t ha-1 para a vegetação natural, 4,02 t ha-1 para bandarra, 3,43 t ha-1 para gliricídia, 2,86 t ha-1para abacateiro, 2,54 t ha-1 para fruta-pão, 1,40 t ha-1 para o cupuaçuzeiro, 1,16 t ha-1 para o cacaueiro, 1,12 t ha-1 para mangueira e 1,07 t ha-1 para a teca. A vegetação natural, a bandarra e o cacaueiro apresentaram uma maior deposição no período seco (verão, enquanto que a fruta-pão, cupuaçuzeiro, mangueira, teca, gliricídia e abacateiro as maiores deposições foram no período chuvoso (inverno. Por outro lado a serapilheira acumulada sobre o solo foi de 14,61 t ha-1 na mangueira, 12,8 t ha-1 na bandarra, 12,73 t ha-1 na vegetação natural, 12,04 t ha-1, no abacateiro, 9,87 t ha-1 no cacaueiro/gliricídia, 9,88 t ha-1 no cupuaçuzeiro, 9,05 t ha-1 na fruta-pão e 7,39 t ha-1 na teca.One study was made to evaluate litter production in different fruitful coverings and forest components of a multistrata agroforestry system located in Ouro Preto do Oeste district (RO, Brazil. The studied species were: mango tree (Mangifera indica L., breadfruit tree (Artocarpus altilis (Parkinson Fosberg, cupuassu tree (Theobroma
Identification and phytochemical screening of Endophytic fungi from ...
African Journals Online (AJOL)
SARAH
2015-06-30
Jun 30, 2015 ... Penicillium (03), Trichoderma (01) and Fusarium (01). The phytochemical ... guajava, Citrus spp. and Theobroma cacao (Dibong et al., 2011). ... Fermentation and extraction of metabolites: Each isolated ... Penicillium sp.1.
Directory of Open Access Journals (Sweden)
Ivan José Antunes Ribeiro
1987-01-01
Full Text Available Ceratocystis fimbriata foi descrito pela primeira vez em 1984, causando murcha em plantas de Cassia renigera, em Campinas (SP. Foram realizadas inoculações cruzadas com dois isolados de C. fimbriata obtidos de Cassia renigera e mangueira (Mangifera indica em plantas de: acácia-negra (Acacia decurrens, cacaueiro (Theobroma cacao, crotalária (Crotalaria juncea, feijão-guandu (Cajanus cajan, figueira (Ficus carica, gamelina (Gmelina arborea, mangueira (Mangifera indica, seringueira (Hevea brasilienses, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea e C. speciosa. Os dois isolados do fungo foram patogênicos a todas as plantas testadas, com exceção de cacaueiro, gamelina e C. grandis.Ceratocystis fimbriata Ell. & Halst. is described for the first time in 1984 on Cassia renigera, in Campinas, State of São Paulo, Brazil. In cross inoculation, the isolates of C. fimbriata obtained from Cassia renigera and from Mangifera indica showed pathogenicity to the following plants: Acacia decurrens, Theobroma cacao, Crotalaria juncea, Cajanus cajan, Ficus Carica, Gmelina arborea, Mangifera indica, Hevea brasiliensis, Cassia sp., C. carnaval, C. ferruginea, C. grandis, C. moschata, C. multijuga, C. nodosa, C. renigera, C. siamea and C. speciosa. The isolates of C. fimbriata were pathogenic to all tested plants, except for Theobroma cacao, Gmelina arborea and C. grandis.
Rita, Joice Cleide O.; Gama-Rodrigues, Emanuela Forestieri; Gama-Rodrigues, Antonio Carlos; Polidoro, Jose Carlos; Machado, Regina Cele R.; Baligar, Virupax C.
2011-07-01
Agroforestry systems (AFSs) have an important role in capturing above and below ground soil carbon and play a dominant role in mitigation of atmospheric CO2. Attempts has been made here to identify soil organic matter fractions in the cacao-AFSs that have different susceptibility to microbial decomposition and further represent the basis of understanding soil C dynamics. The objective of this study was to characterize the organic matter density fractions and soil size fractions in soils of two types of cacao agroforestry systems and to compare with an adjacent natural forest in Bahia, Brazil. The land-use systems studied were: (1) a 30-year-old stand of natural forest with cacao (cacao cabruca), (2) a 30-year-old stand of cacao with Erythrina glauca as shade trees (cacao + erythrina), and (3) an adjacent natural forest without cacao. Soil samples were collected from 0-10 cm depth layer in reddish-yellow Oxisols. Soil samples was separated by wet sieving into five fraction-size classes (>2000 μm, 1000-2000 μm, 250-1000 μm, 53-250 μm, and cacao AFS soils consisted mainly (65 %) of mega-aggregates (>2000 μm) mixed with macroaggregates (32-34%), and microaggregates (1-1.3%). Soil organic carbon (SOC) and total N content increased with increasing soil size fraction in all land-use systems. Organic C-to-total N ratio was higher in the macroaggregate than in the microaggregate. In general, in natural forest and cacao cabruca the contribution of C and N in the light and heavy fractions was similar. However, in cacao + erythrina the heavy fraction was the most common and contributed 67% of C and 63% of N. Finding of this study shows that the majority of C and N in all three systems studied are found in macroaggregates, particularly in the 250-1000 μm size aggregate class. The heavy fraction was the most common organic matter fraction in these soils. Thus, in mature cacao AFS on highly weathered soils the main mechanisms of C stabilization could be the physical
van Straaten, O.; Veldkamp, E.; Köhler, M.; Anas, I.
2010-04-01
Climate change induced droughts pose a serious threat to ecosystems across the tropics and sub-tropics, particularly to those areas not adapted to natural dry periods. In order to study the vulnerability of cacao (Theobroma cacao) - Gliricidia sepium agroforestry plantations to droughts a large scale throughfall displacement roof was built in Central Sulawesi, Indonesia. In this 19-month experiment, we compared soil surface CO2 efflux (soil respiration) from three roof plots with three adjacent control plots. Soil respiration rates peaked at intermediate soil moisture conditions and decreased under increasingly dry conditions (drought induced), or increasingly wet conditions (as evidenced in control plots). The roof plots exhibited a slight decrease in soil respiration compared to the control plots (average 13% decrease). The strength of the drought effect was spatially variable - while some measurement chamber sites reacted strongly (responsive) to the decrease in soil water content (up to R2=0.70) (n=11), others did not react at all (non-responsive) (n=7). A significant correlation was measured between responsive soil respiration chamber sites and sap flux density ratios of cacao (R=0.61) and Gliricidia (R=0.65). Leaf litter CO2 respiration decreased as conditions became drier. The litter layer contributed approximately 3-4% of the total CO2 efflux during dry periods and up to 40% during wet periods. Within days of roof opening soil CO2 efflux rose to control plot levels. Thereafter, CO2 efflux remained comparable between roof and control plots. The cumulative effect on soil CO2 emissions over the duration of the experiment was not significantly different: the control plots respired 11.1±0.5 Mg C ha-1 yr-1, while roof plots respired 10.5±0.5 Mg C ha-1 yr-1. The relatively mild decrease measured in soil CO2 efflux indicates that this agroforestry ecosystem is capable of mitigating droughts with only minor stress symptoms.
Directory of Open Access Journals (Sweden)
I. Anas
2010-04-01
Full Text Available Climate change induced droughts pose a serious threat to ecosystems across the tropics and sub-tropics, particularly to those areas not adapted to natural dry periods. In order to study the vulnerability of cacao (Theobroma cacao – Gliricidia sepium agroforestry plantations to droughts a large scale throughfall displacement roof was built in Central Sulawesi, Indonesia. In this 19-month experiment, we compared soil surface CO2 efflux (soil respiration from three roof plots with three adjacent control plots. Soil respiration rates peaked at intermediate soil moisture conditions and decreased under increasingly dry conditions (drought induced, or increasingly wet conditions (as evidenced in control plots. The roof plots exhibited a slight decrease in soil respiration compared to the control plots (average 13% decrease. The strength of the drought effect was spatially variable – while some measurement chamber sites reacted strongly (responsive to the decrease in soil water content (up to R2=0.70 (n=11, others did not react at all (non-responsive (n=7. A significant correlation was measured between responsive soil respiration chamber sites and sap flux density ratios of cacao (R=0.61 and Gliricidia (R=0.65. Leaf litter CO2 respiration decreased as conditions became drier. The litter layer contributed approximately 3–4% of the total CO2 efflux during dry periods and up to 40% during wet periods. Within days of roof opening soil CO2 efflux rose to control plot levels. Thereafter, CO2 efflux remained comparable between roof and control plots. The cumulative effect on soil CO2 emissions over the duration of the experiment was not significantly different: the control plots respired 11.1±0.5 Mg C ha−1 yr−1, while roof plots respired 10.5±0.5 Mg C ha−1 yr−1. The relatively mild decrease measured in soil CO2 efflux indicates that this agroforestry ecosystem is capable of mitigating droughts with only minor stress symptoms.
Directory of Open Access Journals (Sweden)
Jaimes Yeirme
2011-08-01
Full Text Available
Moniliasis (frosty pod rot, caused by Moniliophthora roreri, is the most limiting disease of cacao bean production in Colombia. Disease control has focused primarily on the implementation of cultural methods, which are inefficient and increase costs of production. A promising alternative for the control of M. roreri is the genetic approach, involving the search for plants with known resistance in the field. The aim of this study was to evaluate the behavior of 13 regional clones of Corpoica Selection Colombia (SCC, ten regional Fedecacao clones (with the initial F, three clones Caucasia (CAU and 13 introduced clones for resistance to M. roreri, by monitoring symptoms and signs of the pathogen in fruits of the cacao at three experimental sites located in Arauquita (Arauca, San Vicente and Rionegro (Santander. To estimate the degree of susceptibility or resistance of each clone, the pathogen was inoculated into fruits 75-5 days old. Eight weeks later, the variables Incidence, Internal Severity Index and External Severity Index were evaluated. In the three experimental sites, the ICS clone 95 behaved as a resistant plant with ISI ranging from 1.4 to 1.9. In the other clones tested, susceptibility varied according to altitude and environmental conditions. However, the ICS clone 95 showed partial resistance, varying the spread of the pathogen in the plant tissue.
African Journals Online (AJOL)
HP Pro 2000
En Côte d'Ivoire, le cacaoyer (Theobroma cacao L.) est traditionnellement cultivé selon un système extensif et itinérant, utilisant du matériel végétal peu performant. Les rendements en cacao sont donc faible (260 à 600 kg·ha-1·an-1). Pour améliorer la productivité des cacaoyères, les chercheurs ivoiriens ont mis au point.
Ayenor, G.K.; Huis, van, A.; Obeng-Ofori, D.; Padi, B.; Röling, N.G.
2007-01-01
Cocoa (Theobroma cacao L.) is an important foreign exchange earner for Ghana. However, production is constrained by a high incidence of pests and diseases. Based on farmers' needs, this study focused on the control of capsids, mainly Sahlbergella singularis Haglund and Distantiella theobroma (Distant) (both Hemiptera: Miridae). Annual crop loss caused by capsids is estimated at 25¿30%. To control capsids, formal research recommends application of synthetic insecticides four times between Augu...
Trichoderma evansii and T. lieckfeldtiae: two new T. hamatum-like species.
Samuels, Gary J; Ismaiel, Adnan
2009-01-01
The new species, Trichoderma evansii and T. lieckfeldtiae, resemble the closely related T. hamatum and T. pubescens in forming discrete, setose conidial pustules within which arise smooth, green conidia from pachybasium-like conidiophores. The phylogenetic position of these species was determined with combined partial sequences of ITS, translationelongation factor 1-alpha, RNA polymerase II subunit and actin genes. All are members of the Viride clade. Trichoderma evansii forms a sister group relationship with a clade that includes T. hamatum and T. pubescens. It differs from the latter two species in having subglobose conidia; it was isolated as an endophyte from sapwood of Lophira alata (Ochnaceae) and Cola verticillata (Malvaceae) in Cameroon and Theobroma gileri (Malvaceae) in Peru. Trichoderma lieckfeldtiae occupies an unresolved position in the Viride clade despite being virtually morphologically indistinguishable from T. hamatum; it was isolated from fruit of cacao infected with Moniliophthora roreri in Colombia, pseudostroma of Moniliophthora roreri on pods of Theobroma cacao in Peru and from soil in a cacao farm in Cameroon (central Africa).
Foliar epidermal characters of some Sterculiaceae species in Nigeria
African Journals Online (AJOL)
DR. AWORINDE D.O
curve and slightly curved. All the species except Cola nitida (Vent) Schott, Malachanta alnifolia (Bak) Pierre, Mansonia altissima (A.Chev) R.Capuron, Theobroma cacao Linn and Waltheria indica Linn are amphistomatic. Stomata types included ...
Equilibrium and Kinetic Studies of Cu (II), Cd (II), Pb (II) and Fe (II ...
African Journals Online (AJOL)
ADOWIE PERE
from Aqueous Solution Using Cocoa (Theobroma cacao) Pod Husk. *1. OBIKE, AI;. 1. IGWE, JC;. 1. EMERUWA, CN;. 2. UWAKWE, KJ. 1 Department of Pure & Industrial Chemistry, Abia State University, Uturu, Abia State, ..... Eclectica Quimica.
Rita, Joice Cleide O; Gama-Rodrigues, Emanuela Forestieri; Gama-Rodrigues, Antonio Carlos; Polidoro, Jose Carlos; Machado, Regina Cele R; Baligar, Virupax C
2011-07-01
Agroforestry systems (AFSs) have an important role in capturing above and below ground soil carbon and play a dominant role in mitigation of atmospheric CO(2). Attempts has been made here to identify soil organic matter fractions in the cacao-AFSs that have different susceptibility to microbial decomposition and further represent the basis of understanding soil C dynamics. The objective of this study was to characterize the organic matter density fractions and soil size fractions in soils of two types of cacao agroforestry systems and to compare with an adjacent natural forest in Bahia, Brazil. The land-use systems studied were: (1) a 30-year-old stand of natural forest with cacao (cacao cabruca), (2) a 30-year-old stand of cacao with Erythrina glauca as shade trees (cacao + erythrina), and (3) an adjacent natural forest without cacao. Soil samples were collected from 0-10 cm depth layer in reddish-yellow Oxisols. Soil samples was separated by wet sieving into five fraction-size classes (>2000 μm, 1000-2000 μm, 250-1000 μm, 53-250 μm, and 2000 μm) mixed with macroaggregates (32-34%), and microaggregates (1-1.3%). Soil organic carbon (SOC) and total N content increased with increasing soil size fraction in all land-use systems. Organic C-to-total N ratio was higher in the macroaggregate than in the microaggregate. In general, in natural forest and cacao cabruca the contribution of C and N in the light and heavy fractions was similar. However, in cacao + erythrina the heavy fraction was the most common and contributed 67% of C and 63% of N. Finding of this study shows that the majority of C and N in all three systems studied are found in macroaggregates, particularly in the 250-1000 μm size aggregate class. The heavy fraction was the most common organic matter fraction in these soils. Thus, in mature cacao AFS on highly weathered soils the main mechanisms of C stabilization could be the physical protection within macroaggregate structures thereby
Cacao, flavanolen, en hart- en vaatziekten: Stand van de wetenschap
Buijsse, B.; Kromhout, D.
