Investigation on cryogenic laser fusion targets: fabrication, characterization, and transport. Annual report, December 1, 1978-November 30, 1979

International Nuclear Information System (INIS)

Kim, K.

1979-01-01

The research has been directed toward fabrication, characterization, and positioning of cryogenic shell laser fusion targets, with particular emphasis on the development of a scheme which would allow for continuous fabrication, inspection, and delivery of the targets. Specifically, progress has been made in the following areas: (1) Fabrication of a uniform spherical shell of DT-condensate using a cold-wall target-freezing-cell. (2) Fabrication of a uniform spherical shell of liquid DT using a room-temperature wall target-freezing-cell. (3) Support-free cryogenic target fabrication using cold-gas-levitation. (4) Continuous fabrication of cryogenic targets using free-fall method. (5) Automatic characterization of DT-layer uniformity. (6) Sorting of DT-filled glass microshells using an interference microscope. (7) Development of an a-c interference microscope for accurate characterization of moving targets. (8) Development of a machine which is capable of producing a continuous stream of uniform DT spheres of controllable sizes. (9) Theoretical study on the behavior of liquid hydrogen contained in a spherical shell

Experimental and Numerical Characterization of a Pulsed Supersonic Uniform Flow for Kinetics and Spectroscopy

Science.gov (United States)

Suas-David, Nicolas; Thawoos, Shameemah; Broderick, Bernadette M.; Suits, Arthur

2017-06-01

The current CPUF (Chirped Pulse Uniform Flow) and the new UF-CRDS (Uniform Flow Cavity Ring-Down Spectroscopy) setups relie mostly on the production of a good quality supersonic uniform flow. A supersonic uniform flow is produced by expanding a gas through a Laval nozzle - similar to the nozzles used in aeronautics - linked to a vacuum chamber. The expansion is characterized by an isentropic core where constant very low kinetic temperature (down to 20K) and constant density are observed. The relatively large diameter of the isentropic core associated with homogeneous thermodynamic conditions makes it a relevant tool for low temperature spectroscopy. On the other hand, the length along the axis of the flow of this core (could be longer than 50cm) allows kinetic studies which is one of the main interest of this setup (CRESU technique. The formation of a uniform flow requires an extreme accuracy in the design of the shape of the nozzle for a set of defined temperature/density. The design is based on a Matlab program which retrieves the shape of the isentropic core according to the method of characteristics prior to calculate the thickness of the boundary layer. Two different approaches are used to test the viability of a new nozzle derived from the program. First, a computational fluid dynamic software (OpenFOAM) models the distribution of the thermodynamic properties of the expansion. Then, fabricated nozzles using 3-D printing are tested based on Pitot measurements and spectroscopic analyses. I will present comparisons of simulation and measured performance for a range of nozzles. We will see how the high level of accuracy of numerical simulations provides a deeper knowledge of the experimental conditions. J. M. Oldham, C. Abeysekera, J. Joalland, L. N. Zack, K. Prozument, I. R. Sims, G. Barrat Park, R. W. Filed and A. G. Suits, J. Chem. Phys. 141, 154202, (2014). I. Sims, J. L. Queffelec, A. Defrance, C. Rebrion-Rowe, D. Travers, P. Bocherel, B. Rowe, I. W. Smith

Weak completeness of the Bourbaki quasi-uniformity

Directory of Open Access Journals (Sweden)

M.A. Sánchez Granero

2001-04-01

Full Text Available The concept of semicompleteness (weaker than half-completeness is defined for the Bourbaki quasi-uniformity of the hyperspace of a quasi-uniform space. It is proved that the Bourbaki quasi-uniformity is semicomplete in the space of nonempty sets of a quasi-uniform space (X,U if and only if each stable filter on (X,U* has a cluster point in (X,U. As a consequence the space of nonempty sets of a quasi-pseudometric space is semicomplete if and only if the space itself is half-complete. It is also given a characterization of semicompleteness of the space of nonempty U*-compact sets of a quasi-uniform space (X,U which extends the well known Zenor-Morita theorem.

Synthesis and magnetic characterizations of uniform iron oxide nanoparticles

International Nuclear Information System (INIS)

Jiang, FuYi; Li, XiaoYi; Zhu, Yuan; Tang, ZiKang

2014-01-01

Uniform iron oxide nanoparticles with a cubic shape were prepared by the decomposition of homemade iron oleate in 1-octadecene with the presence of oleic acid. The particle shape and size uniformity are sensitive to the quantity of oleic acid. XRD, HRTEM and SAED results indicated that the main phase content of as-prepared iron oxide nanoparticles is Fe 3 O 4 with an inverse spinel structure. Magnetic measurements revealed that the as-prepared iron oxide nanoparticles display a ferromagnetic behavior with a blocking temperature of 295 K. At low temperatures the magnetic anisotropy of the aligned nanoparticles caused the appearance of a hysteresis loop.

The riboflavin transporter RibU in Lactococcus lactis : Molecular characterization of gene expression and the transport mechanism

NARCIS (Netherlands)

Burgess, CM; Slotboom, DJ; Geertsma, ER; Duurkens, Hinderika; Poolman, B; van Sinderen, D

This study describes the characterization of the riboflavin transport protein RibU in the lactic acid bacterium Lactococcus lactis subsp. cremoris NZ9000. RibU is predicted to contain five membrane-spanning segments and is a member of a novel transport protein family, not described in the Transport

Size graded sediment dynamics: from the processes characterization to the transport modelling in the English Channel

International Nuclear Information System (INIS)

Blanpain, O.

2009-10-01

The purpose of this work is the implementation of a sediment transport model in the English Channel. The design of such a model requires the identification of the physical processes, their modelling and their in-situ validation. Because of the sedimentary particularities of the study area, modelling of the mechanical behaviour of a non uniform mixture of sediments and particularly of the fine grains within a coarse matrix is required. This study focused on the characterization of the relevant processes by acquisition of experimental and in-situ data. Data acquired in hydro-sedimentary conditions comparable to those found in the English Channel are scarce. A new instrument and image processing technique were specifically conceived and implemented in-situ to observe and measure, with a high temporal resolution, the dynamics of a strongly heterogeneous mixture of particles in a grain-size scale. The data collected compared well with several existing formulations. One of these formulations was chosen to be adapted. The transfer dynamics of fine grains in coarse sediments and their depth of penetration were acquired from stratigraphic samples. The sediment transport model deals with multi-size grains and multi sedimentary layers, it is forced by swell and currents, and accounts for bead load and suspended load transports. It was applied to realistic scenarios for the English Channel. (author)

Kinetic theory of nonlinear transport phenomena in complex plasmas

International Nuclear Information System (INIS)

Mishra, S. K.; Sodha, M. S.

2013-01-01

In contrast to the prevalent use of the phenomenological theory of transport phenomena, a number of transport properties of complex plasmas have been evaluated by using appropriate expressions, available from the kinetic theory, which are based on Boltzmann's transfer equation; in particular, the energy dependence of the electron collision frequency has been taken into account. Following the recent trend, the number and energy balance of all the constituents of the complex plasma and the charge balance on the particles is accounted for; the Ohmic loss has also been included in the energy balance of the electrons. The charging kinetics for the complex plasma comprising of uniformly dispersed dust particles, characterized by (i) uniform size and (ii) the Mathis, Rumpl, and Nordsieck power law of size distribution has been developed. Using appropriate expressions for the transport parameters based on the kinetic theory, the system of equations has been solved to investigate the parametric dependence of the complex plasma transport properties on the applied electric field and other plasma parameters; the results are graphically illustrated.

Highly ordered uniform single-crystal Bi nanowires: fabrication and characterization

International Nuclear Information System (INIS)

Bisrat, Y; Luo, Z P; Davis, D; Lagoudas, D

2007-01-01

A mechanical pressure injection technique has been used to fabricate uniform bismuth (Bi) nanowires in the pores of an anodic aluminum oxide (AAO) template. The AAO template was prepared from general purity aluminum by a two-step anodization followed by heat treatment to achieve highly ordered nanochannels. The nanowires were then fabricated by an injection technique whereby the molten Bi was injected into the AAO template using a hydraulic pressure method. The Bi nanowires prepared by this method were found to be dense and continuous with uniform diameter throughout the length. Electron diffraction experiments using the transmission electron microscope on cross-sectional and free-standing longitudinal Bi nanowires showed that the majority of the individual nanowires were single crystalline, with preferred orientation of growth along the [011] zone axis of the pseudo-cubic structure. The work presented here provides an inexpensive and effective way of fabricating highly ordered single-crystalline Bi nanowires, with uniform size distributions

Photocathode non-uniformity contribution to the energy resolution of scintillators

International Nuclear Information System (INIS)

Mottaghian, M.; Koohi-Fayegh, R.; Ghal-Eh, N.; Etaati, G. R.

2010-01-01

This paper introduces the basics of the light transport simulation in scintillators and the wavelength-dependencies in the process. The non-uniformity measurement of the photocathode surface is undertaken, showing that for the photocathode used in this study the quantum efficiency falls to about 4% of its maximum value, especially in areas far from the centre. The wavelength-and position-dependent quantum efficiency is implemented in the Monte Carlo light transport code, showing that, the contribution of the photocathode non-uniformity to the energy resolution is estimated to be around 18%, when all position-and wavelength-dependencies are included. (authors)

Advances in methods for identification and characterization of plant transporter function

DEFF Research Database (Denmark)

Larsen, Bo; Xu, Deyang; Halkier, Barbara Ann

2017-01-01

Transport proteins are crucial for cellular function at all levels. Numerous importers and exporters facilitate transport of a diverse array of metabolites and ions intra- and intercellularly. Identification of transporter function is essential for understanding biological processes at both......-based approaches. In this review, we highlight examples that illustrate how new technology and tools have advanced identification and characterization of plant transporter functions....

Genome-wide identification and expression characterization of ABCC-MRP transporters in hexaploid wheat.

Science.gov (United States)

Bhati, Kaushal K; Sharma, Shivani; Aggarwal, Sipla; Kaur, Mandeep; Shukla, Vishnu; Kaur, Jagdeep; Mantri, Shrikant; Pandey, Ajay K

2015-01-01

The ABCC multidrug resistance associated proteins (ABCC-MRP), a subclass of ABC transporters are involved in multiple physiological processes that include cellular homeostasis, metal detoxification, and transport of glutathione-conjugates. Although they are well-studied in humans, yeast, and Arabidopsis, limited efforts have been made to address their possible role in crop like wheat. In the present work, 18 wheat ABCC-MRP proteins were identified that showed the uniform distribution with sub-families from rice and Arabidopsis. Organ-specific quantitative expression analysis of wheat ABCC genes indicated significantly higher accumulation in roots (TaABCC2, TaABCC3, and TaABCC11 and TaABCC12), stem (TaABCC1), leaves (TaABCC16 and TaABCC17), flag leaf (TaABCC14 and TaABCC15), and seeds (TaABCC6, TaABCC8, TaABCC12, TaABCC13, and TaABCC17) implicating their role in the respective tissues. Differential transcript expression patterns were observed for TaABCC genes during grain maturation speculating their role during seed development. Hormone treatment experiments indicated that some of the ABCC genes could be transcriptionally regulated during seed development. In the presence of Cd or hydrogen peroxide, distinct molecular expression of wheat ABCC genes was observed in the wheat seedlings, suggesting their possible role during heavy metal generated oxidative stress. Functional characterization of the wheat transporter, TaABCC13 a homolog of maize LPA1 confirms its role in glutathione-mediated detoxification pathway and is able to utilize adenine biosynthetic intermediates as a substrate. This is the first comprehensive inventory of wheat ABCC-MRP gene subfamily.

Concentration polarization effects on the macromolecular transport in the presence of non-uniform magnetic field: A numerical study using a lumen-wall model

Energy Technology Data Exchange (ETDEWEB)

Mohammadpourfard, M., E-mail: Mohammadpour@azaruniv.edu [Department of Mechanical Engineering, Azarbaijan Shahid Madani University, Tabriz 53751-71379 (Iran, Islamic Republic of); Aminfar, H., E-mail: hh_aminfar@tabrizu.ac.ir [Faculty of Mechanical Engineering, University of Tabriz, Tabriz (Iran, Islamic Republic of); Khajeh, K., E-mail: khajeh.k.2005@gmail.com [Faculty of Mechanical Engineering, University of Tabriz, Tabriz (Iran, Islamic Republic of)

2014-04-01

In this paper, the concentration polarization phenomena in a two dimensional tube under steady state conditions containing ferrofluid (blood and 4 vol% Fe{sub 3}O{sub 4}) is reported in the presence of non-uniform magnetic field. Lumen-wall model has been used for solving the mass transport equation. Hemodynamics parameters such as flow rate, viscosity, wall shear stress (WSS) and the macromolecules surface concentration which accumulate on the blood vessel wall, influenced the formation and progression of atherosclerosis disease. Effective parameters on the low density lipoprotein (LDL) surface concentration (LSC) such as: the wall filtration velocity, inlet Reynolds number and WSS under applied non-uniform magnetic field have been examined. Numerical solution of governing equations of the flow field have been obtained by using the single-phase model and the control volume technique. Magnetic field is generated by an electric current going through a thin and straight wire oriented perpendicular to the tube. Results show WSS in the vicinity of magnetic field source increased and LSC decreased along the wall. - Highlights: • In this paper the concentration polarization phenomena of blood flow is reported in the presence of non-uniform magnetic field. • In presence of non-uniform magnetic field LSC will decrease along the wall due to the increasing the velocity gradients near the magnetic source. • When non-uniform magnetic field intensity increases, LSC along the wall becomes lower. • Non-uniform magnetic field can affects the flow more in low Reynolds numbers.

14 CFR Section 19 - Uniform Classification of Operating Statistics

Science.gov (United States)

2010-01-01

... Statistics Section 19 Section 19 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... AIR CARRIERS Operating Statistics Classifications Section 19 Uniform Classification of Operating Statistics ...

Characterization of molecule and particle transport through nanoscale conduits

Science.gov (United States)

Alibakhshi, Mohammad Amin

Nanofluidic devices have been of great interest due to their applications in variety of fields, including energy conversion and storage, water desalination, biological and chemical separations, and lab-on-a-chip devices. Although these applications cross the boundaries of many different disciplines, they all share the demand for understanding transport in nanoscale conduits. In this thesis, different elusive aspects of molecule and particle transport through nanofluidic conduits are investigated, including liquid and ion transport in nanochannels, diffusion- and reaction-governed enzyme transport in nanofluidic channels, and finally translocation of nanobeads through nanopores. Liquid or solvent transport through nanoconfinements is an essential yet barely characterized component of any nanofluidic systems. In the first chapter, water transport through single hydrophilic nanochannels with heights down to 7 nm is experimentally investigated using a new measurement technique. This technique has been developed based on the capillary flow and a novel hybrid nanochannel design and is capable of characterizing flow in both single nanoconduits as well as nanoporous media. The presence of a 0.7 nm thick hydration layer on hydrophilic surfaces and its effect on increasing the hydraulic resistance of the nanochannels is verified. Next, ion transport in a new class of nanofluidic rectifiers is theoretically and experimentally investigated. These so called nanofluidic diodes are nanochannels with asymmetric geometries which preferentially allow ion transport in one direction. A nondimensional number as a function of electrolyte concentration, nanochannel dimensions, and surface charge is derived that summarizes the rectification behavior of this system. In the fourth chapter, diffusion- and reaction-governed enzyme transport in nanofluidic channels is studied and the theoretical background necessary for understanding enzymatic activity in nanofluidic channels is presented. A

Transport processes investigation: A necessary first step in site scale characterization plans

International Nuclear Information System (INIS)

Roepke, C.; Glass, R.J.; Brainard, J.; Mann, M.; Kriel, K.; Holt, R.; Schwing, J.

1995-01-01

We propose an approach, which we call the Transport Processes Investigation or TPI, to identify and verify site-scale transport processes and their controls. The TPI aids in the formulation of an accurate conceptual model of flow and transport, an essential first step in the development of a cost effective site characterization strategy. The TPI is demonstrated in the highly complex vadose zone of glacial tills that underlie the Fernald Environmental Remediation Project (FEMP) in Fernald, Ohio. As a result of the TPI, we identify and verify the pertinent flow processes and their controls, such as extensive macropore and fracture flow through layered clays, which must be included in an accurate conceptual model of site-scale contaminant transport. We are able to conclude that the classical modeling and sampling methods employed in some site characterization programs will be insufficient to characterize contaminant concentrations or distributions at contaminated or hazardous waste facilities sited in such media

Functional expression and characterization of plant ABC transporters in Xenopus laevis oocytes for transport engineering purposes

DEFF Research Database (Denmark)

Xu, Deyang; Veres, Dorottya; Belew, Zeinu Mussa

2016-01-01

the question whether the oocytes system is suitable to express and characterize ABC transporters. Thus we have selected AtABCG25, previously characterized in insect cells as the exporter of commercially valuable abscisic acid—as case study for optimizing of characterization in Xenopus oocytes. The tools...

Charge carrier transport mechanisms in nanocrystalline indium oxide

International Nuclear Information System (INIS)

Forsh, E.A.; Marikutsa, A.V.; Martyshov, M.N.; Forsh, P.A.; Rumyantseva, M.N.; Gaskov, A.M.; Kashkarov, P.K.

2014-01-01

The charge transport properties of nanocrystalline indium oxide (In 2 O 3 ) are studied. A number of nanostructured In 2 O 3 samples with various nanocrystal sizes are prepared by sol–gel method and characterized using various techniques. The mean nanocrystals size varies from 7–8 nm to 18–20 nm depending on the conditions of their preparation. Structural characterizations of the In 2 O 3 samples are performed by means of transmission electron microscopy and X-ray diffraction. The analysis of dc and ac conductivity in a wide temperature range (T = 50–300 K) shows that at high temperatures charge carrier transport takes place over conduction band and at low temperatures a variable range hopping transport mechanism can be observed. We find out that the temperature of transition from one mechanism to another depends on nanocrystal size: the transition temperature rises when nanocrystals are bigger in size. The average hopping distance between two sites and the activation energy are calculated basing on the analysis of dc conductivity at low temperature. Using random barrier model we show a uniform hopping mechanism taking place in our samples and conclude that nanocrystalline In 2 O 3 can be regarded as a disordered system. - Highlights: • In 2 O 3 samples with various nanocrystal sizes are prepared by sol–gel method. • The mean nanocrystal size varies from 7–8 nm to 18–20 nm. • At high temperatures charge carrier transport takes place over conduction band. • At low temperatures a variable range hopping transport mechanism can be observed. • We show a uniform hopping mechanism taking place in our samples

Using heterologous expression systems to characterize potassium and sodium transport activities.

Science.gov (United States)

Rodríguez, Alonso; Benito, Begoña; Cagnac, Olivier

2012-01-01

The expression of plant transporters in simple well-characterized cell systems is an irreplaceable technique for gaining insights into the kinetic and energetic features of plant transporters. Among all the available expression systems, yeast cells offer the highest simplicity and have the capacity to mimic the in vivo properties of plant transporters. Here, we describe the use of yeast mutants to express K(+) and Na(+) plant transporters and discuss some experimental problems that can produce misleading results.

Design and validation of a uniform flow microreactor

Energy Technology Data Exchange (ETDEWEB)

Yi, Seung Jae; Kim, Kyung Chun; Chang, Seung Cheol [Pusan National University, Busan (Korea, Republic of); Park, Ji Min [Global HQ, Hankook Tire Co., Daejeon (Korea, Republic of)

2014-01-15

We present a design method to characterize uniform flows in a microreactor for high performance surface plasmon resonance (SPR) a general-purpose biosensor chips. The shape of the microreactor is designed based on an approximate pressure drop model. The number of micro-pillars and the slopes of the inlet and outlet linear chambers are two dominant parameters used to minimize the velocity difference in the microreactor. The flow uniformity was examined quantitatively by numerical and experimental visualization methods. A computational fluid dynamics (CFD) analysis demonstrates that the designed microreactor has a fairly uniform velocity profile in the reaction zone for a wide range of flow rates. The velocity field in the fabricated microreactor was measured using the micro-particle image velocimetry (μ-PIV) method, and the flow uniformity was confirmed experimentally. The performance of the uniform flow microreactor was verified using the fluorescence antibody technique.

Characterizing the Role of Nanoparticle Design on Tumor Transport and Stability in the Extracellular Environment

Science.gov (United States)

Albanese, Alexandre

Nanotechnology has emerged as an exciting strategy for the delivery of diagnostic and therapeutic agents into established tumors. Advancements in nanomaterial synthesis have generated an extensive number of nanoparticle designs made from different materials. Unfortunately, it remains impossible to predict a design's effectiveness for in vivo tumor accumulation. Little is known about how a nanoparticle's morphology and surface chemistry affect its interactions with cells and proteins inside the tumor tissue. This thesis focuses on the development of in vitro experimental tools to evaluate how nanoparticle design affects transport in a three-dimensional tumor tissue and stability in the tumor microenvironment. Nanoparticle transport was evaluated using a novel 'tumor-on-a-chip' system where multicellular tumor spheroids were immobilized in a microfluidic channel. This setup created a three-dimensional tumor environment displaying physiological cell density, extracellular matrix organization, and interstitial flow rates. The tumor-on-a-chip demonstrated that accumulation of nanoparticles was limited to diameters below 110 nm and was improved by receptor targeting. Nanoparticle stability in the tumor microenvironment was evaluated using media isolated from different tumor cell lines. Nanoparticle diameter and surface chemistry were important determinants of stability in cancer cell-conditioned media. Small nanoparticles with unstable surface chemistries adsorbed cellular proteins on their surface and were prone to aggregation. Nanoparticle aggregation altered cellular interactions leading to changes in cell uptake. Using a novel technique to generate different aggregate sizes possessing a uniform surface composition, it was determined that aggregation can change receptor affinity, cell internalization mechanisms and sub-cellular sequestration patterns. Data from this thesis characterize the behavior of nanoparticles within modeled tumor environments and provide some

Synthesis, characterization and charge transport mechanism of CdZnO nanorods

International Nuclear Information System (INIS)

Mahmoud, Waleed E.; Al-Ghamdi, A.A.; El-Tantawy, F.; Al-Heniti, S.

2009-01-01

ZnO and Cd-doped ZnO nanostructures were prepared by new facile method at 80 deg. C. XRD measurement indicated that both samples had typical hexagonal wurtzite structures. Transmission electron microscopy (TEM) measurement shows that rod-like crystals have been formed. EDX measurement confirms the incorporation of the cadmium ion into the crystalline lattice of ZnO and indicated that cadmium ions uniformly distributed on the surface of the rods. The doping with cadmium ions has a great influence on the optical properties of the ZnO. The electrical measurements of Cd-doped ZnO nanorod were measured. The current-voltage (I-V) characteristic curve revealed that the charge transport above 4 V is mainly non-linear due to grain boundary contribution. The complex impedance spectroscopy was confirmed that the grain boundary effect controls the charge transport mechanism through CdZnO ceramic material.

Skin carcinogenesis following uniform and non-uniform β irradiation

International Nuclear Information System (INIS)

Charles, M.W.; Williams, J.P.; Coggle, J.E.

1989-01-01

Where workers or the general public may be exposed to ionising radiation, the irradiation is rarely uniform. The risk figures and dose limits recommended by the International Commission on Radiological Protection (ICRP) are based largely on clinical and epidemiological studies of reasonably uniform irradiated organs. The paucity of clinical or experimental data for highly non-uniform exposures has prevented the ICRP from providing adequate recommendations. This weakness has led on a number of occasions to the postulate that highly non-uniform exposures of organs could be 100,000 times more carcinogenic than ICRP risk figures would predict. This so-called ''hot-particle hypothesis'' found little support among reputable radiobiologists, but could not be clearly and definitively refuted on the basis of experiment. An experiment, based on skin tumour induction in mouse skin, is described which was developed to test the hypothesis. The skin of 1200 SAS/4 male mice has been exposed to a range of uniform and non-uniform sources of the β emitter 170 Tm (E max ∼ 1 MeV). Non-uniform exposures were produced using arrays of 32 or 8 2-mm diameter sources distributed over the same 8-cm 2 area as a uniform control source. Average skin doses varied from 2-100 Gy. The results for the non-uniform sources show a 30% reduction in tumour incidence by the 32-point array at the lower mean doses compared with the response from uniform sources. The eight-point array showed an order-of-magnitude reduction in tumour incidence compared to uniform irradiation at low doses. These results, in direct contradiction to the ''hot particle hypothesis'', indicate that non-uniform exposures produce significantly fewer tumours than uniform exposures. (author)

Study of the distribution of maxima and minima in multiple sequential images of uniformity

International Nuclear Information System (INIS)

Llacer Martos, S.; Puchal Ane, R.

2011-01-01

To characterize the uniformity of a gamma camera extrinsic used integral uniformity coefficient is calculated with the value of two pixels, the maximum and minimum, single source acquisition of a flat and uniform. This method does not take into account the fact that if a gamma camera having a uniform response, the distribution of these items should be random. In this paper we study how these points are distributed in a succession of large numbers of uniform images.

Synthesis of bulk quantity BN nanotubes with uniform morphology

International Nuclear Information System (INIS)

Wen, G.; Zhang, T.; Huang, X.X.; Zhong, B.; Zhang, X.D.; Yu, H.M.

2010-01-01

Bulk quantity hexagonal BN nanotubes (h-BNNTs) with uniform morphology were synthesized via an improved ball-milling and annealing method. The sample was characterized by X-ray photoelectron spectrometry, electron energy loss spectroscopy, X-ray diffraction, scanning electron microscopy, conventional transmission electron microscopy (TEM) and high-resolution TEM. The results show that the fabricated BNNTs have a uniform diameter ranging from 80 to 100 nm and a length of about 50-60 μm.

The uniformity study of non-oxide thin film at device level using electron energy loss spectroscopy

Science.gov (United States)

Li, Zhi-Peng; Zheng, Yuankai; Li, Shaoping; Wang, Haifeng

2018-05-01

Electron energy loss spectroscopy (EELS) has been widely used as a chemical analysis technique to characterize materials chemical properties, such as element valence states, atoms/ions bonding environment. This study provides a new method to characterize physical properties (i.e., film uniformity, grain orientations) of non-oxide thin films in the magnetic device by using EELS microanalysis on scanning transmission electron microscope. This method is based on analyzing white line ratio of spectra and related extended energy loss fine structures so as to correlate it with thin film uniformity. This new approach can provide an effective and sensitive method to monitor/characterize thin film quality (i.e., uniformity) at atomic level for thin film development, which is especially useful for examining ultra-thin films (i.e., several nanometers) or embedded films in devices for industry applications. More importantly, this technique enables development of quantitative characterization of thin film uniformity and it would be a remarkably useful technique for examining various types of devices for industrial applications.

Tryptophan Transport in Human Fibroblast Cells—A Functional Characterization

Directory of Open Access Journals (Sweden)

Ravi Vumma

2011-01-01

Full Text Available There are indications that serotonergic neurotransmission is disturbed in several psychiatric disorders. One explanation may be disturbed transport of tryptophan (precursor for serotonin synthesis across cell membranes. Human fibroblast cells offer an advantageous model to study the transport of amino acids across cell membranes, since they are easy to propagate and the environmental factors can be controlled. The aim of this study was to functionally characterize tryptophan transport and to identify the main transporters of tryptophan in fibroblast cell lines from healthy controls. Tryptophan kinetic parameters ( V max and K m at low and high concentrations were measured in fibroblasts using the cluster tray method. Uptake of 3 H (5-L-tryptophan at different concentrations in the presence and absence of excess concentrations of inhibitors or combinations of inhibitors of amino acid transporters were also measured. Tryptophan transport at high concentration (0.5 mM had low affinity and high V max and the LAT1 isoform of system-L was responsible for approximately 40% of the total uptake of tryptophan. In comparison, tryptophan transport at low concentration (50 nM had higher affinity, lower V max and approximately 80% of tryptophan uptake was transported by system-L with LAT1 as the major isoform. The uptake of tryptophan at the low concentration was mainly sodium (Na + dependent, while uptake at high substrate concentration was mainly Na + independent. A series of different transporter inhibitors had varying inhibitory effects on tryptophan uptake. This study indicates that tryptophan is transported by multiple transporters that are active at different substrate concentrations in human fibroblast cells. The tryptophan transport trough system-L was mainly facilitated by the LAT1 isoform, at both low and high substrate concentrations of tryptophan.

An Inverse Analysis Approach to the Characterization of Chemical Transport in Paints

Science.gov (United States)

Willis, Matthew P.; Stevenson, Shawn M.; Pearl, Thomas P.; Mantooth, Brent A.

2014-01-01

The ability to directly characterize chemical transport and interactions that occur within a material (i.e., subsurface dynamics) is a vital component in understanding contaminant mass transport and the ability to decontaminate materials. If a material is contaminated, over time, the transport of highly toxic chemicals (such as chemical warfare agent species) out of the material can result in vapor exposure or transfer to the skin, which can result in percutaneous exposure to personnel who interact with the material. Due to the high toxicity of chemical warfare agents, the release of trace chemical quantities is of significant concern. Mapping subsurface concentration distribution and transport characteristics of absorbed agents enables exposure hazards to be assessed in untested conditions. Furthermore, these tools can be used to characterize subsurface reaction dynamics to ultimately design improved decontaminants or decontamination procedures. To achieve this goal, an inverse analysis mass transport modeling approach was developed that utilizes time-resolved mass spectroscopy measurements of vapor emission from contaminated paint coatings as the input parameter for calculation of subsurface concentration profiles. Details are provided on sample preparation, including contaminant and material handling, the application of mass spectrometry for the measurement of emitted contaminant vapor, and the implementation of inverse analysis using a physics-based diffusion model to determine transport properties of live chemical warfare agents including distilled mustard (HD) and the nerve agent VX. PMID:25226346

Beam uniformity of flat top lasers

Science.gov (United States)

Chang, Chao; Cramer, Larry; Danielson, Don; Norby, James

2015-03-01

Many beams that output from standard commercial lasers are multi-mode, with each mode having a different shape and width. They show an overall non-homogeneous energy distribution across the spot size. There may be satellite structures, halos and other deviations from beam uniformity. However, many scientific, industrial and medical applications require flat top spatial energy distribution, high uniformity in the plateau region, and complete absence of hot spots. Reliable standard methods for the evaluation of beam quality are of great importance. Standard methods are required for correct characterization of the laser for its intended application and for tight quality control in laser manufacturing. The International Organization for Standardization (ISO) has published standard procedures and definitions for this purpose. These procedures have not been widely adopted by commercial laser manufacturers. This is due to the fact that they are unreliable because an unrepresentative single-pixel value can seriously distort the result. We hereby propose a metric of beam uniformity, a way of beam profile visualization, procedures to automatically detect hot spots and beam structures, and application examples in our high energy laser production.

Uniform photoresponse in thermally oxidized Ni and MoS2 heterostructures

International Nuclear Information System (INIS)

Luo, Wei; Peng, Gang; Wang, Fei; Miao, Feng; Zhang, Xue-Ao; Qin, Shiqiao

2017-01-01

Non-uniform photocurrent is usually generated at the overlapped region of the heterostructures, and its potential applications may be hindered by the spatial uniformity issue of the device photoresponse. Here, nearly a uniform photoresponse at the overlapped region of the thermally oxidized Ni and molybdenum disulphide (MoS 2 ) heterostructures is obtained. Further characterizations reveal that several nanometers Ni is rightly under the NiO x layer formed at the surface of the film in the oxidation process. The heterostructures based on layered MoS 2 /NiO x /Ni with highly conductive bottom Ni show a high uniform photoresponse with an external quantum efficiency (EQE) of 1.4% at 532 nm. Moreover, successful integration of multiple devices suggests a great priority for such a structure for highly integrated uniform photodetectors. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Assessment indices for uniform and non-uniform thermal environments

Institute of Scientific and Technical Information of China (English)

2008-01-01

Different assessment indices for thermal environments were compared and selected for proper assessment of indoor thermal environments.30 subjects reported their overall thermal sensation,thermal comfort,and thermal acceptability in uniform and non-uniform conditions.The results show that these three assessment indices provide equivalent evaluations in uniform environments.However,overall thermal sensation differs from the other two indices and cannot be used as a proper index for the evaluation of non-uniform environments.The relationship between the percentage and the mean vote for each index is established.

Planned studies of charge collection in non-uniformly irradiated Si and GaAs detectors

International Nuclear Information System (INIS)

Rosenfeld, A.; Reinhard, M.; Carolan, M.; Kaplan, G.; Lerch, M.; Alexiev, D.

1995-01-01

The aim of this project is to study the time and amplitude characteristics of silicon ion-implanted detectors non-uniformly irradiated with fast neutrons in order to predict their radiation behaviour in the LHC and space. It is expected in such detectors increases of the charge deficit due to trapping by large scale traps and transient time increases due to the reduction of the mobility. The theoretical model will be modified to describe the charge kinetics in the electrical field of the detector created by a non uniform space charge distribution. Experimental confirmation techniques are needed to develop non uniform predictable damage of silicon detectors using fast neutron sources (accelerators, reactors) and to study peculiarities of the charge transport in different parts of the detector. In parallel to experimental research will be started the theoretical development of the charge transport model for non-uniform distribution of space charge in the depletion layer (Neff). The model will include the linear distribution of Neff(y) along the detector as well as the change of sign of Neff (conversion from n to p type of silicon) inside the detector

Synthesis and transport characterization of electrochemically deposited CdTe nanowires

Science.gov (United States)

Kaur, Jaskiran; Kaur, Harmanmeet; Singh, R. C.

2018-04-01

This paper reports the synthesis and characterization of CdTe nanowires. A thin polymeric films were irradiated with 80MeV Ag ions at a fluence of 8E7 ions/cm2, followed by UV irradiation and chemically etching in aqueous NaOH. Nanosizes go-through pores so formed were filled using a specially designed cell via electrodeposition. Nanowires so formed were further studied using SEM, I-V, UV and XRD analysis. SEM images show very smooth and uniform CdTe nanowires freely standing on the substrate. The in-situ I-V characteristics of nano-/micro structures was carried out at room temperature by leaving the structures embedded in the insulating template membrane itself.

Contaminant Attenuation and Transport Characterization of 200-UP-1 Operable Unit Sediment Samples

Energy Technology Data Exchange (ETDEWEB)

Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle MV [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Johnson, Kayla C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

2017-09-27

Contaminants disposed of at the land surface migrate through the vadose zone, forming plumes in groundwater. Processes that occur in the groundwater can attenuate contaminant concentrations during transport through the aquifer. For this reason, quantifying contaminant attenuation and contaminant transport processes in the aquifer, in support of the conceptual site model (CSM) and fate and transport modeling, are important for assessing the need for, and type of, remediation in the groundwater, including monitored natural attenuation (MNA). The framework to characterize attenuation and transport processes provided in U.S. Environmental Protection Agency (EPA) guidance documents was used to guide the laboratory effort reported herein.

Detecting Uniform Areas for Vicarious Calibration using Landsat TM Imagery: A Study using the Arabian and Saharan Deserts

Science.gov (United States)

Hilbert, Kent; Pagnutti, Mary; Ryan, Robert; Zanoni, Vicki

2002-01-01

This paper discusses a method for detecting spatially uniform sites need for radiometric characterization of remote sensing satellites. Such information is critical for scientific research applications of imagery having moderate to high resolutions (African Saharan and Arabian deserts contained extremely uniform sites with respect to spatial characteristics. We developed an algorithm for detecting site uniformity and applied it to orthorectified Landsat Thematic Mapper (TM) imagery over eight uniform regions of interest. The algorithm's results were assessed using both medium-resolution (30-m GSD) Landsat 7 ETM+ and fine-resolution (research shows that Landsat TM products appear highly useful for detecting potential calibration sites for system characterization. In particular, the approach detected spatially uniform regions that frequently occur at multiple scales of observation.

Characterizing fate and transport properties in karst aquifers under different hydrologic conditions

Science.gov (United States)

Rodriguez, E.; Padilla, I. Y.

2017-12-01

Karst landscapes contain very productive aquifers. The hydraulic and hydrogeological characteristics of karst aquifers make these systems capable of storing and transporting large amount of water, but also highly vulnerable to contamination. Their extremely heterogeneous nature prevents accurate prediction in contaminant fate and transport. Even more challenging is to understand the impact of hydrologic conditions changes on fate and transport processes. This studies aims at characterizing fate and transport processes in the karst groundwater system of northern Puerto Rico under different hydrologic conditions. The study involves injecting rhodamine and uranine dyes into a sinkhole, and monitoring concentrations at a spring. Results show incomplete recovery of tracers, but breaking curves can be used to estimate advective, dispersive and mass transfer characteristic of the karst system. Preliminary results suggest significant differences in fate and transport characteristics under different hydrologic conditions.

Arrangements of intermodal transport in the field of conflicting conventions

NARCIS (Netherlands)

K.F. Haak (Krijn); M.A.I.H. Hoeks (Marian)

2004-01-01

textabstractThe continuing advance of containerization emphasizes the need for a more uniform legal approach to international intermodal transport. With the current lack of a uniform instrument regulating such transport, the next best solution - both in legal theory as well as in practice - seems to

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-01-01

Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

Mask characterization for critical dimension uniformity budget breakdown in advanced extreme ultraviolet lithography

Science.gov (United States)

Nikolsky, Peter; Strolenberg, Chris; Nielsen, Rasmus; Nooitgedacht, Tjitte; Davydova, Natalia; Yang, Greg; Lee, Shawn; Park, Chang-Min; Kim, Insung; Yeo, Jeong-Ho

2013-04-01

As the International Technology Roadmap for Semiconductors critical dimension uniformity (CDU) specification shrinks, semiconductor companies need to maintain a high yield of good wafers per day and high performance (and hence market value) of finished products. This cannot be achieved without continuous analysis and improvement of on-product CDU as one of the main drivers for process control and optimization with better understanding of main contributors from the litho cluster: mask, process, metrology and scanner. We will demonstrate a study of mask CDU characterization and its impact on CDU Budget Breakdown (CDU BB) performed for advanced extreme ultraviolet (EUV) lithography with 1D (dense lines) and 2D (dense contacts) feature cases. We will show that this CDU contributor is one of the main differentiators between well-known ArFi and new EUV CDU budgeting principles. We found that reticle contribution to intrafield CDU should be characterized in a specific way: mask absorber thickness fingerprints play a role comparable with reticle CDU in the total reticle part of the CDU budget. Wafer CD fingerprints, introduced by this contributor, may or may not compensate variations of mask CDs and hence influence on total mask impact on intrafield CDU at the wafer level. This will be shown on 1D and 2D feature examples. Mask stack reflectivity variations should also be taken into account: these fingerprints have visible impact on intrafield CDs at the wafer level and should be considered as another contributor to the reticle part of EUV CDU budget. We also observed mask error enhancement factor (MEEF) through field fingerprints in the studied EUV cases. Variations of MEEF may play a role towards the total intrafield CDU and may need to be taken into account for EUV lithography. We characterized MEEF-through-field for the reviewed features, with results herein, but further analysis of this phenomenon is required. This comprehensive approach to quantifying the mask part of

Workplace characterizations in case of rail transport of radioactive materials

International Nuclear Information System (INIS)

Donadille, L.; Itie, C.; Lahaye, T.; Muller, H.; Bottolier-Depois, J.F.

2005-01-01

Full text: Radioactive fuel and wastes are frequently transported for storage and/or reprocessing purposes. The main part of this transport is generally done by train. Before, during and after the journey, operators and drivers, who work directly in contact with and in the vicinity of the wagons, are exposed to external irradiations due to the radioactive materials that are confined inside the containers. In order to evaluate the dose that its personnel is liable to receive during such transports, the French National Railway Company (SNCF) has requested to the Institute of Radiological Protection and Nuclear Safety (IRSN) a series of workplaces characterizations for convoys of different types, that are considered to be representative of all types of possible transports. Each one is associated to a given radioactive material (low and medium activity wastes, new and used fuel, MOX, uranium fluoride, etc... ), involving photon or mixed neutron-photon fields. This measurement campaign has started in May 2004 and by the end of 2004 at least four types of radioactive convoys will have been investigated (three have already been measured). By using survey meters and spectrometers, the study consists in measuring the external exposure for different stages of the work that is done beside the wagons (for example coupling / decoupling two wagons, or checking the brakes) and inside the locomotive (driving). For each one of these workplaces, the exposure is estimated in terms of the ambient dose equivalent H*(10) by summing the dose all along the different phases carried out by the operator. In addition, a dosimetric characterization of each convoy is made by performing measurements along the wagons and spectrometric information about the photon and/or neutron fields are collected. This study provides helpful data to predict the dose that the operators are liable to integrate over long periods, typically one year. (author)

Uniform photoresponse in thermally oxidized Ni and MoS{sub 2} heterostructures

Energy Technology Data Exchange (ETDEWEB)

Luo, Wei [College of Science, National University of Defense Technology, Changsha (China); National Laboratory of Solid State Microstructures, School of Physics, Nanjing University (China); Peng, Gang; Wang, Fei [College of Science, National University of Defense Technology, Changsha (China); Miao, Feng [National Laboratory of Solid State Microstructures, School of Physics, Nanjing University (China); Zhang, Xue-Ao; Qin, Shiqiao [College of Science, National University of Defense Technology, Changsha (China); State Key Laboratory of High Performance Computing, National University of Defense Technology, Changsha (China)

2017-09-15

Non-uniform photocurrent is usually generated at the overlapped region of the heterostructures, and its potential applications may be hindered by the spatial uniformity issue of the device photoresponse. Here, nearly a uniform photoresponse at the overlapped region of the thermally oxidized Ni and molybdenum disulphide (MoS{sub 2}) heterostructures is obtained. Further characterizations reveal that several nanometers Ni is rightly under the NiO{sub x} layer formed at the surface of the film in the oxidation process. The heterostructures based on layered MoS{sub 2}/NiO{sub x}/Ni with highly conductive bottom Ni show a high uniform photoresponse with an external quantum efficiency (EQE) of 1.4% at 532 nm. Moreover, successful integration of multiple devices suggests a great priority for such a structure for highly integrated uniform photodetectors. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

Transport of radioactive materials

Energy Technology Data Exchange (ETDEWEB)

NONE

1960-04-15

The increasing use of radioactive substances, not only in reactor operations but also in medicine, industry and other fields, is making the movement of these materials progressively wider, more frequent and larger in volume. Although regulations for the safe transport of radioactive materials have been in existence for many years, it has now become necessary to modify or supplement the existing provisions on an international basis. It is essential that the regulations should be applied uniformly by all countries. It is also desirable that the basic regulations should be uniform for all modes of transport so as to simplify the procedures to be complied with by shippers and carriers

Uniformity testing: assessment of a centralized web-based uniformity analysis system.

Science.gov (United States)

Klempa, Meaghan C

2011-06-01

Uniformity testing is performed daily to ensure adequate camera performance before clinical use. The aim of this study is to assess the reliability of Beth Israel Deaconess Medical Center's locally built, centralized, Web-based uniformity analysis system by examining the differences between manufacturer and Web-based National Electrical Manufacturers Association integral uniformity calculations measured in the useful field of view (FOV) and the central FOV. Manufacturer and Web-based integral uniformity calculations measured in the useful FOV and the central FOV were recorded over a 30-d period for 4 cameras from 3 different manufacturers. These data were then statistically analyzed. The differences between the uniformity calculations were computed, in addition to the means and the SDs of these differences for each head of each camera. There was a correlation between the manufacturer and Web-based integral uniformity calculations in the useful FOV and the central FOV over the 30-d period. The average differences between the manufacturer and Web-based useful FOV calculations ranged from -0.30 to 0.099, with SD ranging from 0.092 to 0.32. For the central FOV calculations, the average differences ranged from -0.163 to 0.055, with SD ranging from 0.074 to 0.24. Most of the uniformity calculations computed by this centralized Web-based uniformity analysis system are comparable to the manufacturers' calculations, suggesting that this system is reasonably reliable and effective. This finding is important because centralized Web-based uniformity analysis systems are advantageous in that they test camera performance in the same manner regardless of the manufacturer.

Mandatory School Uniforms.