2010-01-01
De gedachte dat cacao gezondheidseffecten bezit is niet nieuw. Al in de 18e eeuw werd verondersteld dat cacao een veelvoud aan kwalen kon verlichten, alleen ontbrak hiervoor lange tijd de wetenschappelijke onderbouwing. Nadat halverwege de jaren negentig van de vorige eeuw werd ontdekt dat cacao
Directory of Open Access Journals (Sweden)
Giorgini Augusto Venturieri
2011-03-01
Full Text Available Cupuassu (Theobroma grandiflorum, a specie native to Amazonia, has been planted commercially in Brazil to satisfy the demand for the flavorful juice obtained from the pulp around its seeds. The trees are notorious for low and irregular fruit production. Data gathered over two seasons from trees in a germplasm collection in Pará, Brazil, showed that some of them fruited more regularly than others. Differences in fruit production correlated to differences in flower production. Tree-to-tree variation in flower production, fruit production, and consistency of both over time suggest considerable scope for improving yields by selection. Hand pollinations resulted in a much higher frequency of fruit set than open pollinations, indicating that lack of effective pollination is also a reason for low yield. However, attempts to increase the level of effective pollination are handicapped by low knowledge about the pollinators of cupuassu and their behavior.Cupuaçu (Theobroma grandiflorum é uma espécie nativa da Amazônia que vem sendo plantada comercialmente no Brasil para satisfazer a demanda pelo seu suco, de sabor marcante, obtido da polpa que envolve as suas sementes. As árvores não notórias pela sua baixa e irregular produtividade. Dados obtidos de dois períodos produtivos, de árvores de uma coleção de germoplasma no estado do Pará, Brasil, mostraram que algumas delas frutificam mais irregularmente que outras. Diferenças na produção de frutos foram correlacionadas à diferenças na produção de flores. Variações entre plantas nas produções de flores e de frutos, e a repetibilidade de ambos ao longo do tempo sugerem melhoria das colheitas por seleção. Polinizações manuais resultaram em aumento no pegamento dos frutos, indicando que a falta de polinizador efetivo é também um causa da produtividade baixa. Entretanto, tentativas para aumentar o nível de polinização efetiva são dificultadas pelo pouco conhecimento sobre os
The graft copolymerisation of acrylamide onto cellulose using ...
African Journals Online (AJOL)
Theobroma cacao) wood meal have been produced using hydroquinone enhanced Fe2+/H2O2 redox system. The addition of hydroquinone to the redox system affected the effectiveness of the redox system to initiate graft copolymer formation.
Directory of Open Access Journals (Sweden)
Makita-Ngadi, J.
1993-01-01
Full Text Available Study on the possibilities of agricultural valorisation of sugarcane scums and bagasse of SOSUHO (Gabon. As a first step towards the general use of organic fertilizers in improving poor agricultural yields of soils in the province of Haut-Ogooue, in Gabon, we studied germination and growth of seven different types of plants (maize, Zea mays L. var. 60 ; rice Oryza sativa Var. 1345 ; cacao-tree, Theobroma cacao Var. Forastero ; gombo, Hibiscus esculantus Clenson Spineless var ; culin, Cucurbita pepo Basma var ; aubergine, Solanum melongena, Asgrow var ; soya-bean, Glycine max tropical var. on two six months old sugar cane residues. These residues, froth and bagasse were used by hemselves or mixed with earth or sand. By comparison with commercial compost, we found that froth and bagasse do not inhibit the germination of the seeds studied. However, we found that the growth of all species studied was better in froth than in bagasse. The results of chemical analysis carried out on these residues can explain partially the good growth observed in froth themselves or mixed with earth.
Influence of plant growth regulators on somatic embryos induction ...
African Journals Online (AJOL)
TANOH
2013-04-17
Theobroma cacao L.) using Thidiazuron. In vitro Cell Dev. Biol. 34:293-299. Michaux-Ferrière N, Carron MP (1989). Histology of early somatic embryogenesis in Hevea brasiliensis. The importance of timing of subculturing. Plant Cell Tiss ...
Fungal Planet description sheets: 371 - 399
Crous, P W; Wingfield, M J; Le Roux, J J; Richardson, D M; Strasberg, D; Shivas, R G; Alvarado, P; Edwards, J; Moreno, G; Sharma, R; Sonawane, M S; Tan, Y P; Altes, A; Barasubiye, T; Barnes, C W; Blanchette, R A; Boertmann, D; Bogo, A; Carlavilla, J R; Cheewangkoon, R; Daniel, R; de Beer, Z W; de Jesús Yáñez-Morales, M; Duong, T A; Fernandez-Vicente, J; Geering, A D W; Guest, D I; Held, B W; Heykoop, M; Hubka, V; Ismail, A M; Kajale, S C; Khemmuk, W; Kolarik, M; Kurli, R; Lebeuf, R; Levesque, C A; Lombard, L; Magista, D; Manjon, J L; Marincowitz, S; Mohedano, J M; Novakova, A; Oberlies, N H; Otto, E C; Paguigan, N D; Pascoe, I G; Perez-Butron, J L; Perrone, G; Rahi, P; Raja, H A; Rintoul, T; Sanhueza, R M V; Scarlett, K; Shouche, Y S; Shuttleworth, L A; Taylor, P W J; Thorn, R G; Vawdrey, L L; Solano-Vidal, R; Voitk, A; Wong, P T W; Wood, A R; Zamora, J C; Groenewald, J Z
2015-01-01
Novel species of fungi described in the present study include the following from Australia: Neoseptorioides eucalypti gen. and sp. nov. from Eucalyptus radiata leaves, Phytophthora gondwanensis from soil, Diaporthe tulliensis from rotted stem ends of Theobroma cacao fruit, Diaporthe vawdreyi from
Fungal Planet description sheets: 371–399
Crous, P.W.; Wingfield, M.J.; Le Roux, J.J.; Richardson, D.M.; Strasberg, D.; Shivas, R.G.; Alvarado, P.; Edwards, J.; Moreno, G.; Sharma, R.; Sonawane, M.S.; Tan, Y.P.; Altés, A.; Barasubiye, T.; Barnes, C.W.; Blanchette, R.A.; Boertmann, D.; Bogo, A.; Carlavilla, J.R.; Cheewangkoon, R.; Daniel, R.; Beer, de Z.W.; Jesús Yáñez-Morales, de M.; Doung, T.A.; Fernández-Vicente, J.; Geering, A.D.W.; Guest, D.I.; Held, B.W.; Keykoop, M.; Hubka, V.; Ismail, A.M.; Kajale, S.C.; Khemmuk, W.; Kolařík, M.; Kurli, R.; Lebeuf, R.; Lévesque, C.A.; Lombard, L.; Magista, D.; Manjón, J.L.; Marincowitz, S.; Mohedano, J.M.; Nováková, A.; Oberlies, N.H.; Otto, E.C.; Paguigan, N.D.; Pascoe, I.G.; Pérez-Butrón, J.L.; Perrone, G.; Rahi, P.; Raja, H.A.; Rintoul, T.; Sanhueza, R.M.V.; Scarlett, K.; Shouche, Y.S.; Shuttleworth, L.A.; Taylor, P.W.J.; Thorn, R.G.; Vawdrey, L.L.; Solano-Vidal, R.; Voitk, A.; Wong, P.T.W.; Wood, A.R.; Zamora, J.C.; Groenewald, J.Z.
2015-01-01
Novel species of fungi described in the present study include the following from Australia: Neoseptorioides eucalypti gen. & sp. nov. from Eucalyptus radiata leaves, Phytophthora gondwanensis from soil, Diaporthe tulliensis from rotted stem ends of Theobroma cacao fruit, Diaporthe vawdreyi from
Mining of expressed sequence tag libraries of cacao
Indian Academy of Sciences (India)
Expressed sequence tags (ESTs) provide researchers with a quick and inexpensive route for discovering new genes, data on gene expression and regulation, and also provide genic markers that help in constructing genome maps. Cacao is an important perennial crop of humid tropics. Cacao EST sequences, as available ...
Meinhardt, Lyndel W; Costa, Gustavo Gilson Lacerda; Thomazella, Daniela P T; Teixeira, Paulo José P L; Carazzolle, Marcelo Falsarella; Schuster, Stephan C; Carlson, John E; Guiltinan, Mark J; Mieczkowski, Piotr; Farmer, Andrew; Ramaraj, Thiruvarangan; Crozier, Jayne; Davis, Robert E; Shao, Jonathan; Melnick, Rachel L; Pereira, Gonçalo A G; Bailey, Bryan A
2014-02-27
The basidiomycete Moniliophthora roreri is the causal agent of Frosty pod rot (FPR) disease of cacao (Theobroma cacao), the source of chocolate, and FPR is one of the most destructive diseases of this important perennial crop in the Americas. This hemibiotroph infects only cacao pods and has an extended biotrophic phase lasting up to sixty days, culminating in plant necrosis and sporulation of the fungus without the formation of a basidiocarp. We sequenced and assembled 52.3 Mb into 3,298 contigs that represent the M. roreri genome. Of the 17,920 predicted open reading frames (OFRs), 13,760 were validated by RNA-Seq. Using read count data from RNA sequencing of cacao pods at 30 and 60 days post infection, differential gene expression was estimated for the biotrophic and necrotrophic phases of this plant-pathogen interaction. The sequencing data were used to develop a genome based secretome for the infected pods. Of the 1,535 genes encoding putative secreted proteins, 1,355 were expressed in the biotrophic and necrotrophic phases. Analysis of the data revealed secretome gene expression that correlated with infection and intercellular growth in the biotrophic phase and invasive growth and plant cellular death in the necrotrophic phase. Genome sequencing and RNA-Seq was used to determine and validate the Moniliophthora roreri genome and secretome. High sequence identity between Moniliophthora roreri genes and Moniliophthora perniciosa genes supports the taxonomic relationship with Moniliophthora perniciosa and the relatedness of this fungus to other basidiomycetes. Analysis of RNA-Seq data from infected plant tissues revealed differentially expressed genes in the biotrophic and necrotrophic phases. The secreted protein genes that were upregulated in the biotrophic phase are primarily associated with breakdown of the intercellular matrix and modification of the fungal mycelia, possibly to mask the fungus from plant defenses. Based on the transcriptome data, the
Directory of Open Access Journals (Sweden)
Rehman ur Ateeq
2015-01-01
Full Text Available Dieback of mango caused by Lasiodiplodia theobromae is among several diseases responsible for low crop production in Pakistan. To further complicate the issue, resistance in L. theobromae is emerging against different fungicides. L. theobromae was isolated from diseased samples of mango plants collected from various orchards in the Multan District. The efficacy of different fungicides viz. copper oxychloride, diethofencarb, pyrachlostrobin, carbendazim, difenoconazole, mancozeb, and thiophanate-methyl was evaluated in vitro using a poison food technique. Thiophanate-methyl at all concentrations was found to be the most effective among five systemic fungicides against L. theobromae, followed by carbendazim, difenoconazole and diethofencarb. The fungicides, i.e., thiophanate-methyl, difenoconazole, carbendazim and diethofencarb showed maximum efficacy with increasing concentration. The isolates of L. theobromae showed some resistance development against the tested fungicides when compared with previous work. These investigations provide new information about chemical selection for the control of holistic disease in mango growing zones of Pakistan.
Directory of Open Access Journals (Sweden)
Muhammad Wijaya
2016-10-01
Full Text Available This research aims to utilize the liquid smoke, charcoal, oil and gas that have been produced from cocoa waste shell from fast pyrolysis technology at 125-500 oC. The charcoal of the cocoa waste was analyzed using a bomb calorimeter at 5925 cal/g showed that it contains 52.02% of lignin; 17.27% of alpha cellulose and 19.56% of hemicellulose, respectively. The HPLC analysis of Wajo district cacao bean resulted in polyphenol compound as 308.35. GC-MS analysis of cocoa shell liquid smoke that pyrolized at 125-500 oC produces severals compounds such as acetic acid, n-buthane, methyl esther, propanoac acid, butanoac acid, methyl pyridine, 1-hydroxy-2-propanone, and mequinol. The FTIR analysis of cocoa bean showed a hydroxyl group at 3450.65 cm-1, carbonyl group at 1730.15 cm-1, CH group at 719.45-607.58 cm-1. The crystallinity degree of Wajo District cocoa shell analyzed using XRD was 26,50%. The existence of chemical compounds in liquid smoke products have been found as raw chemicals. Content of biomass carbon at these cacao waste increased according to the increase of pyrolisis temperature, while the carbon emission of these three materials decreased as the temperature increased. Compound polyphenol from cacao bean has a potent as anti oxidant that is friendly for environmental and healthy. Keywords: cacao bean, fermentation, polyphenol, and chemical
Physicochemical properties and antioxidant capacity of raw, roasted and puffed cacao beans.
Hu, SuJung; Kim, Byung-Yong; Baik, Moo-Yeol
2016-03-01
The antioxidant capacity and attributable bioactive compounds of puffed cacao beans were investigated. Roasting was carried out at 190°C for 15min and puffing was performed at 4-7kgf/cm(2). Cacao beans puffed at 4kgf/cm(2) showed the highest total polyphenols (23.16mgGAE/gsample) and total flavonoids (10.65mgCE/gsample) (pbeans reflected the total polyphenols and flavonoids measured. The quantities of theobromine, catechin, epicatechin, and procyanidin B2 were higher in cacao beans puffed at 4kgf/cm(2) than in roasted cacao beans. Puffed cacao beans received a good sensory score in flavor, but sourness increased as puffing pressure increased. Thus, these results suggest that, in cacao bean processing, puffing could be an alternative to roasting, which provide a rich taste and high antioxidant capacity. Copyright © 2015 Elsevier Ltd. All rights reserved.
CACAO facility. Radioactive targets at Orsay
International Nuclear Information System (INIS)
Bacri, C.O.; Petitbon-Thevenet, V.; Mottier, J.; Lefort, H.; Durnez, A.; Fortuna, F.
2014-01-01
CACAO, Chimie des Actinides et Cibles radioActives a Orsay (actinide chemistry and radioactive targets at Orsay), is a new laboratory dedicated to the fabrication and characterization of radioactive targets. It is supported by the radiochemistry group and the stable target service of the IPNO. The recurring needs of physicists working in the nuclear fuel cycle physics and the growing difficulties to obtain radioactive targets elsewhere were the main motivating factors behind the construction of this new laboratory. The first targets of 235,238 U and 232 Th have already been prepared although the full operating licenses still need to be obtained. In this paper, the installation and the equipment of CACAO will be described. An extensive study of a U test target fabricated by the CACAO laboratory has been performed and results are reported here. The different techniques used to characterize the deposit are presented and the outcome is discussed. (author)
POLYPHENOLS DISTRIBUTION AND RESERVE SUBSTANCES ANALYSIS IN CACAO SOMATIC EMBRYOGENESIS
GALLEGO RÚA, Adriana María; HENAO RAMÍREZ, Ana María; URREA TRUJILLO, Aura Inés; ATEHORTÚA GARCÉS, Lucía
2016-01-01
In order to understand the causes of lack of regeneration in cacao somatic embryos, two cacao varieties with different responses to regeneration potential were described based on their capacity to store different compounds. It is well known that seed reserves play a central role in the regenerative capability of somatic embryos; thus, we followed histochemical changes and reserve fluctuations of proteins, polysaccharides and polyphenols during somatic embryogenesis (SE) in the two cacao varie...
Sieving Effect of Sorting Machine with Vibration Table Type on Cacao Pod Based Compost
Soekarno, Siswoyo; Suharyanto, Edy; Arif, Ahmad Hudi
2009-01-01
Cacao pod is the biggest part (70% of weight) of Cacao, which was not optimaly utilized.Cacao podis one of organic material that can be functioned as an organic fertilizer, such as compost. When utilizedwith right proportion, organic fertilizer is safe for plants and not degrades the soil composition. Compostingprocess is one of utilization form of Cacao pod. The size reduction of cacao pod in the organic fertilizerprocess would help to accelerate the composting process. Smaller particle size...
Cacao is an important cash crop in Central and South America and a valuable food commodity in the United States and the global economy. The fungus Moniliophthora roreri infects and destroys cacao fruits and threatens the production of cacao in South and Central America and the Caribbean. To understa...
Royaert, Stefan; Jansen, Johannes; da Silva, Daniela Viana; de Jesus Branco, Samuel Martins; Livingstone, Donald S; Mustiga, Guiliana; Marelli, Jean-Philippe; Araújo, Ioná Santos; Corrêa, Ronan Xavier; Motamayor, Juan Carlos
2016-02-11
Witches' broom disease (WBD) caused by the fungus Moniliophthora perniciosa is responsible for considerable economic losses for cacao producers. One of the ways to combat WBD is to plant resistant cultivars. Resistance may be governed by a few genetic factors, mainly found in wild germplasm. We developed a dense genetic linkage map with a length of 852.8 cM that contains 3,526 SNPs and is based on the MP01 mapping population, which counts 459 trees from a cross between the resistant 'TSH 1188' and the tolerant 'CCN 51' at the Mars Center for Cocoa Science in Barro Preto, Bahia, Brazil. Seven quantitative trait loci (QTL) that are associated with WBD were identified on five different chromosomes using a multi-trait QTL analysis for outbreeders. Phasing of the haplotypes at the major QTL region on chromosome IX on a diversity panel of genotypes clearly indicates that the major resistance locus comes from a well-known source of WBD resistance, the clone 'SCAVINA 6'. Various potential candidate genes identified within all QTL may be involved in different steps leading to disease resistance. Preliminary expression data indicate that at least three of these candidate genes may play a role during the first 12 h after infection, with clear differences between 'CCN 51' and 'TSH 1188'. We combined the information from a large mapping population with very distinct parents that segregate for WBD, a dense set of mapped markers, rigorous phenotyping capabilities and the availability of a sequenced genome to identify several genomic regions that are involved in WBD resistance. We also identified a novel source of resistance that most likely comes from the 'CCN 51' parent. Thanks to the large population size of the MP01 population, we were able to pick up QTL and markers with relatively small effects that can contribute to the creation and selection of more tolerant/resistant plant material.
Planeamiento estratégico del cacao
Gonzales Herrera, Christian; Silva Dávalos, Nelson; Gálvez Moyano, Julio; Mercado Sotomayor, Carlos
2013-01-01
xvi, 188 h. : il. ; 30 cm. La presente tesis desarrolla el plan estratégico para el Cacao en el Perú, el cual tiene como principal objetivo establecer estrategias que permitirán el desarrollo sostenible a largo plazo y una mejora sustantiva en la calidad de vida de los integrantes de la cadena productiva y pobladores de las zona cacaoteras. Al mismo tiempo, se realiza un análisis de la situación actual del Cacao que ayuda a conocer la realidad y lo que representa a nivel nacion...
Anti-HIV and immunomodulation activities of cacao mass lignin-carbohydrate complex.
Sakagami, Hiroshi; Kawano, Michiyo; Thet, May Maw; Hashimoto, Ken; Satoh, Kazue; Kanamoto, Taisei; Terakubo, Shigemi; Nakashima, Hideki; Haishima, Yuji; Maeda, Yuuichi; Sakurai, Koji
2011-01-01
Recently, a prominent antiviral and macrophage stimulatory activity of cacao lignin-carbohydrate complex (LCC) has been reported. However, the solubility and sterility of LCC have not been considered yet. In the present study, complete solubilisation and sterilisation was achieved by autoclaving under mild alkaline conditions and the previously reported biological activities were re-examined. LCCs were obtained by 1% NaOH extraction and acid precipitation, and a repeated extraction-precipitation cycle. Nitric oxide (NO) and cytokine productions were assayed by the Griess method and ELISA, respectively. Inducible NO synthase (iNOS) expression was determined by Western blot analysis. Superoxide anion, hydroxyl radical and nitric oxide radical-scavenging activity was determined by ESR spectroscopy. Cacao mass LCC showed reproducibly higher anti-HIV activity than cacao husk LCC. Cacao mass LCC, up to 62.5 μg/ml, did not stimulate mouse macrophage-like cells (RAW264.7 and J774.1) to produce NO, nor did it induce iNOS protein, in contrast to lipopolysaccharide (LPS). Cacao mass LCC and LPS synergistically stimulated iNOS protein expression, suggesting a different point of action. Cacao mass LCC induced tumour necrosis factor-α production markedly less than LPS, and did not induce interleukin-1β, interferon-α or interferon-γ. ESR spectroscopy showed that cacao mass LCC, but not LPS, scavenged NO produced from NOC-7. This study demonstrated several new biological activities of LCCs distinct from LPS and further confirmed the promising antiviral and immunomodulating activities of LCCs.
Parra, O; Gallego, A M; Urrea, A; Rojas, L F; Correa, C; Atehortúa, L
2017-02-01
Cocoa butter (CB) is composed of 96% palmitic, stearic, oleic, linoleic and linolenic fatty acids that are responsible for the hardness, texture and fusion properties of chocolate. Through in vitro plant cell culture it is possible to modify CB lipid profiles and to study the fatty acid biosynthesis pathway on a subcellular level, evaluating fundamental aspects to enhance in vitro fatty acid production in a specific and controlled way. In this research, culture media was supplemented with acetate, biotin, pyruvate, bicarbonate and glycerol at three different concentrations and the effects on the biomass production (g/L), cell viability, and fatty acids profile and production was evaluated in in vitro cell suspensions culture. It was found that biotin stimulated fatty acid synthesis without altering cell viability and cell growth. It was also evident a change in the lipid profile of cell suspensions, increasing middle and long chain fatty acids proportion, which are unusual to those reported in seeds; thus implying that it is possible to modify lipid profiles according to the treatment used. According to the results of sucrose gradients and enzyme assays performed, it is proposed that cacao cells probably use the pentose phosphate pathway, mitochondria being the key organelle in the carbon flux for the synthesis of reductant power and fatty acid precursors. Copyright © 2016 Elsevier Masson SAS. All rights reserved.
Directory of Open Access Journals (Sweden)
Carla C. Uranga
2017-06-01
Full Text Available Many basic science questions remain regarding protein functions in the pathogen: host interaction, especially in the trunk disease fungi family, the Botryosphaeriaceae, which are a global problem for economically important plants, especially fruiting trees. Proteomics is a highly useful technology for studying protein expression and for discovering novel proteins in unsequenced and poorly annotated organisms. Current fungal proteomics approaches involve 2D SDS-PAGE and extensive, complex, protein extraction methodologies. In this work, a modified Folch extraction was applied to protein extraction to perform both de novo peptide sequencing and peptide fragmentation analysis/protein identification of the plant and human fungal pathogen Lasiodiplodia theobromae. Both bioinformatics approaches yielded novel peptide sequences from proteins produced by L. theobromae in the presence of exogenous triglycerides and glucose. These proteins and the functions they may possess could be targeted for further functional characterization and validation efforts, due to their potential uses in biotechnology and as new paradigms for understanding fungal biochemistry, such as the finding of allergenic enolases, as well as various novel proteases, including zinc metalloproteinases homologous to those found in snake venom. This work contributes to genomic annotation efforts, which, hand in hand with genomic sequencing, will help improve fungal bioinformatics databases for future studies of Botryosphaeriaceae. All data, including raw data, are available via the ProteomeXchange data repository with identifier PXD005283. This is the first study of its kind in Botryosphaeriaceae.
Directory of Open Access Journals (Sweden)
Oscar Ramirez
2011-12-01
Full Text Available The information on ecological behavior of wild sloths is very scarce. In this study we determined the home ranges and resources used by three adult female three-toed sloths (Bradypus variegatus and their four young in an agricultural matrix of cacao (Theobroma cacao, pasture, riparian forests and living fencerows in Costa Rica. Births occurred during November-December and the young became independent at five to seven months of age. Initially, mothers remained fixed in one or a few trees, but expanded their use of resources as young sloths became independent from them. Mothers initially guided the young to preferred food and cover resources, but they gradually left their young in small nucleus areas and colonized new areas for themselves. Home range sizes for young sloths (up to seven months of age varied between 0.04-0.6 hectares, while home range sizes for mothers varied from 0.04-25.0 hectares. During the maternal care period, 22 tree species were used, with the most common being Cecropia obtusifolia (30.9%, Coussapoa villosa (25.6%, Nectandra salicifolia (12.1%, Pterocarpus officinalis (5.8% and Samanea saman (5.4%. However, young sloths used only 20 tree species, with the most common being C. villosa (18.4%, S. saman (18.5 % and N. salicifolia (16.7%. The cacao agroforest was used only by mother sloths and never by their young following separation. However, in the riparian forest, both mother sloths and young used the tree species. A total of 28 tree species were used by the mother sloth; including the food species: C. obtusifolia, C. villosa, N. salicifolia and P. officinalis. However, the young used 18 trees species in this habitat with N. salicifolia and S. saman most commonly used, although they rested and fed during the day in C. obtusifolia, C. villosa and O. sinnuata. The cacao agroforest with adjacent riparian forests and fencerows provides an important habitat type that links the smaller secondary forests and other patches. Rev
African Journals Online (AJOL)
Items 151 - 200 of 283 ... Vol 4 (2004): Supplement, Polyphenol oxidase and peroxidase analysis in newly selected clones of Theobroma cacao L. after inoculation with Phytophthora megakarya bra and grif, Abstract PDF. Djioda Joseph Nankeu, Annie Ewane, Thaddee Boudjeko, Nicolas Niemenak, Pierre François Djocgoue, ...
Separation and characterization of phenolic compounds from ...
African Journals Online (AJOL)
Attioua
2013-07-03
Jul 3, 2013 ... (Theobroma cacao). J. Mass Spectrom. 38:35-42. Sanchez R, Jauregui LR, Viladomat B, Codina (2004). Qualitative analysis of phenolic compounds in apple Pomace using liquid chromatography coupled to mass spectrometry in tandem mode. Rapid Communun Mass Spectrom. 18:553-563. Saulo LDS ...
Directory of Open Access Journals (Sweden)
Lisette Valverde Cerdas
2016-03-01
Full Text Available Se llevó a cabo una investigación con el fin de establecer la metodología adecuada para inducir embriogénesis somática en cacao, a partir de semillas maduras. Se estudió el efecto del pH, la luz y la concentración de sacarosa sobre la respuesta embriogénica. Los dos cultivares mostraron diferente respuesta morfogénica y en ambos, estuvo influenciada por el pH, la luz y la concentración de sacarosa. La mejor respuesta embriogénica se obtuvo con un pH de 6,7. El número de embriones producidos fue mayor bajo condiciones de oscuridad que en presencia de luz. La formación de callo y la diferenciación de embriones somáticos estuvo directamente influenciada por la concentración de azúcar en el medio de cultivo. La mayor cantidad de embriones se obtuvo con niveles de sacarosa entre 4% y 6% para el híbrido UF-613xIMC-67 y niveles entre 2% y 4% de sacarosa para el cultivar CATIE-1000. Se presento una embriogénesis somática directa. Los resultados obtenidos sugieren la necesidad de continuar realizando estudios con esta especie.
Pereira, Allan Silva; de Almeida, Alex-Alan Furtado; Branco, Márcia Christina da Silva; Costa, Marcio Gilberto Cardoso; Ahnert, Dario
2017-01-01
Selecting parents and evaluating progenies is a very important step in breeding programs and involves approaches such as understanding the initial stages of growth and characterizing the variability among genotypes for different parameters, such as physiological, growth, biomass partitioning and nutrient translocation to the aerial part. In these cases, facilitating tools can be used to understand the involved gene dynamics, such as diallel crosses and genetic and phenotypic correlations. Our main hypothesis is that the contrasting phenotypes of these parental genotypes of cocoa used are due to genetic factors, and progenies derived from crosses of these parental genotypes are useful for breeding programs related to plant architecture, physiological parameters and translocation of mineral nutrients. We aimed to evaluate the combining abilities in progenies of cacao (Theobroma cacao L) originating from contrasting parents for canopy vigor. Emphasis was given to the evaluation of morphological and physiological parameters and the phenotypic and genotypic correlations to understand the dynamics of the action of the genes involved, as well as in expression profile from genes of gibberellins biosynthesis pathway in the parents. Fifteen F1 progenies were obtained from crosses of six clones (IMC 67, P4B, PUCALA, SCA 6, SCA 24 and SJ 02) that were evaluated in a randomized complete block design with four replicates of 12 plants per progeny, in a balanced half table diallel scheme. It is possible to identify and select plants and progenies of low, medium and high height, as there is expressive genetic variability for the evaluated parameters, some of these on higher additive effects, others on larger nonadditive effects and others under a balance of these effects. Most physiological parameters evaluated show that for selection of plants with the desired performance, no complex breeding methods would be necessary due to the high and medium heritability observed. Strong
Santos, Ivanildes C Dos; Almeida, Alex-Alan Furtado de; Anhert, Dário; Conceição, Alessandro S da; Pirovani, Carlos P; Pires, José L; Valle, Raúl René; Baligar, Virupax C
2014-01-01
Six months-old seminal plants of 36 cacao genotypes grown under greenhouse conditions were subjected to two soil water regimes (control and drought) to assess, the effects of water deficit on growth, chemical composition and oxidative stress. In the control, soil moisture was maintained near field capacity with leaf water potentials (ΨWL) ranging from -0.1 to -0.5 MPa. In the drought treatment, the soil moisture was reduced gradually by withholding additional water until ΨWL reached values of between -2.0 to -2.5 MPa. The tolerant genotypes PS-1319, MO-20 and MA-15 recorded significant increases in guaiacol peroxidase activity reflecting a more efficient antioxidant metabolism. In relation to drought tolerance, the most important variables in the distinguishing contrasting groups were: total leaf area per plant; leaf, stem and total dry biomass; relative growth rate; plant shoot biomass and leaf content of N, Ca, and Mg. From the results of these analyses, six genotypes were selected with contrasting characteristics for tolerance to soil water deficit [CC-40, C. SUL-4 and SIC-2 (non-tolerant) and MA-15, MO-20, and PA-13 (tolerant)] for further assessment of the expression of genes NCED5, PP2C, psbA and psbO to water deficit. Increased expression of NCED5, PP2C, psbA and psbO genes were found for non-tolerant genotypes, while in the majority of tolerant genotypes there was repression of these genes, with the exception of PA-13 that showed an increased expression of psbA. Mutivariate analysis showed that growth variables, leaf and total dry biomass, relative growth rate as well as Mg content of the leaves were the most important factor in the classification of the genotypes as tolerant, moderately tolerant and sensitive to water deficit. Therefore these variables are reliable plant traits in the selection of plants tolerant to drought.