Science.gov (United States)

Cohn, Carl A.

1996-01-01

Shortly after implementing a mandatory school uniform policy, the Long Beach (California) Public Schools can boast 99% compliance and a substantial reduction in school crime. The uniforms can't be confused with gang colors, save parents money, and help identify outsiders. A sidebar lists ingredients for a mandatory uniform policy. (MLH)

Characterization of vacuolar amino acid transporter from Fusarium oxysporum in Saccharomyces cerevisiae.

Science.gov (United States)

Lunprom, Siriporn; Pongcharoen, Pongsanat; Sekito, Takayuki; Kawano-Kawada, Miyuki; Kakinuma, Yoshimi; Akiyama, Koichi

2015-01-01

Fusarium oxysporum causes wilt disease in many plant families, and many genes are involved in its development or growth in host plants. A recent study revealed that vacuolar amino acid transporters play an important role in spore formation in Schizosaccharomyces pombe and Saccharomyces cerevisiae. To investigate the role of vacuolar amino acid transporters of this phytopathogenic fungus, the FOXG_11334 (FoAVT3) gene from F. oxysporum was isolated and its function was characterized. Transcription of FoAVT3 was upregulated after rapamycin treatment. A green fluorescent protein fusion of FoAvt3p was localized to vacuolar membranes in both S. cerevisiae and F. oxysporum. Analysis of the amino acid content of the vacuolar fraction and amino acid transport activities using vacuolar membrane vesicles from S. cerevisiae cells heterologously expressing FoAVT3 revealed that FoAvt3p functions as a vacuolar amino acid transporter, exporting neutral amino acids. We conclude that the FoAVT3 gene encodes a vacuolar neutral amino acid transporter.

Spectral characterization of differential group delay in uniform fiber Bragg gratings.

Science.gov (United States)

Bette, S; Caucheteur, C; Wuilpart, M; Mégret, P; Garcia-Olcina, R; Sales, S; Capmany, J

2005-12-12

In this paper, we completely study the wavelength dependency of differential group delay (DGD) in uniform fiber Bragg gratings (FBG) exhibiting birefringence. An analytical expression of DGD is established. We analyze the impact of grating parameters (physical length, index modulation and apodization profile) on the wavelength dependency of DGD. Experimental results complete the paper. A very good agreement between theory and experience is reported.

School Uniforms Redux.

Science.gov (United States)

Dowling-Sendor, Benjamin

2002-01-01

Reviews a recent decision in "Littlefield" by the 5th Circuit upholding a school uniform policy. Advises board member who wish to adopt a school uniform policy to solicit input from parents and students, research the experiences of other school districts with uniform policies, and articulate the interests they wish to promote through uniform…

Rolling Force Prediction in Heavy Plate Rolling Based on Uniform Differential Neural Network

Directory of Open Access Journals (Sweden)

Fei Zhang

2016-01-01

Full Text Available Accurate prediction of the rolling force is critical to assuring the quality of the final product in steel manufacturing. Exit thickness of plate for each pass is calculated from roll gap, mill spring, and predicted roll force. Ideal pass scheduling is dependent on a precise prediction of the roll force in each pass. This paper will introduce a concept that allows obtaining the material model parameters directly from the rolling process on an industrial scale by the uniform differential neural network. On the basis of the characteristics that the uniform distribution can fully characterize the solution space and enhance the diversity of the population, uniformity research on differential evolution operator is made to get improved crossover with uniform distribution. When its original function is transferred with a transfer function, the uniform differential evolution algorithms can quickly solve complex optimization problems. Neural network structure and weights threshold are optimized by uniform differential evolution algorithm, and a uniform differential neural network is formed to improve rolling force prediction accuracy in process control system.

Preparing Magnetocaloric LaFeSi Uniform Microstructures by Spark Plasma Sintering

DEFF Research Database (Denmark)

Vicente, N.; Ocanã, J.; Neves Bez, Henrique

2014-01-01

Spark Plasma Sintering (SPS) of LaFeSi alloy powders was conducted to prepare magnetocaloric La-Fe-Si-based uniform microstructures. Two electrically insulating discs made of alumina were interposed between the punches and powder sample inhibiting the flow of electric current across the powder...... from hydrogenated and decrypted casting ingot. The characterizations of sintered samples were performed by Scanning Electron Microscopy (SEM), Archimedes principle, Vicker’s hardness and microhardness. The uniformity of the microstructure was evaluated by checking the evidence of position on the Vicker...

Ballistic charge carrier transmission through graphene multi-barrier structures in uniform magnetic field

International Nuclear Information System (INIS)

Zubarev, A; Dragoman, D

2014-01-01

We investigate charge carrier transport in graphene multi-barrier structures placed in a uniform magnetic field. The transmission coefficient is found analytically by generalizing the transfer matrix method for the case of graphene regions subjected to a uniform magnetic field. The transmission coefficient through the structure can be modulated by varying the gate voltages, the magnetic field and/or the width of the gated regions. Such a configuration could be used in multiple-valued logic circuits, since it has several output states with discrete and easily selectable transmission/current values. (paper)

A novel, substrate independent three-step process for the growth of uniform ZnO nanorod arrays

International Nuclear Information System (INIS)

Byrne, D.; McGlynn, E.; Henry, M.O.; Kumar, K.; Hughes, G.

2010-01-01

We report a three-step deposition process for uniform arrays of ZnO nanorods, involving chemical bath deposition of aligned seed layers followed by nanorod nucleation sites and subsequent vapour phase transport growth of nanorods. This combines chemical bath deposition techniques, which enable substrate independent seeding and nucleation site generation with vapour phase transport growth of high crystalline and optical quality ZnO nanorod arrays. Our data indicate that the three-step process produces uniform nanorod arrays with narrow and rather monodisperse rod diameters (∼ 70 nm) across substrates of centimetre dimensions. X-ray photoelectron spectroscopy, scanning electron microscopy and X-ray diffraction were used to study the growth mechanism and characterise the nanostructures.

Transport proteins promoting Escherichia coli pathogenesis

Science.gov (United States)

Tang, Fengyi; Saier, Milton H.

2014-01-01

Escherichia coli is a genetically diverse species infecting hundreds of millions of people worldwide annually. We examined seven well-characterized E. coli pathogens causing urinary tract infections, gastroenteritis, pyelonephritis and haemorrhagic colitis. Their transport proteins were identified and compared with each other and a non-pathogenic E. coli K12 strain to identify transport proteins related to pathogenesis. Each pathogen possesses a unique set of protein secretion systems for export to the cell surface or for injecting effector proteins into host cells. Pathogens have increased numbers of iron siderophore receptors and ABC iron uptake transporters, but the numbers and types of low-affinity secondary iron carriers were uniform in all strains. The presence of outer membrane iron complex receptors and high-affinity ABC iron uptake systems correlated, suggesting co-evolution. Each pathovar encodes a different set of pore-forming toxins and virulence-related outer membrane proteins lacking in K12. Intracellular pathogens proved to have a characteristically distinctive set of nutrient uptake porters, different from those of extracellular pathogens. The results presented in this report provide information about transport systems relevant to various types of E. coli pathogenesis that can be exploited in future basic and applied studies. PMID:24747185

Transport proteins promoting Escherichia coli pathogenesis.

Science.gov (United States)

Tang, Fengyi; Saier, Milton H

2014-01-01

Escherichia coli is a genetically diverse species infecting hundreds of millions of people worldwide annually. We examined seven well-characterized E. coli pathogens causing urinary tract infections, gastroenteritis, pyelonephritis and haemorrhagic colitis. Their transport proteins were identified and compared with each other and a non-pathogenic E. coli K12 strain to identify transport proteins related to pathogenesis. Each pathogen possesses a unique set of protein secretion systems for export to the cell surface or for injecting effector proteins into host cells. Pathogens have increased numbers of iron siderophore receptors and ABC iron uptake transporters, but the numbers and types of low-affinity secondary iron carriers were uniform in all strains. The presence of outer membrane iron complex receptors and high-affinity ABC iron uptake systems correlated, suggesting co-evolution. Each pathovar encodes a different set of pore-forming toxins and virulence-related outer membrane proteins lacking in K12. Intracellular pathogens proved to have a characteristically distinctive set of nutrient uptake porters, different from those of extracellular pathogens. The results presented in this report provide information about transport systems relevant to various types of E. coli pathogenesis that can be exploited in future basic and applied studies. Copyright © 2014 Elsevier Ltd. All rights reserved.

Experimental study on generation of large area uniform electron beam

International Nuclear Information System (INIS)

Tang Ying; Yi Aiping; Liu Jingru; Qian Hang; Huang Xin; Yu Li; Su Jiancang; Ding Zhenjie; Ding Yongzhong; Yu Jianguo

2007-01-01

In the experiment of gas laser pumped by electron beam, large area uniform electron beam is important to generate high efficiency laser output. The experimental study on generation of large area uniform electron beam with SPG-200 pulsed power generator is introduced. SPG-200 is an all-solid-state components pulsed power generator based on SOS, and its open voltage is more than 350 kV. The cathode have the area of 24 mm x 294 mm, and the anode-cathode(A-C)gap spacing is adjustable from 0 to 49 mm. The electron beam of cathode emission is transported to the laser chamber through the diode pressure foil, which sepa-rates the vacuum chamber from the laser chamber. Velvet and graphite cathodes are studied, each generates large area electron beam. The diode parameters are presented, and the uniformity of e-beam is diagnosed. The experimental results show that the diode voltage of the graphite cathode is 240-280 kV, and the diode current is 0.7-1.8 kA. The diode voltage of the velvet cathode is 200-250 kV, and the diode current is 1.5-1.7 kA. The uniformity of the velvet cathode emission is better than that of the graphite cathode. (authors)

A New Measure for Transported Suspended Sediment

Science.gov (United States)

Yang, Q.

2017-12-01

Non-uniform suspended sediment plays an important role in many geographical and biological processes. Despite extensive study, understanding to it seems to stagnate when times to consider non-uniformity and non-equilibrium scenarios comes. Due to unsatisfactory reproducibility, large-scaled flume seems to be incompetent to conduct more fundamental research in this area. To push the realm a step further, experiment to find how suspended sediment exchanges is conducted in a new validated equipment, in which turbulence is motivated by oscillating grids. Analysis shows that 1) suspended sediment exchange is constrained by ωS invariance, 2) ωS of the suspended sediment that certain flow regime could support is unique regardless of the sediment gradation and 3) the more turbulent the flow, the higher ωS of the suspension the flow could achieve. A new measure for suspended sediment ωS, the work required to sustain sediment in suspension transport mode if multiplied by gravitational acceleration, is thus proposed to better describe the dynamics of transported suspended sediment. Except for the further understanding towards suspended sediment transportation mechanics, with this energy measure, a strategy to distribute total transport capacity to different fractions could be derived and rational calculation of non-uniform sediment transport capacity under non-equilibrium conditions be possible.

Could the peristaltic transition zone be caused by non-uniform esophageal muscle fiber architecture? A simulation study.

Science.gov (United States)

Kou, W; Pandolfino, J E; Kahrilas, P J; Patankar, N A

2017-06-01

Based on a fully coupled computational model of esophageal transport, we analyzed how varied esophageal muscle fiber architecture and/or dual contraction waves (CWs) affect bolus transport. Specifically, we studied the luminal pressure profile in those cases to better understand possible origins of the peristaltic transition zone. Two groups of studies were conducted using a computational model. The first studied esophageal transport with circumferential-longitudinal fiber architecture, helical fiber architecture and various combinations of the two. In the second group, cases with dual CWs and varied muscle fiber architecture were simulated. Overall transport characteristics were examined and the space-time profiles of luminal pressure were plotted and compared. Helical muscle fiber architecture featured reduced circumferential wall stress, greater esophageal distensibility, and greater axial shortening. Non-uniform fiber architecture featured a peristaltic pressure trough between two high-pressure segments. The distal pressure segment showed greater amplitude than the proximal segment, consistent with experimental data. Dual CWs also featured a pressure trough between two high-pressure segments. However, the minimum pressure in the region of overlap was much lower, and the amplitudes of the two high-pressure segments were similar. The efficacy of esophageal transport is greatly affected by muscle fiber architecture. The peristaltic transition zone may be attributable to non-uniform architecture of muscle fibers along the length of the esophagus and/or dual CWs. The difference in amplitude between the proximal and distal pressure segments may be attributable to non-uniform muscle fiber architecture. © 2017 John Wiley & Sons Ltd.

Impact of Uniform Methods on Interlaboratory Antibody Titration Variability: Antibody Titration and Uniform Methods.

Science.gov (United States)

Bachegowda, Lohith S; Cheng, Yan H; Long, Thomas; Shaz, Beth H

2017-01-01

-Substantial variability between different antibody titration methods prompted development and introduction of uniform methods in 2008. -To determine whether uniform methods consistently decrease interlaboratory variation in proficiency testing. -Proficiency testing data for antibody titration between 2009 and 2013 were obtained from the College of American Pathologists. Each laboratory was supplied plasma and red cells to determine anti-A and anti-D antibody titers by their standard method: gel or tube by uniform or other methods at different testing phases (immediate spin and/or room temperature [anti-A], and/or anti-human globulin [AHG: anti-A and anti-D]) with different additives. Interlaboratory variations were compared by analyzing the distribution of titer results by method and phase. -A median of 574 and 1100 responses were reported for anti-A and anti-D antibody titers, respectively, during a 5-year period. The 3 most frequent (median) methods performed for anti-A antibody were uniform tube room temperature (147.5; range, 119-159), uniform tube AHG (143.5; range, 134-150), and other tube AHG (97; range, 82-116); for anti-D antibody, the methods were other tube (451; range, 431-465), uniform tube (404; range, 382-462), and uniform gel (137; range, 121-153). Of the larger reported methods, uniform gel AHG phase for anti-A and anti-D antibodies had the most participants with the same result (mode). For anti-A antibody, 0 of 8 (uniform versus other tube room temperature) and 1 of 8 (uniform versus other tube AHG), and for anti-D antibody, 0 of 8 (uniform versus other tube) and 0 of 8 (uniform versus other gel) proficiency tests showed significant titer variability reduction. -Uniform methods harmonize laboratory techniques but rarely reduce interlaboratory titer variance in comparison with other methods.

Interaction of convective flow generated by human body with room ventilation flow: impact on transport of pollution to the breathing zone

DEFF Research Database (Denmark)

Licina, Dusan; Melikov, Arsen Krikor; Sekhar, Chandra

2014-01-01

interaction with opposing flow from above and assisting flow from below; and secondly, implication of such a flow interaction on the particle transport from the feet to the breathing zone is examined. The results reveal that the human body heat transports the pollution to the breathing zone and increases......This study aims to investigate the interaction between the human convective boundary layer (CBL) and uniform airflow from two directions and with different velocities. The study has two objectives: first, to characterize the velocity field in the breathing zone of a thermal manikin under its...

Preliminary characterization of materials for a reactive transport model validation experiment

International Nuclear Information System (INIS)

Siegel, M.D.; Ward, D.B.; Cheng, W.C.; Bryant, C.; Chocas, C.S.; Reynolds, C.G.

1993-01-01

The geochemical properties of a porous sand and several tracers (Ni, Br, and Li) have been characterized for use in a caisson experiment designed to validate sorption models used in models of inactive transport. The surfaces of the sand grains have been examined by a combination of techniques including potentiometric titration, acid leaching, optical microscopy, and scanning electron microscopy with energy-dispersive spectroscopy. The surface studies indicate the presence of small amounts of carbonate, kaolinite and iron-oxyhydroxides. Adsorption of nickel, lithium and bromide by the sand was measured using batch techniques. Bromide was not sorbed by the sand. A linear (K d ) or an isotherm sorption model may adequately describe transport of Li; however, a model describing the changes of pH and the concentrations of other solution species as a function of time and position within the caisson and the concomitant effects on Ni sorption may be required for accurate predictions of nickel transport

Quasi-uniform Space

OpenAIRE

Coghetto Roland

2016-01-01

In this article, using mostly Pervin [9], Kunzi [6], [8], [7], Williams [11] and Bourbaki [3] works, we formalize in Mizar [2] the notions of quasiuniform space, semi-uniform space and locally uniform space.

Characterizing the toughness of an epoxy resin after wet aging using compact tension specimens with non-uniform moisture content

KAUST Repository

Quino, Gustavo; El Yagoubi, Jalal; Lubineau, Gilles

2014-01-01

Characterizing the change in toughness of polymers subjected to wet aging is challenging because of the heterogeneity of the testing samples. Indeed, as wet aging is guided by a diffusion/reaction process, compact tension samples (defined by the ASTM D5045 standard), which are relevant for toughness characterization but are somewhat thick, display a non-uniform moisture content over the bulk material. We define here a rigorous procedure to extract meaningful data from such tests. Our results showed that the relation between the moisture uptake of the whole sample and the measured toughness was not a meaningful material property. In fact, we found that the measured toughness depended on the locally varying moisture uptake over the cracking path. Here, we propose a post-processing technique that relies on a validated reaction/diffusion model to predict the three-dimensional moisture state of the epoxy. This makes identification of the variation in toughness with respect to the local moisture content possible. In addition, we analyze the fracture surface using micrography and roughness measurements. The observed variations in toughness are correlated with the roughness in the vicinity of the crack tip. © 2014 Elsevier Ltd. All rights rese.

Characterizing the toughness of an epoxy resin after wet aging using compact tension specimens with non-uniform moisture content

KAUST Repository

Quino, Gustavo

2014-11-01

Characterizing the change in toughness of polymers subjected to wet aging is challenging because of the heterogeneity of the testing samples. Indeed, as wet aging is guided by a diffusion/reaction process, compact tension samples (defined by the ASTM D5045 standard), which are relevant for toughness characterization but are somewhat thick, display a non-uniform moisture content over the bulk material. We define here a rigorous procedure to extract meaningful data from such tests. Our results showed that the relation between the moisture uptake of the whole sample and the measured toughness was not a meaningful material property. In fact, we found that the measured toughness depended on the locally varying moisture uptake over the cracking path. Here, we propose a post-processing technique that relies on a validated reaction/diffusion model to predict the three-dimensional moisture state of the epoxy. This makes identification of the variation in toughness with respect to the local moisture content possible. In addition, we analyze the fracture surface using micrography and roughness measurements. The observed variations in toughness are correlated with the roughness in the vicinity of the crack tip. © 2014 Elsevier Ltd. All rights rese.

Quasi-uniform Space

Directory of Open Access Journals (Sweden)

Coghetto Roland

2016-09-01

Full Text Available In this article, using mostly Pervin [9], Kunzi [6], [8], [7], Williams [11] and Bourbaki [3] works, we formalize in Mizar [2] the notions of quasiuniform space, semi-uniform space and locally uniform space.

Quantum ratchet effect in a time non-uniform double-kicked model

Science.gov (United States)

Chen, Lei; Wang, Zhen-Yu; Hui, Wu; Chu, Cheng-Yu; Chai, Ji-Min; Xiao, Jin; Zhao, Yu; Ma, Jin-Xiang

2017-07-01

The quantum ratchet effect means that the directed transport emerges in a quantum system without a net force. The delta-kicked model is a quantum Hamiltonian model for the quantum ratchet effect. This paper investigates the quantum ratchet effect based on a time non-uniform double-kicked model, in which two flashing potentials alternately act on a particle with a homogeneous initial state of zero momentum, while the intervals between adjacent actions are not equal. The evolution equation of the state of the particle is derived from its Schrödinger equation, and the numerical method to solve the evolution equation is pointed out. The results show that quantum resonances can induce the ratchet effect in this time non-uniform double-kicked model under certain conditions; some quantum resonances, which cannot induce the ratchet effect in previous models, can induce the ratchet effect in this model, and the strengths of the ratchet effect in this model are stronger than those in previous models under certain conditions. These results enrich people’s understanding of the delta-kicked model, and provides a new optional scheme to control the quantum transport of cold atoms in experiment.

Do School Uniforms Fit?

Science.gov (United States)

White, Kerry A.

2000-01-01

In 1994, Long Beach (California) Unified School District began requiring uniforms in all elementary and middle schools. Now, half of all urban school systems and many suburban schools have uniform policies. Research on uniforms' effectiveness is mixed. Tightened dress codes may be just as effective and less litigious. (MLH)

Characterization of sand lenses and their role for subsurface transport in low-permeability clay tills

DEFF Research Database (Denmark)

Kessler, Timo Christian; Klint, K. E.; Nilsson, B.

2011-01-01

Glacial sediments dominate large parts of the geological topology in Denmark. They predominantly consist of lowpermeability tills, but fractures and sand-lenses constitute zones of enhanced permeability facilitating preferential flow. This study focuses on characterization of sand deposits with r...... the sand lenses in hydro-geological models to successfully characterize subsurface flow and transport, e.g. for remediation activities....

Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

Science.gov (United States)

Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

2013-11-01

Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

A Structurally Specialized Uniform Wall Layer is Essential for Constructing Wall Ingrowth Papillae in Transfer Cells

Science.gov (United States)

Xia, Xue; Zhang, Hui-Ming; Offler, Christina E.; Patrick, John W.

2017-01-01

Transfer cells are characterized by wall labyrinths with either a flange or reticulate architecture. A literature survey established that reticulate wall ingrowth papillae ubiquitously arise from a modified component of their wall labyrinth, termed the uniform wall layer; a structure absent from flange transfer cells. This finding sparked an investigation of the deposition characteristics and role of the uniform wall layer using a Vicia faba cotyledon culture system. On transfer of cotyledons to culture, their adaxial epidermal cells spontaneously trans-differentiate to a reticulate architecture comparable to their abaxial epidermal transfer cell counterparts formed in planta. Uniform wall layer construction commenced once adaxial epidermal cell expansion had ceased to overlay the original outer periclinal wall on its inner surface. In contrast to the dense ring-like lattice of cellulose microfibrils in the original primary wall, the uniform wall layer was characterized by a sparsely dispersed array of linear cellulose microfibrils. A re-modeled cortical microtubule array exerted no influence on uniform wall layer formation or on its cellulose microfibril organization. Surprisingly, formation of the uniform wall layer was not dependent upon depositing a cellulose scaffold. In contrast, uniform wall cellulose microfibrils were essential precursors for constructing wall ingrowth papillae. On converging to form wall ingrowth papillae, the cellulose microfibril diameters increased 3-fold. This event correlated with up-regulated differential, and transfer-cell specific, expression of VfCesA3B while transcript levels of other cellulose biosynthetic-related genes linked with primary wall construction were substantially down-regulated. PMID:29259611

Experimental characterization of solid particle transport by slug flow using Particle Image Velocimetry

International Nuclear Information System (INIS)

Goharzadeh, A; Rodgers, P

2009-01-01

This paper presents an experimental study of gas-liquid slug flow on solid particle transport inside a horizontal pipe with two types of experiments conducted. The influence of slug length on solid particle transportation is characterized using high speed photography. Using combined Particle Image Velocimetry (PIV) with Refractive Index Matching (RIM) and fluorescent tracers (two-phase oil-air loop) the velocity distribution inside the slug body is measured. Combining these experimental analyses, an insight is provided into the physical mechanism of solid particle transportation due to slug flow. It was observed that the slug body significantly influences solid particle mobility. The physical mechanism of solid particle transportation was found to be discontinuous. The inactive region (in terms of solid particle transport) upstream of the slug nose was quantified as a function of gas-liquid composition and solid particle size. Measured velocity distributions showed a significant drop in velocity magnitude immediately upstream of the slug nose and therefore the critical velocity for solid particle lifting is reached further upstream.

Games Uniforms Unveiled

Institute of Scientific and Technical Information of China (English)

Linda

2008-01-01

The uniforms for Beijing Olympics’ workers, technical staff and volunteers have been unveiled to mark the 200-day countdown to the Games. The uniforms feature the key element of the clouds of promise and will be in three colors:red for Beijing Olympic Games Committee staff, blue

Characterization of contaminant transport by gravity, capillarity and barometric pumping in heterogeneous vadose regimes. 1998 annual progress report

International Nuclear Information System (INIS)

Carrigan, C.R.; Hudson, G.B.

1998-01-01

'The intent of this research program is to obtain an improved understanding of vadose zone transport processes and to develop field and modeling techniques required to characterize contaminant transport in the unsaturated zone at DOE sites. For surface spills and near-surface leaks of chemicals, the vadose zone may well become a long-term source of contamination for the underlying water table. Transport of contaminants can occur in both the liquid and gas phases of the unsaturated zone. This transport occurs naturally as a result of diffusion, buoyancy forces (gravity), capillarity and barometric pressure variations. In some cases transport can be enhanced by anisotropies present in hydrologic regimes. This is particularly true for gas-phase transport which may be subject to vertical pumping resulting from atmospheric pressure changes. For liquid-phase flows, heterogeneity may enhance the downward transport of contaminants to the water table depending on soil properties and the scale of the surface spill or near-surface leak. Characterization techniques based upon the dynamics of transport processes are likely to yield a better understanding of the potential for contaminant transport at a specific site than methods depending solely on hydrologic properties derived from a borehole. Such dynamic-characterization techniques can be useful for evaluating sites where contamination presently exists as well as for providing an objective basis to evaluate the efficacy of proposed as well as implemented clean-up technologies. The real-time monitoring of processes that may occur during clean-up of tank waste and the mobility of contaminants beneath the Hanford storage tanks during sluicing operations is one example of how techniques developed in this effort can be applied to current remediation problems. In the future, such dynamic-characterization methods might also be used as part of the site-characterization process for determining suitable locations of new DOE facilities

Preparation and characterization of uniform-sized chitosan/silver microspheres with antibacterial activities.

Science.gov (United States)

An, Jing; Ji, Zhenxing; Wang, Desong; Luo, Qingzhi; Li, Xueyan

2014-03-01

The chitosan/silver microspheres (CAgMs), which possess effective inhibitory on microorganisms, were prepared by an inverse-emulsification cross-linking method using CS/Ag sol as dispersed phase, whiteruss as continuous phase, and glutaraldehyde as crosslinking agent. The size and shape of CAgMs, greatly affecting their antibacterial activities, were controlled by varying the concentrations of cross-linking agent, emulsifier and CS/Ag colloid. The preparation conditions for obtaining uniform-sized microspheres were optimized. The morphology of CAgMs was characterized by scanning electron microscopy (SEM) and laser particle size analysis. The spherical CAgMs with smooth surface in the mean size of ca. 5 μm exhibited a narrow particle size distribution. Energy Dispersive X-ray spectroscopy (EDX) revealed the elemental composition of the microspheres. Transmission electron micrographs (TEM) and Fourier transform infrared spectroscopy (FTIR) of the microspheres confirmed the formation of silver nanoparticles (AgNPs). The X-ray diffraction (XRD) patterns and UV-Visible diffuse reflectance spectroscopy (UV-vis DRS) of the sample showed that AgNPs with the diameter no more than 20 nm were face-centered cubic crystallites. X-ray photoelectron spectroscopy (XPS) proved that AgO bond existed in the microspheres. Thermogravimetric analysis (TGA) showed that the starting decomposition temperature of CAgMs (ca. 260°C) was much higher than that of CS (ca. 160°C), suggesting that the as-prepared CAgMs possessed better thermal stability than original CS did. Antimicrobial assays were performed using typical Gram bacteria and fungi. The inhibitory effect indicated that the as-prepared microspheres exerted a stronger antibacterial activity as the concentration of the AgNPs is increasing, and the microspheres in smaller size had much better antibacterial activity than those in the larger size. The antimicrobial mechanism of CAgMs was discussed. Copyright © 2013 Elsevier B.V. All

Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

International Nuclear Information System (INIS)

Ortega, P.; Custódio, M.R.; Zanotto, F.P.

2014-01-01

Highlights: • Cd 2+ gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd 2+ enter gill cells through Ca 2+ channels and is dependent of intracellular Ca 2+ levels. • Route of entry in gill cells also involves a Cd 2+ /Ca 2+ (2Na) exchanger. • Cd transport depends on Na + /K + -ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd 2+ transport and ouabain increase gill Cd 2+ transport. - Abstract: Membrane pathway for intracellular cadmium (Cd 2+ ) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd 2+ transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd 2+ concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd 2+ transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl 2 and different inhibitors. Addition of extracellular calcium (Ca 2+ ) to the cells affected little the fluorescence of FluoZin, confirming that Cd 2+ was the main ion increasing intracellular fluorescence. Ca 2+ channels blockers (nimodipine and verapamil) decreased Cd 2+ influx as well as vanadate, a Ca 2+ -ATPase blocker. Chelating intracellular Ca 2+ (BAPTA) decreased Cd 2+ influx in gill cells, while increasing intracellular Ca 2+ (caffeine) augmented Cd influx. Cd 2+ and ATP added at different temporal conditions were not effective at increasing intracellular Cd 2+ accumulation. Ouabain (Na + /K + -ATPase inhibitor) increased Cd 2+ influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd 2+ influx, a non-essential metal, through the gill cell plasma membrane of crabs are suggested

Threshold switching uniformity in In2Se3 nanowire-based phase change memory

International Nuclear Information System (INIS)

Chen Jian; Du Gang; Liu Xiao-Yan

2015-01-01

The uniformity of threshold voltage and threshold current in the In 2 Se 3 nanowire-based phase change memory (PCM) devices is investigated. Based on the trap-limited transport model, amorphous layer thickness, trap density, and trap depth are considered to clarify their influences upon the threshold voltage and threshold current through simulations. (paper)

Uniform Sampling Table Method and its Applications II--Evaluating the Uniform Sampling by Experiment.

Science.gov (United States)

Chen, Yibin; Chen, Jiaxi; Chen, Xuan; Wang, Min; Wang, Wei

2015-01-01

A new method of uniform sampling is evaluated in this paper. The items and indexes were adopted to evaluate the rationality of the uniform sampling. The evaluation items included convenience of operation, uniformity of sampling site distribution, and accuracy and precision of measured results. The evaluation indexes included operational complexity, occupation rate of sampling site in a row and column, relative accuracy of pill weight, and relative deviation of pill weight. They were obtained from three kinds of drugs with different shape and size by four kinds of sampling methods. Gray correlation analysis was adopted to make the comprehensive evaluation by comparing it with the standard method. The experimental results showed that the convenience of uniform sampling method was 1 (100%), odds ratio of occupation rate in a row and column was infinity, relative accuracy was 99.50-99.89%, reproducibility RSD was 0.45-0.89%, and weighted incidence degree exceeded the standard method. Hence, the uniform sampling method was easy to operate, and the selected samples were distributed uniformly. The experimental results demonstrated that the uniform sampling method has good accuracy and reproducibility, which can be put into use in drugs analysis.

Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

Energy Technology Data Exchange (ETDEWEB)

Sá, M.G. [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Department of Biophysics, Escola Paulista de Medicina, Universidade Federal de Sao Paulo, Rua Três de Maio 100, Sao Paulo 04044-020 (Brazil)

2013-11-15

Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl{sub 2} (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V{sub max} for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10{sup 4} cells{sup −1} × 300 s{sup −1} respectively and K{sub m} values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K{sub m} for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that

Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

International Nuclear Information System (INIS)

Sá, M.G.; Zanotto, F.P.

2013-01-01

Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl 2 (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V max for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10 4 cells −1 × 300 s −1 respectively and K m values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K m for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that could also drive Cu to the gill cell

The magneto-optical properties of non-uniform graphene nanoribbons

Science.gov (United States)

Chung, Hsien-Ching; Lin, Ming-Fa

2015-03-01

When synthesizing few-layer graphene nanoribbons (GNRs), non-uniform GNRs would be made simultaneously. Recently, the non-uniform GNRs, which is a stack of two GNRs with unequal widths, have been fabricated by mechanically exfoliated from bulk graphite. Some theoretical predictions have been reported, such as gap opening and transport properties. Under the influence of magnetic fields, magnetic quantization takes place and drastically changes the electronic properties. By tuning the geometric configuration, four categories of magneto-electronic spectra are exhibited. (1) The spectrum is mostly contributed by quasi-Landau levels (QLLs) of monolayer GNRs. (2) The spectrum displays two groups of QLLs, and the non-uniform GNR behaves like a bilayer one. (3) An intermediate category, the spectrum is composite disordered. (4) The spectrum presents the coexistence of monolayer and bilayer spectra. In this work, the magneto-electronic and optical properties for different geometric configurations are given, such as energy dispersions, density of states, wave functions, and magneto-absorption spectra are presented. Furthermore, the transformation between monolayer and bilayer spectra as well as the coexistence of monolayer and bilayer spectra are discussed in detail. One of us (Hsien-Ching Chung) thanks Ming-Hui Chung and Su-Ming Chen for financial support. This work was supported in part by the National Science Council of Taiwan under Grant Number 98-2112-M-006-013-MY4.

Comparison between two methodologies for uniformity correction of extensive reference sources

International Nuclear Information System (INIS)

Junior, Iremar Alves S.; Siqueira, Paulo de T.D.; Vivolo, Vitor; Potiens, Maria da Penha A.; Nascimento, Eduardo

2016-01-01

This article presents the procedures to obtain the uniformity correction factors for extensive reference sources proposed by two different methodologies. The first methodology is presented by the Good Practice Guide of Nº 14 of the NPL, which provides a numerical correction. The second one uses the radiation transport code, MCNP5, to obtain the correction factor. Both methods retrieve very similar corrections factor values, with a maximum deviation of 0.24%. (author)

Synthetic approaches to uniform polymers.

Science.gov (United States)

Ali, Monzur; Brocchini, Steve

2006-12-30

Uniform polymers are characterised by a narrow molecular weight distribution (MWD). Uniformity is also defined by chemical structure in respect of (1) monomer orientation, sequence and stereo-regularity, (2) polymer shape and morphology and (3) chemical functionality. The function of natural polymers such as polypeptides and polynucleotides is related to their conformational structure (e.g. folded tertiary structure). This is only possible because of their high degree of uniformity. While completely uniform synthetic polymers are rare, polymers with broad structure and MWD are widely used in medicine and the biomedical sciences. They are integral components in final dosage forms, drug delivery systems (DDS) and in implantable devices. Increasingly uniform polymers are being used to develop more complex medicines (e.g. delivery of biopharmaceuticals, enhanced formulations or DDS's for existing actives). In addition to the function imparted by any new polymer it will be required to meet stringent specifications in terms of cost containment, scalability, biocompatibility and performance. Synthetic polymers with therapeutic activity are also being developed to exploit their polyvalent properties, which is not possible with low molecular weight molecules. There is need to utilise uniform polymers for applications where the polymer may interact with the systemic circulation, tissues or cellular environment. There are also potential applications (e.g. stimuli responsive coatings) where uniform polymers may be used for their more defined property profile. While it is not yet practical to prepare synthetic polymers to the same high degree of uniformity as proteins, nature also effectively utilises many polymers with lower degrees of uniformity (e.g. polysaccharides, poly(amino acids), polyhydroxyalkanoates). In recent years it has become possible to prepare with practical experimental protocols sufficient quantities of polymers that display many aspects of uniformity. This

Chancellor Water Colloids: Characterization and Radionuclide Associated Transport

Energy Technology Data Exchange (ETDEWEB)

Reimus, Paul William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Boukhalfa, Hakim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

2014-09-26

Column transport experiments were conducted in which water from the Chancellor nuclear test cavity was transported through crushed volcanic tuff from Pahute Mesa. In one experiment, the cavity water was spiked with solute ¹³⁷Cs, and in another it was spiked with ^239/240Pu(IV) nanocolloids. A third column experiment was conducted with no radionuclide spike at all, although the ¹³⁷Cs concentrations in the water were still high enough to quantify in the column effluent. The radionuclides strongly partitioned to natural colloids present in the water, which were characterized for size distribution, mass concentration, zeta potential/surface charge, critical coagulation concentration, and qualitative mineralogy. In the spiked water experiments, the unanalyzed portion of the high-concentration column effluent samples were combined and re-injected into the respective columns as a second pulse. This procedure was repeated again for a third injection. Measurable filtration of the colloids was observed after each initial injection of the Chancellor water into the columns, but the subsequent injections (spiked water experiments only) exhibited no apparent filtration, suggesting that the colloids that remained mobile after relatively short transport distances were more resistant to filtration than the initial population of colloids. It was also observed that while significant desorption of ¹³⁷Cs from the colloids occurred after the first injection in both the spiked and unspiked waters, subsequent injections of the spiked water exhibited much less ¹³⁷Cs desorption (much greater ¹³⁷Cs colloid-associated transport). This result suggests that the ¹³⁷Cs that remained associated with colloids during the first injection represented a fraction that was more strongly adsorbed to the mobile colloids than the initial ¹³⁷Cs associated with the colloids. A greater amount of the ^239/240

Dynamic characterization of external and internal mass transport in heterotrophic biofilms from microsensors measurements.

Science.gov (United States)

Guimerà, Xavier; Dorado, Antonio David; Bonsfills, Anna; Gabriel, Gemma; Gabriel, David; Gamisans, Xavier

2016-10-01

Knowledge of mass transport mechanisms in biofilm-based technologies such as biofilters is essential to improve bioreactors performance by preventing mass transport limitation. External and internal mass transport in biofilms was characterized in heterotrophic biofilms grown on a flat plate bioreactor. Mass transport resistance through the liquid-biofilm interphase and diffusion within biofilms were quantified by in situ measurements using microsensors with a high spatial resolution (mass transport coefficients. The sensitivity of external and internal mass transport resistances to flow conditions within the range of typical fluid velocities over biofilms (Reynolds numbers between 0.5 and 7) was assessed. Estimated external mass transfer coefficients at different liquid phase flow velocities showed discrepancies with studies considering laminar conditions in the diffusive boundary layer near the liquid-biofilm interphase. The correlation of effective diffusivity with flow velocities showed that the heterogeneous structure of biofilms defines the transport mechanisms inside biofilms. Internal mass transport was driven by diffusion through cell clusters and aggregates at Re below 2.8. Conversely, mass transport was driven by advection within pores, voids and water channels at Re above 5.6. Between both flow velocities, mass transport occurred by a combination of advection and diffusion. Effective diffusivities estimated at different biofilm densities showed a linear increase of mass transport resistance due to a porosity decrease up to biofilm densities of 50 g VSS·L(-1). Mass transport was strongly limited at higher biofilm densities. Internal mass transport results were used to propose an empirical correlation to assess the effective diffusivity within biofilms considering the influence of hydrodynamics and biofilm density. Copyright © 2016 Elsevier Ltd. All rights reserved.

Nonlinear generation of zonal flows by ion-acoustic waves in a uniform magnetoplasma

International Nuclear Information System (INIS)

Shukla, Nitin; Shukla, P.K.

2010-01-01

It is shown that large-scale zonal flows (ZFs) can be excited by Reynolds stress of nonlinearly interacting random phase ion-acoustic waves (EIAWs) in a uniform magnetoplasma. Since ZFs are associated with poloidal sheared flows, they can tear apart short scale EIAW turbulence eddies, and hence contribute to the reduction of the cross-field turbulent transport in a magnetized plasma.

Characterizing the transplanar and in-plane water transport properties of fabrics under different sweat rate: Forced Flow Water Transport Tester

Science.gov (United States)

Tang, K. P. M.; Chau, K. H.; Kan, C. W.; Fan, J. T.

2015-11-01

The water absorption and transport properties of fabrics are critical to wear comfort, especially for sportswear and protective clothing. A new testing apparatus, namely Forced Flow Water Transport Tester (FFWTT), was developed for characterizing the transplanar and in-plane wicking properties of fabrics based on gravimetric and image analysis technique. The uniqueness of this instrument is that the rate of water supply is adjustable to simulate varying sweat rates with reference to the specific end-use conditions ranging from sitting, walking, running to other strenuous activities. This instrument is versatile in terms of the types of fabrics that can be tested. Twenty four types of fabrics with varying constructions and surface finishes were tested. The results showed that FFWTT was highly sensitive and reproducible in differentiating these fabrics and it suggests that water absorption and transport properties of fabrics are sweat rate-dependent. Additionally, two graphic methods were proposed to map the direction of liquid transport and its relation to skin wetness, which provides easy and direct comparison among different fabrics. Correlation analysis showed that FFWTT results have strong correlation with subjective wetness sensation, implying validity and usefulness of the instrument.

Deposition uniformity, particle nucleation and the optimum conditions for CVD in multi-wafer furnaces

Energy Technology Data Exchange (ETDEWEB)

Griffiths, S.K.; Nilson, R.H.

1996-06-01

A second-order perturbation solution describing the radial transport of a reactive species and concurrent deposition on wafer surfaces is derived for use in optimizing CVD process conditions. The result is applicable to a variety of deposition reactions and accounts for both diffusive and advective transport, as well as both ordinary and Knudsen diffusion. Based on the first-order approximation, the deposition rate is maximized subject to a constraint on the radial uniformity of the deposition rate. For a fixed reactant mole fraction, the optimum pressure and optimum temperature are obtained using the method of Lagrange multipliers. This yields a weak one-sided maximum; deposition rates fall as pressures are reduced but remain nearly constant at all pressures above the optimum value. The deposition rate is also maximized subject to dual constraints on the uniformity and particle nucleation rate. In this case, the optimum pressure, optimum temperature and optimum reactant fraction are similarly obtained, and the resulting maximum deposition rate is well defined. These results are also applicable to CVI processes used in composites manufacturing.

Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport

International Nuclear Information System (INIS)

Cuesta, J.E.

2006-06-01

Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

Size graded sediment dynamics: from the processes characterization to the transport modelling in the English Channel; Dynamique sedimentaire multiclasse: de l'etude des processus a la modelisation en Manche

Energy Technology Data Exchange (ETDEWEB)

Blanpain, O.

2009-10-15

The purpose of this work is the implementation of a sediment transport model in the English Channel. The design of such a model requires the identification of the physical processes, their modelling and their in-situ validation. Because of the sedimentary particularities of the study area, modelling of the mechanical behaviour of a non uniform mixture of sediments and particularly of the fine grains within a coarse matrix is required. This study focused on the characterization of the relevant processes by acquisition of experimental and in-situ data. Data acquired in hydro-sedimentary conditions comparable to those found in the English Channel are scarce. A new instrument and image processing technique were specifically conceived and implemented in-situ to observe and measure, with a high temporal resolution, the dynamics of a strongly heterogeneous mixture of particles in a grain-size scale. The data collected compared well with several existing formulations. One of these formulations was chosen to be adapted. The transfer dynamics of fine grains in coarse sediments and their depth of penetration were acquired from stratigraphic samples. The sediment transport model deals with multi-size grains and multi sedimentary layers, it is forced by swell and currents, and accounts for bead load and suspended load transports. It was applied to realistic scenarios for the English Channel. (author)

Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

Energy Technology Data Exchange (ETDEWEB)

Ortega, P.; Custódio, M.R. [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Departamento de Biofísica, Escola Paulista de Medicina, Universidade Federal de São Paulo, Rua Três de Maio 100, São Paulo 04044-020 (Brazil)

2014-12-15

Highlights: • Cd{sup 2+} gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd{sup 2+} enter gill cells through Ca{sup 2+} channels and is dependent of intracellular Ca{sup 2+} levels. • Route of entry in gill cells also involves a Cd{sup 2+}/Ca{sup 2+} (2Na) exchanger. • Cd transport depends on Na{sup +}/K{sup +}-ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd{sup 2+} transport and ouabain increase gill Cd{sup 2+} transport. - Abstract: Membrane pathway for intracellular cadmium (Cd{sup 2+}) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd{sup 2+} transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd{sup 2+} concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd{sup 2+} transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl{sub 2} and different inhibitors. Addition of extracellular calcium (Ca{sup 2+}) to the cells affected little the fluorescence of FluoZin, confirming that Cd{sup 2+} was the main ion increasing intracellular fluorescence. Ca{sup 2+} channels blockers (nimodipine and verapamil) decreased Cd{sup 2+} influx as well as vanadate, a Ca{sup 2+}-ATPase blocker. Chelating intracellular Ca{sup 2+} (BAPTA) decreased Cd{sup 2+} influx in gill cells, while increasing intracellular Ca{sup 2+} (caffeine) augmented Cd influx. Cd{sup 2+} and ATP added at different temporal conditions were not effective at increasing intracellular Cd{sup 2+} accumulation. Ouabain (Na{sup +}/K{sup +}-ATPase inhibitor) increased Cd{sup 2+} influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd{sup 2+} influx, a non-essential metal, through the

Novel ion-exchange nanocomposite membrane containing in-situ formed FeOOH nanoparticles: Synthesis, characterization and transport properties

Energy Technology Data Exchange (ETDEWEB)

Heidary, Farhad; Kharat, Ali Nemati [University of Tehran, Tehran (Iran, Islamic Republic of); Khodabakhshi, Ali Reza [Faculty of Science, Arak University, Arak (Iran, Islamic Republic of)

2016-04-15

A new type of cation-exchange nanocomposite membrane was prepared via in-situ formation of FeOOH nanoparticles in a blend containing sulfonated poly (2,6-dimethyl-1,4-phenylene oxide) and sulfonated polyvinylchloride by a simple one-step chemical method. Prepared nanocomposite membranes were characterized using Fourier transform infrared spectroscopy, scanning electron microscopy and X-ray diffraction. The SEM images showed uniform dispersion of FeOOH nanoparticles throughout the polymeric matrices. The effect of additive loading on physicochemical and electrochemical properties of prepared cation-exchange nanocomposite membranes was studied. Various characterizations showed that the incorporation of different amounts of FeOOH nanoparticles into the basic membrane structure had a significant influence on the membrane performance and could improve the electrochemical properties.