Aislamiento de microorganismos para control biológico de Moniliophthora roreri
Liliana Yanet Suárez Contreras; Alba Luz Rangel Riaño
2013-01-01
Moniliophthora roreri es un hongo que causa la moniliasis, una enfermedad de la mazorca en el cultivo de cacao (Theobroma cacao), con pérdidas hasta del 60% de la cosecha. El control biológico utilizando microorganismos endófitos surge como una alternativa para el manejo de esta enfermedad. En la presente investigación se evaluaron microorganismos con potencial para control biológico de M. roreri en Norte de Santander, Colombia. Para el efecto, se aisló e identificó este fitopatógeno y se uti...
Diccionario de alimentación y gastronomía en Venezuela
Gil Otaiza, Ricardo
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
Los productos típicos y su reglamentación.
Cartay, Rafael
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
La demanda de las calorías en Venezuela 1970-1995:
Anido R., José Daniel; Gutiérrez S., Alejandro
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
Notas sobre la situación de la producción primaria de arroz en Venezuela
Molina, Luisa Elena
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
Quevedo, Rafael Isidro
2003-01-01
1.- Artículos Cartay, Rafael. "Los productos típicos y su reglamentación. Una tentativa de aplicación de la denominación de origen al cacao venezolano" Kalvatchev, Zlatko; Garzaro, Domingo; Guerra Cedezo, Franklin. "Theobroma Cacao L.: Un nuevo enfoque para nutrición y salud" Anido, Daniel; Gutiérrez, Alejandro. "La demanda de las calorías en Venezuela 1970-1995: Algunas evidencias empíricas" Molina, Luisa Elena. "Notas sobre la situación de la producción primaria de arroz en Ven...
Antimicrobial and plant growth-promoting properties of the cacao endophyte Bacillus subtilis ALB629.
Falcäo, L L; Silva-Werneck, J O; Vilarinho, B R; da Silva, J P; Pomella, A W V; Marcellino, L H
2014-06-01
To investigate the effects of the endophyte Bacillus subtilisALB629 on the growth of cacao seedlings at early developmental stage and to evaluate its antimicrobial properties. Germinating cacao seeds were inoculated with ALB629, and seedlings growth was evaluated 30 days later. Significant increase (P cacao-grafting procedure in the field, ALB629 increased the grafting success rate (24%), indicating its protective effect. In addition, this Bacillus secretes an antagonist compound, as shown by the antifungal activity of the cell-free culture. Bacillus subtilisALB629 promotes cacao root growth, besides promoting growth of the aerial part of cacao seedlings. It has antimicrobial properties and produces an antifungal compound. ALB629 presented beneficial characteristics for cacao cultivation, being a good biological control agent candidate. Furthermore, it is a potential source of antifungal compound with potential for commercial exploitation. © 2014 The Society for Applied Microbiology.
Protective effect and expression of defense-related ESTs induced by ...
African Journals Online (AJOL)
Witches' broom disease (WBD), caused by the fungus Moniliophthora perniciosa, is one of the main diseases in cocoa (Theobroma cacao) and has caused severe economic losses. Integrated disease management has been the focus for its control and therefore, the identification of new inducers of plant resistance is ...
International Journal of Biological and Chemical Sciences - Vol 8 ...
African Journals Online (AJOL)
Phenolic content and heritability of resistance in four hybrid populations of Theobroma cacao L. after leaves inoculation with Phytophthora megakarya Bras. et Grif · EMAIL FREE FULL TEXT EMAIL FREE FULL TEXT DOWNLOAD FULL TEXT DOWNLOAD FULL TEXT. ML Ondobo, P Effa Onomo, PF Djocgoue, J Manga ...
Impacts of Climate Change and Climate Variability on Cocoa ...
African Journals Online (AJOL)
Impacts of Climate Change and Climate Variability on Cocoa ( Theobroma Cacao ) Yields in Meme Division, South West Region of Cameroon. ... Farm selection was based on age, consistency of sizes and management practices in an attempt to keep the factors affecting cocoa yield constant. Data on cocoa yield, flowering, ...
The Graft Copolymerisation of Acrylamide onto Cellulose using ...
African Journals Online (AJOL)
DR. MIKE HORSFALL
ABSTRACT: Graft copolymers of acrylamide onto holocellulose derived from cocoa. (Theobroma cacao) wood meal have been produced using hydroquinone enhanced Fe2+/H2O2 redox system. The addition of hydroquinone to the redox system affected the effectiveness of the redox system to initiate graft copolymer ...
Líma, L.J.R.
2012-01-01
Cocoa beans (Theobroma cacaoL.) are the basis for chocolate and cocoa powder production. The first step in the production of these food products consists of a spontaneous fermentation of the beans in the tropical producing countries, in order to allow the formation of the essential
1876-IJBCS-Article-Kicho Denis Yapo
African Journals Online (AJOL)
hp
Polyphenols have gained much interest recently due to their antioxidant capacity and possible benefits to human health. Cocoa (Theobroma cacao) is a rich source of polyphenols and has higher antioxidant activity than teas and red wines. Cocoa and its derived products contain different types of polyphenols and possess.
Isolation and characterization of an AGAMOUS homologue from cocoa
Chaidamsari, T.; Sugiarit, H.; Santoso, D.; Angenent, G.C.; Maagd, de R.A.
2006-01-01
We report the cloning of a cDNA from TcAG, an AG (Arabidopsis thaliana MADS-box C-type transcription factor gene AGAMOUS) homologue from cocoa (Theobroma cacao L.). TcAG was in the cocoa flower expressed primarily in stamens and ovaries, comparable to AG in Arabidopsis. Additionally, we found that
Mycological evaluation of a ground cocoa-based beverage ...
African Journals Online (AJOL)
Cocoa beans (Theobroma cacao) are processed into cocoa beverage through fermentation, drying, roasting and grounding of the seed to powder. The mycological quality of 39 samples of different brand of these cocoa – based beverage referred to as 'eruku oshodi' collected from 3 different markets in south – west Nigeria ...
Variability of in vitro and phenological behaviours of cocoa hybrids ...
African Journals Online (AJOL)
Cultivated cocoa species (Theobroma cacao L.) is originated from tropical rainforests of South and Central America. Its fermented and dried seeds constitute the raw material for the chocolate manufacture. In order to analyse the variability of the in vitro and phenological behaviours of 6 cocoa hybrids, the typological and ...
Antimicrobial effects of ionizing radiation on artificially and naturally contaminated cacao beans
International Nuclear Information System (INIS)
Restaino, L.; Myron, J.J.J.; Lenovich, L.M.; Bills, S.; Tscherneff, K.
1984-01-01
With an initial microbial level of ca. 10 7 microorganisms per g of Ivory Coast cacao beans, 5 kGy of gamma radiation from a Co 60 source under an atmosphere of air reduced the microflora per g by 2.49 and 3.03 logs at temperatures of 35 and 50 0 C, respectively. Bahia cacao beans were artificially contaminated with dried spores of Aspergillus flavus and Penicillium citrinum, giving initial fungal levels of 1.9 x 10 4 and 1.4 x 10 3 spores per g of whole Bahia cacao beans, respectively. The average D 10 values for A. flavus and P. citrinum spores on Bahia cacao beans were 0.66 and 0.88 kGy, respectively. 12 references
Natsume, Midori; Baba, Seigo
2014-01-01
Previous studies in humans have shown that the cacao polyphenols, (-)-epicatechin and its oligomers, prevent in vitro and ex vivo low-density lipoprotein oxidation mediated by free radical generators and metal ions and also reduce plasma LDL-cholesterol levels. The aim of this study was to examine the effects of cacao polyphenols on the development of atherosclerosis in apolipoprotein E-deficient (-/-) mice. Mice aged 8 weeks (n = 90) were randomized into three groups, and fed either normal mouse chow (controls) or chow supplemented with 0.25 or 0.40 % cacao polyphenols for 16 weeks. The mean plaque area in cross-sections of the brachiocephalic trunk was measured and found to be lower in the 0.25 % cacao polyphenol group than in the control group (p cacao polyphenol group (p cacao polyphenols inhibit the development of atherosclerosis in apolipoprotein E-deficient (-/-) mice by reducing oxidative stress and inflammatory responses.
Influence of low light intensity and soil flooding on cacao physiology
Growth and development of plants frequently are limited by multiple abiotic stresses that occur simultaneously in the environment. Cabruca’ an agroforestry system is a main cropping system invariably adapted for cultivation of cacao in southern Bahia, Brazil. In this system of management cacao is gr...
The Search for Value and Meaning in the Cocoa Supply Chain in Costa Rica
Jessica Haynes; Frederick Cubbage; D. Evan Mercer; Erin Sills
2012-01-01
Qualitative interviews with participants in the cocoa (Theobroma cacao) supply chain in Costa Rica and the United States were conducted and supplemented with an analysis of the marketing literature to examine the prospects of organic and Fairtrade certification for enhancing environmentally and socially responsible trade of cocoa from Costa Rica. Respondents were...
Effect of liquid nitrogen storage time on the survival and ...
African Journals Online (AJOL)
Investigations were undertaken on the effect of liquid nitrogen (LN) storage time on survival and regeneration of somatic embryos of cocoa (Theobroma cacao l.). Somatic embryos from different cocoa genotypes (AMAZ 3-2, AMAZ 10-1, AMAZ 12, SIAL 93, and IMC 14) at 15.45% moisture content were cryopreserved in LN ...
African Journals Online (AJOL)
Osafo, E L. Vol 47, No 1 (2014) - Articles Some blood indices in finisher broiler chickens fed cocoa pod husk (Theobroma cacao L.) fermented with Pleurotus ostreatus or treated with enzymes as ingredients in their diets. Abstract. ISSN: 0855-0042. AJOL African Journals Online. HOW TO USE AJOL... for Researchers · for ...
Apuntes sobre el Cultivo del Cacao
Directory of Open Access Journals (Sweden)
Chavarriaga. Eduardo
1940-09-01
Full Text Available El sombrío constituye uno de los problemas que se presentan en el cultivo del cacao, de necesaria resolución para ayuda del agricultor en su labor al producir tan importante grano. Contribuye a la economía del cultivo un conocimiento amplio de la cuestión que debe preocupar al productor inquiriendo no solamente por lo acostumbrado en la región, sino por lo que en otras partes se conoce sobre el particular, para abandonar un poco el emperismo y hacer una industria cada día más próspera. Como razón a favor del sombrío, tenemos los países en donde se produce cacao de fina calidad; Trinidad, Venezuela. Nicaragua, siempre acostumbran la sombra; y sin ir muy lejos, en el Valle del Cauca, donde no se cultiva a pleno sol y se obtienen plantaciones de larga duración y producto superior, es bien conocido el beneficio de ella; allí, los agricultores conocen los desastrosos efectos que ocasiona la falta de sombra, cuando por cualquier causa mueren los árboles que la suministran. Por tanto, en este estudio indicaremos el uso de la sombra para el cacao, como el medio de conservar la fertilidad y buenas condiciones del suelo, obtener buenos rendimientos y asegurar larga vida a la plantación.
Determination of Selection Index of Cocoa (Theobroma Cacao L.) Yield Traits Using Regression Methods
Setyawan, Bayu; Taryono; Mitrowihardjo, Suyadi
2016-01-01
The increasing chocolate consumption has not been followed by growing production of dry cocoa beans. In order to support the increase in cocoa production, planting materials with high yield are needed. The objective of this research was to determine the components of cocoa traits affecting weight of dry cocoa beans, and set a selection index for superior cocoa trees. The experiment material were four cocoa hybrid populations of which their family ancestry were unknown, and were planted on Sam...
Directory of Open Access Journals (Sweden)
F.H. Chamorro-Ramirez
2013-12-01
Full Text Available The objective of this work was to evaluate addition effect of 3% of nopal fiber (FN and cacao powder (CA on the physicochemical, nutritional content and sensory acceptation of patty meat. A total of 144 patties were elaborated in three different batches: Control (TC no addition; FN with 3% of FN; and CA with 3% of CA. Physicochemical tests (pH, Aw, texture (TPA and instrumental color (CIE-Lab at different storage times (0, 2, 7, 14 and 28 days, besides to nutritional content and acceptation test. pH increased in all the treatments at 28 days of storage, where CA addition decreased luminosity (P>0.05 and maintained higher a* values (P0.05. FN or CA addition increased fiber content (P<0.05. Patties with FN showed a moderate acceptation. Since addition of FN or CA did not decreased consumer acceptation, these can be employed as ingredients in the development of functional foods.
Energy Technology Data Exchange (ETDEWEB)
Sundaram, Alamelu; Sundaram, K. M.S. [Department of Chemistry, University of Ghana, Legon (Ghana)
1970-01-15
undergone complete degradation within an interval of 10 days after treatment, i. e. within an interval of 5 days after the day from which it was detectable. Thus the presence of anticholinesterase agents in the cocoa plants was shown to be practically nil after a period of 10 days from the date of application. In the present investigation it became evident from the uptake studies that {sup 32}P-materials were detectable in the tree even up to 72 days after the insecticide was applied; the chloroform/water partition technique showed the presence of {sup 32}P-materials in the water layer and in the residue up to 28 days after treatment whereas the spectrophotometric and column-chromatographic techniques were able to detect sumithion and sumioxon only up to 10 days after application. This definitely indicated that during this 10-day period sumithion and sumioxon underwent complete degradation and were hydrolysed into water-soluble phosphoric and substituted phosphoric acid-{sup 32}P which were probably utilised later in the formation of water-insoluble proteins- {sup 32}P of high molecular weights. These proteins- {sup 32}P seem to persist for a considerable length of time in the tree thus accounting for the persistent radioactivity even up to ca. 3 months after application. (author) [French] Les auteurs ont étudié la répartition par translocation et les processus métabolitiques du sumithion, insecticide par contact, dans le cacaoyer, après application foliaire de ce produit, soit ordinaire, soit marqué avec {sup 32}P. La répartition par translocation montre que la radioactivité est initialement le plus élevée dans les échantillons d’écorce et le plus faible dans les échantillons de fruits (fèves de cacao en particulier). Ensuite, pendant environ deux mois et demi, la radioactivité de l'écorce décroît rapidement alors que celle des fèves augmente constamment, ce qui prouve que {sup 32}P de l'insecticide finit par être incorporé dans les protéines qui
Sabatier, Rodolphe; Wiegand, Kerstin; Meyer, Katrin
2013-01-01
Ecological intensification, i.e. relying on ecological processes to replace chemical inputs, is often presented as the ideal alternative to conventional farming based on an intensive use of chemicals. It is said to both maintain high yield and provide more robustness to the agroecosystem. However few studies compared the two types of management with respect to their consequences for production and robustness toward perturbation. In this study our aim is to assess productive performance and robustness toward diverse perturbations of a Cacao agroecosystem managed with two contrasting groups of strategies: one group of strategies relying on a high level of pesticides and a second relying on low levels of pesticides. We conducted this study using a dynamical model of a Cacao agroecosystem that includes Cacao production dynamics, and dynamics of three insects: a pest (the Cacao Pod Borer, Conopomorpha cramerella) and two characteristic but unspecified beneficial insects (a pollinator of Cacao and a parasitoid of the Cacao Pod Borer). Our results showed two opposite behaviors of the Cacao agroecosystem depending on its management, i.e. an agroecosystem relying on a high input of pesticides and showing low ecosystem functioning and an agroecosystem with low inputs, relying on a high functioning of the ecosystem. From the production point of view, no type of management clearly outclassed the other and their ranking depended on the type of pesticide used. From the robustness point of view, the two types of managements performed differently when subjected to different types of perturbations. Ecologically intensive systems were more robust to pest outbreaks and perturbations related to pesticide characteristics while chemically intensive systems were more robust to Cacao production and management-related perturbation.
Keragaman Semut pada Ekosistem Tanaman Kakao di Desa Banjaroya Kecamatan Kalibawang Yogyakarta
Directory of Open Access Journals (Sweden)
Moh. Ikbal
2014-12-01
Full Text Available This study aims to determine the diversity of ants in cocoa (Theobroma cacao L. ecosystems in six hamlets in the village of Banjaroya, District Kalibawang Yogyakarta. The sampling was carried out by the method of feeding ants using tuna and sugar solution, which is placed on the cacao tree and the ground surface; pit-fall traps; and direct picking by hand. Six sub-family of ants, namely Cerapachynae, Dolichoderinae, Myrmicinae, Ponerinae, and Pseudomyrmicinae were found. Six of the most abundant genera found in each catchment were Dolichoderus sp., Anoplolepis sp., Paratrechina sp., Crematogaster sp., Pheidole sp., and Pheidologeton sp., which is known to be aggressive and invasive. The analysis showed that the diversity of ant communities in the Village Banjaroya categorized as medium (H ‘> 1-3, meaning that the overall state of the ecosystem of the cocoa crop was classified as stable or steady. Meanwhile, the results of the analysis of the dominance index (C shows that the community of ants in each village tends was tended to be dominated by a single species (C close to 0. The relationship between habitat condition and the diversity of ant was discussed in this article. Penelitian bertujuan untuk mengetahui keragaman semut pada ekosistem kakao (Theobroma cacao L. di 6 dusun di Desa Banjaroya, Kecamatan Kalibawang Yogyakarta. Pengambilan sampel semut dilakukan dengan metode pengumpanan menggunakan ikan tuna dan larutan gula yang diletakkan pada pohon kakao dan permukaan tanah; lubang perangkap; dan pemungutan dengan tangan. Enam subfamili semut, yaitu Cerapachynae, Dolichoderinae, Myrmicinae, Ponerinae, dan Pseudomyrmicinae telah ditemukan di lokasi pengambilan sampel. Enam genus yaitu Dolichoderus sp., Anoplolepis sp., Paratrechina sp., Crematogaster sp., Pheidole sp. dan Pheidologeton sp. yang dikenal agresif dan invasif, ditemukan paling melimpah di setiap dusun. Hasil analisis keragaman komunitas semut di Desa
Polyphenols distributions and reserve substances analysis in cacao somatic embryogenesis
Adriana María Gallego Rúa; Ana María Henao Ramírez; Aura Inés Urrea Trujillo; Lucía Atehortúa Garcés
2016-01-01
ABSTRACTIn order to understand the causes of lack of regeneration in cacao somatic embryos, two cacao varieties with different responses to regeneration potential were described based on their capacity to store different compounds. It is well known that seed reserves play a central role in the regenerative capability of somatic embryos; thus, we followed histochemical changes and reserve fluctuations of proteins, polysaccharides and polyphenols during somatic embryogenesis (SE) in the two cac...
Tchinda, Romaric Armel Mouafo; Boudjeko, Thaddée; Simao-Beaunoir, Anne-Marie; Lerat, Sylvain; Tsala, Éric; Monga, Ernest; Beaulieu, Carole
2016-01-01
Vascular plants are commonly colonized by endophytic actinobacteria. However, very little is known about the relationship between these microorganisms and cacao fruits. In order to determine the physiological and taxonomic relationships between the members of this community, actinobacteria were isolated from cacao fruits and seeds. Among the 49 isolates recovered, 11 morphologically distinct isolates were selected for further characterization. Sequencing of the 16S rRNA gene allowed the partition of the selected isolates into three phylogenetic clades. Most of the selected endophytic isolates belonged to the Streptomyces violaceusniger clade. Physiological characterization was carried out and a similarity index was used to cluster the isolates. However, clustering based on physiological properties did not match phylogenetic lineages. Isolates were also characterized for traits commonly associated with plant growth-promoting bacteria, including antibiosis and auxin biosynthesis. All isolates exhibited resistance to geldanamycin, whereas only two isolates were shown to produce this antibiotic. Endophytes were inoculated on radish seedlings and most isolates were found to possess plant growth-promoting abilities. These endophytic actinobacteria inhibited the growth of various plant pathogenic fungi and/or bacteria. The present study showed that S. violaceusniger clade members represent a significant part of the actinobacterial community living as endophytes in cacao fruits and seeds. While several members of this clade are known to be geldanamycin producers and efficient biocontrol agents of plant diseases, we herein established the endophytic lifestyle of some of these microorganisms, demonstrating their potential as plant health agents.
Chingandu, Nomatter; Zia-Ur-Rehman, Muhammad; Sreenivasan, Thyail N; Surujdeo-Maharaj, Surendra; Umaharan, Pathmanathan; Gutierrez, Osman A; Brown, Judith K
2017-05-01
Suspected virus-like symptoms were observed in cacao plants in Trinidad during 1943, and the viruses associated with these symptoms were designated as strains A and B of cacao Trinidad virus (CTV). However, viral etiology has not been demonstrated for either phenotype. Total DNA was isolated from symptomatic cacao leaves exhibiting the CTV A and B phenotypes and subjected to Illumina HiSeq and Sanger DNA sequencing. Based on de novo assembly, two apparently full-length badnavirus genomes of 7,533 and 7,454 nucleotides (nt) were associated with CTV strain A and B, respectively. The Trinidad badnaviral genomes contained four open reading frames, three of which are characteristic of other known badnaviruses, and a fourth that is present in only some badnaviruses. Both badnaviral genomes harbored hallmark caulimovirus-like features, including a tRNA Met priming site, a TATA box, and a polyadenylation-like signal. Pairwise comparisons of the RT-RNase H region indicated that the Trinidad isolates share 57-71% nt sequence identity with other known badnaviruses. Based on the system for badnavirus species demarcation in which viruses with less than 80% nt sequence identity in the RT-RNase gene are considered members of separate species, these isolates represent two previously unidentified badnaviruses, herein named cacao mild mosaic virus and cacao yellow vein banding virus, making them the first cacao-infecting badnaviruses identified thus far in the Western Hemisphere.
Exportación de nibs de cacao nativo de fino aroma con niveles de cadmio <= 0.5 mg/kg
Santa Cruz Muñoz, Iris Magaly
2016-01-01
La tesis expone un plan de negocios que surge a raíz de la demanda creciente internacional del cacao debido a una demanda de un chocolate con mayor contenido de cacao, la cual debe satisfacer normas sociales, saludables, ecológicas y éticas del cual el Perú es reconocido como país productor de Cacao de Fino Aroma. Asimismo, existe la amenaza que tienen los productores latinoamericanos de cacao por haberse encontrado altos niveles de cadmio en granos de cacao, siendo este perjudicial para la s...
Moniliophthora roreri (Cif y Par Evans et al. in the crop of cocoa
Directory of Open Access Journals (Sweden)
Fernando David Sánchez Mora
2012-09-01
Full Text Available More than a century, cacao (Theobroma cacao L. in Ecuador has been an important source of income for farmers and currency for the country, becoming one of the biggest exporters worldwide. Then, gradually lost that status due to the attack of diseases, including moniliasis caused by [Moniliophthora roreri (Cif and Par Evans et al.]. It can cause damage of up to 80% in production. Currently there is little scientific date information on its occurrence, symptoms, etiology, epidemiology, life cycle management or control strategies of that disease, by performing this review both these important topics, bringing with it to this area of knowledge.
Algunas Observaciones sobre el Desecamiento del Grano de Cacao Bajo Diferentes Condiciones
Directory of Open Access Journals (Sweden)
Platone E.
1949-12-01
Full Text Available Las diversas modalidades del proceso de desecamiento del cacao fermentado (con tal de que la temperatura de desecamiento no sea muy elevada tienen escasa influencia sobre la calidad aparente del grano, a condición desde luego, de que el proceso sea llevado hasta lograr un mismo porcentaje de humedad en los granos. Ya se sabía que, aparentemente, debería preferirse el desecamiento artificial, al natural, por cuanto se logra un mejor control de la temperatura y de otras condiciones del proceso. En realidad, los fabricantes prefieren, en igualdad de condiciones, el cacao desecado al sol. A este propósito había sido establecido por la Oficina Internacional de Fabricantes de Cacao y Chocolate, según dice Knapp (ya citado, que el cacao que hubiese sido secado a más de 50°C, fuera específicamente rotulado como "desecado artificialmente". Sin embargo, el desecamiento al sol significa ordinariamente para los granos, una temperatura notoriamente superior a dichos 50oC, aunque por lo regular no suprior a 60°C.
Development of a marker assisted selection program for cacao.
Schnell, R J; Kuhn, D N; Brown, J S; Olano, C T; Phillips-Mora, W; Amores, F M; Motamayor, J C
2007-12-01
ABSTRACT Production of cacao in tropical America has been severely affected by fungal pathogens causing diseases known as witches' broom (WB, caused by Moniliophthora perniciosa), frosty pod (FP, caused by M. roreri) and black pod (BP, caused by Phytophthora spp.). BP is pan-tropical and causes losses in all producing areas. WB is found in South America and parts of the Caribbean, while FP is found in Central America and parts of South America. Together, these diseases were responsible for over 700 million US dollars in losses in 2001 (4). Commercial cacao production in West Africa and South Asia are not yet affected by WB and FP, but cacao grown in these regions is susceptible to both. With the goal of providing new disease resistant cultivars the USDA-ARS and Mars, Inc. have developed a marker assisted selection (MAS) program. Quantitative trait loci have been identified for resistance to WB, FP, and BP. The potential usefulness of these markers in identifying resistant individuals has been confirmed in an experimental F(1) family in Ecuador.
Directory of Open Access Journals (Sweden)
Muñoz Arboleda Fernando
2006-06-01
Full Text Available
Se usó el método de bolsas de descomposición para estudiar la pérdida de biomasa y liberación de N, P, K, Ca y Mg desde las raíces finas (<2 mm en los sistemas agroforestales de cacao con sombras de poró y laurel. Se muestrearon bolsas a las 1, 2, 4, 6, 12, 18 y 25 semanas en las épocas seca y lluviosa. Las tasas de descomposición y liberación de nutrimentos fueron bien descritas por un modelo exponencial doble. Se observó alta relación entre las tasas de pérdida de biomasa y liberación de N de las tres especies. Las tasas de liberación de nutrimentos fueron K > Mg > P > N > Ca. Después de una semana de incubación cerca del 90% del K fue liberado mientras que el Ca tendió a la acumulación. Las raíces de poró fueron las de más rápida descomposición y liberación de nutrimentos, excepto de K. El poró sería la especie de sombra adecuada para sistemas de producción que requieran rápida recirculación de nutrimentos. El laurel exhibió tasas lentas de descomposición y liberación de nutrimentos.
Palabras claves: Agroforestería, Theobroma cacao, Erythrina poeppigiana, Cordia alliodora, recirculación de nutrimentos, descomposición de raíces finas.
Origin and Domestication of Native Amazonian Crops
Directory of Open Access Journals (Sweden)
Doriane Picanço-Rodrigues
2010-01-01
Full Text Available Molecular analyses are providing new elements to decipher the origin, domestication and dispersal of native Amazonian crops in an expanding archaeological context. Solid molecular data are available for manioc (Manihot esculenta, cacao (Theobroma cacao, pineapple (Ananas comosus, peach palm (Bactris gasipaes and guaraná (Paullinia cupana, while hot peppers (Capsicum spp., inga (Inga edulis, Brazil nut (Bertholletia excelsa and cupuassu (Theobroma grandiflorum are being studied. Emergent patterns include the relationships among domestication, antiquity (terminal Pleistocene to early Holocene, origin in the periphery, ample pre-Columbian dispersal and clear phylogeographic population structure for manioc, pineapple, peach palm and, perhaps, Capsicum peppers. Cacao represents the special case of an Amazonian species possibly brought into domestication in Mesoamerica, but close scrutiny of molecular data suggests that it may also have some incipiently domesticated populations in Amazonia. Another pattern includes the relationships among species with incipiently domesticated populations or very recently domesticated populations, rapid pre- or post-conquest dispersal and lack of phylogeographic population structure, e.g., Brazil nut, cupuassu and guaraná. These patterns contrast the peripheral origin of most species with domesticated populations with the subsequent concentration of their genetic resources in the center of the basin, along the major white water rivers where high pre-conquest population densities developed. Additional molecular genetic analyses on these and other species will allow better examination of these processes and will enable us to relate them to other historical ecological patterns in Amazonia.
Magagna, Federico; Guglielmetti, Alessandro; Liberto, Erica; Reichenbach, Stephen E; Allegrucci, Elena; Gobino, Guido; Bicchi, Carlo; Cordero, Chiara
2017-08-02
This study investigates chemical information of volatile fractions of high-quality cocoa (Theobroma cacao L. Malvaceae) from different origins (Mexico, Ecuador, Venezuela, Columbia, Java, Trinidad, and Sao Tomè) produced for fine chocolate. This study explores the evolution of the entire pattern of volatiles in relation to cocoa processing (raw, roasted, steamed, and ground beans). Advanced chemical fingerprinting (e.g., combined untargeted and targeted fingerprinting) with comprehensive two-dimensional gas chromatography coupled with mass spectrometry allows advanced pattern recognition for classification, discrimination, and sensory-quality characterization. The entire data set is analyzed for 595 reliable two-dimensional peak regions, including 130 known analytes and 13 potent odorants. Multivariate analysis with unsupervised exploration (principal component analysis) and simple supervised discrimination methods (Fisher ratios and linear regression trees) reveal informative patterns of similarities and differences and identify characteristic compounds related to sample origin and manufacturing step.