46 CFR 310.11 - Cadet uniforms.

Science.gov (United States)

2010-10-01

... for State, Territorial or Regional Maritime Academies and Colleges § 310.11 Cadet uniforms. Cadet uniforms shall be supplied at the school in accordance with the uniform regulations of the School. Those... 46 Shipping 8 2010-10-01 2010-10-01 false Cadet uniforms. 310.11 Section 310.11 Shipping MARITIME...

Characterization of HR coatings for the megajoule laser transport mirrors

International Nuclear Information System (INIS)

Fornier, A.; Cordillot, C.; Bernardino, D.; Lam, O.; Roussel, A.

1997-01-01

One of the concerns with the Megajoule Laser design is the laser-induced damage threshold of the transport mirrors. Earlier studies have shown that the main constraint on the laser damage threshold comes from nodules at the mirror surface. It is therefore important to restrict the number of such nodules. SFIM-ODS, in close collaboration with CEL-V, has initiated a special study to characterize these nodules as precisely as possible. The objective of the study is twofold: (1) to determine the origin of the nodules and subsequently to adapt the mirror fabrication process in order to limit their formation, (2) to analyze their shapes and dimensions in order to ascertain which nodules are critical for laser-induced damage. To understand the origin of the nodules and their effect on the laser damage threshold, the mirrors are characterized using various methods, (3) absorption and scatter mapping: does the presence of nodules result in specific absorption patterns? (4) surface analysis by atomic force microscopy: to characterize nodule shape and dimensions, (5) Focused Ion Beam (FIB) cutting of nodules: to locate the seed initiating the nodule (on the substrate or in the stack), and to characterize the seed shape and composition (contamination, material spatter during evaporation, etc.), and (6) laser damage threshold measurements: to determine the laser damage threshold of the mirror and study the behavior of nodules under laser irradiation depending on their dimensions and shape

Should School Nurses Wear Uniforms?

Science.gov (United States)

Journal of School Health, 2001

2001-01-01

This 1958 paper questions whether school nurses should wear uniforms (specifically, white uniforms). It concludes that white uniforms are often associated with the treatment of ill people, and since many people have a fear reaction to them, they are not necessary and are even undesirable. Since school nurses are school staff members, they should…

Characterization of placental cholesterol transport

DEFF Research Database (Denmark)

Lindegaard, Marie L; Wassif, Christopher A; Vaisman, Boris

2008-01-01

Patients with Smith-Lemli-Opitz syndrome (SLOS) are born with multiple congenital abnormalities. Postnatal cholesterol supplementation is provided; however, it cannot correct developmental malformations due to in utero cholesterol deficit. Increased transport of cholesterol from maternal to fetal...... circulation might attenuate congenital malformations. The cholesterol transporters Abca1, Abcg1, and Sr-b1 are present in placenta; however, their potential role in placental transport remains undetermined. In mice, expression analyses showed that Abca1 and Abcg1 transcripts increased 2-3-fold between...... embryonic days 13.5 and 18.5 in placental tissue; whereas, Sr-b1 expression decreased. To examine the functional role of Abca1, Abcg1 and Sr-b1 we measured the maternal-fetal transfer of (14)C-cholesterol in corresponding mutant embryos. Disruption of either Abca1 or Sr-b1 decreased cholesterol transfer...

Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

Science.gov (United States)

Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

2010-03-01

The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

Characterization of a novel variant of amino acid transport system asc in erythrocytes from Przewalski's horse (Equus przewalskii).

Science.gov (United States)

Fincham, D A; Ellory, J C; Young, J D

1992-08-01

In thoroughbred horses, red blood cell amino acid transport activity is Na(+)-independent and controlled by three codominant genetic alleles (h, l, s), coding for high-affinity system asc1 (L-alanine apparent Km for influx at 37 degrees C congruent to 0.35 mM), low-affinity system asc2 (L-alanine Km congruent to 14 mM), and transport deficiency, respectively. The present study investigated amino acid transport mechanisms in red cells from four wild species: Przewalski's horse (Equus przewalskii), Hartmann's zebra (Zebra hartmannae), Grevy's zebra (Zebra grevyi), and onager (Equus hemonius). Red blood cell samples from different Przewalski's horses exhibited uniformly high rates of L-alanine uptake, mediated by a high-affinity asc1-type transport system. Mean apparent Km and Vmax values (+/- SE) for L-alanine influx at 37 degrees C in red cells from 10 individual animals were 0.373 +/- 0.068 mM and 2.27 +/- 0.11 mmol (L cells.h), respectively. As in thoroughbreds, the Przewalski's horse transporter interacted with dibasic as well as neutral amino acids. However, the Przewalski asc1 isoform transported L-lysine with a substantially (6.4-fold) higher apparent affinity than its thoroughbred counterpart (Km for influx 1.4 mM at 37 degrees C) and was also less prone to trans-stimulation effects. The novel high apparent affinity of the Przewalski's horse transporter for L-lysine provides additional key evidence of functional and possible structural similarities between asc and the classical Na(+)-dependent system ASC and between these systems and the Na(+)-independent dibasic amino acid transport system y+. Unlike Przewalski's horse, zebra red cells were polymorphic with respect to L-alanine transport activity, showing high-affinity or low-affinity saturable mechanisms of L-alanine uptake. Onager red cells transported this amino acid with intermediate affinity (apparent Km for influx 3.0 mM at 37 degrees C). Radiation inactivation analysis was used to estimate the target

A technique to investigate the mechanism of uniform corrosion in the presence of a semi-permeable membrane

International Nuclear Information System (INIS)

King, F.

1987-01-01

A technique to investigate the mechanism of uniform corrosion in the presence of a semi-permeable membrane is described. For both the anodic and cathodic half-reactions three possible rate-determining steps are considered: transport of species through the bulk solution diffusion layer, transport of species through the membrane and the electrochemical reaction itself. The technique is based on the measurement of the corrosion potential, E CORR , of a rotating disc electrode under steady-state conditions. The variation of E CORR with the oxidant concentration, the thickness of the diffusion layer and the membrane thickness is used to identify the rate-determining step for each half-reaction. This technique should be of use in the study of the corrosion behaviour of candidate materials for nuclear waste disposal containers. An understanding of the mechanism of uniform corrosion will enable confident predictions to be made concerning the long-term behaviour of such containers

76 FR 29135 - National Defense Transportation Day and National Transportation Week, 2011

Science.gov (United States)

2011-05-19

... define our economy, increasing the productivity of our people and our land. Our transportation system... rapidly empowers our men and women in uniform to respond to crises or natural disasters at home and abroad... work started by the American Recovery and Reinvestment Act to maintain a world-class logistics network...

Devaney's chaos on uniform limit maps

International Nuclear Information System (INIS)

Yan Kesong; Zeng Fanping; Zhang Gengrong

2011-01-01

Highlights: → The transitivity may not been inherited even if the sequence functions mixing. → The sensitivity may not been inherited even if the iterates of sequence have some uniform convergence. → Some equivalence conditions for the transitivity and sensitivity for uniform limit function are given. → A non-transitive sequence may converge uniformly to a transitive map. - Abstract: Let (X, d) be a compact metric space and f n : X → X a sequence of continuous maps such that (f n ) converges uniformly to a map f. The purpose of this paper is to study the Devaney's chaos on the uniform limit f. On the one hand, we show that f is not necessarily transitive even if all f n mixing, and the sensitive dependence on initial conditions may not been inherited to f even if the iterates of the sequence have some uniform convergence, which correct two wrong claims in . On the other hand, we give some equivalence conditions for the uniform limit f to be transitive and to have sensitive dependence on initial conditions. Moreover, we present an example to show that a non-transitive sequence may converge uniformly to a transitive map.

THE EFFECT OF INTERMITTENT GYRO-SCALE SLAB TURBULENCE ON PARALLEL AND PERPENDICULAR COSMIC-RAY TRANSPORT

International Nuclear Information System (INIS)

Le Roux, J. A.

2011-01-01

Earlier work based on nonlinear guiding center (NLGC) theory suggested that perpendicular cosmic-ray transport is diffusive when cosmic rays encounter random three-dimensional magnetohydrodynamic turbulence dominated by uniform two-dimensional (2D) turbulence with a minor uniform slab turbulence component. In this approach large-scale perpendicular cosmic-ray transport is due to cosmic rays microscopically diffusing along the meandering magnetic field dominated by 2D turbulence because of gyroresonant interactions with slab turbulence. However, turbulence in the solar wind is intermittent and it has been suggested that intermittent turbulence might be responsible for the observation of 'dropout' events in solar energetic particle fluxes on small scales. In a previous paper le Roux et al. suggested, using NLGC theory as a basis, that if gyro-scale slab turbulence is intermittent, large-scale perpendicular cosmic-ray transport in weak uniform 2D turbulence will be superdiffusive or subdiffusive depending on the statistical characteristics of the intermittent slab turbulence. In this paper we expand and refine our previous work further by investigating how both parallel and perpendicular transport are affected by intermittent slab turbulence for weak as well as strong uniform 2D turbulence. The main new finding is that both parallel and perpendicular transport are the net effect of an interplay between diffusive and nondiffusive (superdiffusive or subdiffusive) transport effects as a consequence of this intermittency.

THE EFFECT OF INTERMITTENT GYRO-SCALE SLAB TURBULENCE ON PARALLEL AND PERPENDICULAR COSMIC-RAY TRANSPORT

Energy Technology Data Exchange (ETDEWEB)

Le Roux, J. A. [Department of Physics, University of Alabama in Huntsville, Huntsville, AL 35899 (United States)

2011-12-10

Earlier work based on nonlinear guiding center (NLGC) theory suggested that perpendicular cosmic-ray transport is diffusive when cosmic rays encounter random three-dimensional magnetohydrodynamic turbulence dominated by uniform two-dimensional (2D) turbulence with a minor uniform slab turbulence component. In this approach large-scale perpendicular cosmic-ray transport is due to cosmic rays microscopically diffusing along the meandering magnetic field dominated by 2D turbulence because of gyroresonant interactions with slab turbulence. However, turbulence in the solar wind is intermittent and it has been suggested that intermittent turbulence might be responsible for the observation of 'dropout' events in solar energetic particle fluxes on small scales. In a previous paper le Roux et al. suggested, using NLGC theory as a basis, that if gyro-scale slab turbulence is intermittent, large-scale perpendicular cosmic-ray transport in weak uniform 2D turbulence will be superdiffusive or subdiffusive depending on the statistical characteristics of the intermittent slab turbulence. In this paper we expand and refine our previous work further by investigating how both parallel and perpendicular transport are affected by intermittent slab turbulence for weak as well as strong uniform 2D turbulence. The main new finding is that both parallel and perpendicular transport are the net effect of an interplay between diffusive and nondiffusive (superdiffusive or subdiffusive) transport effects as a consequence of this intermittency.

Functional characterization of water transport and cellular localization of three aquaporin paralogs in the salmonid intestine

DEFF Research Database (Denmark)

Madsen, Steffen S; Olesen, Jesper H; Bedal, Konstanze

2011-01-01

Intestinal water absorption is greatly enhanced in salmonids upon acclimation from freshwater (FW) to seawater (SW); however, the molecular mechanism for water transport is unknown. We conducted a pharmacological characterization of water absorption in the rainbow trout intestine along......%), 0.1 ouabain (72%), and 0.1 bumetanide (82%) suggesting that active transport, Na(+), K(+)-ATPase and Na(+), K(+), 2Cl(-)-co-transport are involved in establishing the driving gradient for water transport. J(v) was also inhibited by 1 mmol L(-1) HgCl(2), serosally (23% in M and 44% in P), mucosally...... (27% in M), or both (61% in M and 58% in P), suggesting involvement of both apical and basolateral aquaporins in water transport. The inhibition was antagonized by 5 mmol L(-1) mercaptoethanol. By comparison, 10 mmol L(-1) mucosal tetraethylammonium, an inhibitor of certain aquaporins, inhibited J...

IDEAL STRUCTURE OF UNIFORM ROE ALGEBRAS OVER SIMPLE CORES

Institute of Scientific and Technical Information of China (English)

CHEN XIAOMAN; WANG QIN

2004-01-01

This paper characterizes ideal structure of the uniform Roe algebra B* (X) over sinple cores X. A necessary and sufficient condition for a principal ideal of B*(X) to be spatial is given and an example of non-spatial ideal of B* (X) is constructed. By establishing an one-one correspondence between the ideals of B* (X) and the ω-filters on X, the maximal ideals of B* (X) are completely described by the corona of the Stone-Cech compactification of X.

Evaluation of the dose uniformity for double-plane high dose rate interstitial breast implants with the use of dose reference points and dose non-uniformity ratio

International Nuclear Information System (INIS)

MAjor, T.; Polgar, C.; Somogyi, A.; Nemeth, G.

2000-01-01

This study investigated the influence of dwell time optimizations on dose uniformity characterized by dose values in dose points and dose non-uniformity ratio (DNR) and analyzed which implant parameters have influence on the DNR. Double-plane breast implants with catheters arranged in triangular pattern were used for the calculations. At a typical breast implant, dose values in dose reference points inside the target volume and volumes enclosed by given isodose surfaces were calculated and compared for non-optimized and optimized implants. The same 6-cm treatment length was used for the comparisons. Using different optimizations plots of dose non-uniformity ratio as a function of catheter separation, source step size, number of catheters, length of active sections were drawn and the minimum DNR values were determined. Optimization resulted in less variation in dose values over dose points through the whole volume and in the central plane only compared to the non-optimized case. At implant configurations consisting of seven catheters with 15-mm separation, 5-mm source step size and various active lengths adapted according to the type of optimization, the no optimization, geometrical (volume mode) and dose point (on dose points and geometry) optimization resulted in similar treatment volumes, but an increased high dose volume was observed due to the optimization. The dose non-uniformity ratio always had the minimum at average dose over dose normalization points, defined in the midpoints between the catheters through the implant volume. The minimum value of DNR depended on catheter separation, source step size, active length and number of catheters. The optimization had only a small influence on DNR. In addition to the reference points in the central plane only, dose points positioned in the whole implant volume can be used for evaluating the dose uniformity of interstitial implants. The dose optimization increases not only the dose uniformity within the implant but

Electroless Formation of Hybrid Lithium Anodes for Fast Interfacial Ion Transport

KAUST Repository

Choudhury, Snehashis; Tu, Zhengyuan; Stalin, Sanjuna; Vu, Duylinh; Fawole, Kristen; Gunceler, Deniz; Sundararaman, Ravishankar; Archer, Lynden A.

2017-01-01

Rechargeable batteries based on metallic anodes are of interest for fundamental and application-focused studies of chemical and physical kinetics of liquids at solid interfaces. Approaches that allow facile creation of uniform coatings on these metals to prevent physical contact with liquid electrolytes, while enabling fast ion transport, are essential to address chemical instability of the anodes. Here, we report a simple electroless ion-exchange chemistry for creating coatings of indium on lithium. By means of joint density functional theory and interfacial characterization experiments, we show that In coatings stabilize Li by multiple processes, including exceptionally fast surface diffusion of lithium ions and high chemical resistance to liquid electrolytes. Indium coatings also undergo reversible alloying reactions with lithium ions, facilitating design of high-capacity hybrid In-Li anodes that use both alloying and plating approaches for charge storage. By means of direct visualization, we further show that the coatings enable remarkably compact and uniform electrodeposition. The resultant In-Li anodes are shown to exhibit minimal capacity fade in extended galvanostatic cycling when paired with commercial-grade cathodes.

Electroless Formation of Hybrid Lithium Anodes for Fast Interfacial Ion Transport

KAUST Repository

Choudhury, Snehashis

2017-08-17

Rechargeable batteries based on metallic anodes are of interest for fundamental and application-focused studies of chemical and physical kinetics of liquids at solid interfaces. Approaches that allow facile creation of uniform coatings on these metals to prevent physical contact with liquid electrolytes, while enabling fast ion transport, are essential to address chemical instability of the anodes. Here, we report a simple electroless ion-exchange chemistry for creating coatings of indium on lithium. By means of joint density functional theory and interfacial characterization experiments, we show that In coatings stabilize Li by multiple processes, including exceptionally fast surface diffusion of lithium ions and high chemical resistance to liquid electrolytes. Indium coatings also undergo reversible alloying reactions with lithium ions, facilitating design of high-capacity hybrid In-Li anodes that use both alloying and plating approaches for charge storage. By means of direct visualization, we further show that the coatings enable remarkably compact and uniform electrodeposition. The resultant In-Li anodes are shown to exhibit minimal capacity fade in extended galvanostatic cycling when paired with commercial-grade cathodes.

Spatially distributed characterization of hyporheic solute transport during baseflow recession in a headwater mountain stream using electrical geophysical imaging

Science.gov (United States)

Adam S. Ward; Michael N. Gooseff; Michael Fitzgerald; Thomas J. Voltz; Kamini Singha

2014-01-01

The transport of solutes along hyporheic flowpaths is recognized as central to numerous biogeochemical cycles, yet our understanding of how this transport changes with baseflow recession, particularly in a spatially distributed manner, is limited. We conducted four steady-state solute tracer injections and collected electrical resistivity data to characterize hyporheic...

Laboratory dust generation and size-dependent characterization of metal and metalloid-contaminated mine tailings deposits

Energy Technology Data Exchange (ETDEWEB)

Gonzales, Patricia; Felix, Omar [Department of Chemical and Environmental Engineering, University of Arizona, 1133 E. James E. Rogers Way, Tucson, AZ 85721 (United States); Alexander, Caitlin; Lutz, Eric [Division of Community, Environment, and Policy, Mel and Enid Zuckerman College of Public Health, University of Arizona, 1656 E. Mabel St., Tucson, AZ 85724 (United States); Ela, Wendell [Department of Chemical and Environmental Engineering, University of Arizona, 1133 E. James E. Rogers Way, Tucson, AZ 85721 (United States); Eduardo Sáez, A., E-mail: esaez@arizona.edu [Department of Chemical and Environmental Engineering, University of Arizona, 1133 E. James E. Rogers Way, Tucson, AZ 85721 (United States)

2014-09-15

Highlights: • A laboratory dust fractionator was developed for the production of respirable dust. • The size-dependent distribution of arsenic and lead in mine tailings dust is reported. • Metal and metalloid contaminants are enriched in particles smaller than 10 μm. • Lead isotope signatures show spread of mine tailings particles onto surrounding soils. - Abstract: The particle size distribution of mine tailings material has a major impact on the atmospheric transport of metal and metalloid contaminants by dust. Implications to human health should be assessed through a holistic size-resolved characterization involving multidisciplinary research, which requires large uniform samples of dust that are difficult to collect using conventional atmospheric sampling instruments. To address this limitation, we designed a laboratory dust generation and fractionation system capable of producing several grams of dust from bulk materials. The equipment was utilized in the characterization of tailings deposits from the arsenic and lead-contaminated Iron King Superfund site in Dewey-Humboldt, Arizona. Results show that metal and metalloid contaminants are more concentrated in particles of <10 μm aerodynamic diameter, which are likely to affect surrounding communities and ecosystems. In addition, we traced the transport of contaminated particles from the tailings to surrounding soils by identifying Pb and Sr isotopic signatures in soil samples. The equipment and methods developed for this assessment ensure uniform samples for further multidisciplinary studies, thus providing a tool for comprehensive representation of emission sources and associated risks of exposure.

Laboratory dust generation and size-dependent characterization of metal and metalloid-contaminated mine tailings deposits

International Nuclear Information System (INIS)

Gonzales, Patricia; Felix, Omar; Alexander, Caitlin; Lutz, Eric; Ela, Wendell; Eduardo Sáez, A.

2014-01-01

Highlights: • A laboratory dust fractionator was developed for the production of respirable dust. • The size-dependent distribution of arsenic and lead in mine tailings dust is reported. • Metal and metalloid contaminants are enriched in particles smaller than 10 μm. • Lead isotope signatures show spread of mine tailings particles onto surrounding soils. - Abstract: The particle size distribution of mine tailings material has a major impact on the atmospheric transport of metal and metalloid contaminants by dust. Implications to human health should be assessed through a holistic size-resolved characterization involving multidisciplinary research, which requires large uniform samples of dust that are difficult to collect using conventional atmospheric sampling instruments. To address this limitation, we designed a laboratory dust generation and fractionation system capable of producing several grams of dust from bulk materials. The equipment was utilized in the characterization of tailings deposits from the arsenic and lead-contaminated Iron King Superfund site in Dewey-Humboldt, Arizona. Results show that metal and metalloid contaminants are more concentrated in particles of <10 μm aerodynamic diameter, which are likely to affect surrounding communities and ecosystems. In addition, we traced the transport of contaminated particles from the tailings to surrounding soils by identifying Pb and Sr isotopic signatures in soil samples. The equipment and methods developed for this assessment ensure uniform samples for further multidisciplinary studies, thus providing a tool for comprehensive representation of emission sources and associated risks of exposure

Quantum transport in d -dimensional lattices

International Nuclear Information System (INIS)

Manzano, Daniel; Chuang, Chern; Cao, Jianshu

2016-01-01

We show that both fermionic and bosonic uniform d -dimensional lattices can be reduced to a set of independent one-dimensional chains. This reduction leads to the expression for ballistic energy fluxes in uniform fermionic and bosonic lattices. By the use of the Jordan–Wigner transformation we can extend our analysis to spin lattices, proving the coexistence of both ballistic and non-ballistic subspaces in any dimension and for any system size. We then relate the nature of transport to the number of excitations in the homogeneous spin lattice, indicating that a single excitation always propagates ballistically and that the non-ballistic behaviour of uniform spin lattices is a consequence of the interaction between different excitations. (paper)

Experimental study on the CHF in uniformly and non-uniformly heated vertical annuli

Energy Technology Data Exchange (ETDEWEB)

Chun, Se Young; Moon, Sang Ki; Chung, Heung June; Park, Jong Kuk; Kim, Bok Deuk; Youn, Young Jung; Chung, Moon Ki

2001-09-01

Up to now, KAERI has performed critical heat flux experiments in water under zero-flow and low-flow conditions using a RCS CHF loop facility with uniformly and non-uniformly heated vertical annulus. Since the existing CHF experiments were mainly performed under low-pressure conditions, we performed the CHF experiment to investigate the pressure effect on the CHF under zero-flow and low-flow conditions for a wide range of system pressures. Also, two vertical annuli with the same geometry have been used to investigate the axial heat flux distributions on the CHF. This report summarizes the experimental results and provides the CHF data that can be used for the development for CHF correlation and a thermal hydraulic analysis code. The CHF data have been collected for system pressures ranging from 0.57 to 15.15 MPa, mass flux 0 and from 200 to 650 kg/m2s, inlet subcooling from 75 to 360 kJ/kg and exit quality from 0.07 to 0.57. At low-flow conditions, the total number of data are 242 and 290 with uniformly heated- and non-uniformly heated test sections, respectively. 41 and 94 CHF data are generated with uniformly heated- and non-uniformly heated test sections, respectively, in zero-flow CHF experiments that are performed by blocking test section bottoms. The CHF experiment result shows that the effects of system pressure, mass flux and inlet subcooling are consistent with conventional understandings and similar to those for round tubes. The behavior of the CHF is relatively complex at low pressures. Also, the effects of axial heat flux profile are large at low-pressure conditions.

Experimental study on the CHF in uniformly and non-uniformly heated vertical annuli

International Nuclear Information System (INIS)

Chun, Se Young; Moon, Sang Ki; Chung, Heung June; Park, Jong Kuk; Kim, Bok Deuk; Youn, Young Jung; Chung, Moon Ki

2001-09-01

Up to now, KAERI has performed critical heat flux experiments in water under zero-flow and low-flow conditions using a RCS CHF loop facility with uniformly and non-uniformly heated vertical annulus. Since the existing CHF experiments were mainly performed under low-pressure conditions, we performed the CHF experiment to investigate the pressure effect on the CHF under zero-flow and low-flow conditions for a wide range of system pressures. Also, two vertical annuli with the same geometry have been used to investigate the axial heat flux distributions on the CHF. This report summarizes the experimental results and provides the CHF data that can be used for the development for CHF correlation and a thermal hydraulic analysis code. The CHF data have been collected for system pressures ranging from 0.57 to 15.15 MPa, mass flux 0 and from 200 to 650 kg/m2s, inlet subcooling from 75 to 360 kJ/kg and exit quality from 0.07 to 0.57. At low-flow conditions, the total number of data are 242 and 290 with uniformly heated- and non-uniformly heated test sections, respectively. 41 and 94 CHF data are generated with uniformly heated- and non-uniformly heated test sections, respectively, in zero-flow CHF experiments that are performed by blocking test section bottoms. The CHF experiment result shows that the effects of system pressure, mass flux and inlet subcooling are consistent with conventional understandings and similar to those for round tubes. The behavior of the CHF is relatively complex at low pressures. Also, the effects of axial heat flux profile are large at low-pressure conditions

Monitoring and characterization of radionuclide transport in the hydrogeologic system

International Nuclear Information System (INIS)

Phillips, S.J.; Raymond, J.R.

1975-01-01

Historical records pertaining to the 300 North and Wye Burial Grounds at the Hanford Reservation were reviewed as a prerequisite to determining programs for land reclamation. All available historical documents, agency communications, and engineering drawings related to the study areas were located, reviewed, and analyzed. An inventory of recorded location, type, and quantity of radionuclides and associated materials in each burial ground was completed and distributed to cooperating investigators. A geophysical survey of the 300 North Burial Ground was conducted as a basis for detecting the composition, size, distribution, and depth of buried objects and characterizing the sediments in which they are buried. Acoustic, radar, magnetic, and metal detection surveys were completed and their applicability evaluated; drilling techniques and equipment for recovering and characterizing sediments and radioactive contaminated material were developed. Drilling will also determine the amount and dimensional extent of radionuclide migration; sediment-fluid interaction and fluid migration through the unsaturated zone at the 300 North Burial Ground were characterized. A study to determine biological transport of radionuclides at the Wye Burial Ground was also initiated. This study involved a preliminary survey of present flora and fauna inhabiting the Wye Burial Ground site. Plant tissue was chemically and radiochemically analyzed to determine radionuclide migration and possible dose effects and population dynamics of burrowing animals that could potentially be exposed to buried waste materials were investigated

Quality assurance inspections in the transportation packaging supplier industry

International Nuclear Information System (INIS)

Jankovich, J.P.

1991-01-01

In this paper the quality assurance inspections of the transportation packaging supplier industry, conducted by the U.S. Nuclear Regulatory Commission (NRC) on a routine basis since 1989 are discussed. The term supplier is used to include designers, fabricators, and distributors that hold NRC approved Quality Assurance Programs and Certificates of Compliance for packagings to transport radioactive materials. The objective of the inspections is to provide assurance that transportation packagings are fabricated and procured in accordance with 10 CFR Parts 21 and 71 requirements. The inspections are conducted in a systematic and comprehensive manner, utilizing uniform inspection techniques in order to assure uniformity and comparability. During the April 1989 and May 1991 period approximately 21 inspections were conducted by the Transportation Branch, Office of Nuclear Material Safety and Safeguards of the NRC. The majority of the findings were identified in the areas of quality assurance procedures, control of special processes (e.g. welding, radiography), and maintenance of QA records

Fokker-Planck equation in the presence of a uniform magnetic field

International Nuclear Information System (INIS)

Dong, Chao; Zhang, Wenlu; Li, Ding

2016-01-01

The Fokker-Planck equation in the presence of a uniform magnetic field is derived which has the same form as the case of no magnetic field but with different Fokker-Planck coefficients. The coefficients are calculated explicitly within the binary collision model, which are free from infinite sums of Bessel functions. They can be used to investigate relaxation and transport phenomena conveniently. The kinetic equation is also manipulated into the Landau form from which it is straightforward to compare with previous results and prove the conservation laws.

Fokker-Planck equation in the presence of a uniform magnetic field

Energy Technology Data Exchange (ETDEWEB)

Dong, Chao, E-mail: chaodong@iphy.ac.cn [Center for Plasma Theory and Computation, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Department of Nuclear Engineering, Seoul National University, Seoul 151-744 (Korea, Republic of); Zhang, Wenlu [Center for Plasma Theory and Computation, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Li, Ding, E-mail: dli@ustc.edu.cn [Center for Plasma Theory and Computation, Institute of Physics, Chinese Academy of Sciences, Beijing 100190 (China); Department of Modern Physics, University of Science and Technology of China, Anhui Hefei 230026 (China)

2016-08-15

The Fokker-Planck equation in the presence of a uniform magnetic field is derived which has the same form as the case of no magnetic field but with different Fokker-Planck coefficients. The coefficients are calculated explicitly within the binary collision model, which are free from infinite sums of Bessel functions. They can be used to investigate relaxation and transport phenomena conveniently. The kinetic equation is also manipulated into the Landau form from which it is straightforward to compare with previous results and prove the conservation laws.

School Uniforms. Research Brief

Science.gov (United States)

Walker, Karen

2007-01-01

Does clothing make the person or does the person make the clothing? How does what attire a student wears to school affect their academic achievement? In 1996, President Clinton cited examples of school violence and discipline issues that might have been avoided had the students been wearing uniforms ("School uniforms: Prevention or suppression?").…

Development of electrochemical supercapacitors with uniform nanoporous silver network

International Nuclear Information System (INIS)

Li, Rui; Liu, Xiongjun; Wang, Hui; Wu, Yuan; Lu, Z.P.

2015-01-01

Metal oxides such as manganese dioxide (MnO 2 ) are often used as electrode materials for supercapacitors due to their high specific capacitance. In practice, however, their specific capacitance is much smaller than the theoretical limit due to the low electrical conductivity and serious agglomeration. In the present work, we demonstrate that highly conductive nanoporous silver (NPS) network with uniform continuous nanoporosity and high surface area which was fabricated by dealloying Ag-Mg-Ca metallic glasses can be employed as supports and collectors for MnO 2 capacitors. By plating the MnO 2 nanocrystals into the nanopore structure, the NPS/MnO 2 composite electrode provides fast ionic conduction and excellent electron-proton transport, resulting in an ultrahigh specific capacitance of the plated active MnO 2 (∼1088 F g −1 ), which is close to the theoretical limit. The unique combination of high specific capacitance and long cycle life enhanced by the current composite structure makes the NPS/MnO 2 composite promising for electrochemical supercapacitor as electrode material. In addition, our findings suggest that the uniform NPS network is capable for improving capacitance performance of metal oxides in electrochemical supercapacitors.

Facile synthesis of uniform MWCNT@Si nanocomposites as high-performance anode materials for lithium-ion batteries

Energy Technology Data Exchange (ETDEWEB)

Chen, Yifan; Du, Ning, E-mail: dna1122@zju.edu.cn; Zhang, Hui; Yang, Deren

2015-02-15

Highlights: • A uniform SiO{sub 2} layer was deposited on multi-walled carbon nanotube. • Synthesis of uniform (MWCNT)@Si nanocomposites via the magnesiothermic reduction. • The MWCNT@Si nanocomposites show high reversible capacity and good cyclability. • Enhanced performance is attributed to porous nanostructure, introduction of MWCNTs. - Abstract: We demonstrate the synthesis of uniform multi-walled carbon nanotube (MWCNT)@Si nanocomposites via the magnesiothermic reduction of pre-synthesized MWCNT@SiO{sub 2} nanocables. At first, the acid vapor steaming is used to treat the surface, which can facilitate the uniform deposition of SiO{sub 2} layer via the TEOS hydrolysis. Then, the uniform MWCNT@Si nanocomposites are obtained on the basis of MWCNT@SiO{sub 2} nanocables via a simple magnesiothermic reduction. When used as an anode material for lithium-ion batteries, the as-synthesized MWCNT@Si nanocomposites show high reversible capacity and good cycling performance, which is better than bulk Si and bare MWCNTs. It is believed that the good electrochemical performance can be attributed to the novel porous nanostructure and the introduction of MWCNTs that can buffer the volume change, maintain the electrical conductive network, and enhance the electronic conductivity and lithium-ion transport.

Uniform Foam Crush Testing for Multi-Mission Earth Entry Vehicle Impact Attenuation

Science.gov (United States)

Patterson, Byron W.; Glaab, Louis J.

2012-01-01

Multi-Mission Earth Entry Vehicles (MMEEVs) are blunt-body vehicles designed with the purpose of transporting payloads from outer space to the surface of the Earth. To achieve high-reliability and minimum weight, MMEEVs avoid use of limited-reliability systems, such as parachutes and retro-rockets, instead using built-in impact attenuators to absorb energy remaining at impact to meet landing loads requirements. The Multi-Mission Systems Analysis for Planetary Entry (M-SAPE) parametric design tool is used to facilitate the design of MMEEVs and develop the trade space. Testing was conducted to characterize the material properties of several candidate impact foam attenuators to enhance M-SAPE analysis. In the current effort, four different Rohacell foams are tested at three different, uniform, strain rates (approximately 0.17, approximately 100, approximately 13,600%/s). The primary data analysis method uses a global data smoothing technique in the frequency domain to remove noise and system natural frequencies. The results from the data indicate that the filter and smoothing technique are successful in identifying the foam crush event and removing aberrations. The effect of strain rate increases with increasing foam density. The 71-WF-HT foam may support Mars Sample Return requirements. Several recommendations to improve the drop tower test technique are identified.

An integrated methodology for characterizing flow and transport processes in fractured rock

International Nuclear Information System (INIS)

Wu, Yu-Shu

2007-01-01

To investigate the coupled processes involved in fluid and heat flow and chemical transport in the highly heterogeneous, unsaturated-zone (UZ) fractured rock of Yucca Mountain, we present an integrated modeling methodology. This approach integrates a wide variety of moisture, pneumatic, thermal, and geochemical isotopic field data into a comprehensive three-dimensional numerical model for modeling analyses. The results of field applications of the methodology show that moisture data, such as water potential and liquid saturation, are not sufficient to determine in situ percolation flux, whereas temperature and geochemical isotopic data provide better constraints to net infiltration rates and flow patterns. In addition, pneumatic data are found to be extremely valuable in estimating large-scale fracture permeability. The integration of hydrologic, pneumatic, temperature, and geochemical data into modeling analyses is thereby demonstrated to provide a practical modeling approach for characterizing flow and transport processes in complex fractured formations

Ultimate intra-wafer critical dimension uniformity control by using lithography and etch tool corrections

Science.gov (United States)

Kubis, Michael; Wise, Rich; Reijnen, Liesbeth; Viatkina, Katja; Jaenen, Patrick; Luca, Melisa; Mernier, Guillaume; Chahine, Charlotte; Hellin, David; Kam, Benjamin; Sobieski, Daniel; Vertommen, Johan; Mulkens, Jan; Dusa, Mircea; Dixit, Girish; Shamma, Nader; Leray, Philippe

2016-03-01

With shrinking design rules, the overall patterning requirements are getting aggressively tighter. For the 7-nm node and below, allowable CD uniformity variations are entering the Angstrom region (ref [1]). Optimizing inter- and intra-field CD uniformity of the final pattern requires a holistic tuning of all process steps. In previous work, CD control with either litho cluster or etch tool corrections has been discussed. Today, we present a holistic CD control approach, combining the correction capability of the etch tool with the correction capability of the exposure tool. The study is done on 10-nm logic node wafers, processed with a test vehicle stack patterning sequence. We include wafer-to-wafer and lot-to-lot variation and apply optical scatterometry to characterize the fingerprints. Making use of all available correction capabilities (lithography and etch), we investigated single application of exposure tool corrections and of etch tool corrections as well as combinations of both to reach the lowest CD uniformity. Results of the final pattern uniformity based on single and combined corrections are shown. We conclude on the application of this holistic lithography and etch optimization to 7nm High-Volume manufacturing, paving the way to ultimate within-wafer CD uniformity control.

The mathematical description of uniformity and related theorems

International Nuclear Information System (INIS)

Luo Chuanwen; Yi Chundi; Wang Gang; Li Longsuo; Wang Chuncheng

2009-01-01

Uniform index is a conception that can describe the uniformity of a finite point set in a polyhedron, and is closely related to chaos. In order to study uniform index, the concept of contained uniform index is defined, which is similar to uniform index and has good mathematical properties. In this paper, we prove the convergence of the contained uniform index, and develop the base of proving the convergence of uniform index.

Downstream lightening and upward heavying, sorting of sediments of uniform grain size but differing in density

Science.gov (United States)

Viparelli, E.; Solari, L.; Hill, K. M.

2014-12-01

Downstream fining, i.e. the tendency for a gradual decrease in grain size in the downstream direction, has been observed and studied in alluvial rivers and in laboratory flumes. Laboratory experiments and field observations show that the vertical sorting pattern over a small Gilbert delta front is characterized by an upward fining profile, with preferential deposition of coarse particles in the lowermost part of the deposit. The present work is an attempt to answer the following questions. Are there analogous sorting patterns in mixtures of sediment particles having the same grain size but differing density? To investigate this, we performed experiments at the Hydrosystems Laboratory at the University of Illinois at Urbana-Champaign. During the experiments a Gilbert delta formed and migrated downstream allowing for the study of transport and sorting processes on the surface and within the deposit. The experimental results show 1) preferential deposition of heavy particles in the upstream part of the deposit associated with a pattern of "downstream lightening"; and 2) a vertical sorting pattern over the delta front characterized by a pattern of "upward heavying" with preferential deposition of light particles in the lowermost part of the deposit. The observed downstream lightening is analogous of the downstream fining with preferential deposition of heavy (coarse) particles in the upstream part of the deposit. The observed upward heavying was unexpected because, considering the particle mass alone, the heavy (coarse) particles should have been preferentially deposited in the lowermost part of the deposit. Further, the application of classical fractional bedload transport relations suggests that in the case of mixtures of particles of uniform size and different densities equal mobility is not approached. We hypothesize that granular physics mechanisms traditionally associated with sheared granular flows may be responsible for the observed upward heavying and for the

Facile Fabrication of Uniform Polyaniline Nanotubes with Tubular Aluminosilicates as Templates

OpenAIRE

Zhang, Long; Liu, Peng

2008-01-01

AbstractThe uniform polyaniline (PANI) nanotubes, with inner diameter, outer diameter, and tubular thickness of 40, 60, and 10 nm, respectively, were prepared successfully by using natural tubular aluminosilicates as templates. The halloysite nanotubes were coated with PANI via the in situ chemical oxidation polymerization. Then the templates were etched with HCl/HF solution. The PANI nanotubes were characterized using FTIR, X-ray diffraction, and transmission electron microscopy. The conduct...

78 FR 60755 - Hazardous Materials: Enhanced Enforcement Procedures-Resumption of Transportation

Science.gov (United States)

2013-10-02

... material,'' we envisioned etiological agents, such as biological products, infectious substances, medical... accidents or incidents involving the transportation of hazardous material. In order to achieve a uniform... DEPARTMENT OF TRANSPORTATION Pipeline and Hazardous Materials Safety Administration 49 CFR Part...

FRACTEX: an experiment aiming at characterizing the transport properties of a secondary fault

International Nuclear Information System (INIS)

Wittebroodt, C.; Matray, J.M.; Dick, P.; Cabrera, J.; Barnichon, J.D.

2012-01-01

Document available in extended abstract form only. Because of their favourable transport and retention properties, argillaceous rocks are considered as potential host rocks for radioactive waste repositories. At the request of the French Authority of Nuclear Safety (ASN), the French Institute for Radioprotection and Nuclear Safety (IRSN) is in charge of an independent expertise of the French industrial (Andra's) project. Therefore, IRSN develops experimental research programs in such geological formations at the Tournemire Underground Research Laboratory (URL, Aveyron, France). One of the objectives of this project is to evaluate the occurrence and the driving processes controlling the radionuclide migration through an argillaceous formation similar to those studied elsewhere for nuclear waste disposal. Since undisturbed argillaceous rocks display very low values for both hydraulic conductivity (K h ) and water content (θ e ), diffusion is considered to be the main transport mechanism governing radionuclide migration through the argillite. On the other hand, in the presence of fracture in the argillaceous formation, the flux of water through this preferential pathway could dramatically accelerate the migration of the radionuclide it contains. Thus, the implementation of a radwaste disposal facility requires a precise sedimentary and structural characterization of the preselected site to guarantee the presence of a regular, homogenous and fault-free clay layer over a large area and so to determine its ability to ensure an effective radionuclide confinement. The site characterization and fracture detection can be performed using complementary approaches such as geological studies, in situ measurements and non-destructive geophysical methods. In order to evaluate both the capacity and the limit of these seismic methods to detect a secondary fault in an argillaceous media, IRSN performed a 3D HR seismic survey from the surface of its Tournemire URL. Due to the weak

Preparation and characterization of uniform-sized chitosan/silver microspheres with antibacterial activities

Energy Technology Data Exchange (ETDEWEB)

An, Jing; Ji, Zhenxing; Wang, Desong, E-mail: dswang06@126.com; Luo, Qingzhi; Li, Xueyan

2014-03-01

The chitosan/silver microspheres (CAgMs), which possess effective inhibitory on microorganisms, were prepared by an inverse-emulsification cross-linking method using CS/Ag sol as dispersed phase, whiteruss as continuous phase, and glutaraldehyde as crosslinking agent. The size and shape of CAgMs, greatly affecting their antibacterial activities, were controlled by varying the concentrations of cross-linking agent, emulsifier and CS/Ag colloid. The preparation conditions for obtaining uniform-sized microspheres were optimized. The morphology of CAgMs was characterized by scanning electron microscopy (SEM) and laser particle size analysis. The spherical CAgMs with smooth surface in the mean size of ca. 5 μm exhibited a narrow particle size distribution. Energy Dispersive X-ray spectroscopy (EDX) revealed the elemental composition of the microspheres. Transmission electron micrographs (TEM) and Fourier transform infrared spectroscopy (FTIR) of the microspheres confirmed the formation of silver nanoparticles (AgNPs). The X-ray diffraction (XRD) patterns and UV–Visible diffuse reflectance spectroscopy (UV–vis DRS) of the sample showed that AgNPs with the diameter no more than 20 nm were face-centered cubic crystallites. X-ray photoelectron spectroscopy (XPS) proved that Ag-O bond existed in the microspheres. Thermogravimetric analysis (TGA) showed that the starting decomposition temperature of CAgMs (ca. 260 °C) was much higher than that of CS (ca. 160 °C), suggesting that the as-prepared CAgMs possessed better thermal stability than original CS did. Antimicrobial assays were performed using typical Gram bacteria and fungi. The inhibitory effect indicated that the as-prepared microspheres exerted a stronger antibacterial activity as the concentration of the AgNPs is increasing, and the microspheres in smaller size had much better antibacterial activity than those in the larger size. The antimicrobial mechanism of CAgMs was discussed. - Highlights: • CAgM was

Uniform Statistical Convergence on Time Scales

Directory of Open Access Journals (Sweden)

Yavuz Altin

2014-01-01

Full Text Available We will introduce the concept of m- and (λ,m-uniform density of a set and m- and (λ,m-uniform statistical convergence on an arbitrary time scale. However, we will define m-uniform Cauchy function on a time scale. Furthermore, some relations about these new notions are also obtained.