Breeding for disease resistance in cacao
Cacao production must increase in order to meet the projected rise in the demand for chocolate. Approximately one-third of global production is lost annually to diseases and insects. Four diseases account for the greatest losses worldwide: black pod, caused by four Phytophthora spp; witches’ broom...
Molecular characterisation of a germplasm bank for Theobroma genus using the RAPD technique
Directory of Open Access Journals (Sweden)
Yovany Moreno
2004-07-01
Full Text Available RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between the two species (58.3% polymorphic. A high degree of intra-specific similarity particularly in T. bicolor was established from the similarity matrix obtained by using the Dice index and represented in a UPGMA dendrogram and the principal components analysis (PCA. The comparison of this analysis with a previous morpho-agronomic evaluation of some T. grandiflorum individuals revealed that the groups generated on the basis of its agronomic and morphological traits were heterogeneous at molecular level. The obtained information will be used as a tool in strategies regarding maintenance, enrichment and use of the germplasm bank. Key words: Theobroma grandiflorum, Theobroma bicolour, RAPD, molecular characterisation.
Directory of Open Access Journals (Sweden)
Fuentes Baca Anamaría
1998-12-01
Full Text Available Se caracterizaron las poblaciones de lombrices de tierr.a de las especies Pheretimasp., Eudovoscolexsp. y Periscolex sp., presentes en un Typic Dystropept del municipio El Retorno (Guaviare, Colombia, bajo ocho tipos de usos (pradera sin pastoreo, pradera con semipastoreo, arreglo silvopastoril, cultivos de chontaduro y cacao socolado, rastrojo de cinco años, rastrojo de segundo crecimiento y bosque, utilizando 10 unidades de muestreo por cobertura y evaluando parámetros de abundancia, densidad y biomasa en relación con algunas características físico-químicas del suelo. Los resultados mostraron diferencias significativas entre las cantidades totales de huevos y adultos en el sistema silvopastoril vs. las praderas y en la pradera con semipastoreo vs. pradera sin pastoreo y de adultos en la cobertura chontaduro (Bactrys gasipaes - kudzu vs. cacao (Theobroma cacao. En varios casos, las respuestas de biomasa y densidad no fueron coincidentes. Mientras que en bosque natural las especies se distribuyen por igual, en las demás coberturas se presentan diferentes patrones de distribución. Se encontraron correlaciones entre biomasa, densidad y abundancia de lombrices con los contenidos de fósforo y magnesio y con la densidad aparente del suelo.
Earthworm populations of Pheretima sp., Eudovoscolex sp. and Periscolex sp found in Typic Dystropepts from El Retorno (Guaviare, Colombia were evaluated for eight different soil uses. Ten experimental units were used to evaluate abundance, density and biomass, as related to soil physico-chemical characteristics. Results showed significant differences between total amount of eggs and adults under forest pasture combinet use vs grazing, and, grazing plus partially grazing vs non-pasture grazing, and, adults in chontaduro (Bactrys gasipaes - Kudzu vs cacao (Theobroma cacao covering. Biomass and densities answers did not show similar results while in undisturbed forest the species have the same pattern
First report of frosty pod rot caused by Moniliophthora roreri on cacao in Bolivia
Frosty pod rot (FPR) is a devastating cacao disease caused by the basidiomycete Moniliophthora roreri (Aime and Phillips-Mora, 2005). The disease is confined to 13 countries in Central and South America and constitutes a permanent threat for cacao cultivation worldwide. In July 2012, FPR was detect...
Cacao Intensification in Sulawesi: A Green Prosperity Model Project
Energy Technology Data Exchange (ETDEWEB)
Moriarty, K.; Elchinger, M.; Hill, G.; Katz, J.; Barnett, J.
2014-09-01
NREL conducted eight model projects for Millennium Challenge Corporation's (MCC) Compact with Indonesia. Green Prosperity, the largest project of the Compact, seeks to address critical constraints to economic growth while supporting the Government of Indonesia's commitment to a more sustainable, less carbon-intensive future. This study evaluates techniques to improve cacao farming in Sulawesi Indonesia with an emphasis on Farmer Field Schools and Cocoa Development Centers to educate farmers and for train the trainer programs. The study estimates the economic viability of cacao farming if smallholder implement techniques to increase yield as well as social and environmental impacts of the project.
Trichoderma ROLE IN AGROFORESTRY-CACAOTAL SYSTEMS AS AN ANTAGONAL AGENT
Directory of Open Access Journals (Sweden)
Úrsula del Carmen López-Ferrer
2017-05-01
Full Text Available Agricultural and cocoa agroforestry systems are important for food production and biodiversity conservation. Among this diversity there is a group of fungi of the genus Trichoderma that present antagonistic effects against phytopathogens and this action can be used as a form of biological control of plant pathogens. In the agroforestry-cacao system the diseases with the highest frequency and with the greatest impact on cocoa production (Theobroma cacao are black rot (Phytophthora spp., Broom broom (Moniliophthora perniciosa and moniliasis (Moniliophthora roreri. The objective of this work was to perform an analysis of the main theoretical and practical aspects about the genus Trichoderma and its role in agriculture as an antagonistic agent. One of the microscopic features in the delimitation of the genus, especially by the presence of structures called phalid. The antagonistic mechanisms used by Trichoderma spp. Are described as competition, antibiosis and mycoparasitism. Mycoparasitism is having a relevance on the implications of extracellular enzymes such as chitinases, cellulases, β-1-3-glucanases and proteases that lyse or digest the walls of fungi, Moniliophthora roreri disease. This fungus can inhibit the growth of other fungi and bacteria by producing several volatile and non-volatile secondary metabolites. On the other hand, it participates in the production of regulators of growth and stimulation of the division, differentiation and cellular growth in the plant by the elicitor agent. Trichoderma species that are commercialized for biological control, growth promoter and biofertilizer are T. viride, T. polysporum and T. harzianum. The T. virens and T. harzianum species are most used for the antagonistic control of M. roreri, Phytophthora spp., and M. perniciosa in agroforestry-cacao systems (Theobroma cacao L. with optimal results to the inhibitory effect for these diseases.
Novais, Samuel M A; Macedo-Reis, Luiz E; DaRocha, Wesley D; Neves, Frederico S
2016-06-01
interesting conservation strategy when compared to rubber agroforests. We also emphasized the potential risk of local pest outbreaks in rubber agroforests for both the rubber and associated cacao trees.
pH effects of the addition of three biochars to acidic Indonesian mineral soils
DEFF Research Database (Denmark)
Martinsen, V; Alling, V; Nurida, N L
2015-01-01
of increasing amounts (0–30%; weight:weight) of three types of field-produced BCs (from cacao (Theobroma cacao. L.) shell, oil palm (Elaeis guineensis. Jacq.) shell and rice (Oryza sativa. L.) husk) on soil pH and CEC. Soils were sampled from croplands at Java, Sumatra and Kalimantan, Indonesia. All BCs caused...... a significant increase in mean soil pH with a stronger response and a greater maximum increase for the cacao shell BC addition, due to a greater acid neutralizing capacity (ANC) and larger amounts of extractable base cations. At 1% BC addition, corresponding to about 30 tons ha−1, the estimated increase in soil...... pH from the initial mean pH of 4.7 was about 0.5 units for the cacao shell BC, whereas this was only 0.05 and 0.04 units for the oil palm shell and rice husk BC, respectively. Besides depending on BC type, the increase in soil pH upon the addition of each of the three BCs was mainly dependent...
Ramirez-Sanchez, Israel; Maya, Lisandro; Ceballos, Guillermo; Villarreal, Francisco
2010-12-01
Polyphenolic compounds of the flavanoid family are abundantly present in cacao seed and its cocoa products. Results from studies using cocoa products indicate beneficial effects of flavanols on cardiovascular endpoints. Evidence indicates that (-)-epicatechin is the main cacao flavanol associated with cardiovascular effects, so the accurate quantification of its content in cacao seeds or cocoa products is important. Common methods for the quantification of phenolic content in cocoa products are based on the reaction of phenols with colorimetric reagents such as the Folin-Ciocalteu (FC) In this study, we compared the FC method of phenolic determinations using 2 different standards (gallic acid and (-)-epicatechin) to construct calibration curves. We compare these results with those obtained from a simple fluorometric method (Ex(280)/Em(320) nm) used to determine catechin/(-)-epicatechin content in samples of cacao seeds and cocoa products. Values obtained from the FC method determination of polyphenols yield an overestimation of phenol (flavonoid) content when gallic acid is used as standard. Moreover, the epicatechin is a more reliable standard because of its abundance in cacao seeds and cocoa products. The use of fluorometric spectra yields a simple and highly quantitative means for a more precise and rapid quantification of cacao catechins. Fluorometric values are essentially in agreement with those reported using more cumbersome methods. In conclusion, the use of fluorescence emission spectra is a quick, practical and suitable means to quantifying catechins in cacao seeds and cocoa products.
EFFECT OF FERMENTED CACAO POD SUPPLEMENTATION ON SHEEP RUMEN MICROBIAL FERMENTATION
Directory of Open Access Journals (Sweden)
S. Wulandari
2015-09-01
Full Text Available The objective of this research was to improve beneficial value of cacao pod as sheep feedingredients comprising up to 50% total feed. This research was conducted in two stages. Stage 1 wascacao pod fermentation. Completely randomized design with 3x3 factorial patterns was used in thisstage, in which factor I was microbial inoculum dosage of 0%, 0.05% and 0.1% and factor II wasincubation period of 0, 3 and 6 days. Result demonstrated that six-day fermentation with 0.05%microbial inoculum could lower cacao NDF, ADF and theobromine. The optimum inoculum dosage andfermentation time from stage 1 was applied to stage 2. Stage 2 was rumen microbial fermentation test.This research administrated 3x3 of latin square design. In period I sheep were fed with CF0 (nonfermentedcomplete feed, in period II sheep were given CF 1 (complete feed containing fermentedcacao pod and in period III sheep were given CF2 (fermented complete feed based cacao pod. Resultdemonstrated that pH value of sheep microbial liquid in treatment of CF0, CF1 and CF2 was in normalpH range and did not affect volatile fatty acids (VFA and ammonia. In conclusion, supplementing up to 50% of feed with complete feed containing fermented or non-fermented cacao pod did not affect theprocess of rumen microbial fermentation.
African Journals Online (AJOL)
AISA
cacaoyers dans ces plantations a été comprise entre 1525 et 2225 plantes/ha. Tous les cacaoyers rencontrés dans les parcelles appartiennent à l'espèce Theobroma cacao et en majorité à la variété «Amelonado Ouest. Africain». Les Miridae sont des insectes déprédateurs du cacaoyer. Les femelles pondent en moyenne.
Directory of Open Access Journals (Sweden)
Agustín Gonzáles Coral
2011-12-01
Full Text Available El objetivo del estudio fue evaluar el comportamiento de cuatro especies de frutales amazónicos bajo un modelo de diversificación instalada en la parcela del Sr. Ezequiel García Tapullima (UTM 9548994; 0669126. El suelo del área es desde franco (0-20cm a franco arcilloso (20-40 cm, pH fuertemente ácido y porcentaje (% de materia orgánica de medio a bajo. La metodología del trabajo consistió en Investigación Acción Participativa. Se instaló un modelo diversificado (5m x 5m con plantones de macambo (Theobroma bicolor, caimito (Pouteria caimito, copoazú (Theobroma grandiflorum y cacao (Theobroma cacao, sembrados con una densidad de 400 plantas por hectárea (5m x 5m. A los 15 meses de instalado, se evaluó el porcentaje de prendimiento, mediciones biométricas trimestrales del crecimiento en 10 individuos por especie, elegidos al azar de un área de 0.5 hectáreas. Se encontró que el 80% de plantas de las cuatro especies se encontraban en estado de foliación. Las especies que presentaron mejor comportamiento fueron T. bicolor y P. caimito con una altura de 293.1 cm y 193.2 cm; y un diámetro basal promedio de 5.8 cm y 2.1 cm respectivamente, T. grandiflorum presentó los menores registros con una altura promedio de 84.3 cm y diámetro basal de 1.4 cm.
International Nuclear Information System (INIS)
Uranga, Carla C.; Beld, Joris; Mrse, Anthony; Córdova-Guerrero, Iván; Burkart, Michael D.; Hernández-Martínez, Rufina
2016-01-01
The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.
Energy Technology Data Exchange (ETDEWEB)
Uranga, Carla C., E-mail: curanga@cicese.edu.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico); Beld, Joris, E-mail: joris.beld@drexelmed.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Mrse, Anthony, E-mail: amrse@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Córdova-Guerrero, Iván, E-mail: icordova@uabc.edu.mx [Universidad Autónoma de Baja California (UABC), Calzada Universidad 14418 Parque Industrial Internacional Tijuana, Tijuana, B.C. 22390 (Mexico); Burkart, Michael D., E-mail: mburkart@ucsd.edu [University of California, San Diego, Department of Chemistry and Biochemistry, 9500 Gilman Dr., La Jolla, CA 92093-0358 (United States); Hernández-Martínez, Rufina, E-mail: ruhernan@cicese.mx [Centro de Investigación Científica y de Educación Superior de Ensenada (CICESE), Carretera Ensenada-Tijuana 3918, Zona Playitas, 22860 Ensenada, B.C. (Mexico)
2016-04-01
The Botryosphaeriaceae are a family of trunk disease fungi that cause dieback and death of various plant hosts. This work sought to characterize fatty acid derivatives in a highly virulent member of this family, Lasiodiplodia theobromae. Nuclear magnetic resonance and gas chromatography-mass spectrometry of an isolated compound revealed (Z, Z)-9,12-ethyl octadecadienoate, (trivial name ethyl linoleate), as one of the most abundant fatty acid esters produced by L. theobromae. A variety of naturally produced esters of fatty acids were identified in Botryosphaeriaceae. In comparison, the production of fatty acid esters in the soil-borne tomato pathogen Fusarium oxysporum, and the non-phytopathogenic fungus Trichoderma asperellum was found to be limited. Ethyl linoleate, ethyl hexadecanoate (trivial name ethyl palmitate), and ethyl octadecanoate, (trivial name ethyl stearate), significantly inhibited tobacco seed germination and altered seedling leaf growth patterns and morphology at the highest concentration (0.2 mg/mL) tested, while ethyl linoleate and ethyl stearate significantly enhanced growth at low concentrations, with both still inducing growth at 98 ng/mL. This work provides new insights into the role of naturally esterified fatty acids from L. theobromae as plant growth regulators with similar activity to the well-known plant growth regulator gibberellic acid. - Highlights: • Lasiodiplodia theobromae produces a wide variety of fatty acid esters in natural substrates. • Ethyl stearate and ethyl linoleate inhibit tobacco germination at 0.2 mg/mL. • Ethyl stearate and ethyl linoleate induce tobacco germination at 98 ng/mL. • Tobacco growth increase in ethyl stearate and ethyl linoleate parallels gibberellic acid. • A role as plant growth regulators is proposed for fatty acid esters.