Analysis of influence of the radial electric field on turbulent transport in tandem mirror plasma

International Nuclear Information System (INIS)

Khvesyuk, Vladimir I.; Chirkov, Alexei Yu.; Pshenichnikov, Anton A.

2000-01-01

The model of anomalous transport in cylindrical non-uniform steady state plasma in uniform magnetic field under the influence of many mode drift wave oscillations is suggested. The effect of anomalous transport suppression due to radial electric field is studied, and physical picture of H mode in plasma of GAMMA-10 tandem mirror device is considered. Presented theoretical and numerical results agree with the experimental data obtained on GAMMA-10. (author)

Controlling of density uniformity of polyacrylate foams

International Nuclear Information System (INIS)

Shan Wenwen; Yuan Baohe; Wang Yanhong; Xu Jiayun; Zhang Lin

2010-01-01

The density non-uniformity existing in most low-density foams will affect performance of the foams. The trimethylolpropane trimethacrylate (TMPTA) foam targets were prepared and controlling methods of the foams, density uniformity were explored together with its forming mechanism. It has been found that the UV-light with high intensity can improve the distribution uniformity of the free radicals induced by UV photons in the solvents, thus improve the density uniformity of the foams. In addition, container wall would influence the concentration distribution of the solution, which affects the density uniformity of the foams. Thus, the UV-light with high intensity was chosen together with polytetrafluoroethylene molds instead of glass molds to prepare the foams with the density non-uniformity less than 10%. β-ray detection technology was used to measure the density uniformity of the TMPTA foams with the density in the range of 10 to 100 mg · cm -3 , and the results show that the lower the foam density is, the worse the density uniformity is. (authors)

Thermal transport characterization of hexagonal boron nitride nanoribbons using molecular dynamics simulation

Directory of Open Access Journals (Sweden)

Asir Intisar Khan

2017-10-01

Full Text Available Due to similar atomic bonding and electronic structure to graphene, hexagonal boron nitride (h-BN has broad application prospects such as the design of next generation energy efficient nano-electronic devices. Practical design and efficient performance of these devices based on h-BN nanostructures would require proper thermal characterization of h-BN nanostructures. Hence, in this study we have performed equilibrium molecular dynamics (EMD simulation using an optimized Tersoff-type interatomic potential to model the thermal transport of nanometer sized zigzag hexagonal boron nitride nanoribbons (h-BNNRs. We have investigated the thermal conductivity of h-BNNRs as a function of temperature, length and width. Thermal conductivity of h-BNNRs shows strong temperature dependence. With increasing width, thermal conductivity increases while an opposite pattern is observed with the increase in length. Our study on h-BNNRs shows considerably lower thermal conductivity compared to GNRs. To elucidate these aspects, we have calculated phonon density of states for both h-BNNRs and GNRs. Moreover, using EMD we have explored the impact of different vacancies, namely, point vacancy, edge vacancy and bi-vacancy on the thermal conductivity of h-BNNRs. With varying percentages of vacancies, significant reduction in thermal conductivity is observed and it is found that, edge and point vacancies are comparatively more destructive than bi-vacancies. Such study would contribute further into the growing interest for accurate thermal transport characterization of low dimensional nanostructures.

Characterization of putative multidrug resistance transporters of the major facilitator-superfamily expressed in Salmonella Typhi

DEFF Research Database (Denmark)

Shaheen, Aqsa; Ismat, Fouzia; Iqbal, Mazhar

2015-01-01

Multidrug resistance mediated by efflux pumps is a well-known phenomenon in infectious bacteria. Although much work has been carried out to characterize multidrug efflux pumps in Gram-negative and Gram-positive bacteria, such information is still lacking for many deadly pathogens. The aim...... of this study was to gain insight into the substrate specificity of previously uncharacterized transporters of Salmonella Typhi to identify their role in the development of multidrug resistance. S. Typhi genes encoding putative members of the major facilitator superfamily were cloned and expressed in the drug......-hypersensitive Escherichia coli strain KAM42, and tested for transport of 25 antibacterial compounds, including representative antibiotics of various classes, antiseptics, dyes and detergents. Of the 15 tested putative transporters, STY0901, STY2458 and STY4874 exhibited a drug-resistance phenotype. Among these, STY4874...

SITE-94. CAMEO: A model of mass-transport limited general corrosion of copper canisters

International Nuclear Information System (INIS)

Worgan, K.J.; Apted, M.J.

1996-12-01

This report describes the technical basis for the CAMEO code, which models the general, uniform corrosion of a copper canister either by transport of corrodants to the canister, or by transport of corrosion products away from the canister. According to the current Swedish concept for final disposal of spent nuclear fuels, extremely long containment times are achieved by thick (60-100 mm) copper canisters. Each canister is surrounded by a compacted bentonite buffer, located in a saturated, crystalline rock at a depth of around 500 m below ground level. Three diffusive transport-limited cases are identified for general, uniform corrosion of copper: General corrosion rate-limited by diffusive mass-transport of sulphide to the canister surface under reducing conditions; General corrosion rate-limited by diffusive mass-transport of oxygen to the canister surface under mildly oxidizing conditions; General corrosion rate-limited by diffusive mass-transport of copper chloride away from the canister surface under highly oxidizing conditions. The CAMEO code includes general corrosion models for each of the above three processes. CAMEO is based on the well-tested CALIBRE code previously developed as a finite-difference, mass-transfer analysis code for the SKI to evaluate long-term radionuclide release and transport in the near-field. A series of scoping calculations for the general, uniform corrosion of a reference copper canister are presented

Morphological, Chemical Surface, and Diffusive Transport Characterizations of a Nanoporous Alumina Membrane

Directory of Open Access Journals (Sweden)

María I. Vázquez

2015-12-01

Full Text Available Synthesis of a nanoporous alumina membrane (NPAM by the two-step anodization method and its morphological and chemical surface characterization by analyzing Scanning Electron Microscopy (SEM micrographs and X-Ray Photoelectron Spectroscopy (XPS spectra is reported. Influence of electrical and diffusive effects on the NaCl transport across the membrane nanopores is determined from salt diffusion measurements performed with a wide range of NaCl concentrations, which allows the estimation of characteristic electrochemical membrane parameters such as the NaCl diffusion coefficient and the concentration of fixed charges in the membrane, by using an appropriated model and the membrane geometrical parameters (porosity and pore length. These results indicate a reduction of ~70% in the value of the NaCl diffusion coefficient through the membrane pores with respect to solution. The transport number of ions in the membrane pores (Na+ and Cl−, respectively were determined from concentration potential measurements, and the effect of concentration-polarization at the membrane surfaces was also considered by comparing concentration potential values obtained with stirred solutions (550 rpm and without stirring. From both kinds of results, a value higher than 0.05 M NaCl for the feed solution seems to be necessary to neglect the contribution of electrical interactions in the diffusive transport.

Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression.

Science.gov (United States)

Shen, Hong; Liu, Tongtong; Morse, Bridget L; Zhao, Yue; Zhang, Yueping; Qiu, Xi; Chen, Cliff; Lewin, Anne C; Wang, Xi-Tao; Liu, Guowen; Christopher, Lisa J; Marathe, Punit; Lai, Yurong

2015-07-01

The contribution of organic anion transporter OAT2 (SLC22A7) to the renal tubular secretion of creatinine and its exact localization in the kidney are reportedly controversial. In the present investigation, the transport of creatinine was assessed in human embryonic kidney (HEK) cells that stably expressed human OAT2 (OAT2-HEK) and isolated human renal proximal tubule cells (HRPTCs). The tubular localization of OAT2 in human, monkey, and rat kidney was characterized. The overexpression of OAT2 significantly enhanced the uptake of creatinine in OAT2-HEK cells. Under physiologic conditions (creatinine concentrations of 41.2 and 123.5 µM), the initial rate of OAT2-mediated creatinine transport was approximately 11-, 80-, and 80-fold higher than OCT2, multidrug and toxin extrusion protein (MATE)1, and MATE2K, respectively, resulting in approximately 37-, 1850-, and 80-fold increase of the intrinsic transport clearance when normalized to the transporter protein concentrations. Creatinine intracellular uptake and transcellular transport in HRPTCs were decreased in the presence of 50 µM bromosulfophthalein and 100 µM indomethacin, which inhibited OAT2 more potently than other known creatinine transporters, OCT2 and multidrug and toxin extrusion proteins MATE1 and MATE2K (IC50: 1.3 µM vs. > 100 µM and 2.1 µM vs. > 200 µM for bromosulfophthalein and indomethacin, respectively) Immunohistochemistry analysis showed that OAT2 protein was localized to both basolateral and apical membranes of human and cynomolgus monkey renal proximal tubules, but appeared only on the apical membrane of rat proximal tubules. Collectively, the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

7 CFR 1006.61 - Computation of uniform prices.

Science.gov (United States)

2010-01-01

..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

7 CFR 1131.61 - Computation of uniform prices.

Science.gov (United States)

2010-01-01

..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

7 CFR 1007.61 - Computation of uniform prices.

Science.gov (United States)

2010-01-01

..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

Acceleration of Solar Energetic Particles at a Fast Traveling Shock in Non-uniform Coronal Conditions

Science.gov (United States)

Le Roux, J. A.; Arthur, A. D.

2017-09-01

Time-dependent solar energetic particle (SEP) acceleration is investigated at a fast, nearly parallel spherical traveling shock in the strongly non-uniform corona by solving the standard focused transport equation for SEPs and transport equations for parallel propagating Alfvén waves that form a set of coupled equations. This enables the modeling of self-excitation of Alfvén waves in the inertial range by SEPs ahead of the shock and its role in enhancing the efficiency of the diffusive shock acceleration (DSA) of SEPs in a self-regulatory fashion. Preliminary results suggest that, because of the highly non-uniform coronal conditions that the shock encounters, both DSA and wave excitation are highly time-dependent processes. Thus, DSA spectra of SEPs strongly deviate from the simple power-law prediction of standard steady-state DSA theory and initially strong wave excitation weakens rapidly. Consequently, the ability of DSA to produce high energy SEPs in the corona of ∼1 GeV, as observed in the strongest gradual SEP events, appears to be strongly curtailed at a fast nearly parallel shock, but further research is needed before final conclusions can be drawn.

Characterization of inorganic phosphate transport in the triple-negative breast cancer cell line, MDA-MB-231.

Science.gov (United States)

Russo-Abrahão, Thais; Lacerda-Abreu, Marco Antônio; Gomes, Tainá; Cosentino-Gomes, Daniela; Carvalho-de-Araújo, Ayra Diandra; Rodrigues, Mariana Figueiredo; Oliveira, Ana Carolina Leal de; Rumjanek, Franklin David; Monteiro, Robson de Queiroz; Meyer-Fernandes, José Roberto

2018-01-01

Recent studies demonstrate that interstitial inorganic phosphate is significantly elevated in the breast cancer microenvironment as compared to normal tissue. In addition it has been shown that breast cancer cells express high levels of the NaPi-IIb carrier (SLC34A2), suggesting that this carrier may play a role in breast cancer progression. However, the biochemical behavior of inorganic phosphate (Pi) transporter in this cancer type remains elusive. In this work, we characterize the kinetic parameters of Pi transport in the aggressive human breast cancer cell line, MDA-MB-231, and correlated Pi transport with cell migration and adhesion. We determined the influence of sodium concentration, pH, metabolic inhibitors, as well as the affinity for inorganic phosphate in Pi transport. We observed that the inorganic phosphate is dependent on sodium transport (K0,5 value = 21.98 mM for NaCl). Furthermore, the transport is modulated by different pH values and increasing concentrations of Pi, following the Michaelis-Menten kinetics (K0,5 = 0.08 mM Pi). PFA, monensin, furosemide and ouabain inhibited Pi transport, cell migration and adhesion. Taken together, these results showed that the uptake of Pi in MDA-MB-231 cells is modulated by sodium and by regulatory mechanisms of intracellular sodium gradient. General Significance: Pi transport might be regarded as a potential target for therapy against tumor progression.

Particle-in-cell simulation of electron trajectories and irradiation uniformity in an annular cathode high current pulsed electron beam source

Energy Technology Data Exchange (ETDEWEB)

Jiang, Wei; Wang, Langping, E-mail: aplpwang@hit.edu.cn; Zhou, Guangxue; Wang, Xiaofeng

2017-02-01

Highlights: • The transmission process of electrons and irradiation uniformity was simulated. • Influence of the irradiation parameters on irradiation uniformity are discussed. • High irradiation uniformity can be obtained in a wide processing window. - Abstract: In order to study electron trajectories in an annular cathode high current pulsed electron beam (HCPEB) source based on carbon fiber bunches, the transmission process of electrons emitted from the annular cathode was simulated using a particle-in-cell model with Monte Carlo collisions (PIC-MCC). The simulation results show that the intense flow of the electrons emitted from the annular cathode are expanded during the transmission process, and the uniformity of the electron distribution is improved in the transportation process. The irradiation current decreases with the irradiation distance and the pressure, and increases with the negative voltage. In addition, when the irradiation distance and the cathode voltage are larger than 40 mm and −15 kV, respectively, a uniform irradiation current distribution along the circumference of the anode can be obtained. The simulation results show that good irradiation uniformity of circular components can be achieved by this annular cathode HCPEB source.

7 CFR 1005.61 - Computation of uniform prices.

Science.gov (United States)

2010-01-01

... month, the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and...) and (a)(2) of this section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

Ion beam induced charge and cathodoluminescence imaging of response uniformity of CVD diamond radiation detectors

CERN Document Server

Sellin, P J; Galbiati, A; Maghrabi, M; Townsend, P D

2002-01-01

The uniformity of response of CVD diamond radiation detectors produced from high quality diamond film, with crystallite dimensions of >100 mu m, has been studied using ion beam induced charge imaging. A micron-resolution scanning alpha particle beam was used to produce maps of pulse height response across the device. The detectors were fabricated with a single-sided coplanar electrode geometry to maximise their sensitivity to the surface region of the diamond film where the diamond crystallites are highly ordered. High resolution ion beam induced charge images of single crystallites were acquired that demonstrate variations in intra-crystallite charge transport and the termination of charge transport at the crystallite boundaries. Cathodoluminescence imaging of the same crystallites shows an inverse correlation between the density of radiative centres and regions of good charge transport.

Characterization of transport phenomena in porous transport layers using X-ray microtomography

Science.gov (United States)

Hasanpour, S.; Hoorfar, M.; Phillion, A. B.

2017-06-01

Among different methods available for estimating the transport properties of porous transport layers (PTLs) of polymer electrolyte membrane fuel cells, X-ray micro computed tomography (X-μCT) imaging in combination with image-based numerical simulation has been recognized as a viable tool. In this study, four commercially-available single-layer and dual-layer PTLs are analyzed using this method in order to compare and contrast transport properties between different PTLs, as well as the variability within a single sheet. Complete transport property datasets are created for each PTL. The simulation predictions indicate that PTLs with high porosity show considerable variability in permeability and effective diffusivity, while PTLs with low porosity do not. Furthermore, it is seen that the Tomadakis-Sotirchos (TS) analytical expressions for porous media match the image-based simulations when porosity is relatively low but predict higher permeability and effective diffusivity for porosity values greater than 80%. Finally, the simulations show that cracks within MPL of dual-layer PTLs have a significant effect on the overall permeability and effective diffusivity of the PTLs. This must be considered when estimating the transport properties of dual-layer PTLs. These findings can be used to improve macro-scale models of product and reactant transport within fuel cells, and ultimately, fuel cell efficiency.

Label-free nanoscale characterization of red blood cell structure and dynamics using single-shot transport of intensity equation

Science.gov (United States)

Poola, Praveen Kumar; John, Renu

2017-10-01

We report the results of characterization of red blood cell (RBC) structure and its dynamics with nanometric sensitivity using transport of intensity equation microscopy (TIEM). Conventional transport of intensity technique requires three intensity images and hence is not suitable for studying real-time dynamics of live biological samples. However, assuming the sample to be homogeneous, phase retrieval using transport of intensity equation has been demonstrated with single defocused measurement with x-rays. We adopt this technique for quantitative phase light microscopy of homogenous cells like RBCs. The main merits of this technique are its simplicity, cost-effectiveness, and ease of implementation on a conventional microscope. The phase information can be easily merged with regular bright-field and fluorescence images to provide multidimensional (three-dimensional spatial and temporal) information without any extra complexity in the setup. The phase measurement from the TIEM has been characterized using polymeric microbeads and the noise stability of the system has been analyzed. We explore the structure and real-time dynamics of RBCs and the subdomain membrane fluctuations using this technique.

Characterization of the serotonin transporter knockout rat : A selective change in the functioning of the serotonergic system

NARCIS (Netherlands)

Homberg, J. R.; Olivier, J.D.A.; Smits, B. M. G.; Mul, J. D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O. F. M.; Cools, A. R.; Ronken, E; Cremers, Thomas; Schoffelmeere, A. N. M.; Ellenbroeik, B. A.; Cuppen, E.

2007-01-01

Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

Characterization of the serotonin transporter knockout rat: a selective change in the functioning of the serotonergic system.

NARCIS (Netherlands)

Homberg, J.R.; Olivier, J.D.A.; Smits, B.M.; Mul, J.D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O.F.; Cools, A.R.; Ronken, E.; Cremers, T.; Schoffelmeer, A.N.; Ellenbroek, B.A.; Cuppen, E.

2007-01-01

Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

Comparisons of uniform and discrete source distributions for use in bioassay laboratory performance testing

International Nuclear Information System (INIS)

Scherpelz, R.I.; MacLellan, J.A.

1987-09-01

The Pacific Northwest Laboratory (PNL) is sending a torso phantom with radioactive material uniformly distributed in the lungs to in vivo bioassay laboratories for analysis. Although the radionuclides ultimately chosen for the studies had relatively long half-lives, future accreditation testing will require repeated tests with short half-life test nuclides. Computer modeling was used to simulate the major components of the phantom. Radiation transport calculations were then performed using the computer models to calculate dose rates either 15 cm from the chest or at its surface. For 144 Ce and 60 Co, three configurations were used for the lung comparison tests. Calculations show that, for most detector positions, a single plug containing 40 K located in the back of the heart provides a good approximation to a uniform distribution of 40 K. The approximation would lead, however, to a positive bias for the detector reading if the detector were located at the chest surface near the center. Loading the 40 K in a uniform layer inside the chest wall is not a good approximation of the uniform distribution in the lungs, because most of the radionuclides would be situated close to the detector location and the only shielding would be the thickness of the chest wall. The calculated dose rates for 60 Co and 144 Ce were similar at all calculated reference points. 3 refs., 5 figs., 10 tabs

Study of the distribution of maxima and minima in multiple sequential images of uniformity; Estudio de la distribucion de maximos y minimos en multiples imagenes secuenciales de uniformidad

Energy Technology Data Exchange (ETDEWEB)

Llacer Martos, S.; Puchal Ane, R.

2011-07-01

To characterize the uniformity of a gamma camera extrinsic used integral uniformity coefficient is calculated with the value of two pixels, the maximum and minimum, single source acquisition of a flat and uniform. This method does not take into account the fact that if a gamma camera having a uniform response, the distribution of these items should be random. In this paper we study how these points are distributed in a succession of large numbers of uniform images.

Characterization of Contaminant Transport using Naturally-Occurring U-Series Disequilibria - Final Report

International Nuclear Information System (INIS)

Murrell, Michael T.; Ku, Teh-Lung

2001-01-01

The interactions of mixed wastes containing radionuclides with solid rock surface and the mobility of the radionuclides in aquifer systems depend not only on the chemistry of the nuclides and the physico-chemical effects of radioactive decay, but also on the site-specific hydrogeology. Thus, to characterize contaminant transport, it is best to cross-check figures derived from any small-scale laboratory experiments over limited times with that obtained from field-oriented, natural analog studies. We propose such a study using the naturally-occurring U and Th decay-series disequilibria. The work of ours and other researchers have shown that the parent/daughter disequilibrium patterns existing in groundwater systems can be modeled in terms of local nuclide mass balance to arrive at such information as the rock-water contact time (fluid flow) and rates of contaminant transport, taking into account the retardation effect due to nuclide/rock interaction contaminants at INEL by grouping them into three categories, represented by isotopes of (1) Th and Pa, (2) U and (3) Ra. Mass spectrometric measurements of these elements will be emphasized in order to minimize sample size requirements and to maximize precision. Results will form the data base for a model code for computing: (1) Fluid residence time (transport rates) in the basalt aquifers at various locations, (2) The in-situ adsorption and desorption rate constants, as well as the retardation factors, of various radionuclide wastes, and (3) Rock dissolution rate and its relation to preferential flow and contamination transport in the fractured rock

Design and characterization of a neutralized-transport experiment for heavy-ion fusion

Directory of Open Access Journals (Sweden)

Enrique Henestroza

2004-08-01

Full Text Available In heavy-ion inertial-confinement fusion systems, intense beams of ions must be transported from the exit of the final-focus magnet system through the fusion chamber to hit spots on the target with radii of about 2 mm. For the heavy-ion-fusion power-plant scenarios presently favored in the U.S., a substantial fraction of the ion-beam space charge must be neutralized during this final transport. The most effective neutralization technique found in numerical simulations is to pass each beam through a low-density plasma after the final focusing. To provide quantitative comparisons of these theoretical predictions with experiment, the Virtual National Laboratory for Heavy Ion Fusion has completed the construction and has begun experimentation with the neutralized-transport experiment. The experiment consists of three main sections, each with its own physics issues. The injector is designed to generate a very high-brightness, space-charge-dominated potassium beam, while still allowing variable perveance by a beam aperturing technique. The magnetic-focusing section, consisting of four pulsed quadrupoles, permits the study of magnet tuning, as well as the effects of phase-space dilution due to higher-order nonlinear fields. In the final section, the converging ion beam exiting the magnetic section is transported through a drift region with plasma sources for beam neutralization, and the final spot size is measured under various conditions of neutralization. In this paper, we discuss the design and characterization of the three sections in detail and present initial results from the experiment.

Characterization of chemical agent transport in paints.

Science.gov (United States)

Willis, Matthew P; Gordon, Wesley; Lalain, Teri; Mantooth, Brent

2013-09-15

A combination of vacuum-based vapor emission measurements with a mass transport model was employed to determine the interaction of chemical warfare agents with various materials, including transport parameters of agents in paints. Accurate determination of mass transport parameters enables the simulation of the chemical agent distribution in a material for decontaminant performance modeling. The evaluation was performed with the chemical warfare agents bis(2-chloroethyl) sulfide (distilled mustard, known as the chemical warfare blister agent HD) and O-ethyl S-[2-(diisopropylamino)ethyl] methylphosphonothioate (VX), an organophosphate nerve agent, deposited on to two different types of polyurethane paint coatings. The results demonstrated alignment between the experimentally measured vapor emission flux and the predicted vapor flux. Mass transport modeling demonstrated rapid transport of VX into the coatings; VX penetrated through the aliphatic polyurethane-based coating (100 μm) within approximately 107 min. By comparison, while HD was more soluble in the coatings, the penetration depth in the coatings was approximately 2× lower than VX. Applications of mass transport parameters include the ability to predict agent uptake, and subsequent long-term vapor emission or contact transfer where the agent could present exposure risks. Additionally, these parameters and model enable the ability to perform decontamination modeling to predict how decontaminants remove agent from these materials. Published by Elsevier B.V.

Desynchronization boost by non-uniform coordinated reset stimulation in ensembles of pulse-coupled neurons

Science.gov (United States)

Lücken, Leonhard; Yanchuk, Serhiy; Popovych, Oleksandr V.; Tass, Peter A.

2013-01-01

Several brain diseases are characterized by abnormal neuronal synchronization. Desynchronization of abnormal neural synchrony is theoretically compelling because of the complex dynamical mechanisms involved. We here present a novel type of coordinated reset (CR) stimulation. CR means to deliver phase resetting stimuli at different neuronal sub-populations sequentially, i.e., at times equidistantly distributed in a stimulation cycle. This uniform timing pattern seems to be intuitive and actually applies to the neural network models used for the study of CR so far. CR resets the population to an unstable cluster state from where it passes through a desynchronized transient, eventually resynchronizing if left unperturbed. In contrast, we show that the optimal stimulation times are non-uniform. Using the model of weakly pulse-coupled neurons with phase response curves, we provide an approach that enables to determine optimal stimulation timing patterns that substantially maximize the desynchronized transient time following the application of CR stimulation. This approach includes an optimization search for clusters in a low-dimensional pulse coupled map. As a consequence, model-specific non-uniformly spaced cluster states cause considerably longer desynchronization transients. Intriguingly, such a desynchronization boost with non-uniform CR stimulation can already be achieved by only slight modifications of the uniform CR timing pattern. Our results suggest that the non-uniformness of the stimulation times can be a medically valuable parameter in the calibration procedure for CR stimulation, where the latter has successfully been used in clinical and pre-clinical studies for the treatment of Parkinson's disease and tinnitus. PMID:23750134

Nanosecond laser texturing of uniformly and non-uniformly wettable micro structured metal surfaces for enhanced boiling heat transfer

Energy Technology Data Exchange (ETDEWEB)

Zupančič, Matevž, E-mail: matevz.zupancic@fs.uni-lj.si; Može, Matic; Gregorčič, Peter; Golobič, Iztok

2017-03-31

Highlights: • Surfaces with periodically changed wettability were produced by a ns marking laser. • Heat transfer was investigated on uniformly and non-uniformly wettable surfaces. • Microporous surfaces with non-uniform wettability enhance boiling heat transfer. • The most bubble nucleations were observed in the vicinity of the microcavities. • Results agree with the predictions of the nucleation criteria. - Abstract: Microstructured uniformly and non-uniformly wettable surfaces were created on 25-μm-thin stainless steel foils by laser texturing using a marking nanosecond Nd:YAG laser (λ = 1064 nm) and utilizing various laser fluences and scan line separations. High-speed photography and high-speed IR thermography were used to investigate nucleate boiling heat transfer on the microstructured surfaces. The most pronounced results were obtained on a surface with non-uniform microstructure and non-uniform wettability. The obtained results show up to a 110% higher heat transfer coefficients and 20–40 times higher nucleation site densities compared to the untextured surface. We show that the number of active nucleation sites is significantly increased in the vicinity of microcavities that appeared in areas with the smallest (10 μm) scan line separation. Furthermore, this confirms the predictions of nucleation criteria and proves that straightforward, cost-effective nanosecond laser texturing allows the production of cavities with diameters of up to a few micrometers and surfaces with non-uniform wettability. Additionally, this opens up important possibilities for a more deterministic control over the complex boiling process.

Electroless formation of hybrid lithium anodes for fast interfacial ion transport

Energy Technology Data Exchange (ETDEWEB)

Choudhury, Snehashis; Stalin, Sanjuna; Vu, Duylinh; Fawole, Kristen; Archer, Lynden A. [School of Chemical and Biomolecular Engineering, Cornell University, Ithaca, NY (United States); Tu, Zhengyuan [Department of Material Science and Engineering, Cornell University, Ithaca, NY (United States); Gunceler, Deniz [Department of Physics, Cornell University, Ithaca, NY (United States); Sundararaman, Ravishankar [Material Science and Engineering, Rensselaer Polytechnic Institute, Troy, NY (United States)

2017-10-09

Rechargeable batteries based on metallic anodes are of interest for fundamental and application-focused studies of chemical and physical kinetics of liquids at solid interfaces. Approaches that allow facile creation of uniform coatings on these metals to prevent physical contact with liquid electrolytes, while enabling fast ion transport, are essential to address chemical instability of the anodes. Here, we report a simple electroless ion-exchange chemistry for creating coatings of indium on lithium. By means of joint density functional theory and interfacial characterization experiments, we show that In coatings stabilize Li by multiple processes, including exceptionally fast surface diffusion of lithium ions and high chemical resistance to liquid electrolytes. Indium coatings also undergo reversible alloying reactions with lithium ions, facilitating design of high-capacity hybrid In-Li anodes that use both alloying and plating approaches for charge storage. By means of direct visualization, we further show that the coatings enable remarkably compact and uniform electrodeposition. The resultant In-Li anodes are shown to exhibit minimal capacity fade in extended galvanostatic cycling when paired with commercial-grade cathodes. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)

24 CFR 5.801 - Uniform financial reporting standards.

Science.gov (United States)

2010-04-01

... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Uniform financial reporting... and Urban Development GENERAL HUD PROGRAM REQUIREMENTS; WAIVERS Uniform Financial Reporting Standards § 5.801 Uniform financial reporting standards. (a) Applicability. This subpart H implements uniform...

Decidability of uniform recurrence of morphic sequences

OpenAIRE

Durand , Fabien

2012-01-01

We prove that the uniform recurrence of morphic sequences is decidable. For this we show that the number of derived sequences of uniformly recurrent morphic sequences is bounded. As a corollary we obtain that uniformly recurrent morphic sequences are primitive substitutive sequences.

Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric

International Nuclear Information System (INIS)

Silva Lobo, M.A. da; Kronemberger, B.M.E.

1989-01-01

Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs

Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

KAUST Repository

Scheu, Arne Hagen August

2017-05-01

Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

One-dimensional spatially dependent solute transport in semi ...

African Journals Online (AJOL)

Initially porous domain is considered solute free and the input source condition is ... parameters for description of solute transport in porous media. ... flow assuming uniform initial concentration with first and third type boundary conditions. Aral.

School uniforms: tradition, benefit or predicament?

OpenAIRE

Van Aardt, Annette Marie; Wilken, Ilani

2012-01-01

This article focuses on the controversies surrounding school uniforms. Roleplayers in this debate in South Africa are parents, learners and educators, and arguments centre on aspects such as identity, economy and the equalising effect of school uniforms, which are considered in the literature to be benefits. Opposing viewpoints highlight the fact that compulsory uniforms infringe on learners’ constitutional rights to self-expression. The aim of this research was to determine the perspectives ...

Cloning, characterization and tissue distribution of the rat ATP-binding cassette (ABC) transporter ABC2/ABCA2.

OpenAIRE

Zhao, L X; Zhou, C J; Tanaka, A; Nakata, M; Hirabayashi, T; Amachi, T; Shioda, S; Ueda, K; Inagaki, N

2000-01-01

The ABC1 (ABCA) subfamily of the ATP-binding cassette (ABC) transporter superfamily has a structural feature that distinguishes it from other ABC transporters. Here we report the cloning, molecular characterization and tissue distribution of ABC2/ABCA2, which belongs to the ABC1 subfamily. Rat ABC2 is a protein of 2434 amino acids that has 44.5%, 40.0% and 40.8% identity with mouse ABC1/ABCA1, human ABC3/ABCA3 and human ABCR/ABCA4 respectively. Immunoblot analysis showed that proteins of 260 ...

Progress in nano-electro optics characterization of nano-optical materials and optical near-field interactions

CERN Document Server

Ohtsu, Motoichi

2005-01-01

This volume focuses on the characterization of nano-optical materials and optical-near field interactions. It begins with the techniques for characterizing the magneto-optical Kerr effect and continues with methods to determine structural and optical properties in high-quality quantum wires with high spatial uniformity. Further topics include: near-field luminescence mapping in InGaN/GaN single quantum well structures in order to interpret the recombination mechanism in InGaN-based nano-structures; and theoretical treatment of the optical near field and optical near-field interactions, providing the basis for investigating the signal transport and associated dissipation in nano-optical devices. Taken as a whole, this overview will be a valuable resource for engineers and scientists working in the field of nano-electro-optics.

Creatine Transporter Deficiency: Screening of Males with Neurodevelopmental Disorders and Neurocognitive Characterization of a Case.

Science.gov (United States)

Thurm, Audrey; Himelstein, Daniel; DʼSouza, Precilla; Rennert, Owen; Jiang, Susanqi; Olatunji, Damilola; Longo, Nicola; Pasquali, Marzia; Swedo, Susan; Salomons, Gajja S; Carrillo, Nuria

2016-05-01

Creatine transporter deficiency (CTD) is an X-linked, neurometabolic disorder associated with intellectual disability that is characterized by brain creatine (Cr) deficiency and caused by mutations in SLC6A8, the Cr transporter 1 protein gene. CTD is identified by elevated urine creatine/creatinine (Cr/Crn) ratio or reduced Cr peak on brain magnetic resonance spectroscopy; the diagnosis is confirmed by decreased Cr uptake in cultured fibroblasts, and/or identification of a mutation in the SLC6A8 gene. Prevalence studies suggest this disorder may be underdiagnosed. We sought to identify cases from a well-characterized cohort of children diagnosed with neurodevelopmental disorders. Urine screening for CTD was performed on a cohort of 46 males with autism spectrum disorder (ASD) and 9 males with a history of non-ASD developmental delay (DD) classified with intellectual disability. We identified 1 patient with CTD in the cohort based on abnormal urine Cr/Crn, and confirmed the diagnosis by the identification of a novel frameshift mutation in the SLC6A8 gene. This patient presented without ASD but with intellectual disability, and was characterized by a nonspecific phenotype of early language delay and DD that persisted into moderate-to-severe intellectual disability, consistent with previous descriptions of CTD. Identification of patients with CTD is possible by measuring urine Cr and Crn levels and the current case adds to the growing literature of neurocognitive deficits associated with the disorder that affect cognition, language and behavior in childhood.

Instruction sequence based non-uniform complexity classes

NARCIS (Netherlands)

Bergstra, J.A.; Middelburg, C.A.

2013-01-01

We present an approach to non-uniform complexity in which single-pass instruction sequences play a key part, and answer various questions that arise from this approach. We introduce several kinds of non-uniform complexity classes. One kind includes a counterpart of the well-known non-uniform

Preparation, characterization, biological activity, and transport study of polystyrene based calcium–barium phosphate composite membrane

Energy Technology Data Exchange (ETDEWEB)

Khan, Mohammad Mujahid Ali; Rafiuddin,, E-mail: rafi_amu@rediffmail.com

2013-10-15

Calcium–barium phosphate (CBP) composite membrane with 25% polystyrene was prepared by co-precipitation method. Scanning electron microscopy (SEM), X-ray diffraction (XRD), Fourier transformed infrared (FTIR), and Thermogravimetric analysis (TGA) were used to characterize the membrane. The membrane was found to be crystalline in nature with consistent arrangement of particles and no indication of visible cracks. The electrical potentials measured across the composite membrane in contact with univalent electrolytes (KCl, NaCl and LiCl), have been found to increase with decrease in concentrations. Thus the membrane was found to be cation-selective. Transport properties of developed membranes may be utilized for the efficient desalination of saline water and more importantly demineralization process. The antibacterial study of this composite membrane shows good results for killing the disease causing bacteria along with waste water treatment. Highlights: • Transport properties of composite membrane are evaluated. • The composite membrane was found to be stable in all media. • TMS method is used for electrochemical characterization. • The membrane was found to be cation selective. • The order of surface charge density was found to be LiCl < NaCl < KCl.

School Uniforms: Esprit de Corps.

Science.gov (United States)

Ryan, Rosemary P.; Ryan, Thomas E.

1998-01-01

The benefits of school uniforms far outweigh their short-term costs. School uniforms not only keep students safe, but they increase their self-esteem, promote a more positive attitude toward school, lead to improved student behavior, and help blur social-class distinctions. Students are allowed to wear their own political or religious messages,…

Comments on Beckmann's Uniform Reducts

OpenAIRE

Cook, Stephen

2006-01-01

Arnold Beckmann defined the uniform reduct of a propositional proof system f to be the set of those bounded arithmetical formulas whose propositional translations have polynomial size f-proofs. We prove that the uniform reduct of f + Extended Frege consists of all true bounded arithmetical formulas iff f + Extended Frege simulates every proof system.

A mountain-scale model for characterizing unsaturated flow and transport in fractured tuffs of Yucca Mountain

International Nuclear Information System (INIS)

Wu, Yu-Shu; Lu, Guoping; Zhang, Keni; Bodvarsson, G.S.

2003-01-01

This paper presents a large-scale modeling study characterizing fluid flow and tracer transport in the unsaturated zone of Yucca Mountain, Nevada, the proposed underground repository site for storing high-level radioactive waste. The modeling study is conducted using a three-dimensional numerical model, which incorporates a wide variety of field data and takes into account the coupled processes of flow and transport in Yucca Mountain's highly heterogeneous, unsaturated, fractured porous rock. The modeling approach is based on a dual-continuum formulation. Using different conceptual models of unsaturated flow, various scenarios of current and future climate conditions and their effects on the unsaturated zone are evaluated to aid in the assessment of the repository's system performance. These models are calibrated against field-measured data. Model-predicted flow and transport processes under current and future climates are discussed

Pellicle transmission uniformity requirements

Science.gov (United States)

Brown, Thomas L.; Ito, Kunihiro

1998-12-01

Controlling critical dimensions of devices is a constant battle for the photolithography engineer. Current DUV lithographic process exposure latitude is typically 12 to 15% of the total dose. A third of this exposure latitude budget may be used up by a variable related to masking that has not previously received much attention. The emphasis on pellicle transmission has been focused on increasing the average transmission. Much less, attention has been paid to transmission uniformity. This paper explores the total demand on the photospeed latitude budget, the causes of pellicle transmission nonuniformity and examines reasonable expectations for pellicle performance. Modeling is used to examine how the two primary errors in pellicle manufacturing contribute to nonuniformity in transmission. World-class pellicle transmission uniformity standards are discussed and a comparison made between specifications of other components in the photolithographic process. Specifications for other materials or parameters are used as benchmarks to develop a proposed industry standard for pellicle transmission uniformity.

Downsampling Non-Uniformly Sampled Data

Directory of Open Access Journals (Sweden)

Fredrik Gustafsson

2007-10-01

Full Text Available Decimating a uniformly sampled signal a factor D involves low-pass antialias filtering with normalized cutoff frequency 1/D followed by picking out every Dth sample. Alternatively, decimation can be done in the frequency domain using the fast Fourier transform (FFT algorithm, after zero-padding the signal and truncating the FFT. We outline three approaches to decimate non-uniformly sampled signals, which are all based on interpolation. The interpolation is done in different domains, and the inter-sample behavior does not need to be known. The first one interpolates the signal to a uniformly sampling, after which standard decimation can be applied. The second one interpolates a continuous-time convolution integral, that implements the antialias filter, after which every Dth sample can be picked out. The third frequency domain approach computes an approximate Fourier transform, after which truncation and IFFT give the desired result. Simulations indicate that the second approach is particularly useful. A thorough analysis is therefore performed for this case, using the assumption that the non-uniformly distributed sampling instants are generated by a stochastic process.

Chamber transport

International Nuclear Information System (INIS)

Olson, Craig L.

2001-01-01

Heavy ion beam transport through the containment chamber plays a crucial role in all heavy ion fusion (HIF) scenarios. Here, several parameters are used to characterize the operating space for HIF beams; transport modes are assessed in relation to evolving target/accelerator requirements; results of recent relevant experiments and simulations of HIF transport are summarized; and relevant instabilities are reviewed. All transport options still exist, including (1) vacuum ballistic transport, (2) neutralized ballistic transport, and (3) channel-like transport. Presently, the European HIF program favors vacuum ballistic transport, while the US HIF program favors neutralized ballistic transport with channel-like transport as an alternate approach. Further transport research is needed to clearly guide selection of the most attractive, integrated HIF system

A micromechanical approach of suffusion based on a length scale analysis of the grain detachment and grain transport processes.

Science.gov (United States)

Wautier, Antoine; Bonelli, Stéphane; Nicot, François

2017-06-01

Suffusion is the selective erosion of the finest particles of a soil subjected to an internal flow. Among the four types of internal erosion and piping identified today, suffusion is the least understood. Indeed, there is a lack of micromechanical approaches for identifying the critical microstructural parameters responsible for this process. Based on a discrete element modeling of non cohesive granular assemblies, specific micromechanical tools are developed in a unified framework to account for the two first steps of suffusion, namely the grain detachment and the grain transport processes. Thanks to the use of an enhanced force chain definition and autocorrelation functions the typical lengths scales associated with grain detachment are characterized. From the definition of transport paths based on a graph description of the pore space the typical lengths scales associated with grain transport are recovered. For a uniform grain size distribution, a separation of scales between these two processes exists for the finest particles of a soil

A Uniform Publish-Subscribe Infrastructure for Communication in Wireless Mobile Environments

DEFF Research Database (Denmark)

Brønsted, Jeppe; Hansen, Klaus Marius; Thorup, Rolf

2006-01-01

In near future the transportation sector will be communication enabled. Devices in vehicles will be able to communicate and thus make a new range of services possible. However, heterogeneous communication capabilities and vehicle mobility complicates the art of designing and implementing these ne...... communication is handled uniformly. By showing how the infrastructure is used in a concrete instance we argue that it meets the requirements for middleware stated above and provides a good programming model for distributed systems in mobile environments......In near future the transportation sector will be communication enabled. Devices in vehicles will be able to communicate and thus make a new range of services possible. However, heterogeneous communication capabilities and vehicle mobility complicates the art of designing and implementing these new...... systems and therefore it is important to have communication middleware that hides the complexity of low level network programming and presents a clean and understandable abstraction over communication to the application programmer. It has previously been shown that the publish-subscribe messaging paradigm...

Identification and characterization of jasmonate transporters

DEFF Research Database (Denmark)

Lambertz, Sophie Konstanze

of the stimulus but also in distal tissues. The systemic accumulation has been the focus of many studies, which proposed that jasmonate is transported over long and short distances to induce defense responses. However, our knowledge of jasmonate transporting elements is marginal. In this thesis, two jasmonate...... Spodoptera littoralis and the fungus Botrytis cinerea was tested. Wounding assays indicate that the JEFFs are involved in systemic induction of the defense compounds glucosinolates, which may be caused by a JEFF mediated shift of jasmonate precursors to the biologically active form of jasmonates. Further...

Large-scale syntheses of uniform ZnO nanorods and ethanol gas sensors application

International Nuclear Information System (INIS)

Chen Jin; Li Jin; Li Jiahui; Xiao Guoqing; Yang Xiaofeng

2011-01-01

Research highlights: → The uniform ZnO nanorods could be synthesized by a low temperature, solution-based method. → The results showed that the sample had uniform rod-like morphology with a narrow size distribution and highly crystallinity. → Room-temperature photoluminescence spectra of these nanorods show an exciton emission around 382 nm and a weak deep level emission, indicating the nanorods have high quality. → The sensor exhibited high sensitivity and fast response to ethanol gas at a work temperature of 400 deg. C. - Abstract: Uniform ZnO nanorods with a gram scale were prepared by a low temperature and solution-based method. The samples are characterized by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM) and photoluminescence (PL). The results showed that the sample had uniform rod-like morphology with a narrow size distribution and highly crystallinity. Room-temperature PL spectra of these nanorods show an exciton emission around 382 nm and a negligible deep level emission, indicating the nanorods have high quality. The gas-sensing properties of the materials have been investigated. The results indicate that the as-prepared nanorods show much better sensitivity and stability. The n-type semiconductor gas sensor exhibited high sensitivity and fast response to ethanol gas at a work temperature of 400 deg. C. ZnO nanorods are excellent potential candidates for highly sensitive gas sensors and ultraviolet laser.

Uniform-droplet spray forming

Energy Technology Data Exchange (ETDEWEB)

Blue, C.A.; Sikka, V.K. [Oak Ridge National Lab., TN (United States); Chun, Jung-Hoon [Massachusetts Institute of Technology, Cambridge, MA (United States); Ando, T. [Tufts Univ., Medford, MA (United States)

1997-04-01

The uniform-droplet process is a new method of liquid-metal atomization that results in single droplets that can be used to produce mono-size powders or sprayed-on to substrates to produce near-net shapes with tailored microstructure. The mono-sized powder-production capability of the uniform-droplet process also has the potential of permitting engineered powder blends to produce components of controlled porosity. Metal and alloy powders are commercially produced by at least three different methods: gas atomization, water atomization, and rotating disk. All three methods produce powders of a broad range in size with a very small yield of fine powders with single-sized droplets that can be used to produce mono-size powders or sprayed-on substrates to produce near-net shapes with tailored microstructures. The economical analysis has shown the process to have the potential of reducing capital cost by 50% and operating cost by 37.5% when applied to powder making. For the spray-forming process, a 25% savings is expected in both the capital and operating costs. The project is jointly carried out at Massachusetts Institute of Technology (MIT), Tuffs University, and Oak Ridge National Laboratory (ORNL). Preliminary interactions with both finished parts and powder producers have shown a strong interest in the uniform-droplet process. Systematic studies are being conducted to optimize the process parameters, understand the solidification of droplets and spray deposits, and develop a uniform-droplet-system (UDS) apparatus appropriate for processing engineering alloys.

Functional characterization of apical transporters expressed in rat proximal tubular cells (PTCs) in primary culture.

Science.gov (United States)

Nakanishi, Takeo; Fukushi, Akimasa; Sato, Masanobu; Yoshifuji, Mayuko; Gose, Tomoka; Shirasaka, Yoshiyuki; Ohe, Kazuyo; Kobayashi, Masato; Kawai, Keiichi; Tamai, Ikumi

2011-12-05

Since in vitro cell culture models often show altered apical transporter expression, they are not necessarily suitable for the analysis of renal transport processes. Therefore, we aimed here to investigate the usefulness of primary-cultured rat proximal tubular cells (PTCs) for this purpose. After isolation of renal cortical cells from rat kidneys, PTCs were enriched and the gene expression and function of apical transporters were analyzed by means of microarray, RT-PCR and uptake experiments. RT-PCR confirmed that the major apical transporters were expressed in rat PTCs. Na(+)-dependent uptake of α-methyl-d-glucopyranoside (αMG), ergothioneine and carnitine by the PTCs suggests functional expression of Sglts, Octn1 and Octn2, respectively. Inhibition of pH-dependent glycylsarcosine uptake by low concentration of cephalexin, which is a β-lactam antibiotics recognized by Pepts, indicates a predominant role of high affinity type Pept2, but not low affinity type Pept1, in the PTCs. Moreover, the permeability ratio of [(14)C]αMG (apical to basolateral/basolateral to apical) across PTCs was 4.3, suggesting that Sglt-mediated reabsorptive transport is characterized. In conclusion, our results indicate that rat PTCs in primary culture are found to be a promising in vitro model to evaluate reabsorption processes mediated at least by Sglts, Pept2, Octn1 and Octn2.

Uniform Single Valued Neutrosophic Graphs

Directory of Open Access Journals (Sweden)

S. Broumi

2017-09-01

Full Text Available In this paper, we propose a new concept named the uniform single valued neutrosophic graph. An illustrative example and some properties are examined. Next, we develop an algorithmic approach for computing the complement of the single valued neutrosophic graph. A numerical example is demonstrated for computing the complement of single valued neutrosophic graphs and uniform single valued neutrosophic graph.

Uniform-related infection control practices of dental students

Directory of Open Access Journals (Sweden)

Aljohani Y

2017-04-01

Full Text Available Yazan Aljohani,1 Mohammed Almutadares,1 Khalid Alfaifi,1 Mona El Madhoun,1 Maysoon H Albahiti,2 Nadia Al-Hazmi3 1Internship Program, Faculty of dentistry, King Abdulaziz University, 2Department of Endodontics, King Abdulaziz University, 3Department of Oral Biology, King Abdulaziz University, Faculty of Dentistry, Jeddah, Saudi Arabia Background: Uniform-related infection control practices are sometimes overlooked and underemphasized. In Saudi Arabia, personal protective equipment must meet global standards for infection control, but the country’s Islamic legislature also needs to be taken into account. Aim: To assess uniform-related infection control practices of a group of dental students in a dental school in Saudi Arabia and compare the results with existing literature related to cross-contamination through uniforms in the dental field. Method: A questionnaire was formulated and distributed to dental students at King Abdulaziz University Faculty of Dentistry in Jeddah, Saudi Arabia, which queried the students about their uniform-related infection control practices and their methods and frequency of laundering and sanitizing their uniforms, footwear, and name tags. Results: There is a significant difference between genders with regard to daily uniform habits. The frequency of uniform washing was below the standard and almost 30% of students were not aware of how their uniforms are washed. Added to this, there is no consensus on a unified uniform for male and female students. Conclusion: Information on preventing cross-contamination through wearing uniforms must be supplied, reinforced, and emphasized while taking into consideration the cultural needs of the Saudi society. Keywords: cross-contamination, infection control, dental students, uniforms

Transport lattice models of heat transport in skin with spatially heterogeneous, temperature-dependent perfusion

Directory of Open Access Journals (Sweden)

Martin Gregory T

2004-11-01

Full Text Available Abstract Background Investigation of bioheat transfer problems requires the evaluation of temporal and spatial distributions of temperature. This class of problems has been traditionally addressed using the Pennes bioheat equation. Transport of heat by conduction, and by temperature-dependent, spatially heterogeneous blood perfusion is modeled here using a transport lattice approach. Methods We represent heat transport processes by using a lattice that represents the Pennes bioheat equation in perfused tissues, and diffusion in nonperfused regions. The three layer skin model has a nonperfused viable epidermis, and deeper regions of dermis and subcutaneous tissue with perfusion that is constant or temperature-dependent. Two cases are considered: (1 surface contact heating and (2 spatially distributed heating. The model is relevant to the prediction of the transient and steady state temperature rise for different methods of power deposition within the skin. Accumulated thermal damage is estimated by using an Arrhenius type rate equation at locations where viable tissue temperature exceeds 42°C. Prediction of spatial temperature distributions is also illustrated with a two-dimensional model of skin created from a histological image. Results The transport lattice approach was validated by comparison with an analytical solution for a slab with homogeneous thermal properties and spatially distributed uniform sink held at constant temperatures at the ends. For typical transcutaneous blood gas sensing conditions the estimated damage is small, even with prolonged skin contact to a 45°C surface. Spatial heterogeneity in skin thermal properties leads to a non-uniform temperature distribution during a 10 GHz electromagnetic field exposure. A realistic two-dimensional model of the skin shows that tissue heterogeneity does not lead to a significant local temperature increase when heated by a hot wire tip. Conclusions The heat transport system model of the

Characterization of SLC transporters in human skin

Directory of Open Access Journals (Sweden)

Marion Alriquet

2015-03-01

Full Text Available Most identified drug transporters belong to the ATP-binding Cassette (ABC and Solute Carrier (SLC families. Recent research indicates that some of these transporters play an important role in the absorption, distribution and excretion of drugs, and are involved in clinically relevant drug-drug interactions for systemic drugs. However, very little is known about the role of drug transporters in human skin in the disposition of topically applied drugs and their involvement in drug-drug interactions. The aim of this work was to compare the expression in human skin (vs human hepatocytes and kidney of SLC transporters included in the EMA guidance as the most likely clinical sources of drug interactions. The expression of SLC transporters in human tissues was analyzed by quantitative RT-PCR. Modulation of SLC47A1 and SLC47A2 (MATE1 and MATE2 expression was analyzed after treatment of human skin in organ-culture with rifampicin and UV irradiation. The expression of SLCO2B1 (OATPB, SLCO3A1 (OATPD, SLCO4A1 (OATPE, SLC47A1 and SLC47A2 (MATE1 and MATE2 was detected in human skin, OATPE and MATE1 being the most expressed. OATPE is about 70 times more expressed in human skin than in human hepatocytes. Moreover, the expression of SLC47A1 and SLC47A2 was down-regulated after treatment with rifampicin or after exposure to UV light. The present findings demonstrate that SLCO4A1 (OATPE and SLC47A1 (MATE1 are highly expressed in human skin and suggest the involvement of SLC transporters in the disposition of topically applied drugs.

Cytochemical characterization of gill and hepatopancreatic cells of the crab Ucides cordatus (Crustacea, Brachyura validated by cell metal transport

Directory of Open Access Journals (Sweden)

Priscila Ortega

2014-09-01

Full Text Available Ucides cordatus (Linnaeus, 1763 is a hypo-hyper-regulating mangrove crab possessing gills for respiratory and osmoregulatory processes, separated in anterior and posterior sections. They also have hepatopancreas, which is responsible for digestion and absorption of nutrients and detoxification of toxic metals. Each of these organs has specific cells that are important for in vitro studies in cell biology, ion and toxic metals transport. In order to study and characterize cells from gills and hepatopancreas, both were separated using a Sucrose Gradient (SG from 10 to 40% and cells in each gradient were characterized using the vital mitochondrial dye DASPEI (2-(4-dimethylaminostyryl-N- ethylpyridinium iodide and Trichrome Mallory's stain. Both in 20 and 40% SG for gill cells and 30% SG for hepatopancreatic cells, a greater number of cells were colored with DASPEI, indicating a larger number of mitochondria in these cells. It is concluded that the gill cells present in 20% and 40% SG are Thin cells, responsible for respiratory processes and Ionocytes responsible for ion transport, respectively. For hepatopancreatic cells, the 30% SG is composed of Fibrillar cells that possess larger number of membrane ion and nutrient transporters. Moreover, the transport of toxic metal cadmium (Cd by isolated hepatopancreatic cells was performed as a way of following cell physiological integrity after cell separation and to study differences in transport among the cells. All hepatopancreatic cells were able to transport Cd. These findings are the first step for further work on isolated cells of these important exchange epithelia of crabs, using a simple separation method and to further develop successful in vitro cell culture in crabs.

Colloidal transport of uranium in soil: Size fractionation and characterization by field-flow fractionation-multi-detection

International Nuclear Information System (INIS)

Claveranne-Lamolere, C.; Lespes, G.; Dubascoux, St.; Potin-Gautier, M.; Claveranne-Lamolere, C.; Aupiais, J.; Pointurier, F.

2009-01-01

The aim of this study was to characterize colloids associated with uranium by using an on-line fractionation/multi-detection technique based on asymmetrical flow field-flow fractionation (As-Fl-FFF) hyphenated with UV detector, multi angle laser light scattering (MALLS) and inductively coupling plasma-mass spectrometry (ICP-MS). Moreover, thanks to the As-Fl-FFF, the different colloidal fractions were collected and characterized by a total organic carbon analyzer (TOC). Thus it is possible to determine the nature (organic or inorganic colloids), molar mass, size (gyration and hydrodynamic radii) and quantitative uranium distribution over the whole colloidal phase. In the case of the site studied, two populations are highlighted. The first population corresponds to humic-like substances with a molar mass of (1500 ± 300) g mol -1 and a hydrodynamic diameter of (2. 0 ± 0. 2) nm. The second one has been identified as a mix of carbonated nano-particles or clays with organic particles (aggregates and/or coating of the inorganic particles) with a size range hydrodynamic diameter between 30 and 450 nm. Each population is implied in the colloidal transport of uranium: maximum 1% of the uranium content in soil leachate is transported by the colloids in the site studied, according to the depth in the soil. Indeed, humic substances are the main responsible of this transport in sub-surface conditions whereas nano-particles drive the phenomenon in depth conditions. (authors)

Discontinuity model for internal transport barrier formation in reversed magnetic shear plasmas

International Nuclear Information System (INIS)

Kishimoto, Y.; Dettrick, S.A.; Li, J.Q.; Shirai, S.; Kim, J.Y.; Horton, W.; Tajima, T.; LeBrun, M.J.

2000-01-01

It is becoming clear that tokamak anomalous transport is dominated by radially extended non-local modes which originate from strong toroidal coupling of rational surfaces in non-uniform plasmas. To aid in understanding the internal transport barrier (ITB) formed in reversed magnetic shear experiments, in addition to the well known shear flow effect, the article points out an important non-local effect and/or finite size effect which comes from the complex behaviour of the mode over a finite radial region around the minimum q (safety factor) surface. The non-local mode, which is characterized by its radial extent and the degree of tilting in the poloidal direction (Δr, θ 0 ), changes its structure depending on the sign of the magnetic shear, and as a result such modes are weakly excited across the q min surface. This leads to a discontinuity or gap which disconnects the phase relation in the global wave structure across the q min surface. Once such a discontinuity (or gap) is formed, transport suppression occurs and therefore a transport barrier can be expected near the q min surface. The existence of this discontinuity is confirmed through use of a toroidal particle simulation. It is also shown that whether such a discontinuity is efficiently established depends on the presence of the radial electric field and the related plasma shear flow. (author)

Impact of School Uniforms on Student Discipline and the Learning Climate: A Comparative Case Study of Two Middle Schools with Uniform Dress Codes and Two Middle Schools without Uniform Dress Codes

Science.gov (United States)

Dulin, Charles Dewitt

2016-01-01

The purpose of this research is to evaluate the impact of uniform dress codes on a school's climate for student behavior and learning in four middle schools in North Carolina. The research will compare the perceptions of parents, teachers, and administrators in schools with uniform dress codes against schools without uniform dress codes. This…

Roles of ethylene glycol solvent and polymers in preparing uniformly distributed MgO nanoparticles

Directory of Open Access Journals (Sweden)

Chunxi Hai

2017-06-01

Full Text Available This study focus on specifying the roles of solvent ethylene glycol (EG and polymers for synthesis of uniformly distributed magnesium oxide (MgO nanoparticles with average crystallite size of around 50 nm through a modified polyol method. Based on different characterization results, it was concluded that, Mg2+ ions was precipitated by the −OH and CO32− ions decomposed from urea in ethylene glycol (EG medium (CO(NH22 → NH3 + HNCO, HNCO + H2O → NH3 + CO2, thus forming well crystallized Mg5(CO34(OH2 (H2O4 precursor which could be converted to MgO by calcination. Surface protectors PEG and PVP have no obvious influences on cyrtsal structure, morphology and size uniformity of as-prepared precursors and target MgO nanoparticles. In comparison with polymers PEG and PVP, solvent EG plays an important role in controlling the morphology and diameter uniformity of MgO nanoparticles.

Spatially adaptive hp refinement approach for PN neutron transport equation using spectral element method

International Nuclear Information System (INIS)

Nahavandi, N.; Minuchehr, A.; Zolfaghari, A.; Abbasi, M.

2015-01-01

Highlights: • Powerful hp-SEM refinement approach for P N neutron transport equation has been presented. • The method provides great geometrical flexibility and lower computational cost. • There is a capability of using arbitrary high order and non uniform meshes. • Both posteriori and priori local error estimation approaches have been employed. • High accurate results are compared against other common adaptive and uniform grids. - Abstract: In this work we presented the adaptive hp-SEM approach which is obtained from the incorporation of Spectral Element Method (SEM) and adaptive hp refinement. The SEM nodal discretization and hp adaptive grid-refinement for even-parity Boltzmann neutron transport equation creates powerful grid refinement approach with high accuracy solutions. In this regard a computer code has been developed to solve multi-group neutron transport equation in one-dimensional geometry using even-parity transport theory. The spatial dependence of flux has been developed via SEM method with Lobatto orthogonal polynomial. Two commonly error estimation approaches, the posteriori and the priori has been implemented. The incorporation of SEM nodal discretization method and adaptive hp grid refinement leads to high accurate solutions. Coarser meshes efficiency and significant reduction of computer program runtime in comparison with other common refining methods and uniform meshing approaches is tested along several well-known transport benchmarks

The prediction of burnout in non-uniformly heated rod clusters from burnout data for uniformly heated round tubes

International Nuclear Information System (INIS)

Barnett, P.G.

1964-11-01

The practice of using burnout data for uniformly heated round tubes to predict burnout in non-uniformly heated reactor channels having complex cross sections is examined. At least two hypotheses are involved: (i) a relationship exists between uniform and non-uniform heat flux distributions and (ii) a relationship exists between simple and complex channel cross sections. Use of two such hypotheses each accurate to ± 15% and a correlation of uniformly heated round tube data having an R.M.S. error of 5%, could yield errors of ± 40% in any predicted value; this figure of ± 40% is regarded as a realistic upper limit for design purposes. It is shown that no method can exist for relating different channel cross sections to within ± 15% and existing methods for relating different heat flux distributions incur some errors exceeding 20%. Furthermore, any suggested method for relating different heat flux distributions can be adequately checked only when a sufficiently large number of results are available and then the preferable alternative of correlating the data is possible. It is concluded that no reliable method can exist for predicting burnout in rod bundles from uniformly heated round tube data with sufficient accuracy for design purposes. (author)

Regulation of the Deposition Morphology of Inkjet-Printed Crystalline Materials via Polydopamine Functional Coatings for Highly Uniform and Electrically Conductive Patterns.

Science.gov (United States)

Liu, Liang; Ma, Siyuan; Pei, Yunheng; Xiong, Xiao; Sivakumar, Preeth; Singler, Timothy J

2016-08-24

We report a method to achieve highly uniform inkjet-printed silver nitrate (AgNO3) and a reactive silver precursor patterns on rigid and flexible substrates functionalized with polydopamine (PDA) coatings. The printed AgNO3 patterns on PDA-coated substrates (glass and polyethylene terephthalate (PET)) exhibit a narrow thickness distribution ranging between 0.9 and 1 μm in the line transverse direction and uniform deposition profiles in the line axial direction. The deposited reactive silver precursor patterns on PDA-functionalized substrates also show "dome-shaped" morphology without "edge-thickened" structure due to "coffee-stain" effect. We posit that the highly uniform functional ink deposits formed on PDA-coated substrates are attributable to the strong binding interaction between the abundant catecholamine moieties at the PDA surface and the metallic silver cations (Ag(+) or Ag(NH3)(2+)) in the solutal inks. During printing of the ink rivulet and solvent evaporation, the substrate-liquid ink (S-L) interface is enriched with the silver-based cations and a solidification at the S/L interface is induced. The preferential solidification initiated at the S-L interface is further verified by the in situ visualization of the dynamic solidification process during solvent evaporation, and results suggest an enhanced crystal nucleation and growth localized at the S-L interface on PDA functionalized substrates. This interfacial interaction mediates solute transport in the liquid phase, resulting in the controlled enrichment of solute at the S-L interface and mitigated solute precipitation in both the contact line region and the liquid ink-vapor (L-V) interface due to evaporation. This mediated transport contributes to the final uniform solid deposition for both types of ink systems. This technique provides a complementary strategy for achieving highly uniform inkjet-printed crystalline structures, and can serve as an innovative foundation for high-precision additive

Facile Fabrication of Uniform Polyaniline Nanotubes with Tubular Aluminosilicates as Templates

Science.gov (United States)

Zhang, Long; Liu, Peng

2008-08-01

The uniform polyaniline (PANI) nanotubes, with inner diameter, outer diameter, and tubular thickness of 40, 60, and 10 nm, respectively, were prepared successfully by using natural tubular aluminosilicates as templates. The halloysite nanotubes were coated with PANI via the in situ chemical oxidation polymerization. Then the templates were etched with HCl/HF solution. The PANI nanotubes were characterized using FTIR, X-ray diffraction, and transmission electron microscopy. The conductivity of the PANI nanotubes was found to be 1.752 × 10-5 (Ω·cm)-1.

Purification and biochemical characterization of NpABCG5/NpPDR5, a plant pleiotropic drug resistance transporter expressed in Nicotiana tabacum BY-2 suspension cells.

Science.gov (United States)

Toussaint, Frédéric; Pierman, Baptiste; Bertin, Aurélie; Lévy, Daniel; Boutry, Marc

2017-05-04

Pleiotropic drug resistance (PDR) transporters belong to the ABCG subfamily of ATP-binding cassette (ABC) transporters and are involved in the transport of various molecules across plasma membranes. During evolution, PDR genes appeared independently in fungi and in plants from a duplication of a half-size ABC gene. The enzymatic properties of purified PDR transporters from yeast have been characterized. This is not the case for any plant PDR transporter, or, incidentally, for any purified plant ABC transporter. Yet, plant PDR transporters play important roles in plant physiology such as hormone signaling or resistance to pathogens or herbivores. Here, we describe the expression, purification, enzymatic characterization and 2D analysis by electron microscopy of NpABCG5/NpPDR5 from Nicotiana plumbaginifolia , which has been shown to be involved in the plant defense against herbivores. We constitutively expressed NpABCG5/NpPDR5, provided with a His-tag in a homologous system: suspension cells from Nicotiana tabacum (Bright Yellow 2 line). NpABCG5/NpPDR5 was targeted to the plasma membrane and was solubilized by dodecyl maltoside and purified by Ni-affinity chromatography. The ATP-hydrolyzing specific activity (27 nmol min -1  mg -1 ) was stimulated seven-fold in the presence of 0.1% asolectin. Electron microscopy analysis indicated that NpABCG5/NpPDR5 is monomeric and with dimensions shorter than those of known ABC transporters. Enzymatic data (optimal pH and sensitivity to inhibitors) confirmed that plant and fungal PDR transporters have different properties. These data also show that N. tabacum suspension cells are a convenient host for the purification and biochemical characterization of ABC transporters. © 2017 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.

Vapor-transport growth of high optical quality WSe2 monolayers

Directory of Open Access Journals (Sweden)

Genevieve Clark

2014-10-01

Full Text Available Monolayer transition metal dichalcogenides are atomically thin direct-gap semiconductors that show a variety of novel electronic and optical properties with an optically accessible valley degree of freedom. While they are ideal materials for developing optical-driven valleytronics, the restrictions of exfoliated samples have limited exploration of their potential. Here, we present a physical vapor transport growth method for triangular WSe2 sheets of up to 30 μm in edge length on insulating SiO2 substrates. Characterization using atomic force microscopy and optical microscopy reveals that they are uniform, monolayer crystals. Low temperature photoluminescence shows well resolved and electrically tunable excitonic features similar to those in exfoliated samples, with substantial valley polarization and valley coherence. The monolayers grown using this method are therefore of high enough optical quality for routine use in the investigation of optoelectronics and valleytronics.

Novel attempt to create uniform magnetic-field space generated by face-to-face settled HTS bulk magnets

International Nuclear Information System (INIS)

Oka, Tetsuo; Ichiju, Kana; Higa, Kazuya; Fukui, Satoshi; Ogawa, Jun; Sato, Takao; Yokoyama, Kazuya; Nakamura, Takashi

2017-01-01

Various experimental attempts have been made to obtain a uniform magnetic field in the space between face-to-face HTS bulk magnets that could possibly be utilized as NMR magnets. In general, the magnetic fields emitted from the magnetic pole surfaces containing HTS bulk magnets are characterized as non-uniform field distributions. Since the NMR magnets require highly uniform magnetic-field spaces, it has been assumed to be difficult to form uniform magnetic-field spaces between magnetic poles placed face-to-face. The authors modified the shapes of the magnetic-field distribution from convex to concave by attaching ferromagnetic iron plates to the pole surfaces. The magnets were then set face-to-face with various gaps of 30-70 mm, and the experimental data on magnetic-field uniformity was precisely measured in the space. In order to detect the NMR signals, the target performance for uniformity was set as 1,500 ppm throughout the 4-mm span on the x-axis, which is equivalent to performance in the past when the world's first detection of NMR signals was observed in the bore of hollow-type HTS bulk magnets. When we combined the concave and convex field distributions to compensate the uneven field distributions, the data of the best uniformity reached 358 ppm and 493 ppm in the 30 mm and 50 mm gaps, respectively, which exceeded the target value for the purpose of detecting the NMR signals within the space. Furthermore, it was shown that the field distributions change from concave to convex shape without any change at 1.1 T in the range from 7 to 11 mm in the 30-mm gap, indicating that the distributions are uniform. This suggests the possibility that the uniform magnetic-field space between the HTS bulk magnets set face-to-face expands. (author)

Assessment of MODIS RSB Detector Uniformity Using Deep Convective Clouds

Science.gov (United States)

Chang, Tiejun; Xiong, Xiaoxiong (Jack); Angal, Amit; Mu, Qiaozhen

2016-01-01

For satellite sensor, the striping observed in images is typically associated with the relative multiple detector gain difference derived from the calibration. A method using deep convective cloud (DCC) measurements to assess the difference among detectors after calibration is proposed and demonstrated for select reflective solar bands (RSBs) of the Moderate Resolution Imaging Spectroradiometer (MODIS). Each detector of MODIS RSB is calibrated independently using a solar diffuser (SD). Although the SD is expected to accurately characterize detector response, the uncertainties associated with the SD degradation and characterization result in inadequacies in the estimation of each detector's gain. This work takes advantage of the DCC technique to assess detector uniformity and scan mirror side difference for RSB. The detector differences for Terra MODIS Collection 6 are less than 1% for bands 1, 3-5, and 18 and up to 2% for bands 6, 19, and 26. The largest difference is up to 4% for band 7. Most Aqua bands have detector differences less than 0.5% except bands 19 and 26 with up to 1.5%. Normally, large differences occur for edge detectors. The long-term trending shows seasonal oscillations in detector differences for some bands, which are correlated with the instrument temperature. The detector uniformities were evaluated for both unaggregated and aggregated detectors for MODIS band 1 and bands 3-7, and their consistencies are verified. The assessment results were validated by applying a direct correction to reflectance images. These assessments can lead to improvements to the calibration algorithm and therefore a reduction in striping observed in the calibrated imagery.

A Uniform Syntax and Discourse Structure

DEFF Research Database (Denmark)

Hardt, Daniel

2013-01-01

I present arguments in favor of the Uniformity Hypothesis: the hypothesis that discourse can extend syntax dependencies without conflicting with them. I consider arguments that Uniformity is violated in certain cases involving quotation, and I argue that the cases presented in the literature...

Characterization of nitride hole lateral transport in a charge trap flash memory by using a random telegraph signal method

Science.gov (United States)

Liu, Yu-Heng; Jiang, Cheng-Min; Lin, Hsiao-Yi; Wang, Tahui; Tsai, Wen-Jer; Lu, Tao-Cheng; Chen, Kuang-Chao; Lu, Chih-Yuan

2017-07-01

We use a random telegraph signal method to investigate nitride trapped hole lateral transport in a charge trap flash memory. The concept of this method is to utilize an interface oxide trap and its associated random telegraph signal as an internal probe to detect a local channel potential change resulting from nitride charge lateral movement. We apply different voltages to the drain of a memory cell and vary a bake temperature in retention to study the electric field and temperature dependence of hole lateral movement in a nitride. Thermal energy absorption by trapped holes in lateral transport is characterized. Mechanisms of hole lateral transport in retention are investigated. From the measured and modeled results, we find that thermally assisted trap-to-band tunneling is a major trapped hole emission mechanism in nitride hole lateral transport.

UOBPRM: A uniformly distributed obstacle-based PRM

KAUST Repository

Yeh, Hsin-Yi

2012-10-01

This paper presents a new sampling method for motion planning that can generate configurations more uniformly distributed on C-obstacle surfaces than prior approaches. Here, roadmap nodes are generated from the intersections between C-obstacles and a set of uniformly distributed fixed-length segments in C-space. The results show that this new sampling method yields samples that are more uniformly distributed than previous obstacle-based methods such as OBPRM, Gaussian sampling, and Bridge test sampling. UOBPRM is shown to have nodes more uniformly distributed near C-obstacle surfaces and also requires the fewest nodes and edges to solve challenging motion planning problems with varying narrow passages. © 2012 IEEE.

Two-relaxation-time lattice Boltzmann method and its application to advective-diffusive-reactive transport

Science.gov (United States)

Yan, Zhifeng; Yang, Xiaofan; Li, Siliang; Hilpert, Markus

2017-11-01

The lattice Boltzmann method (LBM) based on single-relaxation-time (SRT) or multiple-relaxation-time (MRT) collision operators is widely used in simulating flow and transport phenomena. The LBM based on two-relaxation-time (TRT) collision operators possesses strengths from the SRT and MRT LBMs, such as its simple implementation and good numerical stability, although tedious mathematical derivations and presentations of the TRT LBM hinder its application to a broad range of flow and transport phenomena. This paper describes the TRT LBM clearly and provides a pseudocode for easy implementation. Various transport phenomena were simulated using the TRT LBM to illustrate its applications in subsurface environments. These phenomena include advection-diffusion in uniform flow, Taylor dispersion in a pipe, solute transport in a packed column, reactive transport in uniform flow, and bacterial chemotaxis in porous media. The TRT LBM demonstrated good numerical performance in terms of accuracy and stability in predicting these transport phenomena. Therefore, the TRT LBM is a powerful tool to simulate various geophysical and biogeochemical processes in subsurface environments.

Strain distributions in nano-onions with uniform and non-uniform compositions

International Nuclear Information System (INIS)

Duan, H L; Karihaloo, B L; Wang, J; Yi, X

2006-01-01

Nano-onions are ellipsoidal or spherical particles consisting of a core surrounded by concentric shells of nanometre size. Nano-onions produced by self-assembly and colloidal techniques have different structures and compositions, and thus differ in the state of strains. The mismatch of the thermal expansion coefficients and lattice constants between neighbouring shells induces stress/strain fields in the core and shells, which in turn affect their physical/mechanical properties and/or the properties of the composites containing them. In this paper, the strains in embedded and free-standing nano-onions with uniform and non-uniform compositions are studied in detail. It is found that the strains in the nano-onions can be modified by adjusting their compositions and structures. The results are useful for the band structure engineering of semiconductor nano-onions

Characterization of transport properties in uranium dioxide: the case of the oxygen auto-diffusion

International Nuclear Information System (INIS)

Fraczkiewicz, M.; Baldinozzi, G.

2008-01-01

Point defects in uranium dioxide which control the transport phenomena are still badly known. The aim of this work is to show how in carrying out several experimental techniques, it is possible to demonstrate both the existence and to determine the nature (charge and localization) of predominant defects responsible of the transport phenomena in a fluorite-type structure oxide. The oxygen diffusion in the uranium dioxide illustrates this. In the first part of this work, the accent is put on the electric properties of uranium dioxide and more particularly on the variation laws of the electric conductivity in terms of temperature, of oxygen potential and of the impurities amounts present in the material. These evolutions are connected to point and charged complex defects models and the pertinence of these models is discussed. Besides, it is shown how the electric conductivity measurements can allow to define oxygen potential domains in which the concentrations in electronic carriers are controlled. This characterization being made, it is shown that the determination of the oxygen intrinsic diffusion coefficient and particularly its dependence to the oxygen potential and to the amount of impurity, allows to determine the main defect responsible to the atomic diffusion as well as its nature and its charge. In the second part, the experimental techniques to determine the oxygen diffusion coefficient are presented: there are the isotopic exchange technique for introducing the tracer in the material, and two techniques to characterize the diffusion profiles (SIMS and NRA). Examples of preliminary results are given for mono and polycrystalline samples. At last, from this methodology on uranium dioxide, studies considered to quantify the thermal and physicochemical effects are presented. Experiments considered with the aim to characterize the radiation diffusion in uranium dioxide are presented too. (O.M.)

On Uniform Weak König's Lemma

DEFF Research Database (Denmark)

Kohlenbach, Ulrich

2002-01-01

The so-called weak Konig's lemma WKL asserts the existence of an infinite path b in any infinite binary tree (given by a representing function f). Based on this principle one can formulate subsystems of higher-order arithmetic which allow to carry out very substantial parts of classical mathematics...... which-relative to PRA -implies the schema of 10-induction). In this setting one can consider also a uniform version UWKL of WKL which asserts the existence of a functional which selects uniformly in a given infinite binary tree f an infinite path f of that tree. This uniform version of WKL...

In Vitro Analysis of Metabolite Transport Proteins.

Science.gov (United States)

Roell, Marc-Sven; Kuhnert, Franziska; Zamani-Nour, Shirin; Weber, Andreas P M

2017-01-01

The photorespiratory cycle is distributed over four cellular compartments, the chloroplast, peroxisomes, cytoplasm, and mitochondria. Shuttling of photorespiratory intermediates between these compartments is essential to maintain the function of photorespiration. Specific transport proteins mediate the transport across biological membranes and represent important components of the cellular metabolism. Although significant progress was made in the last years on identifying and characterizing new transport proteins, the overall picture of intracellular metabolite transporters is still rather incomplete. The photorespiratory cycle requires at least 25 transmembrane transport steps; however to date only plastidic glycolate/glycerate transporter and the accessory 2-oxoglutarate/malate and glutamate/malate transporters as well as the mitochondrial transporter BOU1 have been identified. The characterization of transport proteins and defining their substrates and kinetics are still major challenges.Here we present a detailed set of protocols for the in vitro characterization of transport proteins. We provide protocols for the isolation of recombinant transport protein expressed in E. coli or Saccharomyces cerevisiae and the extraction of total leaf membrane protein for in vitro analysis of transporter proteins. Further we explain the process of reconstituting transport proteins in artificial lipid vesicles and elucidate the details of transport assays.

Recent developments in the integrated approach toward characterization of radionuclide transport, Yucca Mountain, Nevada

International Nuclear Information System (INIS)

Simmons, A.M.; Canepa, J.A.

1992-01-01

The radionuclide migration program for the Yucca Mountain Site Characterization Project (YMP) includes studies of radionuclide solubility, sorption, diffusion, and transport. The study plans incorporate all possible parameters of investigation; decision-making strategies for prioritizing the parameters and evaluating their significance were developed in conjunction with the study plans. After definition of explicit research goals for each study, YMP evaluated the applicability of existing data and formulated experimental approaches for obtaining additional data. This resulted in development of individual testing strategies that were integrated into an overall strategy for the radionuclide migration program designed to provide input to credible performance assessments. The strategies allow for decision points at various steps of data collection and testing. They provide a streamlined process toward a defensible level of understanding of chemical retardation and transport processes that will be used to predict the mountain's ability to isolate waste. (author)

Direct minority carrier transport characterization of InAs/InAsSb superlattice nBn photodetectors

International Nuclear Information System (INIS)

Zuo, Daniel; Liu, Runyu; Wasserman, Daniel; Mabon, James; He, Zhao-Yu; Liu, Shi; Zhang, Yong-Hang; Kadlec, Emil A.; Olson, Benjamin V.; Shaner, Eric A.

2015-01-01

We present an extensive characterization of the minority carrier transport properties in an nBn mid-wave infrared detector incorporating a Ga-free InAs/InAsSb type-II superlattice as the absorbing region. Using a modified electron beam induced current technique in conjunction with time-resolved photoluminescence, we were able to determine several important transport parameters of the absorber region in the device, which uses a barrier layer to reduce dark current. For a device at liquid He temperatures, we report a minority carrier diffusion length of 750 nm and a minority carrier lifetime of 200 ns, with a vertical diffusivity of 3 × 10 −2  cm 2 /s. We also report on the device's optical response characteristics at 78 K

Effect of scandia doping method on the emission uniformity of scandate cathode with Sc2O3–W matrix

International Nuclear Information System (INIS)

Wang, Jinshu; Lai, Chen; Liu, Wei; Yang, Fan; Zhang, Xizhu; Cui, Yuntao; Zhou, Meiling

2013-01-01

Graphical abstract: Emission uniformity of the cathodes prepared by mechanical mixing (a) and spray drying method (b). - Highlights: • The emission uniformity of scandate cathodes has been quantitively obtained. • The nanoparticles on the cathode surface lead to the electric field enhancement. • The cathode prepared by spray drying method exhibits good emission uniformity. - Abstract: Scandia doped tungsten matrix dispenser cathodes were manufactured using scandia doped tungsten powder prepared by mechanical mixing, liquid–solid doping and a spray drying method. It is found the macrostructure of the cathode depended on the powder preparation method. The cathode prepared using the powder prepared by spray drying method had a homogenous and porous matrix characterized with grains with a diameter of less than 1 μm and with many nanoparticles distributing uniformly around these grains. The cathode with submicron structure and uniform distribution of scandia exhibited good emission uniformity. The emission uniformity ΔJ/J of the cathode prepared by spray drying method was 0.17, about 6 times lower than that of the cathode prepared by mechanical mixing method. The calculation results showed that the nanoparticles led to electric field enhancement. A Ba–Sc–O multilayer on the cathode surface and nanoparticles distributing mainly on W grains contributed to the emission property of the cathode

Accessible triple-phase boundary length: A performance metric to account for transport pathways in heterogeneous electrochemical materials

Science.gov (United States)

Nakajo, A.; Cocco, A. P.; DeGostin, M. B.; Peracchio, A. A.; Cassenti, B. N.; Cantoni, M.; Van herle, J.; Chiu, W. K. S.

2016-09-01

The performance of materials for electrochemical energy conversion and storage depends upon the number of electrocatalytic sites available for reaction and their accessibility by the transport of reactants and products. For solid oxide fuel/electrolysis cell materials, standard 3-D measurements such as connected triple-phase boundary (TPB) length and effective transport properties partially inform on how local geometry and network topology causes variability in TPB accessibility. A new measurement, the accessible TPB, is proposed to quantify these effects in detail and characterize material performance. The approach probes the reticulated pathways to each TPB using an analytical electrochemical fin model applied to a 3-D discrete representation of the heterogeneous structure provided by skeleton-based partitioning. The method is tested on artificial and real structures imaged by 3-D x-ray and electron microscopy. The accessible TPB is not uniform and the pattern varies depending upon the structure. Connected TPBs can be even passivated. The sensitivity to manipulations of the local 3-D geometry and topology that standard measurements cannot capture is demonstrated. The clear presence of preferential pathways showcases a non-uniform utilization of the 3-D structure that potentially affects the performance and the resilience to alterations due to degradation phenomena. The concepts presented also apply to electrochemical energy storage and conversion devices such as other types of fuel cells, electrolyzers, batteries and capacitors.

Identification and Functional Characterization of the Caenorhabditis elegans Riboflavin Transporters rft-1 and rft-2

Science.gov (United States)

Biswas, Arundhati; Elmatari, Daniel; Rothman, Jason; LaMunyon, Craig W.; Said, Hamid M.

2013-01-01

Two potential orthologs of the human riboflavin transporter 3 (hRFVT3) were identified in the C. elegans genome, Y47D7A.16 and Y47D7A.14, which share 33.7 and 30.5% identity, respectively, with hRFVT3. The genes are tandemly arranged, and we assign them the names rft-1 (for Y47D7A.16) and rft-2 (for Y47D7A.14). Functional characterization of the coding sequences in a heterologous expression system demonstrated that both were specific riboflavin transporters, although the rft-1 encoded protein had greater transport activity. A more detailed examination of rft-1 showed its transport of riboflavin to have an acidic pH dependence, saturability (apparent Km = 1.4±0.5 µM), inhibition by riboflavin analogues, and Na+ independence. The expression of rft-1 mRNA was relatively higher in young larvae than in adults, and mRNA expression dropped in response to RF supplementation. Knocking down the two transporters individually via RNA interference resulted in a severe loss of fertility that was compounded in a double knockdown. Transcriptional fusions constructed with two fluorophores (rft-1::GFP, and rft-2::mCherry) indicated that rft-1 is expressed in the intestine and a small subset of neuronal support cells along the entire length of the animal. Expression of rft-2 is localized mainly to the intestine and pharynx. We also observed a drop in the expression of the two reporters in animals that were maintained in high riboflavin levels. These results report for the first time the identification of two riboflavin transporters in C. elegans and demonstrate their expression and importance to metabolic function in worms. Absence of transporter function renders worms sterile, making them useful in understanding human disease associated with mutations in hRFVT3. PMID:23483992

Functional characterization of the Bradyrhizobium japonicum modA and modB genes involved in molybdenum transport.

Science.gov (United States)

Delgado, María J; Tresierra-Ayala, Alvaro; Talbi, Chouhra; Bedmar, Eulogio J

2006-01-01

A modABC gene cluster that encodes an ABC-type, high-affinity molybdate transporter from Bradyrhizobium japonicum has been isolated and characterized. B. japonicum modA and modB mutant strains were unable to grow aerobically or anaerobically with nitrate as nitrogen source or as respiratory substrate, respectively, and lacked nitrate reductase activity. The nitrogen-fixing ability of the mod mutants in symbiotic association with soybean plants grown in a Mo-deficient mineral solution was severely impaired. Addition of molybdate to the bacterial growth medium or to the plant mineral solution fully restored the wild-type phenotype. Because the amount of molybdate required for suppression of the mutant phenotype either under free-living or under symbiotic conditions was dependent on sulphate concentration, it is likely that a sulphate transporter is also involved in Mo uptake in B. japonicum. The promoter region of the modABC genes has been characterized by primer extension. Reverse transcription and expression of a transcriptional fusion, P(modA)-lacZ, was detected only in a B. japonicum modA mutant grown in a medium without molybdate supplementation. These findings indicate that transcription of the B. japonicum modABC genes is repressed by molybdate.

A School Uniform Program That Works.

Science.gov (United States)

Loesch, Paul C.

1995-01-01

According to advocates, school uniforms reduce gang influence, decrease families' clothing expenditures, and help mitigate potentially divisive cultural and economic differences. Aiming to improve school climate, a California elementary school adopted uniforms as a source of pride and affiliation. This article describes the development of the…

Characterization of Nanoscale Gas Transport in Shale Formations

Science.gov (United States)

Chai, D.; Li, X.

2017-12-01

Non-Darcy flow behavior can be commonly observed in nano-sized pores of matrix. Most existing gas flow models characterize non-Darcy flow by empirical or semi-empirical methods without considering the real gas effect. In this paper, a novel layered model with physical meanings is proposed for both ideal and real gas transports in nanopores. It can be further coupled with hydraulic fracturing models and consequently benefit the storage evaluation and production prediction for shale gas recovery. It is hypothesized that a nanotube can be divided into a central circular zone where the viscous flow behavior mainly exists due to dominant intermolecular collisions and an outer annular zone where the Knudsen diffusion mainly exists because of dominant collisions between molecules and the wall. The flux is derived based on integration of two zones by applying the virtual boundary. Subsequently, the model is modified by incorporating slip effect, real gas effect, porosity distribution, and tortuosity. Meanwhile, a multi-objective optimization method (MOP) is applied to assist the validation of analytical model to search fitting parameters which are highly localized and contain significant uncertainties. The apparent permeability is finally derived and analyzed with various impact factors. The developed nanoscale gas transport model is well validated by the flux data collected from both laboratory experiments and molecular simulations over the entire spectrum of flow regimes. It has a decrease of as much as 43.8% in total molar flux when the real gas effect is considered in the model. Such an effect is found to be more significant as pore size shrinks. Knudsen diffusion accounts for more than 60% of the total gas flux when pressure is lower than 0.2 MPa and pore size is smaller than 50 nm. Overall, the apparent permeability is found to decrease with pressure, though it rarely changes when pressure is higher than 5.0 MPa and pore size is larger than 50 nm.

Uniform manganese hexacyanoferrate hydrate nanocubes featuring superior performance for low-cost supercapacitors and nonenzymatic electrochemical sensors

Science.gov (United States)

Pang, Huan; Zhang, Yizhou; Cheng, Tao; Lai, Wen-Yong; Huang, Wei

2015-09-01

Uniform manganese hexacyanoferrate hydrate nanocubes are prepared via a simple chemical precipitation method at room temperature. Due to both micro/mesopores of the Prussian blue analogue and nanocubic structures, the manganese hexacyanoferrate hydrate nanocubes allow the efficient charge transfer and mass transport for electrolyte solution and chemical species. Thus, the manganese hexacyanoferrate hydrate nanocube electrode shows a good rate capability and cycling stability for electrochemical capacitors. Furthermore, electrodes modified with manganese hexacyanoferrate hydrate nanocubes demonstrate a sensitive electrochemical response to hydrogen peroxide (H2O2) in buffer solutions with a high selectivity.Uniform manganese hexacyanoferrate hydrate nanocubes are prepared via a simple chemical precipitation method at room temperature. Due to both micro/mesopores of the Prussian blue analogue and nanocubic structures, the manganese hexacyanoferrate hydrate nanocubes allow the efficient charge transfer and mass transport for electrolyte solution and chemical species. Thus, the manganese hexacyanoferrate hydrate nanocube electrode shows a good rate capability and cycling stability for electrochemical capacitors. Furthermore, electrodes modified with manganese hexacyanoferrate hydrate nanocubes demonstrate a sensitive electrochemical response to hydrogen peroxide (H2O2) in buffer solutions with a high selectivity. Electronic supplementary information (ESI) available. See DOI: 10.1039/c5nr04322k

Diuretics and salt transport along the nephron.