Sieving Effect of Sorting Machine with Vibration Table Type on Cacao Pod Based Compost
Directory of Open Access Journals (Sweden)
Siswoyo Soekarno
2009-10-01
Full Text Available Cacao pod is the biggest part (70% of weight of Cacao, which was not optimaly utilized.Cacao podis one of organic material that can be functioned as an organic fertilizer, such as compost. When utilizedwith right proportion, organic fertilizer is safe for plants and not degrades the soil composition. Compostingprocess is one of utilization form of Cacao pod. The size reduction of cacao pod in the organic fertilizerprocess would help to accelerate the composting process. Smaller particle size would faster interacting withenvironment, so the composting process would be well accelerated if compared to the material with biggersize. Chopping machine of Cacao pod is used to cut the biomass to be small particle in order to be able tobe utilized as some important necessity, i.e. fertilizer or farm animals feed. However, Varies compost sizewas one of the problems faced in the composting process. Therefore, the sorting process was needed tobe done after chopping process, so the compost size became uniform and fulfill the user demand. Thisresearch was aimed at knowing the slope effect of sorting machine and rotation speed (RPM. The methodused in analyzing the results of this research was comparing the treatment factors, which are shown withhistogram. As the super small size of compost recommended for applying in the fertilizing process, so theoptimum treatment combination for having high mass fraction of SS compost grade was achieved at 12oslope of sieve table and 1400 RPM motor rotation speed. As bigger the particle densities of the compostsize as smaller the compost porosity. Mass loss was very low at all treatment combination with the valuearound 0.43-1.33%, so the sieving efficiency can be said very high.
Mood Components in Cocoa and Chocolate: The Mood Pyramid.
Tuenter, Emmy; Foubert, Kenn; Pieters, Luc
2018-03-14
Cocoa and chocolate, prepared from cocoa beans that originate from the fruits of the cocoa tree Theobroma cacao , have a long-standing reputation as healthy food, including mood-enhancing effects. In spite of many clinical trials with chocolate, cocoa, or its constituents, the mechanisms of action on mood and cognition remain unclear. More in particular, it is still controversial which constituents may contribute to the psychopharmacological activities, ranging from the major cacao flavanols and methylxanthines to the minor amines, amides, and alkaloids. In this review a critical appraisal is made of recent studies on mood and cognition, with a special emphasis on analytical characterization of the test samples. It is concluded that the mood and cognition-enhancing effects of cocoa and chocolate can be ranked from more general activities associated with flavanols and methylxanthines, to more specific activities related to minor constituents such as salsolinol, with on top the orosensory properties of chocolate. Therefore, the "mood pyramid" of cocoa and chocolate is proposed as a new concept. To understand the role and interactions of the different major and minor constituents of cocoa, it is recommended that all test samples used in future in vitro, in vivo , or human studies should be phytochemically characterized in much more detail than is common practice today. Georg Thieme Verlag KG Stuttgart · New York.
Energy Technology Data Exchange (ETDEWEB)
De Vries, R; Pfeiffer, A E [KEMA Milieu Technologie, Arnhem (Netherlands)
1994-05-27
A cacao factory in Zaanstad, Netherlands, produces cacao shells, which are applied as filling material in fodder. However, while the development of the market and environmental regulations are uncertain, the option to use cacao shells as an energy source to generate heat and/or electricity seems to be attractive. Attention is paid to the consequences of the combustion of cacao shells for which two variants are considered: (1) only heat production which covers the total heat demand; (2) combined generation of power and heat, which saves natural gas and electricity. Surplus power can be supplied to the grid. Descriptions of the systems for the two variants are given, as well as the costs and benefits. A preference for one of the two variants depends on the market sales for cacao shells. If it is decided to put the chosen installation to tender it is recommended to investigate further the subsidy options and the possibility of cooperation with the energy utility sector. In the appendix the results of the flue gas purification concept are presented. 5 figs., 6 tabs., 1 appendix
Directory of Open Access Journals (Sweden)
Wahyunto Wahyunto
2016-10-01
Full Text Available Tree farming such as coconut, cocoa, coffee, rubber, and rambutan was dominant in the west coast of Aceh prior to tsunami. The farming is not only important for sustainable livelihood, but also for superior environmental protection. During the tsunami, considerable portion of this ‘green infrastructure’ was devastated. Therefore, a scientifically based land suitability evaluation is needed for supporting the redesign and reconstruction of the tree-based farming. The objectives of this research were to evaluate the current physical condition of the area and develop recommendation of land suitability for tree crops farming in the area. Field survey for inventory and evaluation of land characteristics was conducted in 2006, 15 months after the tsunami. Land suitability evaluation was conducted by matching field survey data and soil sample analyses in every mapping unit with crop growth requirements. The land suitability map was further matched with the district development plan, existing land uses and land status. The resulted land use recommendation map showed that the marine ecosystem along the coastal line was most suitable for coconut, cacao, coffee, and casuarinas. The recommended tree crops for the ancient sandy beach were areca nut, coconut, rambutan, mango, rubber and oil palm; and for the alluvial ecosystem were coconut, cacao, areca nut, mango, and bread fruit. Peatland of less than 3 m thick was marginally suitable for oil palm and rubber, while those thicker than 3 m were recommended for conservation due to its fragile ecosystem. In the undulating tectonic plain, the suitable tree crops were rubber, oil palm, coconut, and rambutan.
Yoneda, Mitsugu; Sugimoto, Naotoshi; Katakura, Masanori; Matsuzaki, Kentaro; Tanigami, Hayate; Yachie, Akihiro; Ohno-Shosaku, Takako; Shido, Osamu
2017-01-01
Theobromine, which is a caffeine derivative, is the primary methylxanthine produced by Theobroma cacao. Theobromine works as a phosphodiesterase (PDE) inhibitor to increase intracellular cyclic adenosine monophosphate (cAMP). cAMP activates the cAMP-response element-binding protein (CREB), which is involved in a large variety of brain processes, including the induction of the brain-derived neurotrophic factor (BDNF). BDNF supports cell survival and neuronal functions, including learning and m...
Laode Muhammad Harjoni Kilowasid; Tati Suryati Syamsudin; Franciscus Xaverius Susilo; Endah Sulistyawati
2012-01-01
Taxa diversity within soil fauna functional groups can affected ecosystem functioning such as ecosystem engineers,which influence decomposition and nutrient cycling. The objective of this study is to describe ecological diversityvariation within soil fauna as ecosystem engineers in soil ecosystem of cocoa (Theobroma cacao L.) plantation.Sampling was conducted during one year period from five different ages of plantation. Soil fauna removed from soilcore using hand sorting methods. A total of ...
Understanding sensory and analytical relationships in cocoa-based products
Sundara, Ramana; Festring, Daniel
2015-01-01
The distinctive flavour of cocoa or chocolate made from fermented and roasted cocoa beans (Theobroma cacao L.) is familiar to everybody in the cocoa consuming world. The industry differentiates between cocoa processing and chocolate manufacturing. Cocoa processing covers the activity of converting the beans into nib, liquor, butter, cake and powder. Chocolate manufacturing covers the blending and refining of cocoa liquor, cocoa butter and various optional ingredients, such as milk...
Directory of Open Access Journals (Sweden)
Rubens Ribeiro da Silva
2007-01-01
Full Text Available O presente estudo foi conduzido com o objetivo de avaliar o comportamento inicial de plântulas de Theobroma grandiflorum (Willd. ex Spreng. Schum. (cupuaçu, em função de diferentes níveis de sombreamento. Ao final de 50 dias, após a emergência, as plântulas de cupuaçu foram submetidas a três níveis de sombreamento, sendo: 0% de sombreamento, 50% de sombreamento e Sombra Natural. O crescimento das mudas foi conduzido em delineamento de blocos casualizados, com 15 repetições, sendo cada planta considerada como uma repetição. Foram avaliados a altura, o diâmetro e o número de folhas aos 60, 82, 103, 124, 145 dias após a emergência das plântulas. A Massa Seca de Folhas (MSF, Massa Seca do Caule (MSC, Massa Seca da Raiz (MSR e Massa Seca Total (MST, Relação parte aérea/raiz (PA/R e relação Altura da planta/Diâmetro do colo (A/D, foram avaliadas no final do experimento. O crescimento inicial de Theobroma grandiflorum foi corroborado com os padrões da espécie, que ocorre no interior das matas primárias, tendo melhor desenvolvimento dos parâmetros avaliados em condições de 50% de sombreamento. A condição de 50% de sombreamento pode ser recomendada para a formação de mudas de Theobroma grandiflorum, devido o seu melhor desempenho em altura, diâmetro, número de folhas e alocação de massa nas partes da planta.The objective of this work was to evaluate the initial growth of sapling of Theobroma grandiflorum (cupuaçú, in function of different levels of solar radiation. Fifty days, after the emergency, the saplings were submitted to three levels of shade, being: 0%, 50% and natural shade. Sapling development was carried out in randomized block design with 15 repetitions (15 saplings. The sapling height, lap diameter and the numbers of leaves being evaluated on the 60st, 82nd, 103rd, 124th, 145 days after sapling emergence. The Dry Mass of the leaves (DML, Dry Mass of the stem (DMS, Dry Mass of the root (DMR and Dry
Algunas Características de los Cacaos Criollos de Venezuela
Directory of Open Access Journals (Sweden)
Ciferri R.
1949-03-01
Full Text Available Se indican algunas características morfológicas y biométricas de los cacaos "Criollo de cáscara morada" y "Criollo de cáscara decolorada", observadas en un cacaotal de Venezuela y las cuales se comparan con las de algunos de sus cruces, así más afines, como más alejados, que en conjunto forman el Forastero Venezolano. Se llama la atención sobre unos tipos de cacao muy valiosos, derivados de los cruzamientos entre estos dos tipos de Criollo, mencionados. Se indica, además, la distribución de dichos Criollos en Venezuela.
De jacht op het geheim van cacao
Hollman, P.C.H.
2008-01-01
Je kans op een dodelijke hartaanval halveert als je elke dag een groot paaseitje pure chocolade eet, blijkt uit een recente Nederlandse epidemiologische studie. En ook andere studies laten zien dat consumptie van cacao beschermt tegen hart- en vaatziekten. Maar het is nog een raadsel hoe dat precies
Directory of Open Access Journals (Sweden)
Quintero Lorena
2004-12-01
Full Text Available Mediante la utilización de marcadores RAPD (Random Amplified Polymorphic DNA, se analizaron 145 materiales (128 de T. grandiflorum y 17 de T. bicolor pertenecientes al banco de germoplasma ex situ del género Theobroma del Instituto Sinchi, localizado en San José del Guaviare. A partir de un número inicial de 20, se seleccionaron los 5 cebadores capaces de generar mayor número de polimorfismos para generar 114 bandas que lograron distinguir entre más del 99% de los materiales analizados: 57 bandas para T. grandiflorum (84,2% polimórficas, 45 bandas para T. bicolor (26,7% polimórficas y 12 bandas compartidas entre las dos especies (58,3% polimórficas. A partir de la matriz de semejanza generada utilizando el índice de Dice, representada en un dendrograma UPGMA, y el análisis de componentes principales, se determinó un alto grado de semejanza intraespecífica en los materiales analizados, particularmente en T. bicolor. Luego de comparar este análisis con el morfoagronómico previamente realizado en algunos materiales de T. grandiflorum, se encontró que los grupos generados por dicha evaluación morfológica y agronómica son heterogéneos a nivel molecular. La información obtenida se utilizará como herramienta para la toma de decisiones en cuanto a las estrategias de mantenimiento, enriquecimiento y uso del banco. Palabras clave: Theobroma grandiflorum, Theobroma bicolor, RAPD, caracterización molecular.RAPD markers (Random Amplified Polymorphic DNA were used for analysing 145 individuals (128 T. grandiflorum and 17 T. bicolor from the ex situ Theobroma genus germplasm bank at Instituto Sinchi, located at San José del Guaviare. 5 primers able to generated polymorphism were selected from an initial set of 20, generating 114 bands that enable to us to distinguish between more than 99% of individuals analysed: 57 bands for T. grandiflorum (84.2% polymorphic, 45 bands for T. bicolor (26.7% polymorphic and 12 bands shared between
El nombre 'Forastero' no más: A new protocol for meaningful cacao germplasm classification.
The title of this article (The name ‘Forastero’ no more) is to convey an attempt in this paper to try to convince the cacao scientific community not to use the term Forastero to identify cacao germplasm of non-Criollo origin. The term Forastero originated in Latin America to differentiate the intro...
Kamil, Fatima H.; Saeed, Esam E.; El-Tarabily, Khaled A.; AbuQamar, Synan F.