Science.gov (United States)

Bernstein, Paul L; Ellison, David H

2011-11-01

The clinical use of diuretics almost uniformly predated the localization of their site of action. The consequence of diuretic specificity predicts clinical application and side effect, and the proximity of the sodium transporters, one to the next, often dictates potency or diuretic efficiency. All diuretics function by inhibiting the normal transport of sodium from the filtrate into the renal tubular cells. This movement of sodium into the renal epithelial cells on the apical side is facilitated by a series of transporters whose function is, in turn, dependent on the adenosine triphosphate (ATP)-dependent Na-K cotransporter on the basolateral side of the cell. Our growing understanding of the physiology of sodium transport has spawned new possibilities for diuretic development. Copyright © 2011 Elsevier Inc. All rights reserved.

Nurse uniform wearing practices and associated factors among nurses working in Northwest Ethiopia: a cross-sectional institution based study.

Science.gov (United States)

Desta, Etaferahu Alamaw; Gebrie, Mignote Hailu; Dachew, Berihun Assefa

2015-01-01

Wearing uniforms help in the formation of professional identity in healthcare. It fosters a strong self image and professional identity which can lead to good confidence and better performance in nursing practice. However, most nurses in Ethiopia are not wearing nursing uniforms and the reasons remain unclear. Therefore, the aim of this research is to assess nurse uniform wearing practices among nurses and factors associated with such practice in hospitals in Northwest Ethiopia. A hospital based cross-sectional study was conducted from March to April, 2014 in five hospitals located in Northwest Ethiopia. A total 459 nurses participated in the study. Data was collected using a pre-tested self-administered questionnaire. Descriptive statistics were analyzed in order to characterize the study population. Bivariate and multiple logistic regression models were fitted. Odds ratios with 95 % confidence intervals were computed to identify factors associated with nursing uniform practice. Nurse uniform wearing practice was found to be 49.2 % of the total sample size. Around 35 % of the respondents that did not implement nurse uniform wearing practices stated that there was no specific uniform for nurses recommended by hospital management. In addition to this, nurse uniform wearing practices were positively associated with being female [AOR = 1.58, 95 % CI (1.02, 2.44)], studying nursing by choice [AOR =3.16, 95 % CI (2.03, 4.92)], and the appeal of nursing uniforms to nurses [AOR = 3.43 95 % CI (1.96, 5.98)]. Nurse uniform wearing practices were not exceptionally prevalent in Northwest Ethiopian hospitals. However, encouraging students to pursue interest-based careers and implementing a nurse uniform wearing policy may have the potential to improve such practices.

A stability criterion for HNFDE with non-uniform delays

International Nuclear Information System (INIS)

Liu Xingwen; Zhong Shouming; Zhang Fengli

2005-01-01

Stability of functional differential equations (FDE) is an increasingly important problem in both science and engineering. Delays, whether uniform or non-uniform, play an important role in the dynamics of a system. Since non-uniform delay is more general and less focused than uniform delay, this paper concentrates on the stability of high-order neutral functional differential equations (HNFDE) with non-uniform delay, and proposes a sufficient condition for it. This result may be widely helpful, thanks to the frequent emergence of a HNFDE with non-uniform delay in various fields. Its effectiveness is illustrated by some examples

Quantitative characterization of water transport and flooding in the diffusion layers of polymer electrolyte fuel cells

Energy Technology Data Exchange (ETDEWEB)

Casalegno, A.; Colombo, L.; Galbiati, S.; Marchesi, R. [Department of Energy, Politecnico di Milano, via Lambruschini 4, 20156 Milano (Italy)

2010-07-01

Optimization of water management in polymer electrolyte membrane fuel cells (PEMFC) and in direct methanol fuel cells (DMFC) is a very important factor for the achievement of high performances and long lifetime. A good hydration of the electrolyte membrane is essential for high proton conductivity; on the contrary water in excess may lead to electrode flooding and severe reduction in performances. Many studies on water transport across the gas diffusion layer (GDL) have been carried out to improve these components; anyway efforts in this field are affected by lack of effective experimental methods. The present work reports an experimental investigation with the purpose to determine the global coefficient of water transport across different diffusion layers under real operating conditions. An appropriate and accurate experimental apparatus has been designed and built to test the single GDL under a wide range of operating conditions. Data analysis has allowed quantification of both the water vapor transport across different diffusion layers, and the effects of micro-porous layers; furthermore flooding onset and its consequences on the mass transport coefficient have been characterized by means of suitably defined parameters. (author)

Liouville theory and uniformization of four-punctured sphere

OpenAIRE

Hadasz, Leszek; Jaskolski, Zbigniew

2006-01-01

Few years ago Zamolodchikov and Zamolodchikov proposed an expression for the 4-point classical Liouville action in terms of the 3-point actions and the classical conformal block. In this paper we develop a method of calculating the uniformizing map and the uniformizing group from the classical Liouville action on n-punctured sphere and discuss the consequences of Zamolodchikovs conjecture for an explicit construction of the uniformizing map and the uniformizing group for the sphere with four ...

Using a precursor in lamellar structure for the synthesis of uniform ZnS nanocrystals

KAUST Repository

Xu, Xinjiang

2011-11-12

Uniform ZnS nanocrystals of about 15 nm were prepared through a low temperature hydrothermal approach by treating Zn-PhPO nanosheets with Na 2S aqueous solution. Both the precursor and the final product were studied by the means of X-ray diffraction, scanning electron microscopy and transmission electron microscopy. The photo-luminescent spectrum of the synthesized ZnS nanocrystals showed their good crystalline nature. Based on this study, the precursor structure-controlling effect was discussed, and in addition, the relevant factors possibly affecting the particle formation and the growth possessed were applied in the discussion to interpret the transformation mechanism. Further research showed that both the structure characters of the precursors and the mass transportation which occurred during the synthesis greatly affected the morphology and organization state of the final products. This research may provide some facts on the structure-controlling approaches along with a general method for the preparation of uniform sulfide nanocrystals. © Springer Science+Business Media B.V. 2011.

The canonical partial metric and the uniform convexity on normed spaces

Directory of Open Access Journals (Sweden)

S. Oltra

2005-10-01

Full Text Available In this paper we introduce the notion of canonical partial metric associated to a norm to study geometric properties of normed spaces. In particular, we characterize strict convexity and uniform convexity of normed spaces in terms of the canonical partial metric defined by its norm. We prove that these geometric properties can be considered, in this sense, as topological properties that appear when we compare the natural metric topology of the space with the non translation invariant topology induced by the canonical partial metric in the normed space.

Facile Fabrication of Uniform Polyaniline Nanotubes with Tubular Aluminosilicates as Templates

Directory of Open Access Journals (Sweden)

Zhang Long

2008-01-01

Full Text Available AbstractThe uniform polyaniline (PANI nanotubes, with inner diameter, outer diameter, and tubular thickness of 40, 60, and 10 nm, respectively, were prepared successfully by using natural tubular aluminosilicates as templates. The halloysite nanotubes were coated with PANI via the in situ chemical oxidation polymerization. Then the templates were etched with HCl/HF solution. The PANI nanotubes were characterized using FTIR, X-ray diffraction, and transmission electron microscopy. The conductivity of the PANI nanotubes was found to be 1.752 × 10−5(Ω·cm−1.

School Uniforms and Discourses on Childhood.

Science.gov (United States)

Bodine, Ann

2003-01-01

This ethnographic study examined the introduction of school uniforms in the public schools of one California city. Findings indicated that the uniform issue intersected with issues such as student safety and violence, family stress, egalitarianism, competitive dressing, and a power struggle over shaping the childhood environment. It was concluded…

Automated fabrication, characterization and transport of ICF pellets. Final report, March 1, 1979-October 31, 1980

International Nuclear Information System (INIS)

Clifford, .D.W.; Boyd, B.A.; Lilienkamp, R.H.

1980-12-01

The near-term objectives of the contract were threefold: (1) evaluate techniques for the production of frozen hydrogen microspheres and demonstrate concepts for coating them; (2) develop and demonstrate an optical characterization system which could lead to automated pellet inspection; and (3) develop and demonstrate a preliminary electrostatic pellet transport control system. This report describes the equipment assembled for these experiments and the results obtained

On The Dynamic Analysis of Non-Uniform Beams Under Uniformly ...

African Journals Online (AJOL)

... the non-uniform continuous beam was replaced by a non-continuous (discrete) system made up of beam elements. The modified elemental and overall stiffness, and mass matrices, the elemental and overall centripetal acceleration matrices as well as the load vector were derived. Next, the Newmark's direct integration ...

Gas transport through porous media; Sur le transport des gaz a travers les milieux poreux

Energy Technology Data Exchange (ETDEWEB)

Breton, J P [Commissariat a l' Energie Atomique Saclay (France). Centre d' Etudes Nucleaires

1968-06-01

In the first part of this work we derive a rigorous transport theory for a mixture of gases passing through a bed of spheres, when the temperature is uniform. We solve the Boltzmann equation, putting boundary conditions in the solution. Two different methods are used, according to the nature of the flow. The second part deals with the experimental work: measurements of permeability, of separation and of interdiffusion. In the last part, with the help of the new theory presented here, we are for the first time able to explain all the experimental data. (author) [French] Dans la premiere partie de ce travail nous developpons une theorie rigoureuse du transport d'un melange de gaz a travers un lit de spheres, quand la temperature est uniforme. Nous integrons l'equation de Boltzmann en introduisant des conditions aux limites dans la solution. Nous utilisons deux methodes differentes selon le regime d'ecoulement. La seconde partie est consacree a l'etude experimentale: mesures de permeametrie, de separation et d'interdiffusion. Dans la derniere partie, a l'aide de la nouvelle theorie developpee ici, nous expliquons tous les resultats experimentaux, ce qui n'avait pas ete fait jusque la. (auteur)

Design of multiplier-less sharp non-uniform cosine modulated filter banks for efficient channelizers in software defined radio

Directory of Open Access Journals (Sweden)

Shaeen Kalathil

2016-03-01

Full Text Available Forthcoming software defined radios require filter banks which satisfy stringent specifications efficiently with low implementation complexity. Cosine modulated filter banks (CMFB have simple and efficient design procedure. The different wireless standards have different channel spacing or bandwidths and hence demand non-uniform decomposition of subbands. The non-uniform CMFB can be obtained from a uniform CMFB in a simple and efficient approach by merging the adjacent channels of the uniform CMFB. Very narrow transition width filters with low complexity can be achieved using frequency response masking (FRM filter as prototype filter. The complexity is further reduced by the multiplier-less realization of filter banks in which the least number of signed power of two (SPT terms is achieved by representing the filter coefficients using canonic signed digit (CSD representation and then optimizing using suitable modified meta-heuristic algorithms. Hybrid meta-heuristic algorithms are used in this paper. A hybrid algorithm combines the qualities of two meta-heuristic algorithms and results in improved performances with low implementation complexity. Highly frequency selective filter banks characterized by small passband ripple, narrow transition width and high stopband attenuation with non-uniform decomposition of subbands can be designed with least the implementation complexity, using this approach. A digital channelizer can be designed for SDR implementations, using the proposed approach. In this paper, the non-uniform CMFB is designed for various existing wireless standards.

Determining irrigation distribution uniformity and efficiency for nurseries

Science.gov (United States)

R. Thomas Fernandez

2010-01-01

A simple method for testing the distribution uniformity of overhead irrigation systems is described. The procedure is described step-by-step along with an example. Other uses of distribution uniformity testing are presented, as well as common situations that affect distribution uniformity and how to alleviate them.

Uniformly distributed anatase TiO2 nanoparticles on graphene: Synthesis, characterization, and photocatalytic application

International Nuclear Information System (INIS)

Bai, Xue; Zhang, Xiaoyuan; Hua, Zulin; Ma, Wenqiang; Dai, Zhangyan; Huang, Xin; Gu, Haixin

2014-01-01

Highlights: • Uniform distributed TiO 2 nanoparticles on graphene by a modified method. • Reduced recombination rate of photogenerated electron–hole pairs. • Effective charge transfer from TiO 2 to graphene. • Better photocatalytic activity upon UV and visible irradiation. • A mechanism of bisphenol A degradation process is proposed. - Abstract: Graphene (GR)/TiO 2 nanocomposites are successfully synthesized using a simple and efficient hydrothermal method. Even-sized anatase TiO 2 nanoparticles are uniformly distributed on GR. The GR/TiO 2 nanocomposites exhibit an extended light absorption range and decreased electron–hole recombination rates. The photocatalytic activity of the as-prepared GR/TiO 2 nanocomposites for bisphenol A (BPA) degradation is investigated under UV (λ = 365 nm) and visible (λ ⩾ 400 nm) light irradiation. The results show that GR/TiO 2 nanocomposites have significantly higher photocatalytic activity than P25 (pure TiO 2 ). The large increase in photocatalytic activity is mostly attributed to effective charge transfer from TiO 2 nanoparticles to GR, which suppresses charge recombination during the photocatalytic process. After five successive cycles, the photodegradation activity of the GR/TiO 2 nanocomposites shows no significant decrease, which indicates that the nanocomposites are stable under UV and visible light. X-ray photoelectron spectroscopy (XPS) is used to investigate the chemical bonds of GR/TiO 2 nanocomposites before and after degradation to determine the degradation intermediate products of BPA under irradiation. A proposed degradation reaction pathway of BPA is also established. This study provides new insights into the fabrication and practical application of high-performance photocatalysts in wastewater treatment

Uniform topology on EQ-algebras

Directory of Open Access Journals (Sweden)

Yang Jiang

2017-04-01

Full Text Available In this paper, we use filters of an EQ-algebra E to induce a uniform structure (E, , and then the part induce a uniform topology in E. We prove that the pair (E, is a topological EQ-algebra, and some properties of (E, are investigated. In particular, we show that (E, is a first-countable, zero-dimensional, disconnected and completely regular space. Finally, by using convergence of nets, the convergence of topological EQ-algebras is obtained.

Non-uniform versus uniform attenuation correction in brain perfusion SPET of healthy volunteers

International Nuclear Information System (INIS)

Van Laere, K.; Versijpt, J.; Dierckx, R.; Koole, M.

2001-01-01

Although non-uniform attenuation correction (NUAC) can supply more accurate absolute quantification, it is not entirely clear whether NUAC provides clear-cut benefits in the routine clinical practice of brain SPET imaging. The aim of this study was to compare the effect of NUAC versus uniform attenuation correction (UAC) on volume of interest (VOI)-based semi-quantification of a large age- and gender-stratified brain perfusion normal database. Eighty-nine healthy volunteers (46 females and 43 males, aged 20-81 years) underwent standardised high-resolution single-photon emission tomography (SPET) with 925 MBq 99m Tc-ethyl cysteinate dimer (ECD) on a Toshiba GCA-9300A camera with 153 Gd or 99m Tc transmission CT scanning. Emission images were reconstructed by filtered back-projection and scatter corrected using the triple-energy window correction method. Both non-uniform Chang attenuation correction (one iteration) and uniform Sorenson correction (attenuation coefficient 0.09 cm -1 ) were applied. Images were automatically re-oriented to a stereotactic template on which 35 predefined VOIs were defined for semi-quantification (normalisation on total VOI counts). Small but significant differences between relative VOI uptake values for NUAC versus UAC in the infratentorial region were found. VOI standard deviations were significantly smaller for UAC, 4.5% (range 2.6-7.5), than for NUAC, 5.0% (2.3-9.0) (P 99m Tc-ECD uptake values in healthy volunteers to those obtained with NUAC, although values for the infratentorial region are slightly lower. NUAC produces a slight increase in inter-subject variability. Further study is necessary in various patient populations to establish the full clinical impact of NUAC in brain perfusion SPET. (orig.)

Liouville theory and uniformization of four-punctured sphere

Science.gov (United States)

Hadasz, Leszek; Jaskólski, Zbigniew

2006-08-01

A few years ago Zamolodchikov and Zamolodchikov proposed an expression for the four-point classical Liouville action in terms of the three-point actions and the classical conformal block [Nucl. Phys. B 477, 577 (1996)]. In this paper we develop a method of calculating the uniformizing map and the uniformizing group from the classical Liouville action on n-punctured sphere and discuss the consequences of Zamolodchikovs conjecture for an explicit construction of the uniformizing map and the uniformizing group for the sphere with four punctures.

School Uniform Policies in Public Schools

Science.gov (United States)

Brunsma, David L.

2006-01-01

The movement for school uniforms in public schools continues to grow despite the author's research indicating little if any impact on student behavior, achievement, and self-esteem. The author examines the distribution of uniform policies by region and demographics, the impact of these policies on perceptions of school climate and safety, and…

Synthesis and Characterization of Valyloxy Methoxy Luciferin for the Detection of Valacyclovirase and Peptide Transporter

Science.gov (United States)

Amidon, Gordon L.; Lee, Kyung-Dall

2014-01-01

An amino acid ester derivative of luciferin (valoluc) was synthesized to mimic the transport and activation of valacyclovir. This molecule was characterized in vitro for specificity and enzymatic constants, and then assayed in two different, physiologically-relevant conditions. It was demonstrated that valoluc activation is sensitive to the same cellular factors as valacyclovir and thus has the potential to elucidate the dynamics of amino acid ester prodrug therapies in a functional, high-throughput manner. PMID:25240255

Green Design and Sustainable Development of School Uniforms

Science.gov (United States)

Cui, Yumei; Fang, Xuemeng; Zhou, Honglei

2018-01-01

Since the 1990s, the school uniform has gradually become an integral part of campus culture construction. A school uniform is not only an iconic symbol of students and a school, but also the carrier of campus culture, with special education function and cultural connotation. However in the same time, many problems exist in the design, making and material selection of school uniforms, in which, substandard fabric quality is the most serious problem. To ensure the quality, health and safety of school uniforms, in my opinion, priority should be given to green design and sustainable development in the design process of school uniforms, which will be more conducive to promoting the sound development of school uniforms. In today’s economic development, the globalization of mass production is no longer just a symbol of challenging the limits of human beings, but to explore the unlimited potential of human spiritual collaboration. If we want to have a better future on this planet, we need to completely redefine the key issue we need to address, that is, green design. The rise of green products is a great progress of human understanding and solving environmental problems. It is the inevitable development trend of commodity production, and will have a profound impact on human survival and development in the future. School uniform is an important part of campus culture construction. In order to not damage the health of primary and secondary school students, in the school uniform design and production process should follow the concept of “green design” to achieve the school uniform style, color, material design, a comprehensive “green” positioning.

Generalized Landau-Lifshitz-Gilbert equation for uniformly magnetized bodies

Energy Technology Data Exchange (ETDEWEB)

Serpico, C. [Dipartimento di Ingegneria Elettrica, Universita di Napoli ' FedericoII' , Via Claudio 21, I-80125 Naples (Italy)], E-mail: serpico@unina.it; Mayergoyz, I.D. [ECE Department and UMIACS, University of Maryland, College Park, MD 20742 (United States); Bertotti, G. [Istituto Nazionale di Ricerca Metrologica (INRiM), I-10135 Turin (Italy); D' Aquino, M. [Dipartimento per le Tecnologie, University of Napoli ' Parthenope' , I-80133 Naples (Italy); Bonin, R. [Istituto Nazionale di Ricerca Metrologica (INRiM), I-10135 Turin (Italy)

2008-02-01

We consider generalized Landau-Lifshitz-Gilbert (LLG) deterministic dynamics in uniformly magnetized bodies. The dynamics take place on the unit sphere {sigma}, and are characterized by a vector field v tangential to {sigma}. By using Helmholtz decomposition on {sigma}, it is proven that v is uniquely defined by two potentials {chi} and {psi}. Potential {chi} can be identified with the free energy of the system, while {psi} describes non-conservative interactions of the system with the environment. The presence of {psi} modifies the usual energy balance of LLG dynamics. Instead of purely relaxation dynamics we may have steady injection of energy through non-conservative interactions. The implications of the new form of the energy balance are discussed in detail.

40 CFR Appendix to Part 262 - Uniform Hazardous Waste Manifest and Instructions (EPA Forms 8700-22 and 8700-22A and Their...

Science.gov (United States)

2010-07-01

... Regulatory Affairs, Office of Management and Budget, Washington, DC 20503. I. Instructions for Generators... GENERATORS OF HAZARDOUS WASTE Pt. 262, App. Appendix to Part 262—Uniform Hazardous Waste Manifest and... down hard. 2. Federal regulations require generators and transporters of hazardous waste and owners or...

UMAPRM: Uniformly sampling the medial axis

KAUST Repository

Yeh, Hsin-Yi Cindy

2014-05-01

© 2014 IEEE. Maintaining clearance, or distance from obstacles, is a vital component of successful motion planning algorithms. Maintaining high clearance often creates safer paths for robots. Contemporary sampling-based planning algorithms That utilize The medial axis, or The set of all points equidistant To Two or more obstacles, produce higher clearance paths. However, They are biased heavily Toward certain portions of The medial axis, sometimes ignoring parts critical To planning, e.g., specific Types of narrow passages. We introduce Uniform Medial Axis Probabilistic RoadMap (UMAPRM), a novel planning variant That generates samples uniformly on The medial axis of The free portion of Cspace. We Theoretically analyze The distribution generated by UMAPRM and show its uniformity. Our results show That UMAPRM\\'s distribution of samples along The medial axis is not only uniform but also preferable To other medial axis samplers in certain planning problems. We demonstrate That UMAPRM has negligible computational overhead over other sampling Techniques and can solve problems The others could not, e.g., a bug Trap. Finally, we demonstrate UMAPRM successfully generates higher clearance paths in The examples.

A method for solving neutron transport equation

International Nuclear Information System (INIS)

Dimitrijevic, Z.

1993-01-01

The procedure for solving the transport equation by directly integrating for case one-dimensional uniform multigroup medium is shown. The solution is expressed in terms of linear combination of function H n (x,μ), and the coefficient is determined from given conditions. The solution is applied for homogeneous slab of critical thickness. (author)

Control of thickness uniformity and grain size in graphene films for transparent conductive electrodes

International Nuclear Information System (INIS)

Wu Wei; Yu Qingkai; Pei, Shin-Shem; Peng Peng; Bao Jiming; Liu Zhihong

2012-01-01

Large-scale and transferable graphene films grown on metal substrates by chemical vapor deposition (CVD) still hold great promise for future nanotechnology. To realize the promise, one of the key issues is to further improve the quality of graphene, e.g., uniform thickness, large grain size, and low defects. Here we grow graphene films on Cu foils by CVD at ambient pressure, and study the graphene nucleation and growth processes under different concentrations of carbon precursor. On the basis of the results, we develop a two-step ambient pressure CVD process to synthesize continuous single-layer graphene films with large grain size (up to hundreds of square micrometers). Scanning electron microscopy and Raman spectroscopy characterizations confirm the film thickness and uniformity. The transferred graphene films on cover glass slips show high electrical conductivity and high optical transmittance that make them suitable as transparent conductive electrodes. The growth mechanism of CVD graphene on Cu is also discussed, and a growth model has been proposed. Our results provide important guidance toward the synthesis of high quality uniform graphene films, and could offer a great driving force for graphene based applications. (paper)

A nu-space for ICS: characterization and application to measure protein transport in live cells.

Science.gov (United States)

Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W

2013-08-01

We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency ( ν , nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for STICS that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins ( α 6- and αLβ 2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and ICAM ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrinligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport; Caracteisation des aeosols atmospheiques en Ile-de-France: contribution locale et transport a longues distances

Energy Technology Data Exchange (ETDEWEB)

Cuesta, J.E

2006-06-15

Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

Shape memory polymers based on uniform aliphatic urethane networks

Energy Technology Data Exchange (ETDEWEB)

Wilson, T S; Bearinger, J P; Herberg, J L; Marion III, J E; Wright, W J; Evans, C L; Maitland, D J

2007-01-19

Aliphatic urethane polymers have been synthesized and characterized, using monomers with high molecular symmetry, in order to form amorphous networks with very uniform supermolecular structures which can be used as photo-thermally actuable shape memory polymers (SMPs). The monomers used include hexamethylene diisocyanate (HDI), trimethylhexamethylenediamine (TMHDI), N,N,N{prime},N{prime}-tetrakis(hydroxypropyl)ethylenediamine (HPED), triethanolamine (TEA), and 1,3-butanediol (BD). The new polymers were characterized by solvent extraction, NMR, XPS, UV/VIS, DSC, DMTA, and tensile testing. The resulting polymers were found to be single phase amorphous networks with very high gel fraction, excellent optical clarity, and extremely sharp single glass transitions in the range of 34 to 153 C. Thermomechanical testing of these materials confirms their excellent shape memory behavior, high recovery force, and low mechanical hysteresis (especially on multiple cycles), effectively behaving as ideal elastomers above T{sub g}. We believe these materials represent a new and potentially important class of SMPs, and should be especially useful in applications such as biomedical microdevices.

A Review of Darcy's Law: Limitations and Alternatives for Predicting Solute Transport

Science.gov (United States)

Steenhuis, Tammo; Kung, K.-J. Sam; Jaynes, Dan; Helling, Charles S.; Gish, Tim; Kladivko, Eileen

2016-04-01

Darcy's Law that was derived originally empirically 160 years ago, has been used successfully in calculating the (Darcy) flux in porous media throughout the world. However, field and laboratory experiments have demonstrated that the Darcy flux employed in the convective disperse equation could only successfully predict solute transport under two conditions: (1) uniformly or densely packed porous media; and (2) field soils under relatively dry condition. Employing the Darcy flux for solute transport in porous media with preferential flow pathways was problematic. In this paper we examine the theoretical background behind these field and laboratory observations and then provide an alternative to predict solute movement. By examining the characteristics of the momentum conservation principles on which Darcy's law is based, we show under what conditions Darcy flux can predict solute transport in porous media of various complexity. We find that, based on several case studies with capillary pores, Darcy's Law inherently merges momentum and in that way erases information on pore-scale velocities. For that reason the Darcy flux cannot predict flow in media with preferential flow conduits where individual pore velocities are essential in predicting the shape of the breakthrough curve and especially "the early arrival" of solutes. To overcome the limitations of the assumption in Darcy's law, we use Jury's conceptualization and employ the measured chemical breakthrough curve as input to characterize the impact of individual preferential flow pathways on chemical transport. Specifically, we discuss how best to take advantage of Jury's conceptualization to extract the pore-scale flow velocity to accurately predict chemical transport through soils with preferential flow pathways.

Characterization of events of transport over the Mediterranean Basin during summer 2012

Science.gov (United States)

Bucci, Silvia; Fierli, Federico; Di Donfrancesco, Guido; Diliberto, Luca; Viterbini, Maurizio; Ravetta, François; Pap, Ines; Weinhold, Kay; Größ, Johannes; Wiedensohler, Alfred; Cairo, Francesco

2014-05-01

Long-range transport has a great influence on the atmospheric composition in the Mediterranean Basin (MB). This work focuses on the dust intrusion events and the outflows of polluted air from the Po Valley during the PEGASOS (Pan-European Gas-AeroSOls Climate Interaction Study), TRAQA (TRAnsport et Qualité de l'Air au dessus du bassin Méditerranéen) and Supersito Arpa (Emilia Romagna) measurements campaigns of June - July 2012. In order to investigate the sources and identify the transport patterns, numerical simulations, in-situ, remote sensing and airborne aerosol measurements were jointly used. The ground based lidar situated at the San Pietro Capofiume (SPC) station, in the eastern part of the Po Valley, provides continuous measurements of backscatter and depolarization profiles and the Aerodynamical Particle Sizer (APS), in the same site, gives the aerosol spectral distribution at the ground. Observations show two main events of mineral aerosol inflow over north Italy (19- 21 June and 29-01 July). Optical properties provide a primary discrimination between coarser (likely dust) and finer particles (probably anthropogenic). The vertical statistical distribution of the different aerosol classes shows that larger particles are mainly individuated over the Planetary Boundary Layer (PBL) level while smaller particles tend to follow the daily evolution of the PBL or remain confined under it. Dust events are also detected during the TRAQA airborne campaign in the area of the gulf of Genoa, contributing to the identification of the dust plume characterization. Cluster trajectories analysis coupled to mesoscale simulations highlights the effective export of air masses from the Sahara with frequent intrusions of dust over the Po Valley, as recorded in the observational SPC site. Transport analysis also indicates an inversion of the main advection pattern (the Po Valley outflow is mainly directed eastward in the Adriatic region) during 23th and 26th June, with a

A quantitative experimental phantom study on MRI image uniformity.

Science.gov (United States)

Felemban, Doaa; Verdonschot, Rinus G; Iwamoto, Yuri; Uchiyama, Yuka; Kakimoto, Naoya; Kreiborg, Sven; Murakami, Shumei

2018-05-02

Our goal was to assess MR image uniformity by investigating aspects influencing said uniformity via a method laid out by the National Electrical Manufacturers Association (NEMA). Six metallic materials embedded in a glass phantom were scanned (i.e., Au, Ag, Al, Au-Ag-Pd alloy, Ti and Co-Cr alloy) as well as a reference image. Sequences included Spin Echo (SE) and gradient echo (GRE) scanned in three planes (i.e., Axial, Coronal, and Sagittal). Moreover, three surface coil types (i.e., Head and Neck or HN, Brain, and TMJ coils) and two image correction methods (i.e., Surface Coil Intensity Correction or SCIC, Phased array Uniformity Enhancement or PURE) were employed to evaluate their effectiveness on image uniformity. Image uniformity was assessed using the NEMA peak-deviation non-uniformity method. Results showed that TMJ coils elicited the least uniform image and Brain coils outperformed HN coils when metallic materials were present. Additionally, when metallic materials were present, SE outperformed GRE especially for Co-Cr (particularly in the axial plane). Furthermore, both SCIC and PURE improved image uniformity compared to uncorrected images, and SCIC slightly surpassed PURE when metallic metals were present. Lastly, Co-Cr elicited the least uniform image while other metallic materials generally showed similar patterns (i.e., no significant deviation from images without metallic metals). Overall, a quantitative understanding of the factors influencing MR image uniformity (e.g., coil type, imaging method, metal susceptibility, and post-hoc correction method) is advantageous to optimize image quality, assists clinical interpretation, and may result in improved medical and dental care.

School Dress Codes and Uniform Policies.

Science.gov (United States)

Anderson, Wendell

2002-01-01

Opinions abound on what students should wear to class. Some see student dress as a safety issue; others see it as a student-rights issue. The issue of dress codes and uniform policies has been tackled in the classroom, the boardroom, and the courtroom. This Policy Report examines the whole fabric of the debate on dress codes and uniform policies…

Uniforms, status and professional boundaries in hospital.

Science.gov (United States)

Timmons, Stephen; East, Linda

2011-11-01

Despite their comparative neglect analytically, uniforms play a key role in the delineation of occupational boundaries and the formation of professional identity in healthcare. This paper analyses a change to the system of uniforms in one UK hospital, where management have required all professions (with the exception of doctors) to wear the same 'corporate' uniform. Focus groups were conducted with the professionals and patients. We analyse this initiative as a kind of McDonaldisation, seeking to create a new 'corporate' worker whose allegiance is principally to the organisation, rather than a profession. Our findings show how important uniforms are to their wearers, both in terms of the defence of professional boundaries and status, as well as the construction of professional identity. © 2011 The Authors. Sociology of Health & Illness © 2011 Foundation for the Sociology of Health & Illness/Blackwell Publishing Ltd.

Non-uniform sampling of NMR relaxation data

DEFF Research Database (Denmark)

Schwarz-Linnet, Troels; Teilum, Kaare

2016-01-01

The use of non-uniform sampling of NMR spectra may give significant reductions in the data acquisition time. For quantitative experiments such as the measurement of spin relaxation rates, non-uniform sampling is however not widely used as inaccuracies in peak intensities may lead to errors...... in the extracted dynamic parameters. By systematic reducing the coverage of the Nyquist grid of (15)N Carr-Purcell-Meiboom-Gill (CPMG) relaxation dispersion datasets for four different proteins and performing a full data analysis of the resulting non-uniform sampled datasets, we have compared the performance...... of the multi-dimensional decomposition and iterative re-weighted least-squares algorithms in reconstructing spectra with accurate peak intensities. As long as a single fully sampled spectrum is included in a series of otherwise non-uniform sampled two-dimensional spectra, multi-dimensional decomposition...

Effect of heterogeneity on the characterization of cell membrane compartments: I. Uniform size and permeability.

Science.gov (United States)

Hall, Damien

2010-03-15

Observations of the motion of individual molecules in the membrane of a number of different cell types have led to the suggestion that the outer membrane of many eukaryotic cells may be effectively partitioned into microdomains. A major cause of this suggested partitioning is believed to be due to the direct/indirect association of the cytosolic face of the cell membrane with the cortical cytoskeleton. Such intimate association is thought to introduce effective hydrodynamic barriers into the membrane that are capable of frustrating molecular Brownian motion over distance scales greater than the average size of the compartment. To date, the standard analytical method for deducing compartment characteristics has relied on observing the random walk behavior of a labeled lipid or protein at various temporal frequencies and different total lengths of time. Simple theoretical arguments suggest that the presence of restrictive barriers imparts a characteristic turnover to a plot of mean squared displacement versus sampling period that can be interpreted to yield the average dimensions of the compartment expressed as the respective side lengths of a rectangle. In the following series of articles, we used computer simulation methods to investigate how well the conventional analytical strategy coped with heterogeneity in size, shape, and barrier permeability of the cell membrane compartments. We also explored questions relating to the necessary extent of sampling required (with regard to both the recorded time of a single trajectory and the number of trajectories included in the measurement bin) for faithful representation of the actual distribution of compartment sizes found using the SPT technique. In the current investigation, we turned our attention to the analytical characterization of diffusion through cell membrane compartments having both a uniform size and permeability. For this ideal case, we found that (i) an optimum sampling time interval existed for the analysis

Molecular cloning and functional characterization of an ATP-binding cassette transporter OtrC from Streptomyces rimosus

Directory of Open Access Journals (Sweden)

Yu Lan

2012-08-01

Full Text Available Abstract Background The otrC gene of Streptomyces rimosus was previously annotated as an oxytetracycline (OTC resistance protein. However, the amino acid sequence analysis of OtrC shows that it is a putative ATP-binding cassette (ABC transporter with multidrug resistance function. To our knowledge, none of the ABC transporters in S. rimosus have yet been characterized. In this study, we aimed to characterize the multidrug exporter function of OtrC and evaluate its relevancy to OTC production. Results In order to investigate OtrC’s function, otrC is cloned and expressed in E. coli The exporter function of OtrC was identified by ATPase activity determination and ethidium bromide efflux assays. Also, the susceptibilities of OtrC-overexpressing cells to several structurally unrelated drugs were compared with those of OtrC-non-expressing cells by minimal inhibitory concentration (MIC assays, indicating that OtrC functions as a drug exporter with a broad range of drug specificities. The OTC production was enhanced by 1.6-fold in M4018 (P = 0.000877 and 1.4-fold in SR16 (P = 0.00973 duplication mutants, while it decreased to 80% in disruption mutants (P = 0.0182 and 0.0124 in M4018 and SR16, respectively. Conclusions The results suggest that OtrC is an ABC transporter with multidrug resistance function, and plays an important role in self-protection by drug efflux mechanisms. This is the first report of such a protein in S. rimosus, and otrC could be a valuable target for genetic manipulation to improve the production of industrial antibiotics.

Characterization of SiaA, a streptococcal heme-binding protein associated with a heme ABC transport system.

Science.gov (United States)

Sook, Brian R; Block, Darci R; Sumithran, Suganya; Montañez, Griselle E; Rodgers, Kenton R; Dawson, John H; Eichenbaum, Zehava; Dixon, Dabney W

2008-02-26

Many pathogenic bacteria require heme and obtain it from their environment. Heme transverses the cytoplasmic membrane via an ATP binding cassette (ABC) pathway. Although a number of heme ABC transport systems have been described in pathogenic bacteria, there is as yet little biophysical characterization of the proteins in these systems. The sia (hts) gene cluster encodes a heme ABC transporter in the Gram positive Streptococcus pyogenes. The lipoprotein-anchored heme binding protein (HBP) of this transporter is SiaA (HtsA). In the current study, resonance Raman (rR), magnetic circular dichroism (MCD), and nuclear magnetic resonance (NMR) spectroscopies were used to determine the coordination state and spin state of both the ferric and ferrous forms of this protein. Identifiers from these techniques suggest that the heme is six-coordinate and low-spin in both oxidation states of the protein, with methionine and histidine as axial ligands. SiaA has a pKa of 9.7 +/- 0.1, attributed to deprotonation of the axial histidine. Guanidinium titration studies show that the ferric state is less stable than the ferrous state, with DeltaG(H2O) values for the oxidized and reduced proteins of 7.3 +/- 0.8 and 16.0 +/- 3.6 kcal mol-1, respectively. The reductive and oxidative midpoint potentials determined via spectroelectrochemistry are 83 +/- 3 and 64 +/- 3 mV, respectively; the irreversibility of heme reduction suggests that redox cycling of the heme is coupled to a kinetically sluggish change in structure or conformation. The biophysical characterization described herein will significantly advance our understanding of structure-function relationships in HBP.

Uniform excitations in magnetic nanoparticles

Directory of Open Access Journals (Sweden)

Steen Mørup

2010-11-01

Full Text Available We present a short review of the magnetic excitations in nanoparticles below the superparamagnetic blocking temperature. In this temperature regime, the magnetic dynamics in nanoparticles is dominated by uniform excitations, and this leads to a linear temperature dependence of the magnetization and the magnetic hyperfine field, in contrast to the Bloch T3/2 law in bulk materials. The temperature dependence of the average magnetization is conveniently studied by Mössbauer spectroscopy. The energy of the uniform excitations of magnetic nanoparticles can be studied by inelastic neutron scattering.

Uniform excitations in magnetic nanoparticles

DEFF Research Database (Denmark)

Mørup, Steen; Frandsen, Cathrine; Hansen, Mikkel Fougt

2010-01-01

We present a short review of the magnetic excitations in nanoparticles below the superparamagnetic blocking temperature. In this temperature regime, the magnetic dynamics in nanoparticles is dominated by uniform excitations, and this leads to a linear temperature dependence of the magnetization...... and the magnetic hyperfine field, in contrast to the Bloch T3/2 law in bulk materials. The temperature dependence of the average magnetization is conveniently studied by Mössbauer spectroscopy. The energy of the uniform excitations of magnetic nanoparticles can be studied by inelastic neutron scattering....

Alternative methods for evaluation of non-uniformity in nuclear medicine images

International Nuclear Information System (INIS)

Rasaneh, S.; Rajabi, H.; Hajizadeh, E.

2005-01-01

Non-uniformity test is the most essential in daily quality control procedures of nuclear medicine equipment's. However, the calculation of non-uniformity is hindered due to high level of noise in nuclear medicine data. Non-uniformity may be considered as a type of systematic error while noise is certainly a random error. The present methods of uniformity evaluation are not able to distinguish between systematic and random error and therefore produce incorrect results when noise is significant. In the present study, two hypothetical methods have been tested for evaluation of non-uniformity in nuclear medicine images. Materials and Methods: Using the Monte Carlo method, uniform and non-uniform flood images of different matrix sizes and different counts were generated. The uniformity of the images was calculated using the conventional method and proposed methods. The results were compared with the known non-uniformity data of simulated images. Results: It was observed that the value of integral uniformity never went below the recommended values except in small matrix size of high counts (more than 80 millions counts). The differential uniformity was quite insensitive to the degree of non-uniformity in large matrix size. Matrix size of 64*64 was only found to be suitable for the calculation of differential uniformity. It was observed that in uniform images, a small amount of non-uniformity changes the p-value of Kolmogorov-Smirnov test and noise amplitude of fast fourier transformation test significantly while the conventional methods failed to detect the nonuniformity. Conclusion: The conventional methods do not distinguish noise, which is always present in the data and occasional non-uniformity at low count density. In a uniform intact flood image, the difference between maximum and minimum pixel count (the value of integral uniformity) is much more than the recommended values for non-uniformity. After filtration of image, this difference decreases, but remains high

Cpuf: Chirped-Pulse Microwave Spectroscopy in Pulsed Uniform Supersonic Flows

Science.gov (United States)

Suits, Arthur; Abeysekera, Chamara; Zack, Lindsay N.; Joalland, Baptiste; Ariyasingha, Nuwandi M.; Park, Barratt; Field, Robert W.; Sims, Ian

2015-06-01

Chirped-pulse Fourier-transform microwave spectroscopy has stimulated a resurgence of interest in rotational spectroscopy owing to the dramatic reduction in spectral acquisition time it enjoys when compared to cavity-based instruments. This suggests that it might be possible to adapt the method to study chemical reaction dynamics and even chemical kinetics using rotational spectroscopy. The great advantage of this would be clear, quantifiable spectroscopic signatures for polyatomic products as well as the possibility to identify and characterize new radical reaction products and transient intermediates. To achieve this, however, several conditions must be met: 1) products must be thermalized at low temperature to maximize the population difference needed to achieve adequate signal levels and to permit product quantification based on the rotational line strength; 2) a large density and volume of reaction products is also needed to achieve adequate signal levels; and 3) for kinetics studies, a uniform density and temperature is needed throughout the course of the reaction. These conditions are all happily met by the uniform supersonic flow produced from a Laval nozzle expansion. In collaboration with the Field group at MIT we have developed a new instrument we term a CPUF (Chirped-pulse/Uniform Flow) spectrometer in which we can study reaction dynamics, photochemistry and kinetics using broadband microwave and millimeter wave spectroscopy as a product probe. We will illustrate the performance of the system with a few examples of photodissociation and reaction dynamics, and also discuss a number of challenges unique to the application of chirped-pulse microwave spectroscopy in the collisional environment of the flow. Future directions and opportunities for application of CPUF will also be explored.

Nuclear materials transportation

International Nuclear Information System (INIS)

Ushakov, B.A.

1986-01-01

Various methods of nuclear materials transportation at different stages of the fuel cycle (U 3 O 8 , UF 6 production enrichment, fuel element manufacturing, storage) are considered. The advantages and drawbacks of railway, automobile, maritime and air transport are analyzed. Some types of containers are characterized

Uniform shock waves in disordered granular matter.

Science.gov (United States)

Gómez, Leopoldo R; Turner, Ari M; Vitelli, Vincenzo

2012-10-01

The confining pressure P is perhaps the most important parameter controlling the properties of granular matter. Strongly compressed granular media are, in many respects, simple solids in which elastic perturbations travel as ordinary phonons. However, the speed of sound in granular aggregates continuously decreases as the confining pressure decreases, completely vanishing at the jamming-unjamming transition. This anomalous behavior suggests that the transport of energy at low pressures should not be dominated by phonons. In this work we use simulations and theory to show how the response of granular systems becomes increasingly nonlinear as pressure decreases. In the low-pressure regime the elastic energy is found to be mainly transported through nonlinear waves and shocks. We numerically characterize the propagation speed, shape, and stability of these shocks and model the dependence of the shock speed on pressure and impact intensity by a simple analytical approach.

Transporter taxonomy - a comparison of different transport protein classification schemes.

Science.gov (United States)

Viereck, Michael; Gaulton, Anna; Digles, Daniela; Ecker, Gerhard F

2014-06-01

Currently, there are more than 800 well characterized human membrane transport proteins (including channels and transporters) and there are estimates that about 10% (approx. 2000) of all human genes are related to transport. Membrane transport proteins are of interest as potential drug targets, for drug delivery, and as a cause of side effects and drug–drug interactions. In light of the development of Open PHACTS, which provides an open pharmacological space, we analyzed selected membrane transport protein classification schemes (Transporter Classification Database, ChEMBL, IUPHAR/BPS Guide to Pharmacology, and Gene Ontology) for their ability to serve as a basis for pharmacology driven protein classification. A comparison of these membrane transport protein classification schemes by using a set of clinically relevant transporters as use-case reveals the strengths and weaknesses of the different taxonomy approaches.

Radiochromic film measurement of spatial uniformity for a laser generated x-ray environment

Energy Technology Data Exchange (ETDEWEB)

Fisher, J. H.; Newlander, C. D.; Horton, R.; Fournier, K. B.; Emig, J.; Patterson, R.; Davis, J. F.; Seiler, S.; Jenkins, P. P.

2012-10-01

n existing x-ray source application (XRSA) test cassette was modified to hold multiple x-ray filter materials followed by two radiochromic film types (FWT-60 and HD-810 Gafchromic® film) to qualitatively characterize the spectral-spatial uniformity over the XRSA sample field of view. Multiple sets of film were examined and nominal set was determined. These initial, qualitative measurements suggest a low-energy regime (E < 3 keV) spatial anisotropy and spatial isotropy at higher energies (E > 3 keV).

Effect of scandia doping method on the emission uniformity of scandate cathode with Sc{sub 2}O{sub 3}–W matrix

Energy Technology Data Exchange (ETDEWEB)

Wang, Jinshu, E-mail: wangjsh@bjut.edu.cn; Lai, Chen; Liu, Wei; Yang, Fan; Zhang, Xizhu; Cui, Yuntao; Zhou, Meiling

2013-09-01

Graphical abstract: Emission uniformity of the cathodes prepared by mechanical mixing (a) and spray drying method (b). - Highlights: • The emission uniformity of scandate cathodes has been quantitively obtained. • The nanoparticles on the cathode surface lead to the electric field enhancement. • The cathode prepared by spray drying method exhibits good emission uniformity. - Abstract: Scandia doped tungsten matrix dispenser cathodes were manufactured using scandia doped tungsten powder prepared by mechanical mixing, liquid–solid doping and a spray drying method. It is found the macrostructure of the cathode depended on the powder preparation method. The cathode prepared using the powder prepared by spray drying method had a homogenous and porous matrix characterized with grains with a diameter of less than 1 μm and with many nanoparticles distributing uniformly around these grains. The cathode with submicron structure and uniform distribution of scandia exhibited good emission uniformity. The emission uniformity ΔJ/J of the cathode prepared by spray drying method was 0.17, about 6 times lower than that of the cathode prepared by mechanical mixing method. The calculation results showed that the nanoparticles led to electric field enhancement. A Ba–Sc–O multilayer on the cathode surface and nanoparticles distributing mainly on W grains contributed to the emission property of the cathode.

On Uniform Exponential Trichotomy in Banach Spaces

Directory of Open Access Journals (Sweden)

Kovacs Monteola Ilona

2014-06-01

Full Text Available In this paper we consider three concepts of uniform exponential trichotomy on the half-line in the general framework of evolution operators in Banach spaces. We obtain a systematic classification of uniform exponential trichotomy concepts and the connections between them.

Dopamine transporter; solubilization and characterization of [3H] GBR-12935 binding in canine caudate

International Nuclear Information System (INIS)

Sallee, F.R.

1988-01-01

The dopamine (DA) transporter protein, as indexed by [ 3 H]GBR-12935 binding, was solubilized from canine striatal membranes with the detergent digitonin. This solubilized protein retained the same pharmacological characteristics as membrane attached uptake sites. The binding of [ 3 H]GBR-12935 to solubilized preparations was specific, saturable and reversible with an equilibrium dissociation constant of approximately 3 nM and a maximum ligand binding (B max ) of 3.4 pmol/mg protein. [ 3 H]GBR-12935 also bound to solubilized sites in a sodium-independent manner with a K D of approximately 6 nM and a B max of 1.2 ± 0.2 pmol/mg protein. Dopamine uptake inhibitors and substrates of DA uptake inhibited [ 3 H]GBR-12935 binding in a stereoselective and concentration dependent manner. For these compounds rank order of potency for inhibition of [ 3 H]GBR-12935 binding correlated with their potency for inhibition of dopamine uptake. K D values for DA uptake inhibitors in solubilized preparations correlated with those obtained on [ 3 H]GBR-12935 binding in the native state. The dopamine transporter appears to be a transmembrane glycoprotein by virtue of its absorption and specific elution from wheat germ agglutinin (WGA)-lectin column. Solubilization of the putative dopamine transporter with full retention of binding activity now allows for the purification and biochemical characterization of this important membrane protein

ELECTRONIC CIRCUIT BOARDS NON-UNIFORM COOLING SYSTEM MODEL

Directory of Open Access Journals (Sweden)

D. V. Yevdulov

2016-01-01

Full Text Available Abstract. The paper considers a mathematical model of non-uniform cooling of electronic circuit boards. The block diagram of the system implementing this approach, the method of calculation of the electronic board temperature field, as well as the principle of its thermal performance optimizing are presented. In the considered scheme the main heat elimination from electronic board is produced by the radiator system, and additional cooling of the most temperature-sensitive components is produced by thermoelectric batteries. Are given the two-dimensional temperature fields of the electronic board during its uniform and non-uniform cooling, is carried out their comparison. As follows from the calculations results, when using a uniform overall cooling of electronic unit there is a waste of energy for the cooling 0f electronic board parts which temperature is within acceptable temperature range without the cooling system. This approach leads to the increase in the cooling capacity of used thermoelectric batteries in comparison with the desired values. This largely reduces the efficiency of heat elimination system. The use for electronic boards cooling of non-uniform local heat elimination removes this disadvantage. The obtained dependences show that in this case, the energy required to create a given temperature is smaller than when using a common uniform cooling. In this approach the temperature field of the electronic board is more uniform and the cooling is more efficient. 

Ultrasonic transducer design for uniform insonation

International Nuclear Information System (INIS)

Harrison, G.H.; Balcer-Kubiczek, E.K.; McCulloch, D.

1984-01-01

Techniques used in transducer development for acoustical imaging have been evaluated for the purpose of producing broad, uniform ultrasonic fields from planar radiators. Such fields should be useful in hyperthermia, physical therapy, and ultrasonic bioeffects studies. Fourier inversion of the circ function yielded a source velocity distribution proportional to (P/r) exp ((-ik/2Z) (2Z/sup 2/+r/sup 2/)) J/sub 1/(krP/Z), where r is the radial source coordinate, k is the wave number, and P is the desired radius of uniform insonation at a depth Z in water. This source distribution can be truncated without significantly degrading the solution. A simpler solution consists of exponentially shading the edge of an otherwise uniformly excited disk transducer. This approach was successfully approximated experimentally

7 CFR 51.2085 - Fairly uniform color.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Fairly uniform color. 51.2085 Section 51.2085 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... color. Fairly uniform color means that the shells do not show excessive variation in color, whether...

Characterization of a putative grapevine Zn transporter, VvZIP3, suggests its involvement in early reproductive development in Vitis vinifera L

Directory of Open Access Journals (Sweden)

Gainza-Cortés Felipe

2012-07-01

Full Text Available Abstract Background Zinc (Zn deficiency is one of the most widespread mineral nutritional problems that affect normal development in plants. Because Zn cannot passively diffuse across cell membranes, it must be transported into intracellular compartments for all biological processes where Zn is required. Several members of the Zinc-regulated transporters, Iron-regulated transporter-like Protein (ZIP gene family have been characterized in plants, and have shown to be involved in metal uptake and transport. This study describes the first putative Zn transporter in grapevine. Unravelling its function may explain an important symptom of Zn deficiency in grapevines, which is the production of clusters with fewer and usually smaller berries than normal. Results We identified and characterized a putative Zn transporter from berries of Vitis vinifera L., named VvZIP3. Compared to other members of the ZIP family identified in the Vitis vinifera L. genome, VvZIP3 is mainly expressed in reproductive tissue - specifically in developing flowers - which correlates with the high Zn accumulation in these organs. Contrary to this, the low expression of VvZIP3 in parthenocarpic berries shows a relationship with the lower Zn accumulation in this tissue than in normal seeded berries where its expression is induced by Zn. The predicted protein sequence indicates strong similarity with several members of the ZIP family from Arabidopsis thaliana and other species. Moreover, VvZIP3 complemented the growth defect of a yeast Zn-uptake mutant, ZHY3, and is localized in the plasma membrane of plant cells, suggesting that VvZIP3 has the function of a Zn uptake transporter. Conclusions Our results suggest that VvZIP3 encodes a putative plasma membrane Zn transporter protein member of the ZIP gene family that might play a role in Zn uptake and distribution during the early reproductive development in Vitis vinifera L., indicating that the availability of this micronutrient

A mechanistic study of the uniform corrosion of copper in compacted clay-sand soil

International Nuclear Information System (INIS)

Litke, C.D.; Ryan, S.R.; King, F.

1992-08-01

The results of a study of the mechanism of uniform corrosion of copper under simulated nuclear fuel waste disposal conditions are presented. Evidence is given that suggests that the rate-controlling process is the transport of copper corrosion products away from the corroding surface. In the experiments described here, the copper diffused through a column of compacted clay-sand buffer. The properties of the buffer material, especially its ability to sorb copper species, are significant in determining the rate of uniform corrosion of copper. The evidence that copper diffusion is rate-controlling stems from the effect of γ-radiation on the tests. In the presence of γ-radiation, copper diffused farther along the column of compacted buffer material than in the unirradiated tests, but the corrosion rate was lower. These two effects can be best explained in terms of a slow copper-diffusion process. Irradiation is thought to reduce the extent of sorption of copper by the clay component of the buffer. This results in a more mobile copper species and a smaller interfacial flux of copper (i.e., a lower corrosion rate)

Trends, prospects and challenges in quantifying flow and transport through fractured rocks

Science.gov (United States)

Neuman, Shlomo P.

2005-03-01

Among the current problems that hydrogeologists face, perhaps there is none as challenging as the characterization of fractured rock (Faybishenko and Benson 2000). This paper discusses issues associated with the quantification of flow and transport through fractured rocks on scales not exceeding those typically associated with single- and multi-well pressure (or flow) and tracer tests. As much of the corresponding literature has focused on fractured crystalline rocks and hard sedimentary rocks such as sandstones, limestones (karst is excluded) and chalk, so by default does this paper. Direct quantification of flow and transport in such rocks is commonly done on the basis of fracture geometric data coupled with pressure (or flow) and tracer tests, which therefore form the main focus. Geological, geophysical and geochemical (including isotope) data are critical for the qualitative conceptualization of flow and transport in fractured rocks, and are being gradually incorporated in quantitative flow and transport models, in ways that this paper unfortunately cannot describe but in passing. The hydrogeology of fractured aquifers and other earth science aspects of fractured rock hydrology merit separate treatments. All evidence suggests that rarely can one model flow and transport in a fractured rock consistently by treating it as a uniform or mildly nonuniform isotropic continuum. Instead, one must generally account for the highly erratic heterogeneity, directional dependence, dual or multicomponent nature and multiscale behavior of fractured rocks. One way is to depict the rock as a network of discrete fractures (with permeable or impermeable matrix blocks) and another as a nonuniform (single, dual or multiple) continuum. A third way is to combine these into a hybrid model of a nonuniform continuum containing a relatively small number of discrete dominant features. In either case the description can be deterministic or stochastic. The paper contains a brief assessment

A method to measure the mean thickness and non-uniformity of non-uniform thin film by alpha-ray thickness gauge

International Nuclear Information System (INIS)

Miyahara, Hiroshi; Yoshida, Makoto; Watanabe, Tamaki

1977-01-01

The α-ray thickness gauge is used to measure non-destructively the thicknesses of thin films, and up to the present day, a thin film with uniform thickness is only taken up as the object of α-ray thickness gauge. When the thickness is determined from the displacement between the absorption curves in the presence and absence of thin film, the absorption curve must be displaced in parallel. When many uniform particles were dispersed as sample, the shape of the absorption curve was calculated as the sum of many absorption curves corresponding to the thin films with different thicknesses. By the comparison of the calculated and measured absorption curves, the number of particles, or the mean superficial density can be determined. This means the extension of thickness measurement from uniform to non-uniform films. Furthermore, these particle models being applied to non-uniform thin film, the possibility of measuring the mean thickness and non-uniformity was discussed. As the result, if the maximum difference of the thickness was more than 0.2 mg/cm 2 , the nonuniformity was considered to distinguish by the usual equipment. In this paper, an α-ray thickness gauge using the absorption curve method was treated, but one can apply this easily to an α-ray thickness gauge using α-ray energy spectra before and after the penetration of thin film. (auth.)

ESPRIT And Uniform Linear Arrays

Science.gov (United States)

Roy, R. H.; Goldburg, M.; Ottersten, B. E.; Swindlehurst, A. L.; Viberg, M.; Kailath, T.

1989-11-01

Abstract ¬â€?ESPRIT is a recently developed and patented technique for high-resolution estimation of signal parameters. It exploits an invariance structure designed into the sensor array to achieve a reduction in computational requirements of many orders of magnitude over previous techniques such as MUSIC, Burg's MEM, and Capon's ML, and in addition achieves performance improvement as measured by parameter estimate error variance. It is also manifestly more robust with respect to sensor errors (e.g. gain, phase, and location errors) than other methods as well. Whereas ESPRIT only requires that the sensor array possess a single invariance best visualized by considering two identical but other-wise arbitrary arrays of sensors displaced (but not rotated) with respect to each other, many arrays currently in use in various applications are uniform linear arrays of identical sensor elements. Phased array radars are commonplace in high-resolution direction finding systems, and uniform tapped delay lines (i.e., constant rate A/D converters) are the rule rather than the exception in digital signal processing systems. Such arrays possess many invariances, and are amenable to other types of analysis, which is one of the main reasons such structures are so prevalent. Recent developments in high-resolution algorithms of the signal/noise subspace genre including total least squares (TLS) ESPRIT applied to uniform linear arrays are summarized. ESPRIT is also shown to be a generalization of the root-MUSIC algorithm (applicable only to the case of uniform linear arrays of omni-directional sensors and unimodular cisoids). Comparisons with various estimator bounds, including CramerRao bounds, are presented.

Non-uniform dispersion of the source-sink relationship alters wavefront curvature.

Directory of Open Access Journals (Sweden)

Lucia Romero

Full Text Available The distribution of cellular source-sink relationships plays an important role in cardiac propagation. It can lead to conduction slowing and block as well as wave fractionation. It is of great interest to unravel the mechanisms underlying evolution in wavefront geometry. Our goal is to investigate the role of the source-sink relationship on wavefront geometry using computer simulations. We analyzed the role of variability in the microscopic source-sink relationship in driving changes in wavefront geometry. The electrophysiological activity of a homogeneous isotropic tissue was simulated using the ten Tusscher and Panfilov 2006 action potential model and the source-sink relationship was characterized using an improved version of the Romero et al. safety factor formulation (SFm2. Our simulations reveal that non-uniform dispersion of the cellular source-sink relationship (dispersion along the wavefront leads to alterations in curvature. To better understand the role of the source-sink relationship in the process of wave formation, the electrophysiological activity at the initiation of excitation waves in a 1D strand was examined and the source-sink relationship was characterized using the two recently updated safety factor formulations: the SFm2 and the Boyle-Vigmond (SFVB definitions. The electrophysiological activity at the initiation of excitation waves was intimately related to the SFm2 profiles, while the SFVB led to several counterintuitive observations. Importantly, with the SFm2 characterization, a critical source-sink relationship for initiation of excitation waves was identified, which was independent of the size of the electrode of excitation, membrane excitability, or tissue conductivity. In conclusion, our work suggests that non-uniform dispersion of the source-sink relationship alters wavefront curvature and a critical source-sink relationship profile separates wave expansion from collapse. Our study reinforces the idea that the

Quasiparticles in non-uniformly magnetized plasma

International Nuclear Information System (INIS)

Sosenko, P.P.

1994-01-01

A quasiparticle concept is generalized for the case of non-uniformly magnetized plasma. Exact and reduced continuity equations for the microscopic density in the quasiparticle phase space are derived, and the nature of quasiparticles is analyzed. The theory is developed for the general case of relativistic particles in electromagnetic fields, besides non-uniform but stationary magnetic fields. Effects of non-stationary magnetic fields are briefly investigated also. 26 refs

Peak load-impulse characterization of critical pulse loads in structural dynamics

International Nuclear Information System (INIS)

Abrahamson, G.R.; Lindberg, H.E.

1975-01-01

In presenting the characterization scheme, some general features are described first. A detailed analysis is given for the rigid-plastic system of one degree of freedom to illustrate the calculation of critical load curves in terms of peak load and impulse. This is followed by the presentation of critical load curves for uniformly loaded rigid-plastic beams and plates and for dynamic buckling of cylindrical shells under uniform lateral loads. The peak load-impulse characterization of critical pulse loads is compared with the dynamic load factor characterization, and some aspects of the history of the peak load-pulse scheme are presented. (orig./HP) [de

Probabilistic finite-size transport models for fusion: Anomalous transport and scaling laws

International Nuclear Information System (INIS)

Milligen, B.Ph. van; Sanchez, R.; Carreras, B.A.

2004-01-01

Transport in fusion plasmas in the low confinement mode is characterized by several remarkable properties: the anomalous scaling of transport with system size, stiff (or 'canonical') profiles, power degradation, and rapid transport phenomena. The present article explores the possibilities of constructing a unified transport model, based on the continuous-time random walk, in which all these phenomena are handled adequately. The resulting formalism appears to be sufficiently general to provide a sound starting point for the development of a full-blown plasma transport code, capable of incorporating the relevant microscopic transport mechanisms, and allowing predictions of confinement properties

On the Invariant Uniform Roe Algebra as Crossed Product

OpenAIRE

Kankeyanathan Kannan

2013-01-01

The uniform Roe C*-algebra (also called uniform translation)C^*- algebra provides a link between coarse geometry and C^*- algebra theory. The uniform Roe algebra has a great importance in geometry, topology and analysis. We consider some of the elementary concepts associated with coarse spaces.

Analysis of the minority actinides transmutation in a sodium fast reactor with uniform load pattern by the MCNPX-CINDER code

International Nuclear Information System (INIS)

Ochoa Valero, R.; Garcia-Herranz, N.; Aragones, J. M.

2010-01-01

The aim of this study is to evaluate the minority actinides transmutation in sodium fast reactors (SFR) assuming a uniform load pattern. It is determined the isotopic evolution of the actinides along burn, and the evolution of the reactivity and the reactivity coefficients. For that, it is used the MCNPX neutron transport code coupled with the inventory code CINDER90.

An experimental comparison between forced convection burn-out in freon 12 flowing vertically upwards through uniformly and non-uniformly heated round tubes

International Nuclear Information System (INIS)

Stevens, G.F.; Elliott, D.F.; Wood, R.W.

1965-05-01

Some correlations of forced convection burn-out data are based on the approximate linearity of the relationship between burn-out heat flux and the channel-averaged quality at the burn-out point. These correlations perform satisfactorily on data obtained from uniformly heated configurations. Therefore the further inference is sometimes made that the burn-out heat flux is uniquely related to the quality, and that the burn-out in non-uniformly heated configurations can be calculated from measurements made with uniform heating. This report presents burn-out data for Freon 12 flowing vertically upwards through both uniformly and non-uniformly heated round tubes. This data shows that the quality at burn-out does depend on the heat flux profile, and that the inference mentioned above is not justified. (author)

Characterization of Hall effect thruster propellant distributors with flame visualization

Science.gov (United States)

Langendorf, S.; Walker, M. L. R.

2013-01-01

A novel method for the characterization and qualification of Hall effect thruster propellant distributors is presented. A quantitative measurement of the azimuthal number density uniformity, a metric which impacts propellant utilization, is obtained from photographs of a premixed flame anchored on the exit plane of the propellant distributor. The technique is demonstrated for three propellant distributors using a propane-air mixture at reservoir pressure of 40 psi (gauge) (377 kPa) exhausting to atmosphere, with volumetric flow rates ranging from 15-145 cfh (7.2-68 l/min) with equivalence ratios from 1.2 to 2.1. The visualization is compared with in-vacuum pressure measurements 1 mm downstream of the distributor exit plane (chamber pressure held below 2.7 × 10-5 Torr-Xe at all flow rates). Both methods indicate a non-uniformity in line with the propellant inlet, supporting the validity of the technique of flow visualization with flame luminosity for propellant distributor characterization. The technique is applied to a propellant distributor with a manufacturing defect in a known location and is able to identify the defect and characterize its impact. The technique is also applied to a distributor with numerous small orifices at the exit plane and is able to resolve the resulting non-uniformity. Luminosity data are collected with a spatial resolution of 48.2-76.1 μm (pixel width). The azimuthal uniformity is characterized in the form of standard deviation of azimuthal luminosities, normalized by the mean azimuthal luminosity. The distributors investigated achieve standard deviations of 0.346 ± 0.0212, 0.108 ± 0.0178, and 0.708 ± 0.0230 mean-normalized luminosity units respectively, where a value of 0 corresponds to perfect uniformity and a value of 1 represents a standard deviation equivalent to the mean.

School Uniform Policies: Students' Views of Effectiveness.

Science.gov (United States)

McCarthy, Teresa M.; Moreno, Josephine

2001-01-01

Focus-group interviews of New York City middle-school students about their perceptions of the effectiveness of the school-uniform policy. Finds that students' perceptions of the effects of school-uniform policy on school culture varied considerably with those intended by the principal. (Contains 40 references.) (PKP)

44 CFR 12.18 - Uniform pay guidelines.

Science.gov (United States)

2010-10-01

... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Uniform pay guidelines. 12.18 Section 12.18 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF HOMELAND SECURITY GENERAL ADVISORY COMMITTEES § 12.18 Uniform pay guidelines. (a) Members. Subject to the...

Maximum Power Point tracking algorithm based on I-V characteristic of PV array under uniform and non-uniform conditions

DEFF Research Database (Denmark)

Kouchaki, Alireza; Iman-Eini, H.; Asaei, B.

2012-01-01

This paper presents a new algorithm based on characteristic equation of solar cells to determine the Maximum Power Point (MPP) of PV modules under partially shaded conditions (PSC). To achieve this goal, an analytic condition is introduced to determine uniform or non-uniform atmospheric condition...

Stochastic analysis of transport of conservative solutes in caisson experiments

International Nuclear Information System (INIS)

Dagan, G.

1995-01-01

The Los Alamos National Laboratory has conducted in the past a series of experiments of transport of conservative and reactive solutes. The experimental setup and the experimental results are presented in a series of reports. The main aim of the experiments was to validate models of transport of solutes in unsaturated flow at the caisson intermediate scale, which is much larger than the one pertaining to laboratory columns. First attempts to analyze the experimental results were by one-dimensional convective-dispersion models. These models could not explain the observed solute breakthrough curves and particularly the large solute dispersion in the caisson effluent Since there were some question marks about the uniformity of water distribution at the caisson top, the transport experiments were repeated under conditions of saturated flow. In these experiments constant heads were applied at the top and the bottom of the caisson and the number of concentration monitoring stations was quadrupled. The analysis of the measurements by the same one-dimensional model indicated clearly that the fitted dispersivity is much larger than the pore-sole dispersivity and that it grows with the distance in an approximately linear fashion. This led to the conclusion, raised before, that transport in the caisson is dominated by heterogeneity effects, i.e. by spatial variability of the material Such effects cannot be captured by traditional one-dimensional models. In order to account for the effect of heterogeneity, the saturated flow experiments have been analyzed by using stochastic transport modeling. The apparent linear growth of dispersivity with distance suggested that the system behaves like a stratified one. Consequently, the model of Dagan and Bresier has been adopted in order to interpret concentration measurements. In this simple model the caisson is viewed as a bundle of columns of different permeabilities, which are characterized by a p.d.f. (probability denasity function)

Site characterization and performance assessment for a low-level radioactive waste management site in the American Southwest

International Nuclear Information System (INIS)

Shott, G.J.; Sully, M.J.; Muller, C.J.; Hammermeister, D.P.; Ginanni, J.M.

1995-01-01

The Area 5 Radioactive Waste Management Site located in southern Nevada, has been used for the disposal of low-level radioactive waste since 1961. The site is located in the Mohave Desert of the American Southwest, an extremely arid region receiving as little as 0.1 m/yr of precipitation. Site characterization studies have measured the physical, hydrologic, and geochemical properties of core samples collected from 10 shallow boreholes and 3 deep boreholes that extend through the unsaturated zone to the uppermost aquifer. Results indicate that the unsaturated zone consists of 240 m of dry alluvial sediments and is remarkably uniform with respect to most physical parameters. Measurements of saturated hydraulic conductivity with depth showed no evidence of trends, layering, or anisotropy. Parameters for hydraulic functions were not highly variable and exhibited little trend with depth. Water potential profiles indicate that water movement in the upper alluvium is upward, except immediately following a precipitation event. Below the evaporative zone, the liquid flux was downward and of the same order of magnitude as the upward thermal vapor flux induced by the geothermal gradient. The extreme climatic conditions at the site reduce or eliminate many radionuclide release and transport mechanisms. Downward transport of radionuclides to the uppermost aquifer appears unlikely under current climatic conditions. Important radionuclide transport pathways appear to be limited to upward diffusion and advection of gases and biologically-mediated transport. Conceptual models of disposal site performance have been developed based on site characterization studies. The limited transport pathways and limited land use potential of the site provide reasonable assurance that regulatory performance objectives can be met

Transport stochastic multi-dimensional media

International Nuclear Information System (INIS)

Haran, O.; Shvarts, D.

1996-01-01

Many physical phenomena evolve according to known deterministic rules, but in a stochastic media in which the composition changes in space and time. Examples to such phenomena are heat transfer in turbulent atmosphere with non uniform diffraction coefficients, neutron transfer in boiling coolant of a nuclear reactor and radiation transfer through concrete shields. The results of measurements conducted upon such a media are stochastic by nature, and depend on the specific realization of the media. In the last decade there has been a considerable efforts to describe linear particle transport in one dimensional stochastic media composed of several immiscible materials. However, transport in two or three dimensional stochastic media has been rarely addressed. The important effect in multi-dimensional transport that does not appear in one dimension is the ability to bypass obstacles. The current work is an attempt to quantify this effect. (authors)

Transport stochastic multi-dimensional media

Energy Technology Data Exchange (ETDEWEB)

Haran, O; Shvarts, D [Israel Atomic Energy Commission, Beersheba (Israel). Nuclear Research Center-Negev; Thiberger, R [Ben-Gurion Univ. of the Negev, Beersheba (Israel)

1996-12-01

Many physical phenomena evolve according to known deterministic rules, but in a stochastic media in which the composition changes in space and time. Examples to such phenomena are heat transfer in turbulent atmosphere with non uniform diffraction coefficients, neutron transfer in boiling coolant of a nuclear reactor and radiation transfer through concrete shields. The results of measurements conducted upon such a media are stochastic by nature, and depend on the specific realization of the media. In the last decade there has been a considerable efforts to describe linear particle transport in one dimensional stochastic media composed of several immiscible materials. However, transport in two or three dimensional stochastic media has been rarely addressed. The important effect in multi-dimensional transport that does not appear in one dimension is the ability to bypass obstacles. The current work is an attempt to quantify this effect. (authors).

Biological tracer for waste site characterization

International Nuclear Information System (INIS)

Strong-Gunderson, J.

1995-01-01

Remediating hazardous waste sites requires detailed site characterization. In groundwater remediation, characterizing the flow paths and velocity is a major objective. Various tracers have been used for measuring groundwater velocity and transport of contaminants, colloidal particles, and bacteria and nutrients. The conventional techniques use dissolved solutes, dyes. and gases to estimate subsurface transport pathways. These tracers can provide information on transport and diffusion into the matrix, but their estimates for groundwater flow through fractured regions are very conservative. Also, they do not have the same transport characteristics as bacteria and suspended colloid tracers, both of which must be characterized for effective in-place remediation. Bioremediation requires understanding bacterial transport and nutrient distribution throughout the acquifer, knowledge of contaminants s mobile colloidal particles is just essential

Impact of uniform electrode current distribution on ETF

Science.gov (United States)

Bents, D. J.

1982-01-01

The design impacts on the ETF electrode consolidation network associated with uniform channel electrode current distribution are examined and the alternate consolidation design which occur are presented compared to the baseline (non-uniform current) design with respect to performance, and hardware requirements. A rational basis is given for comparing the requirements for the different designs and the savings that result from uniform current distribution. Performance and cost impacts upon the combined cycle plant are discussed.

The FEL-TNO uniform open systems model

NARCIS (Netherlands)

Luiijf, H.A.M.; Overbeek, P.L.

1989-01-01

The FEL-TNO Uniform Open Systems Model is based upon the IS0/0SI Basic Reference Model and integrates operating systems, (OSI) networks, equipment and media into one single uniform nodel. Usage of the model stimulates the development of operating systen and network independent applications and puts

Flood field uniformity testing - effects of crystal hydration

International Nuclear Information System (INIS)

Dimcheva, M.; Sergieva, S.; Doldurova, M.; Jovanovska, A.

2012-01-01

The most basic and sensitive routine quality control (QC) of gamma camera is that of intrinsic flood-field uniformity. The routine QC test must be assessed daily and any nonuniformity must be eliminated before patient testing to eliminate artifacts and false positive or false-negative patient results. The purpose of this study was to compare uniformity analysis results for scintillation crystal hydration with symmetric and asymmetric energy window on the Siemens Symbia T2 SPECTCT camera. Integral and differential uniformity analysis was performed by placing a point source 99m Tc in front of the detector with removed collimator to measure the effect of correction matrix, a count rate and activity volume on intrinsic uniformity. A 15% energy window set symmetrically over the 99m Tc photo peak is equivalent to 140±10% keV or a window spanning 126-154 keV. The results, received from Detector 2 gave the following uniformity parameter values: Both asymmetric energy window images show clearly multiple focal spots due to crystal hydration: discrete hot spots in the asymmetric low window image and discrete cold spots in the asymmetric high window image. The above results are not seen yet on the symmetric window image. We had replaced Detector 2 in order to avoid spots become visible in flood images obtained with the clinical energy window. The uniformity of a gamma camera is maybe the most important parameter that expresses the quality of the camera's performance. Non uniform areas in the field of view can result in misdiagnosed patients and low quality of clinical services. (authors)

Growth functions for some uniformly amenable groups

Directory of Open Access Journals (Sweden)

Dronka Janusz

2017-04-01

Full Text Available We present a simple constructive proof of the fact that every abelian discrete group is uniformly amenable. We improve the growth function obtained earlier and find the optimal growth function in a particular case. We also compute a growth function for some non-abelian uniformly amenable group.

Linking of uniform random polygons in confined spaces

International Nuclear Information System (INIS)

Arsuaga, J; Blackstone, T; Diao, Y; Karadayi, E; Saito, M

2007-01-01

In this paper, we study the topological entanglement of uniform random polygons in a confined space. We derive the formula for the mean squared linking number of such polygons. For a fixed simple closed curve in the confined space, we rigorously show that the linking probability between this curve and a uniform random polygon of n vertices is at least 1-O(1/√n). Our numerical study also indicates that the linking probability between two uniform random polygons (in a confined space), of m and n vertices respectively, is bounded below by 1-O(1/√(mn)). In particular, the linking probability between two uniform random polygons, both of n vertices, is bounded below by 1-O(1/n)

Molecular characterization of ABC transporters in marine ciliate, Euplotes crassus: Identification and response to cadmium and benzo[a]pyrene.

Science.gov (United States)

Kim, Hokyun; Yim, Bora; Kim, Jisoo; Kim, Haeyeon; Lee, Young-Mi

2017-11-30

ATP-binding cassette (ABC) transporters participate in transporting various substances, including xenobiotics, in or out of cells. However, their genetic information and function in ciliates remain still unclear. In this study, we sequenced and characterized two ABC transporter genes (EcABCB and EcABCC), and investigated the effect of cadmium (Cd) and benzo[a]pyrene (B[a]P) on their function and gene expression, using efflux assay and real-time reverse transcription-polymerase chain reaction (qRT-PCR), respectively, in the marine ciliate, Euplotes crassus. Sequencing analysis and efflux assay showed that EcABCB and EcABCC are typical ABC transporters, possessing conserved function. Exposure to Cd (≥5mg/L) and B[a]P (≥50.5μg/L) enhanced accumulation of a substrate. A significant increase in the expression of EcABCB and EcABC mRNA was observed at lower concentration in response to Cd and B[a]P. Our findings indicate that Cd and B[a]P could inhibit the efflux function of ABC transporters, leading to cellular toxicity in the ciliate. Copyright © 2017 Elsevier Ltd. All rights reserved.

Semianalytical solutions for contaminant transport under variable velocity field in a coastal aquifer

Science.gov (United States)

Koohbor, Behshad; Fahs, Marwan; Ataie-Ashtiani, Behzad; Simmons, Craig T.; Younes, Anis

2018-05-01

Existing closed-form solutions of contaminant transport problems are limited by the mathematically convenient assumption of uniform flow. These solutions cannot be used to investigate contaminant transport in coastal aquifers where seawater intrusion induces a variable velocity field. An adaptation of the Fourier-Galerkin method is introduced to obtain semi-analytical solutions for contaminant transport in a confined coastal aquifer in which the saltwater wedge is in equilibrium with a freshwater discharge flow. Two scenarios dealing with contaminant leakage from the aquifer top surface and contaminant migration from a source at the landward boundary are considered. Robust implementation of the Fourier-Galerkin method is developed to efficiently solve the coupled flow, salt and contaminant transport equations. Various illustrative examples are generated and the semi-analytical solutions are compared against an in-house numerical code. The Fourier series are used to evaluate relevant metrics characterizing contaminant transport such as the discharge flux to the sea, amount of contaminant persisting in the groundwater and solute flux from the source. These metrics represent quantitative data for numerical code validation and are relevant to understand the effect of seawater intrusion on contaminant transport. It is observed that, for the surface contamination scenario, seawater intrusion limits the spread of the contaminant but intensifies the contaminant discharge to the sea. For the landward contamination scenario, moderate seawater intrusion affects only the spatial distribution of the contaminant plume while extreme seawater intrusion can increase the contaminant discharge to the sea. The developed semi-analytical solution presents an efficient tool for the verification of numerical models. It provides a clear interpretation of the contaminant transport processes in coastal aquifers subject to seawater intrusion. For practical usage in further studies, the full

Size-Selective Modes of Aeolian Transport on Earth and Mars

Science.gov (United States)

Swann, C.; Ewing, R. C.; Sherman, D. J.; McLean, C. J.

2016-12-01

Aeolian sand transport is a dominant driver of surface change and dust emission on Mars. Estimates of aeolian sand transport on Earth and Mars rely on terrestrial transport models that do not differentiate between transport modes (e.g., creep vs. saltation), which limits estimates of the critical threshold for transport and the total sand flux during a transport event. A gap remains in understanding how the different modes contribute to the total sand flux. Experiments conducted at the MARtian Surface WInd Tunnel separated modes of transport for uniform and mixed grain size surfaces at Earth and Martian atmospheric pressures. Crushed walnut shells with a density of 1.0 gm/cm3 were used. Experiments resolved grain size distributions for creeping and saltating grains over 3 uniform surfaces, U1, U2, and U3, with median grain sizes of 308 µm, 721 µm, and 1294 µm, and a mixed grain size surface, M1, with median grain sizes of 519 µm. A mesh trap located 5 cm above the test bed and a surface creep trap were deployed to capture particles moving as saltation and creep. Grains that entered the creep trap at angles ≥ 75° were categorized as moving in creep mode only. Only U1 and M1 surfaces captured enough surface creep at both Earth and Mars pressure for statistically significant grain size analysis. Our experiments show that size selective transport differs between Earth and Mars conditions. The median grain size of particles moving in creep for both uniform and mixed surfaces are larger under Earth conditions. (U1Earth = 385 µm vs. U1Mars = 355 µm; M1Earth = 762 vs. M1Mars = 697 µm ). However, particles moving in saltation were larger under Mars conditions (U1Earth = 282 µm; U1Mars = 309 µm; M1Earth = 347 µm; M1Mars = 454 µm ). Similar to terrestrial experiments, the median size of surface creep is larger than the median grain size of saltation. Median sizes of U1, U2, U3 at Mars conditions for creep was 355 µm, 774 µm and 1574 µm. Saltation at Mars

Barriers to Implementing a Single Joint Combat Camouflage Uniform

Science.gov (United States)

2017-12-01

opportunities, threats (SWOT), and political, economic, social, and technological (PEST) analyses; examines the requirements and role of each of the...SUBJECT TERMS ground combat uniform, combat camouflage uniform history , combat camouflage uniform pattern, camouflage pattern testing 15. NUMBER...methodology applies strengths, weaknesses, opportunities, threats (SWOT), and political, economic, social, and technological (PEST) analyses

Student Dress Codes and Uniforms. Research Brief

Science.gov (United States)

Johnston, Howard

2009-01-01

According to an Education Commission of the States "Policy Report", research on the effects of dress code and school uniform policies is inconclusive and mixed. Some researchers find positive effects; others claim no effects or only perceived effects. While no state has legislatively mandated the wearing of school uniforms, 28 states and…

50 CFR 510.9 - Uniform pay guidelines.

Science.gov (United States)

2010-10-01

... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Uniform pay guidelines. 510.9 Section 510... ACT § 510.9 Uniform pay guidelines. (a) Compensation of members and staff of, and consultants to the... accordance with guidelines established by the Director of the Office of Management and Budget pursuant to...

Experimental characterization of MHD pressure drop of liquid sodium flow under uniform magnetic field

International Nuclear Information System (INIS)

Kim, Hee Reyoung; Park, Jon Ho; Kim, Jong Man; Nam, Ho Yoon; Choi, Jong Hyun

2001-01-01

Magnetic field has many effects on the hydraulic pressure drop of fluids with high electrical conductivity. The theoretical solution about MHD pressure drop is sought for the uniform current density model with simplified physical geometry. Using the MHD equation in the rectangular duct of the sodium liquid flow under a transverse magnetic field, the electrical potential is sought in terms of the duct geometry and the electrical parameters of the liquid metal and duct material. By the product of the induced current inside the liquid metal and transverse magnetic field, the pressure gradients is found as a function of the duct size and the electrical conductivity of the liquid metal. The theoretically predicted pressure drop is compared with experimental results on the change of flow velocity and magnetic flux density

The ciliate Paramecium shows higher motility in non-uniform chemical landscapes.

Directory of Open Access Journals (Sweden)

Carl Giuffre

Full Text Available We study the motility behavior of the unicellular protozoan Paramecium tetraurelia in a microfluidic device that can be prepared with a landscape of attracting or repelling chemicals. We investigate the spatial distribution of the positions of the individuals at different time points with methods from spatial statistics and Poisson random point fields. This makes quantitative the informal notion of "uniform distribution" (or lack thereof. Our device is characterized by the absence of large systematic biases due to gravitation and fluid flow. It has the potential to be applied to the study of other aquatic chemosensitive organisms as well. This may result in better diagnostic devices for environmental pollutants.

The Ciliate Paramecium Shows Higher Motility in Non-Uniform Chemical Landscapes

Science.gov (United States)

Giuffre, Carl; Hinow, Peter; Vogel, Ryan; Ahmed, Tanvir; Stocker, Roman; Consi, Thomas R.; Strickler, J. Rudi

2011-01-01

We study the motility behavior of the unicellular protozoan Paramecium tetraurelia in a microfluidic device that can be prepared with a landscape of attracting or repelling chemicals. We investigate the spatial distribution of the positions of the individuals at different time points with methods from spatial statistics and Poisson random point fields. This makes quantitative the informal notion of “uniform distribution” (or lack thereof). Our device is characterized by the absence of large systematic biases due to gravitation and fluid flow. It has the potential to be applied to the study of other aquatic chemosensitive organisms as well. This may result in better diagnostic devices for environmental pollutants. PMID:21494596

Experimental Studies of Coal and Biomass Fuel Synthesis and Flame Characterization for Aircraft Engines

Science.gov (United States)

2012-03-31

function of temperature. When the gas medium is uniform (i.e. uniform temperature and species distribution), the distribution reduces to the Beer ...between calculated and measured thermodynamic properties (pressure and temperature). The thermodynamic properties were calculated iteratively. The... thermodynamic and transport properties. Four surface reactions were considered and the reaction rates were simulated by the diffusion-kinetics model with

On Uniformly finitely extensible Banach spaces

OpenAIRE

Castillo, Jesús M. F.; Ferenczi, Valentin; Moreno, Yolanda

2013-01-01

We continue the study of Uniformly Finitely Extensible Banach spaces (in short, UFO) initiated in Moreno-Plichko, \\emph{On automorphic Banach spaces}, Israel J. Math. 169 (2009) 29--45 and Castillo-Plichko, \\emph{Banach spaces in various positions.} J. Funct. Anal. 259 (2010) 2098-2138. We show that they have the Uniform Approximation Property of Pe\\l czy\\'nski and Rosenthal and are compactly extensible. We will also consider their connection with the automorphic space problem of Lindenstraus...

Characterizing and modelling the radionuclide transport properties of fracture zones in plutonic rocks of the Canadian Shield

International Nuclear Information System (INIS)

Davison, C.C.; Kozak, E.T.; Frost, L.H.; Everitt, R.A.; Brown, A.; Gascoyne, M.; Scheier, N.W.

1999-01-01

Plutonic rocks of the Canadian Shield were investigated as a potential host medium for nuclear fuel waste disposal of used CANDU nuclear fuel. Field investigations at several geologic research areas on the Shield have shown that major fracture zones are the dominant pathways for the large scale movement of groundwater and solutes through plutonic rock bodies. Because of this, a significant amount of the geoscience work has focused on methods to identify, characterize and model the radionuclide transport properties of major fracture zones in the fractured plutonic rocks of the Shield. In order to quantify the transport properties of such fracture zones a series of, groundwater tracer tests were performed over a period of several years in several major, low dipping fracture zones. Sixteen tracer tests were performed using dipole recirculation methods to evaluate transport over distance scales ranging from 17 m to 700 m. It was concluded that only tracer tests can provide useful estimates of the effective porosity and dispersivity characteristics of these large fracture zones in plutonic rocks of the Canadian Shield. (author)

Evaluation of bacterial nanocellulose-based uniform wound dressing for large area skin transplantation

Energy Technology Data Exchange (ETDEWEB)

Fu, Lina [Department of Biomedical Engineering, College of Life Science and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); National Engineering Research Center for Nano-Medicine, Huazhong University of Science and Technology, Wuhan 430074 (China); Zhou, Ping [Institute of Organ Transplant of Tongji Hospital, Huazhong University of Science and Technology, Wuhan (China); Zhang, Shengmin [Advanced Biomaterials and Tissue Engineering Center, Huazhong University of Science and Technology, Wuhan (China); Yang, Guang, E-mail: yang_sunny@yahoo.com [Department of Biomedical Engineering, College of Life Science and Technology, Huazhong University of Science and Technology, Wuhan 430074 (China); National Engineering Research Center for Nano-Medicine, Huazhong University of Science and Technology, Wuhan 430074 (China)

2013-07-01

Bacterial nanocellulose (BNC) was biosynthesized by Gluconacetobacter xylinus. The surface area, physicochemical structure and morphology of the materials were characterized. Here provides a method for an efficient production of uniform BNC, which is beneficial for the fast characterization and evaluation of BNC. In vitro cytotoxicity of the materials was evaluated by the proliferation, the adhesion, the viability and the morphology of NIH/3T3 cells. Low cytotoxicity of the BNC was observed, and micrographs demonstrate a good proliferation and adhesion of NIH/3T3 cells on BNC. Large area full-thickness skin defects were made on the back of C57BL/6 mice in animal surgery. The wounds were transplanted with BNC films and the results compared to those in a control group. The rehabilitation of the wound surfaces and the pathological sections of mice were investigated and are discussed. Histological examinations demonstrated faster and better healing effect and lower inflammatory response in the BNC group than those in the control group. Preliminary results on wound dressings from BNC show a curative effect promoting the healing of epithelial tissue. BNC is a promising natural polymer with medical applications in wound dressings. - Highlights: • BNC is expected to be a promising material in wound healing and skin transplantation. • We studied surface area, physicochemical structures and morphology of uniform BNC. • Cyto-evaluation results of BNC-based wound dressing show a good biocompatibility. • Large area skin transplantation experiments suggest a good performance of healing.