2018-01-01
Dieback caused by the fungus Lasiodiplodia theobromae is an important disease on mango plantations in the United Arab Emirates (UAE). In this study, 53 actinobacterial isolates were obtained from mango rhizosphere soil in the UAE, of which 35 (66%) were classified as streptomycetes (SA) and 18 (34%) as non-streptomycetes (NSA). Among these isolates, 19 (12 SA and 7 NSA) showed antagonistic activities against L. theobromae associated with either the production of diffusible antifungal metabolites, extracellular cell-wall-degrading enzymes (CWDEs), or both. Using a “novel” mango fruit bioassay, all isolates were screened in vivo for their abilities to reduce lesion severity on fruits inoculated with L. theobromae. Three isolates, two belonging to Streptomyces and one to Micromonospora spp., showed the strongest inhibitory effect against this pathogen in vitro and were therefore selected for tests on mango seedlings. Our results revealed that the antifungal action of S. samsunensis UAE1 was related to antibiosis, and the production of CWDEs (i.e., chitinase) and siderophores; whilst S. cavourensis UAE1 and M. tulbaghiae UAE1 were considered to be associated with antibiotic- and CWDE-production, respectively. Pre-inoculation in greenhouse experiments with the most promising actinobacterial isolates resulted in very high levels of disease protection in mango seedlings subsequently inoculated with the pathogen. This was evident by the dramatic reduction in the estimated disease severity indices of the mango dieback of individual biocontrol agent (BCA) applications compared with the pathogen alone, confirming their potential in the management of mango dieback disease. L. theobromae-infected mango seedlings treated with S. samsunensis showed significantly reduced number of defoliated leaves and conidia counts of L. theobromae by 2- and 4-fold, respectively, in comparison to the other two BCA applications. This indicates that the synergistic antifungal effects of S
Effects of different agricultural systems on soil quality in Northern Limón province, Costa Rica
Directory of Open Access Journals (Sweden)
Emma Cornwell
2014-09-01
Full Text Available Conversion of native rainforest ecosystems in Limón Province of Costa Rica to banana and pineapple monoculture has led to reductions in biodiversity and soil quality. Agroforestry management of cacao (Theobroma cacao is an alternative system that may maintain the agricultural livelihood of the region while more closely mimicking native ecosystems. This study compared physical, biological and chemical soil quality indicators of a cacao plantation under organic agroforestry management with banana, pineapple, and pasture systems; a native forest nearby served as a control. For bulk density and earthworm analysis, 18 samples were collected between March and April 2012 from each ecosystem paired with 18 samples from the cacao. Cacao had a lower bulk density than banana and pineapple monocultures, but greater than the forest (p<0.05. Cacao also hosted a greater number and mass of earthworms than banana and pineapple (p<0.05, but similar to forest and pasture. For soil chemical characteristics, three composite samples were collected in March 2012 from each agroecosystem paired with three samples from the cacao plantation. Forest and pineapple ecosystems had the lowest pH, cation exchange capacity, and exchangeable nutrient cations, while cacao had the greatest (p<0.05. Total nutrient levels of P and N were slightly greater in banana, pineapple and pasture than in cacao; probably related to addition of chemical fertilizer and manure from cattle grazing. Forest and cacao also had greater %C, than other ecosystems, which is directly related to soil organic matter content (p<0.0001. Overall, cacao had more favorable physical, biological and chemical soil characteristics than banana and pineapple monocultures, while trends were less conclusive compared to the pastureland. While organic cacao was inferior to native forest in some soil characteristics such as bulk density and organic carbon, its soil quality did best mimic that of the native forest. This
Saha, A; Mandal, P; Dasgupta, S; Saha, D
2008-05-01
Lasiodiplodia theobromae, a common tea (Camellia sinensis) pathogen, usually does not sporulate or sporulates poorly in common media, which makes spore production difficult. In this study the effects of culture media, carbon source, nitrogen source, temperature, pH and light on mycelial growth and sporulation were evaluated. Among several carbon sources tested, glucose and sucrose were found superior for growth. Potassium nitrate supplemented media showed maximum growth amongst the tested inorganic nitrogen sources while peptone produced maximum growth among the tested organic nitrogen sources. Tea root extract supplemented potato dextrose agar medium was found to be the most suitable for mycelial growth and sporulation of L. theobromae. The fungus grow at temperatures ranging from 40 to 36 degrees C, with optimum growth at 28 degrees C and no growth was noted at 40 degrees C. There was no significant effect of different light period on growth of L. theobromae, but light enhanced sporulation. The fungus grow at pH 3.0-8.0 and optimum growth was observed at pH 6.0. Tea root extract supplemented potato dextrose agar medium with pH 6.0 was the most suitable for production of conidia of L. theobromae at 28 degrees C. Hence this media may be recommended for inoculum production for further studies.
Echeverry, A.; Reyes, H.
2016-01-01
Se evaluó de forma cualitativa y cuantitativa la presencia de cadmio en un chocolate amargo con 65% de cacao producido en Colombia y en chocolates extranjeros con diferentes porcentajes de cacao. Para la preparación de las muestras se tomaron 0,5 gramos y se realizó una digestión ácida con ácido nítrico concentrado (HNO3 65%). La determinación del metal se llevó a cabo por medio de la técnica de espectrofotometría de absorción atómica de llama (FAAS). Se determinó el límite de detección (LOD)...
Cacao families and parents selected as resistant to natural infection of Moniliophthora perniciosa
Directory of Open Access Journals (Sweden)
Carolina S. Benjamin
2016-07-01
Full Text Available The known sources of resistance to witches’ broom (WB, a severe disease of cacao, are limited. Aiming to identify families and parents resistant to Moniliophthora perniciosa, a population of 22 families was evaluated by assessing the number of brooms formed per tree during 10 years under field conditions. The population was established in randomized blocks with three replications of 12 plants each. Significant differences were observed among families. The most outstanding families were NA33 x RB39 and RB39 x P4B, which presented the lowest WB incidence during 10 years. The increase in natural field infection of Scavina clones families and their descendants were clearly demonstrated after 2006. The existence of additive effects for resistance appears clearly for families, which had other source of resistance associated with Scavina. Clones RB39, RB36, P4B, NA33 and CSUL3 are promising parents for pyramiding resistance genes and increasing the stability and durability of resistance to WB.
Lam Thi, Viet Ha; D.T., Khang; Everaert, Helena; T.N, Dung; P.H.D, Phuoc; H.T., Toan; Dewettinck, Koen; Messens, Kathy
2017-01-01
Cocoa (Theobroma cacao L.) cultivation has increased in tropical areas around the world, including Vietnam, due to the high demand of cocoa beans for chocolate production. The genetic diversity of cocoa genotypes is recognized to be complex, however, their phylogenetic relationships need to be clarified. The present study aimed to classify the cocoa genotypes that are imported and cultivated in Vietnam based on a chloroplast DNA region. Sixty-three Vietnamese Cocoa accessions were collected f...
The role of trees in agroecology and sustainable agriculture in the tropics.
Leakey, Roger R B
2014-01-01
Shifting agriculture in the tropics has been replaced by sedentary smallholder farming on a few hectares of degraded land. To address low yields and low income both, the soil fertility, the agroecosystem functions, and the source of income can be restored by diversification with nitrogen-fixing trees and the cultivation of indigenous tree species that produce nutritious and marketable products. Biodiversity conservation studies indicate that mature cash crop systems, such as cacao and coffee with shade trees, provide wildlife habitat that supports natural predators, which, in turn, reduce the numbers of herbivores and pathogens. This review offers suggestions on how to examine these agroecological processes in more detail for the most effective rehabilitation of degraded land. Evidence from agroforestry indicates that in this way, productive and environmentally friendly farming systems that provide food and nutritional security, as well as poverty alleviation, can be achieved in harmony with wildlife.
Dinarti, Diny; Susilo, Agung W; Meinhardt, Lyndel W; Ji, Kun; Motilal, Lambert A; Mischke, Sue; Zhang, Dapeng
2015-12-01
Indonesia is the third largest cocoa-producing country in the world. Knowledge of genetic diversity and parentage of farmer selections is important for effective selection and rational deployment of superior cacao clones in farmers' fields. We assessed genetic diversity and parentage of 53 farmer selections of cacao in Sulawesi, Indonesia, using 152 international clones as references. Cluster analysis, based on 15 microsatellite markers, showed that these Sulawesi farmer selections are mainly comprised of hybrids derived from Trinitario and two Upper Amazon Forastero groups. Bayesian assignment and likelihood-based parentage analysis further demonstrated that only a small number of germplasm groups, dominantly Trinitario and Parinari, contributed to these farmer selections, in spite of diverse parental clones having been used in the breeding program and seed gardens in Indonesia since the 1950s. The narrow parentage predicts a less durable host resistance to cacao diseases. Limited access of the farmers to diverse planting materials or the strong preference for large pods and large bean size by local farmers, may have affected the selection outcome. Diverse sources of resistance, harbored in different cacao germplasm groups, need to be effectively incorporated to broaden the on-farm diversity and ensure sustainable cacao production in Sulawesi.
Dinarti, Diny; Susilo, Agung W.; Meinhardt, Lyndel W.; Ji, Kun; Motilal, Lambert A.; Mischke, Sue; Zhang, Dapeng
2015-01-01
Indonesia is the third largest cocoa-producing country in the world. Knowledge of genetic diversity and parentage of farmer selections is important for effective selection and rational deployment of superior cacao clones in farmers’ fields. We assessed genetic diversity and parentage of 53 farmer selections of cacao in Sulawesi, Indonesia, using 152 international clones as references. Cluster analysis, based on 15 microsatellite markers, showed that these Sulawesi farmer selections are mainly comprised of hybrids derived from Trinitario and two Upper Amazon Forastero groups. Bayesian assignment and likelihood-based parentage analysis further demonstrated that only a small number of germplasm groups, dominantly Trinitario and Parinari, contributed to these farmer selections, in spite of diverse parental clones having been used in the breeding program and seed gardens in Indonesia since the 1950s. The narrow parentage predicts a less durable host resistance to cacao diseases. Limited access of the farmers to diverse planting materials or the strong preference for large pods and large bean size by local farmers, may have affected the selection outcome. Diverse sources of resistance, harbored in different cacao germplasm groups, need to be effectively incorporated to broaden the on-farm diversity and ensure sustainable cacao production in Sulawesi. PMID:26719747
Drought effects on soil COcacao agroforestry system in Sulawesi, Indonesia
van Straaten, O.; Veldkamp, E.; Köhler, M.; Anas, I.
2009-12-01
Climate change induced droughts pose a serious threat to ecosystems across the tropics and sub-tropics, particularly to those areas not adapted to natural dry periods. In order to study the vulnerability of cacao (Theobroma cacao) - Gliricidia sepium agroforestry plantations to droughts a large scale throughfall displacement roof was built in Central Sulawesi, Indonesia. In this 19-month replicated experiment, we measured soil surface CO2 efflux (soil respiration) in three simulated drought plots compared with three adjacent control plots. Soil respiration rates peaked at intermediate soil moisture and decreased under increasingly dry conditions (drought induced), but also decreased when soils became water saturated, as evidenced in control plots. The simulated drought plots exhibited a slight decrease in soil respiration compared to the control plots (average 13% decrease). The strength of the drought effect was spatially variable - while some measurement chamber sites reacted strongly ("responsive") to the decrease in soil water content (up to R2=0.70) (n=11), others did not react at all ("non-responsive") (n=7). The degree of soil CO2 respiration drought response was highest around cacao tree stems and decreased with distance from the stem (R2=0.22). A significant correlation was measured between "responsive" soil respiration chamber sites and sap flux density ratios of cacao (R=0.61) and Gliricidia (R=0.65). Leaf litter CO2 respiration decreased as conditions became drier. During dry periods the litter layer contributed approximately 3-4% of the total CO2 efflux and up to 40% during wet periods. A CO2 flush was recorded during the rewetting phase that lasted for approximately two weeks, during which time accumulated labile carbon stocks mineralized. The net effect on soil CO2 emissions over the duration of the experiment was neutral, control plots respired 11.1±0.5 Mg C ha-1 yr-1, while roof plots respired 10.5±0.5 Mg C ha-1 yr-1.
Energy Technology Data Exchange (ETDEWEB)
Douiri, A
2002-03-01
The computer aided collimation gamma camera (CACAO in French) is a gamma camera using a collimator with large holes, a supplementary linear scanning motion during the acquisition and a dedicated reconstruction program taking full account of the source depth. The CACAO system was introduced to improve both the sensitivity and the resolution in nuclear medicine. This thesis focuses on the design of a fast and robust reconstruction algorithm in the CACAO project. We start by an overview of tomographic imaging techniques in nuclear medicine. After modelling the physical CACAO system, we present the complete reconstruction program which involves three steps: 1) shift and sum 2) deconvolution and filtering 3) rotation and sum. The deconvolution is the critical step that decreases the signal to noise ratio of the reconstructed images. We propose a regularized multi-channel algorithm to solve the deconvolution problem. We also present a fast algorithm based on Splines functions and preserving the high quality of the reconstructed images for the shift and the rotation steps. Comparisons of simulated reconstructed images in 2D and 3D for the conventional system (CPHC) and CACAO demonstrate the ability of CACAO system to increase the quality of the SPECT images. Finally, this study concludes with an experimental approach with a pixellated detector conceived for a 3D measurement of contaminated wounds. This experimentation proves the possible advantages of coupling the CACAO project with pixellated detectors. Moreover, a variety of applications could fully benefit from the CACAO system, such as low activity imaging, the use of high-energy gamma isotopes and the visualization of deep organs. Moreover the combination of the CACAO system with a pixels detector may open up further possibilities for the future of nuclear medicine. (author)
Health Benefits of Methylxanthines in Cacao and Chocolate
Franco, Rafael; Oñatibia-Astibia, Ainhoa; Martínez-Pinilla, Eva
2013-01-01
One may wonder why methylxanthines are so abundant in beverages used by humans for centuries, or in cola-drinks that have been heavily consumed since their appearance. It is likely that humans have stuck to any brew containing compounds with psychoactive properties, resulting in a better daily life, i.e., more efficient thinking, exploring, hunting, etc., however, without the serious side effects of drugs of abuse. The physiological effects of methylxanthines have been known for a long time and they are mainly mediated by the so-called adenosine receptors. Caffeine and theobromine are the most abundant methylxanthines in cacao and their physiological effects are notable. Their health-promoting benefits are so remarkable that chocolate is explored as a functional food. The consequences of adenosine receptor blockade by natural compounds present in cacao/chocolate are here reviewed. Palatability and health benefits of methylxanthines, in general, and theobromine, in particular, have further contributed to sustain one of the most innocuous and pleasant habits: chocolate consumption. PMID:24145871
Health Benefits of Methylxanthines in Cacao and Chocolate
Directory of Open Access Journals (Sweden)
Rafael Franco
2013-10-01
Full Text Available One may wonder why methylxanthines are so abundant in beverages used by humans for centuries, or in cola-drinks that have been heavily consumed since their appearance. It is likely that humans have stuck to any brew containing compounds with psychoactive properties, resulting in a better daily life, i.e., more efficient thinking, exploring, hunting, etc., however, without the serious side effects of drugs of abuse. The physiological effects of methylxanthines have been known for a long time and they are mainly mediated by the so-called adenosine receptors. Caffeine and theobromine are the most abundant methylxanthines in cacao and their physiological effects are notable. Their health-promoting benefits are so remarkable that chocolate is explored as a functional food. The consequences of adenosine receptor blockade by natural compounds present in cacao/chocolate are here reviewed. Palatability and health benefits of methylxanthines, in general, and theobromine, in particular, have further contributed to sustain one of the most innocuous and pleasant habits: chocolate consumption.
Health benefits of methylxanthines in cacao and chocolate.
Franco, Rafael; Oñatibia-Astibia, Ainhoa; Martínez-Pinilla, Eva
2013-10-18
One may wonder why methylxanthines are so abundant in beverages used by humans for centuries, or in cola-drinks that have been heavily consumed since their appearance. It is likely that humans have stuck to any brew containing compounds with psychoactive properties, resulting in a better daily life, i.e., more efficient thinking, exploring, hunting, etc., however, without the serious side effects of drugs of abuse. The physiological effects of methylxanthines have been known for a long time and they are mainly mediated by the so-called adenosine receptors. Caffeine and theobromine are the most abundant methylxanthines in cacao and their physiological effects are notable. Their health-promoting benefits are so remarkable that chocolate is explored as a functional food. The consequences of adenosine receptor blockade by natural compounds present in cacao/chocolate are here reviewed. Palatability and health benefits of methylxanthines, in general, and theobromine, in particular, have further contributed to sustain one of the most innocuous and pleasant habits: chocolate consumption.