Evaluation of bacterial nanocellulose-based uniform wound dressing for large area skin transplantation

International Nuclear Information System (INIS)

Fu, Lina; Zhou, Ping; Zhang, Shengmin; Yang, Guang

2013-01-01

Bacterial nanocellulose (BNC) was biosynthesized by Gluconacetobacter xylinus. The surface area, physicochemical structure and morphology of the materials were characterized. Here provides a method for an efficient production of uniform BNC, which is beneficial for the fast characterization and evaluation of BNC. In vitro cytotoxicity of the materials was evaluated by the proliferation, the adhesion, the viability and the morphology of NIH/3T3 cells. Low cytotoxicity of the BNC was observed, and micrographs demonstrate a good proliferation and adhesion of NIH/3T3 cells on BNC. Large area full-thickness skin defects were made on the back of C57BL/6 mice in animal surgery. The wounds were transplanted with BNC films and the results compared to those in a control group. The rehabilitation of the wound surfaces and the pathological sections of mice were investigated and are discussed. Histological examinations demonstrated faster and better healing effect and lower inflammatory response in the BNC group than those in the control group. Preliminary results on wound dressings from BNC show a curative effect promoting the healing of epithelial tissue. BNC is a promising natural polymer with medical applications in wound dressings. - Highlights: • BNC is expected to be a promising material in wound healing and skin transplantation. • We studied surface area, physicochemical structures and morphology of uniform BNC. • Cyto-evaluation results of BNC-based wound dressing show a good biocompatibility. • Large area skin transplantation experiments suggest a good performance of healing

Solving the equation of neutron transport

International Nuclear Information System (INIS)

Nasfi, Rim

2009-01-01

This work is devoted to the study of some numerical methods of resolution of the problem of transport of the neutrons. We started by introducing the equation integro-differential transport of the neutrons. Then we applied the finite element method traditional for stationary and nonstationary linear problems in 2D. A great part is reserved for the presentation of the mixed numerical diagram and mixed hybrid with two types of uniform grids: triangular and rectangular. Thereafter we treated some numerical examples by implementations in Matlab in order to test the convergence of each method. To finish, we had results of simulation by the Monte Carlo method on a problem of two-dimensional transport with an aim of comparing them with the results resulting from the finite element method mixed hybrids. Some remarks and prospects conclude this work.

22 CFR 214.42 - Uniform pay guidelines.

Science.gov (United States)

2010-04-01

... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Uniform pay guidelines. 214.42 Section 214.42... Advisory Committees § 214.42 Uniform pay guidelines. (a) A.I.D. follows OMB/CSC guidelines in section 11 of... experts, their compensation shall be fixed in accordance with CSC guidelines and regulations, and the...

Linking of uniform random polygons in confined spaces

Science.gov (United States)

Arsuaga, J.; Blackstone, T.; Diao, Y.; Karadayi, E.; Saito, M.

2007-03-01

In this paper, we study the topological entanglement of uniform random polygons in a confined space. We derive the formula for the mean squared linking number of such polygons. For a fixed simple closed curve in the confined space, we rigorously show that the linking probability between this curve and a uniform random polygon of n vertices is at least 1-O\\big(\\frac{1}{\\sqrt{n}}\\big) . Our numerical study also indicates that the linking probability between two uniform random polygons (in a confined space), of m and n vertices respectively, is bounded below by 1-O\\big(\\frac{1}{\\sqrt{mn}}\\big) . In particular, the linking probability between two uniform random polygons, both of n vertices, is bounded below by 1-O\\big(\\frac{1}{n}\\big) .

An NDE Approach for Characterizing Quality Problems in Polymer Matrix Composites

Science.gov (United States)

Roth, Don J.; Baaklini, George Y.; Sutter, James K.; Bodis, James R.; Leonhardt, Todd A.; Crane, Elizabeth A.

1994-01-01

Polymer matrix composite (PMC) materials are periodically identified appearing optically uniform but containing a higher than normal level of global nonuniformity as indicated from preliminary ultrasonic scanning. One such panel was thoroughly examined by nondestructive (NDE) and destructive methods to quantitatively characterize the nonuniformity. The NDE analysis of the panel was complicated by the fact that the panel was not uniformly thick. Mapping of ultrasonic velocity across a region of the panel in conjunction with an error analysis was necessary to (1) characterize properly the porosity gradient that was discovered during destructive analyses and (2) account for the thickness variation effects. Based on this study, a plan for future NDE characterization of PMC's is presented to the PMC community.

Compliance assurance in the field of radioactive material transport in Russia

International Nuclear Information System (INIS)

Ershov, V.; Syssoev, M.

1999-01-01

The main provisions of the system of compliance assurance, as understood in the IAEA Safety Regulations, are presented in this article as they are applied in Russia in the field of transport of radioactive materials. The urgency of the development and enactment of the uniform programme of compliance assurance in this area is underlined since it is foreseen by the new national regulations for the safety of radioactive material transport in Russia. (author)

Cold-Water Immersion for Hyperthermic Humans Wearing American Football Uniforms.

Science.gov (United States)

Miller, Kevin C; Swartz, Erik E; Long, Blaine C

2015-08-01

Current treatment recommendations for American football players with exertional heatstroke are to remove clothing and equipment and immerse the body in cold water. It is unknown if wearing a full American football uniform during cold-water immersion (CWI) impairs rectal temperature (Trec) cooling or exacerbates hypothermic afterdrop. To determine the time to cool Trec from 39.5°C to 38.0°C while participants wore a full American football uniform or control uniform during CWI and to determine the uniform's effect on Trec recovery postimmersion. Crossover study. Laboratory. A total of 18 hydrated, physically active, unacclimated men (age = 22 ± 3 years, height = 178.8 ± 6.8 cm, mass = 82.3 ± 12.6 kg, body fat = 13% ± 4%, body surface area = 2.0 ± 0.2 m(2)). Participants wore the control uniform (undergarments, shorts, crew socks, tennis shoes) or full uniform (control plus T-shirt; tennis shoes; jersey; game pants; padding over knees, thighs, and tailbone; helmet; and shoulder pads). They exercised (temperature approximately 40°C, relative humidity approximately 35%) until Trec reached 39.5°C. They removed their T-shirts and shoes and were then immersed in water (approximately 10°C) while wearing each uniform configuration; time to cool Trec to 38.0°C (in minutes) was recorded. We measured Trec (°C) every 5 minutes for 30 minutes after immersion. Time to cool from 39.5°C to 38.0°C and Trec. The Trec cooled to 38.0°C in 6.19 ± 2.02 minutes in full uniform and 8.49 ± 4.78 minutes in control uniform (t17 = -2.1, P = .03; effect size = 0.48) corresponding to cooling rates of 0.28°C·min(-1) ± 0.12°C·min(-1) in full uniform and 0.23°C·min(-1) ± 0.11°C·min(-1) in control uniform (t17 = 1.6, P = .07, effect size = 0.44). The Trec postimmersion recovery did not differ between conditions over time (F1,17 = 0.6, P = .59). We speculate that higher skin temperatures before CWI, less shivering, and greater conductive cooling explained the faster cooling

Deformation and transport of micro-fibers and helices in viscous flows

Science.gov (United States)

Lindner, Anke

Fluid-structure interactions between flexible objects and viscous flows are, to a large extent, governed by the shape of the flexible object. Using microfabrication methods, we obtain complex ``particles'' in fiber and helix form with perfect control not only over the material properties, but also the particle geometry. We then perform an experimental study on the deformation and transport of these particles in microfluidic flows. Fibers are shown to drift laterally in confined flows due to the transport anisotropy of the elongated object. When these fibers interact with lateral walls, complex dynamics are observed, such as fiber oscillation. Fiber flexibility modifies these dynamics. Flexible microhelices are easily stretched by a viscous flow and we characterize the overall shape as a function of the frictional properties. The deformation of these helices is well-described by non-linear finite extensibility. Due to the non-uniform distribution of the pitch of a helix subject to viscous drag, linear and nonlinear behavior is identified along the contour length of a single helix. When a polymer solution is used for the viscous flow, an interesting multiscale problem arises and the typical polymer size needs to be compared not only to the global size of the helix, but also to the dimensions of the ribbon.

Transport of Terrestrial gamma-Radiation in Plane Semi-Infinite Geometry

DEFF Research Database (Denmark)

Kirkegaard, Peter; Løvborg, Leif

1980-01-01

The plane one-dimensional photon transport equation is solved for the scattered γ-radiation flux in the case of two adjacent media. One medium represents a natural ground with uniformly distributed potassium, uranium, and thorium γ-ray emitters. The other medium is air with no radioactive contami...

A comparison on the heat load of HTS current leads with respect to uniform and non-uniform cross-sectional areas

Energy Technology Data Exchange (ETDEWEB)

Han, Seung Hak; Nam, Seok Ho; Lee, Je Yull; Song, Seung Hyun; Jeon, Hae Ryong; Baek, Geon Woo; Ko, Tae Kuk [Yonsei University, Seoul (Korea, Republic of); Kang, Hyoung Ku [Korea National University of Transportation, Chungju (Korea, Republic of)

2017-09-15

Current lead is a device that connects the power supply and superconducting magnets. High temperature superconductor (HTS) has lower thermal conductivity and higher current density than normal metal. For these reasons, the heat load can be reduced by replacing the normal metal of the current lead with the HTS. Conventional HTS current lead has same cross-sectional area in the axial direction. However, this is over-designed at the cold-end (4.2 K) in terms of current. The heat load can be reduced by reducing this part because the heat load is proportional to the cross-sectional area. Therefore, in this paper, heat load was calculated from the heat diffusion equation of HTS current leads with uniform and non-uniform cross-sectional areas. The cross-sectional area of the warm-end (65K) is designed considering burnout time when cooling system failure occurs. In cold-end, Joule heat and heat load due to current conduction occurs at the same time, so the cross-sectional area where the sum of the two heat is minimum is obtained. As a result of simulation, current leads for KSTAR TF coils with uniform and non-uniform cross-sectional areas were designed, and it was confirmed that the non-uniform cross-sectional areas could further reduce the heat load.

Synthesis, Characterization and Transport Properties of Novel Ion-exchange Nanocomposite Membrane Containing In-situ Formed ZnO Nanoparticles

Directory of Open Access Journals (Sweden)

F. Heidary

2015-10-01

Full Text Available A  new  type  of  cation-exchange  nanocomposite  membranes  was prepared  by  in-situ  formation  of  ZnO  nanoparticles  in  a  blend containing  sulfonated  poly  (2,6-dimethyl-1,4-phenylene  oxide  and sulfonated polyvinylchloride  via  a  simple  one-step  chemical method.  As-synthesized  nanocomposite  membranes were characterized  using  Fourier  transform  infrared  spectroscopy, scanning  electron  microscopy  and X-ray  diffraction.  The  SEM images  showed  that  ZnO  nanoparticles  were  uniformly  dispersed throughout the polymeric matrices. The effect of additive loading on physicochemical and electrochemical properties of prepared cation-exchange  nanocomposite  membranes  was  studied.  Various characterizations revealed that  the  incorporation  of  different amounts  of  ZnO  nanoparticles  into  the  basic  membrane  structure had a significant influence on the membrane performance and could improve the electrochemical properties.

Characterization of active ion transport across primary rabbit corneal epithelial cell layers (RCrECL) cultured at an air-interface.

Science.gov (United States)

Chang-Lin, Joan-En; Kim, Kwang-Jin; Lee, Vincent H L

2005-06-01

Previously, we reported the development of a primary culture model of tight rabbit corneal epithelial cell layers (RCrECL) characterizing bioelectric parameters, morphology, cytokeratin, and passive permeability. In the present study, we specifically evaluated the active ion transport processes of RCrECL cultured from either pigmented or albino rabbits. Primary cultured RCrECL were grown at an air-interface on Clear-Snapwells precoated with collagen/fibronectin/laminin and mounted in a modified Ussing-type chamber for the evaluation of their active ion transport processes under short-circuited conditions. Contribution of active Na(+) and Cl(-) transport to overall short-circuit current (I(sc)) was evaluated by removing Na(+) and Cl(-), respectively, from bathing fluids of RCrECL and measurements of net fluxes of Na(+) and Cl(-) using (22)Na and (36)Cl, respectively. Amiloride and benzamil were used to determine the role of apical Na(+)-channel activities to net Na(+) fluxes. N-phenylanthranilic acid (NPAA), ouabain, BaCl(2) and bumetanide were used to determine the role of basolateral Na,K-ATPase, apical Cl(-)-channel, and basolateral K(+)-channel and Na(+)(K(+))2Cl(-)-cotransporter activities, respectively, in active ion transport across RCrECL. I(sc) of RCrECL derived from pigmented rabbits was comprised of 64+/-2% and 44+/-5% for active Na(+) and Cl(-) transport, respectively, consistent with net Na(+) absorption and Cl(-) secretion of 0.062+/-0.006 and 0.046+/-0.008 muEq/cm(2)/hr estimated from radionuclide fluxes. Apical amiloride and benzamil inhibited I(sc) by up to approximately 50% with an IC(50) of 1 and 0.1 microm, respectively, consistent with participation of apical epithelial Na(+)-channels to net Na(+) absorption across RCrECL cultured from pigmented rabbits. Addition of ouabain to the basolateral, NPAA to the apical, BaCl(2) to the basolateral and bumetanide to basolateral fluid decreased I(sc) by 86+/-1.5%, 53+/-3%, 18+/-1.8% and 13+/-1.9% in RCr

Mechanical transport in two-dimensional networks of fractures

International Nuclear Information System (INIS)

Endo, H.K.

1984-04-01

The objectives of this research are to evaluate directional mechanical transport parameters for anisotropic fracture systems, and to determine if fracture systems behave like equivalent porous media. The tracer experiments used to measure directional tortuosity, longitudinal geometric dispersivity, and hydraulic effective porosity are conducted with a uniform flow field and measurements are made from the fluid flowing within a test section where linear length of travel is constant. Since fluid flow and mechanical transport are coupled processes, the directional variations of specific discharge and hydraulic effective porosity are measured in regions with constant hydraulic gradients to evaluate porous medium equivalence for the two processes, respectively. If the fracture region behaves like an equivalent porous medium, the system has the following stable properties: (1) specific discharge is uniform in any direction and can be predicted from a permeability tensor; and (2) hydraulic effective porosity is directionally stable. Fracture systems with two parallel sets of continuous fractures satisfy criterion 1. However, in these systems hydraulic effective porosity is directionally dependent, and thus, criterion 2 is violated. Thus, for some fracture systems, fluid flow can be predicted using porous media assumptions, but it may not be possible to predict transport using porous media assumptions. Two discontinuous fracture systems were studied which satisfied both criteria. Hydraulic effective porosity for both systems has a value between rock effective porosity and total porosity. A length-density analysis (LDS) of Canadian fracture data shows that porous media equivalence for fluid flow and transport is likely when systems have narrow aperture distributions. 54 references, 90 figures, 7 tables

Oscillations, complex spatiotemporal behavior, and information transport in networks of excitatory and inhibitory neurons

International Nuclear Information System (INIS)

Destexhe, A.

1994-01-01

Various types of spatiotemporal behavior are described for two-dimensional networks of excitatory and inhibitory neurons with time delayed interactions. It is described how the network behaves as several structural parameters are varied, such as the number of neurons, the connectivity, and the values of synaptic weights. A transition from spatially uniform oscillations to spatiotemporal chaos via intermittentlike behavior is observed. The properties of spatiotemporally chaotic solutions are investigated by evaluating the largest positive Lyapunov exponent and the loss of correlation with distance. Finally, properties of information transport are evaluated during uniform oscillations and spatiotemporal chaos. It is shown that the diffusion coefficient increases significantly in the spatiotemporal phase similar to the increase of transport coefficients at the onset of fluid turbulence. It is proposed that such a property should be seen in other media, such as chemical turbulence or networks of oscillators. The possibility of measuring information transport from appropriate experiments is also discussed

Compliance assurance for the safe transport of radioactive material

International Nuclear Information System (INIS)

1994-01-01

The purpose of this book is to assist competent authorities in the development and maintenance of compliance assurance programmes in connection with the transport of radioactive material, and to assist applicants, licensees and organizations in their interactions, with competent authorities. In order to increase co-operation between competent authorities and to promote uniform application of international regulations and recommendations it is desirable to adopt a common approach to regulatory activities. This book is intended to assist in accomplishing such uniform application by laying down most of the actions that competent authorities need to provide for in their programmes for ensuring regulatory compliance. 23 refs, figs and tabs

Uniform irradiation of irregularly shaped cavities for photodynamic therapy.

Science.gov (United States)

Rem, A I; van Gemert, M J; van der Meulen, F W; Gijsbers, G H; Beek, J F

1997-03-01

It is difficult to achieve a uniform light distribution in irregularly shaped cavities. We have conducted a study on the use of hollow 'integrating' moulds for more uniform light delivery of photodynamic therapy in irregularly shaped cavities such as the oral cavity. Simple geometries such as a cubical box, a sphere, a cylinder and a 'bottle-neck' geometry have been investigated experimentally and the results have been compared with computed light distributions obtained using the 'radiosity method'. A high reflection coefficient of the mould and the best uniform direct irradiance possible on the inside of the mould were found to be important determinants for achieving a uniform light distribution.

Spatial correlation characterization of a uniform circular array in 3D MIMO systems

KAUST Repository

Nadeem, Qurrat-Ul-Ain; Kammoun, Abla; Debbah, Merouane; Alouini, Mohamed-Slim

2016-01-01

In this paper, we consider a uniform circular array (UCA) of directional antennas at the base station (BS) and the mobile station (MS) and derive an exact closed-form expression for the spatial correlation present in the 3D multiple-input multiple-output (MIMO) channel constituted by these arrays. The underlying method leverages the mathematical convenience of the spherical harmonic expansion (SHE) of plane waves and the trigonometric expansion of Legendre and associated Legendre polynomials. In contrast to the existing results, this generalized closed-form expression is independent of the form of the underlying angular distributions and antenna patterns. Moreover, the incorporation of the elevation dimension into the antenna pattern and channel model renders the proposed expression extremely useful for the performance evaluation of 3D MIMO systems in the future. Verification is achieved with the help of simulation results, which highlight the dependence of the spatial correlation on channel and array parameters. An interesting interplay between the mean angle of departure (AoD), angular spread and the positioning of antennas in the array is demonstrated. © 2016 IEEE.

Spatial correlation characterization of a uniform circular array in 3D MIMO systems

KAUST Repository

Nadeem, Qurrat-Ul-Ain

2016-08-11

In this paper, we consider a uniform circular array (UCA) of directional antennas at the base station (BS) and the mobile station (MS) and derive an exact closed-form expression for the spatial correlation present in the 3D multiple-input multiple-output (MIMO) channel constituted by these arrays. The underlying method leverages the mathematical convenience of the spherical harmonic expansion (SHE) of plane waves and the trigonometric expansion of Legendre and associated Legendre polynomials. In contrast to the existing results, this generalized closed-form expression is independent of the form of the underlying angular distributions and antenna patterns. Moreover, the incorporation of the elevation dimension into the antenna pattern and channel model renders the proposed expression extremely useful for the performance evaluation of 3D MIMO systems in the future. Verification is achieved with the help of simulation results, which highlight the dependence of the spatial correlation on channel and array parameters. An interesting interplay between the mean angle of departure (AoD), angular spread and the positioning of antennas in the array is demonstrated. © 2016 IEEE.

Metabolism and transport studies of exogenous compounds thanks to 13C uniform isotopic enrichment

International Nuclear Information System (INIS)

Bravin, F.

2008-12-01

The study of many exogenous compounds does not raise difficulties when they are isolated, purified and in quantities sufficient for the usual detection methods used in biology (Chromatography, NMR, Mass Spectrometry, etc). When they are found in a biological fluid (blood, urines,..), they are often in infinitesimal amount such as the effect of their biological matrices or the background noise that make their detection and their quantification very delicate. The use of internal standards uniformly enriched with carbon 13 and/or nitrogen 15 makes it possible to obtain a signal more easily recognizable and identifiable thanks to the presence of the isotopes (peaks shifted in a mass spectrum for example). This is why, complementary to the analytical and biochemical studies of zearalenone (ZEN) metabolism, we were interested in building mass spectra of molecules enriched (rates between 0 and 1) by various isotopes ( 13 C, 15 N, 18 O and 2 H). In parallel we studied the influence of the 13 C enrichment on the reactivity of a given molecule, from a theoretical and an experimental point of view. (author)

Current transport in graphene/AlGaN/GaN vertical heterostructures probed at nanoscale.

Science.gov (United States)

Fisichella, Gabriele; Greco, Giuseppe; Roccaforte, Fabrizio; Giannazzo, Filippo

2014-08-07

Vertical heterostructures combining two or more graphene (Gr) layers separated by ultra-thin insulating or semiconductor barriers represent very promising systems for next generation electronics devices, due to the combination of high speed operation with wide-range current modulation by a gate bias. They are based on the specific mechanisms of current transport between two-dimensional-electron-gases (2DEGs) in close proximity. In this context, vertical devices formed by Gr and semiconductor heterostructures hosting an "ordinary" 2DEG can be also very interesting. In this work, we investigated the vertical current transport in Gr/Al(0.25)Ga(0.75)N/GaN heterostructures, where Gr is separated from a high density 2DEG by a ∼ 24 nm thick AlGaN barrier layer. The current transport from Gr to the buried 2DEG was characterized at nanoscale using conductive atomic force microscopy (CAFM) and scanning capacitance microscopy (SCM). From these analyses, performed both on Gr/AlGaN/GaN and on AlGaN/GaN reference samples using AFM tips with different metal coatings, the Gr/AlGaN Schottky barrier height ΦB and its lateral uniformity were evaluated, as well as the variation of the carrier densities of graphene (ngr) and AlGaN/GaN 2DEG (ns) as a function of the applied bias. A low Schottky barrier (∼ 0.40 eV) with excellent spatial uniformity was found at the Gr/AlGaN interface, i.e., lower compared to the measured values for metal/AlGaN contacts, which range from ∼ 0.6 to ∼ 1.1 eV depending on the metal workfunction. The electrical behavior of the Gr/AlGaN contact has been explained by Gr interaction with AlGaN donor-like surface states located in close proximity, which are also responsible of high n-type Gr doping (∼ 1.3 × 10(13) cm(-2)). An effective modulation of ns by the Gr Schottky contact was demonstrated by capacitance analysis under reverse bias. From this basic understanding of transport properties in Gr/AlGaN/GaN heterostructures, novel vertical field effect

Synthesis of uniform CdS nanowires in high yield and its single nanowire electrical property

International Nuclear Information System (INIS)

Yan Shancheng; Sun Litao; Qu Peng; Huang Ninping; Song Yinchen; Xiao Zhongdang

2009-01-01

Large-scale high quality CdS nanowires with uniform diameter were synthesized by using a rapid and simple solvothermal route. Field emission scan electron microscopy (FESEM) and transmission electron microscopy (TEM) images show that the CdS nanowires have diameter of about 26 nm and length up to several micrometres. High resolution TEM (HRTEM) study indicates the single-crystalline nature of CdS nanowires with an oriented growth along the c-axis direction. The optical properties of the products were characterized by UV-vis absorption spectra, photoluminescence spectra and Raman spectra. The resistivity, electron concentration and electron mobility of single NW are calculated by fitting the symmetric I-V curves measured on single NW by the metal-semiconductor-metal model based on thermionic field emission theory. - Graphical abstract: Large-scale high quality CdS nanowires (NWs) with uniform diameter were synthesized by using a rapid and simple solvothermal route. The reaction time is reduced to 2 h, comparing to other synthesis which needed long reaction time up to 12 h. In addition, the as-prepared CdS nanowires have more uniform diameter and high yield. More importantly, the I-V curve of present single CdS nanowire has a good symmetric characteristic as expected by the theory.

Non-Uniformity Correction Using Nonlinear Characteristic Performance Curves for Calibration

Science.gov (United States)

Lovejoy, McKenna Roberts

Infrared imaging is an expansive field with many applications. Advances in infrared technology have lead to a greater demand from both commercial and military sectors. However, a known problem with infrared imaging is its non-uniformity. This non-uniformity stems from the fact that each pixel in an infrared focal plane array has its own photoresponse. Many factors such as exposure time, temperature, and amplifier choice affect how the pixels respond to incoming illumination and thus impact image uniformity. To improve performance non-uniformity correction (NUC) techniques are applied. Standard calibration based techniques commonly use a linear model to approximate the nonlinear response. This often leaves unacceptable levels of residual non-uniformity. Calibration techniques often have to be repeated during use to continually correct the image. In this dissertation alternates to linear NUC algorithms are investigated. The goal of this dissertation is to determine and compare nonlinear non-uniformity correction algorithms. Ideally the results will provide better NUC performance resulting in less residual non-uniformity as well as reduce the need for recalibration. This dissertation will consider new approaches to nonlinear NUC such as higher order polynomials and exponentials. More specifically, a new gain equalization algorithm has been developed. The various nonlinear non-uniformity correction algorithms will be compared with common linear non-uniformity correction algorithms. Performance will be compared based on RMS errors, residual non-uniformity, and the impact quantization has on correction. Performance will be improved by identifying and replacing bad pixels prior to correction. Two bad pixel identification and replacement techniques will be investigated and compared. Performance will be presented in the form of simulation results as well as before and after images taken with short wave infrared cameras. The initial results show, using a third order

Astrocytic GABA Transporters

DEFF Research Database (Denmark)

Schousboe, Arne; Wellendorph, Petrine; Frølund, Bente

2017-01-01

, and several of these compounds have been shown to exhibit pronounced anticonvulsant activity in a variety of animal seizure models. As proof of concept of the validity of this drug development approach, one GABA-transport inhibitor, tiagabine, has been developed as a clinically active antiepileptic drug......Inactivation of GABA-mediated neurotransmission is achieved by high-affinity transporters located at both GABAergic neurons and the surrounding astrocytes. Early studies of the pharmacological properties of neuronal and glial GABA transporters suggested that different types of transporters might...... be expressed in the two cell types, and such a scenario was confirmed by the cloning of four distinctly different GABA transporters from a number of different species. These GABA-transport entities have been extensively characterized using a large number of GABA analogues of restricted conformation...

Uniformly irradiated polymer film

International Nuclear Information System (INIS)

Fowler, S.L.

1979-01-01

Irradiated film having substantial uniformity in the radiation dosage profile is produced by irradiating the film within a trough having lateral deflection blocks disposed adjacent the film edges for deflecting electrons toward the surface of the trough bottom for further deflecting the electrons toward the film edge

Uniform color space is not homogeneous

Science.gov (United States)

Kuehni, Rolf G.

2002-06-01

Historical data of chroma scaling and hue scaling are compared and evidence is shown that we do not have a reliable basis in either case. Several data sets indicate explicitly or implicitly that the number of constant sized hue differences between unique hues as well as in the quadrants of the a*, b* diagram differs making what is commonly regarded as uniform color space inhomogeneous. This problem is also shown to affect the OSA-UCS space. A Euclidean uniform psychological or psychophysical color space appears to be impossible.

75 FR 78155 - Uniform Compliance Date for Food Labeling Regulations

Science.gov (United States)

2010-12-15

.... FDA-2000-N-0011] Uniform Compliance Date for Food Labeling Regulations AGENCY: Food and Drug... 1, 2014, as the uniform compliance date for food labeling regulations that are issued between... established January 2, 2012, as the uniform compliance date for food labeling regulations issued between...

The yeast plasma membrane ATP binding cassette (ABC) transporter Aus1: purification, characterization, and the effect of lipids on its activity.

Science.gov (United States)

Marek, Magdalena; Milles, Sigrid; Schreiber, Gabriele; Daleke, David L; Dittmar, Gunnar; Herrmann, Andreas; Müller, Peter; Pomorski, Thomas Günther

2011-06-17

The ATP binding cassette (ABC) transporter Aus1 is expressed under anaerobic growth conditions at the plasma membrane of the yeast Saccharomyces cerevisiae and is required for sterol uptake. These observations suggest that Aus1 promotes the translocation of sterols across membranes, but the precise transport mechanism has yet to be identified. In this study, an extraction and purification procedure was developed to characterize the Aus1 transporter. The detergent-solubilized protein was able to bind and hydrolyze ATP. Mutagenesis of the conserved lysine to methionine in the Walker A motif abolished ATP hydrolysis. Likewise, ATP hydrolysis was inhibited by classical inhibitors of ABC transporters. Upon reconstitution into proteoliposomes, the ATPase activity of Aus1 was specifically stimulated by phosphatidylserine (PS) in a stereoselective manner. We also found that Aus1-dependent sterol uptake, but not Aus1 expression and trafficking to the plasma membrane, was affected by changes in cellular PS levels. These results suggest a direct interaction between Aus1 and PS that is critical for the activity of the transporter.

Synthesis, characterization, and monoamine transporter activity of the new psychoactive substance 3',4'-methylenedioxy-4-methylaminorex (MDMAR).

Science.gov (United States)

McLaughlin, Gavin; Morris, Noreen; Kavanagh, Pierce V; Power, John D; Twamley, Brendan; O'Brien, John; Talbot, Brian; Dowling, Geraldine; Mahony, Olivia; Brandt, Simon D; Patrick, Julian; Archer, Roland P; Partilla, John S; Baumann, Michael H

2015-07-01

The recent occurrence of deaths associated with the psychostimulant cis-4,4'-dimethylaminorex (4,4'-DMAR) in Europe indicated the presence of a newly emerged psychoactive substance on the market. Subsequently, the existence of 3,4-methylenedioxy-4-methylaminorex (MDMAR) has come to the authors' attention and this study describes the synthesis of cis- and trans-MDMAR followed by extensive characterization by chromatographic, spectroscopic, mass spectrometric platforms and crystal structure analysis. MDMAR obtained from an online vendor was subsequently identified as predominantly the cis-isomer (90%). Exposure of the cis-isomer to the mobile phase conditions (acetonitrile/water 1:1 with 0.1% formic acid) employed for high performance liquid chromatography analysis showed an artificially induced conversion to the trans-isomer, which was not observed when characterized by gas chromatography. Monoamine release activities of both MDMAR isomers were compared with the non-selective monoamine releasing agent (+)-3,4-methylenedioxymethamphetamine (MDMA) as a standard reference compound. For additional comparison, both cis- and trans-4,4'-DMAR, were assessed under identical conditions. cis-MDMAR, trans-MDMAR, cis-4,4'-DMAR and trans-4,4'-DMAR were more potent than MDMA in their ability to function as efficacious substrate-type releasers at the dopamine (DAT) and norepinephrine (NET) transporters in rat brain tissue. While cis-4,4'-DMAR, cis-MDMAR and trans-MDMAR were fully efficacious releasing agents at the serotonin transporter (SERT), trans-4,4'-DMAR acted as a fully efficacious uptake blocker. Currently, little information is available about the presence of MDMAR on the market but the high potency of ring-substituted methylaminorex analogues at all three monoamine transporters investigated here might be relevant when assessing the potential for serious side-effects after high dose exposure. Copyright © 2014 John Wiley & Sons, Ltd.

High quality uniform YBCO film growth by the metalorganic deposition using trifluoroacetates

Energy Technology Data Exchange (ETDEWEB)

Wang, S.S., E-mail: wangssh@tsinghua.edu.cn [Key Laboratory of Micro-nano Measurement, Manipulation and Physics (Beihang University), Ministry of Education, Beijing 100191 (China); Beijing Dingchen Superconducting Technology Co., Ltd., Beijing 100084 (China); Zhang, Z.L. [Key Laboratory of Micro-nano Measurement, Manipulation and Physics (Beihang University), Ministry of Education, Beijing 100191 (China); Wang, L. [Applied superconductivity research center, Department of Physics, Tsinghua University, Beijing 100084 (China); Gao, L.K.; Liu, J. [Beijing Dingchen Superconducting Technology Co., Ltd., Beijing 100084 (China)

2017-03-15

Highlights: • High quality double-sided YBCO films are fabricated on LaAlO3 substrates by TFA-MOD method with diameters up to 2 in. • Large area YBCO films were very uniform in microstructure and thickness distribution, an average inductive Jc in excess of 6 MA/cm{sup 2} and low R{sub s} (10 GHz) of 0.3 mΩ at 77 K were obtained. • It will greatly promoted the research and applications of large-area YBCO films by chemical solution method. - Abstract: A need exists for the large-area superconducting YBa{sub 2}Cu{sub 3}O{sub 7-x} (YBCO) films with high critical current density for microwave communication and/or electric power applications. Trifluoroacetic metalorganic (TFA-MOD) method is a promising low cost technique for large-scale production of YBCO films, because it does not need high vacuum device and is easily applicable to substrates of various shape and size. In this paper, double-sided YBCO films with maximum 2 in diameter were prepared on LaAlO{sub 3} substrates by TFA-MOD method. Inductive critical current densitiy J{sub c}, microwave surface resistance R{sub s}, as well as the microstructure were characterized. A newly homemade furnace system was used to epitaxially grown YBCO films, which can improve the uniformity of YBCO film significantly by gas supply and temperature distribution proper design. Results showed that the large area YBCO films were very uniform in microstructure and thickness distribution, an average inductive J{sub c} in excess of 6 MA/cm{sup 2} with uniform distribution, and low R{sub s} (10 GHz) below 0.3 mΩ at 77 K were obtained. Andthe film filter may be prepared to work at temperatures lower than 74 K. These results are very close to the highest value of YBCO films made by conventional vacuum method, so we show a very promising route for large-scale production of high quality large-area YBCO superconducting films at a lower cost.

In-situ testing of aircraft and satellites using a transportable reverberation chamber

NARCIS (Netherlands)

Leferink, Frank Bernardus Johannes

2009-01-01

A transportable reverberation chamber with vibrating walls to create high field strength has been developed, called Vibrating Intrinsic Reverberation Chamber (VIRC). It creates a statistically uniform electromagnetic field without the use of a rotating mode stirrer, resulting in a better homogeneity

Which matrices are immune against the transportation paradox

NARCIS (Netherlands)

Deineko, Vladimir G.; Klinz, Bettina; Woeginger, Gerhard

2003-01-01

We characterize the m×n cost matrices of the transportation problem for which there exist supplies and demands such that the transportation paradox arises. Our characterization is fairly simple and can be verified within O(mn) computational steps. Moreover, we discuss the corresponding question for

Improving the quality factor of an RF spiral inductor with non-uniform metal width and non-uniform coil spacing

International Nuclear Information System (INIS)

Shen Pei; Zhang Wanrong; Huang Lu; Jin Dongyue; Xie Hongyun

2011-01-01

An improved inductor layout with non-uniform metal width and non-uniform spacing is proposed to increase the quality factor (Q factor). For this inductor layout, from outer coil to inner coil, the metal width is reduced by an arithmetic-progression step, while the metal spacing is increased by a geometric-progression step. An improved layout with variable width and changed spacing is of benefit to the Q factor of RF spiral inductor improvement (approximately 42.86%), mainly due to the suppression of eddy-current loss by weakening the current crowding effect in the center of the spiral inductor. In order to increase the Q factor further, for the novel inductor, a patterned ground shield is used with optimized layout together. The results indicate that, in the range of 0.5 to 16 GHz, the Q factor of the novel inductor is at an optimum, which improves by 67% more than conventional inductors with uniform geometry dimensions (equal width and equal spacing), is enhanced by nearly 23% more than a PGS inductor with uniform geometry dimensions, and improves by almost 20% more than an inductor with an improved layout. (semiconductor devices)

Transport of Particle Swarms Through Fractures

Science.gov (United States)

Boomsma, E.; Pyrak-Nolte, L. J.

2011-12-01

The transport of engineered micro- and nano-scale particles through fractured rock is often assumed to occur as dispersions or emulsions. Another potential transport mechanism is the release of particle swarms from natural or industrial processes where small liquid drops, containing thousands to millions of colloidal-size particles, are released over time from seepage or leaks. Swarms have higher velocities than any individual colloid because the interactions among the particles maintain the cohesiveness of the swarm as it falls under gravity. Thus particle swarms give rise to the possibility that engineered particles may be transported farther and faster in fractures than predicted by traditional dispersion models. In this study, the effect of fractures on colloidal swarm cohesiveness and evolution was studied as a swarm falls under gravity and interacts with fracture walls. Transparent acrylic was used to fabricate synthetic fracture samples with either (1) a uniform aperture or (2) a converging aperture followed by a uniform aperture (funnel-shaped). The samples consisted of two blocks that measured 100 x 100 x 50 mm. The separation between these blocks determined the aperture (0.5 mm to 50 mm). During experiments, a fracture was fully submerged in water and swarms were released into it. The swarms consisted of dilute suspensions of either 25 micron soda-lime glass beads (2% by mass) or 3 micron polystyrene fluorescent beads (1% by mass) with an initial volume of 5μL. The swarms were illuminated with a green (525 nm) LED array and imaged optically with a CCD camera. In the uniform aperture fracture, the speed of the swarm prior to bifurcation increased with aperture up to a maximum at a fracture width of approximately 10 mm. For apertures greater than ~15 mm, the velocity was essentially constant with fracture width (but less than at 10 mm). This peak suggests that two competing mechanisms affect swarm velocity in fractures. The wall provides both drag, which

A nu-space for image correlation spectroscopy: characterization and application to measure protein transport in live cells

Science.gov (United States)

Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W.

2013-08-01

We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency (ν, nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for spatio-temporal ICS (STICS) that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins (α6- and αLβ2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and intercellular adhesion molecule 1 (ICAM-1) ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrin-ligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

77 FR 70885 - Uniform Compliance Date for Food Labeling Regulations

Science.gov (United States)

2012-11-28

.... FDA-2000-N-0011] Uniform Compliance Date for Food Labeling Regulations AGENCY: Food and Drug... January 1, 2016, as the uniform compliance date for food labeling regulations that are issued between... established January 1, 2014, as the uniform compliance date for food labeling regulations issued between...

A non-uniform expansion mechanical safety model of the stent.

Science.gov (United States)

Yang, J; Huang, N; Du, Q

2009-01-01

Stents have a serial unstable structure that readily leads to non-uniform expansion. Non-uniform expansion in turn creates a stent safety problem. We explain how a stent may be simplified to a serial unstable structure, and present a method to calculate the non-uniform expansion of the stent on the basis of the serial unstable structure. We propose a safety criterion based on the expansion displacement instead of the strain, and explain that the parameter Rd, the ratio of the maximum displacement of the elements to normal displacement, is meaningful to assess the safety level of the stent. We also examine how laser cutting influences non-uniform expansion. The examples illustrate how to calculate the parameter Rd to assess non-uniform expansion of the stent, and demonstrate how the laser cutting offset and strengthening coefficient of the material influence the stent expansion behaviour. The methods are valuable for assessing stent safety due to non-uniform expansion.

Final technical report for project titled Quantitative Characterization of Cell Aggregation/Adhesion as Predictor for Distribution and Transport of Microorganisms in Subsurface Environment

Energy Technology Data Exchange (ETDEWEB)

Gu, April Z. [Northeastern Univ., Boston, MA (United States); Wan, Kai-tak [Northeastern Univ., Boston, MA (United States)

2014-09-02

This project aims to explore and develop enabling methodology and techniques for nano-scale characterization of microbe cell surface contact mechanics, interactions and adhesion quantities that allow for identification and quantification of indicative properties related to microorganism migration and transport behavior in porous media and in subsurface environments. Microbe transport has wide impact and therefore is of great interest in various environmental applications such as in situ or enhanced subsurface bioremediation,filtration processes for water and wastewater treatments and protection of drinking water supplies. Although great progress has been made towards understanding the identities and activities of these microorganisms in the subsurface, to date, little is known of the mechanisms that govern the mobility and transport of microorganisms in DOE’s contaminated sites, making the outcomes of in situ natural attenuation or contaminant stability enhancement unpredictable. Conventionally, movement of microorganisms was believed to follows the rules governing solute (particle) transport. However, recent studies revealed that cell surface properties, especially those pertaining to cell attachment/adhesion and aggregation behavior, can cause the microbe behavior to deviate from non-viable particles and hence greatly influence the mobility and distribution of microorganisms in porous media.This complexity highlights the need to obtain detailed information of cell-cell and cell-surface interactions in order to improve and refine the conceptual and quantitative model development for fate and transport of microorganisms and contaminant in subsurface. Traditional cell surface characterization methods are not sufficient to fully predict the deposition rates and transport behaviors of microorganism observed. A breakthrough of methodology that would allow for quantitative and molecular-level description of intrinsic cell surface properties indicative for cell

Vertical uniformity of cells and nuclei in epithelial monolayers.

Science.gov (United States)

Neelam, Srujana; Hayes, Peter Robert; Zhang, Qiao; Dickinson, Richard B; Lele, Tanmay P

2016-01-22

Morphological variability in cytoskeletal organization, organelle position and cell boundaries is a common feature of cultured cells. Remarkable uniformity and reproducibility in structure can be accomplished by providing cells with defined geometric cues. Cells in tissues can also self-organize in the absence of directing extracellular cues; however the mechanical principles for such self-organization are not understood. We report that unlike horizontal shapes, the vertical shapes of the cell and nucleus in the z-dimension are uniform in cells in cultured monolayers compared to isolated cells. Apical surfaces of cells and their nuclei in monolayers were flat and heights were uniform. In contrast, isolated cells, or cells with disrupted cell-cell adhesions had nuclei with curved apical surfaces and variable heights. Isolated cells cultured within micron-sized square wells displayed flat cell and nuclear shapes similar to cells in monolayers. Local disruption of nuclear-cytoskeletal linkages resulted in spatial variation in vertical uniformity. These results suggest that competition between cell-cell pulling forces that expand and shorten the vertical cell cross-section, thereby widening and flattening the nucleus, and the resistance of the nucleus to further flattening results in uniform cell and nuclear cross-sections. Our results reveal the mechanical principles of self-organized vertical uniformity in cell monolayers.

Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

Energy Technology Data Exchange (ETDEWEB)

Fanning, J.J.; Kim, K.

1981-01-01

The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment.

Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

International Nuclear Information System (INIS)

Fanning, J.J.; Kim, K.

1981-01-01

The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment

Customer Driven Uniform Manufacture (CDUM) Program. Customer Driven Uniform Management Apparel Research

Science.gov (United States)

2008-11-13

ABSTRACT (Maximum 200 Words) The DLA and DSCP sponsored Customer Driven Uniform Manufacturing (CDUM) program’s primary goals are to reduce total...functions that make decisions or consume apparel items. PDIT’s CDUM assignments were to create the web accessible database, create decision support tools...Manufacturing Monitoring Processes ....................................................40  Figure 32 – Assign Contract to Buyer

Transport Task Force Leadership, Task 4

International Nuclear Information System (INIS)

Callen, J.D.

1991-07-01

The Transport Task Force (TTF) was initiated as a broad-based US magnetic fusion community activity during the fall of 1988 to focus attention on and encourage development of an increased understanding of anomalous transport in tokamaks. The overall TTF goal is to make progress on Characterizing, Understanding and Identifying how to Reduce plasma transport in tokamaks -- to CUIR transport

Characterization of a New Open Jet Wind Tunnel to Optimize and Test Vertical Axis Wind Turbines Using Flow Visualization and Measurement

DEFF Research Database (Denmark)

Tourn, S.; Gilabert, R.; Sánchez, V.

Characterize a new open jet wind tunnel and define the uniform test section where performance studies of small VAWTs will be carried out.......Characterize a new open jet wind tunnel and define the uniform test section where performance studies of small VAWTs will be carried out....

SNPs altering ammonium transport activity of human Rhesus factors characterized by a yeast-based functional assay.

Directory of Open Access Journals (Sweden)

Aude Deschuyteneer

Full Text Available Proteins of the conserved Mep-Amt-Rh family, including mammalian Rhesus factors, mediate transmembrane ammonium transport. Ammonium is an important nitrogen source for the biosynthesis of amino acids but is also a metabolic waste product. Its disposal in urine plays a critical role in the regulation of the acid/base homeostasis, especially with an acid diet, a trait of Western countries. Ammonium accumulation above a certain concentration is however pathologic, the cytotoxicity causing fatal cerebral paralysis in acute cases. Alteration in ammonium transport via human Rh proteins could have clinical outcomes. We used a yeast-based expression assay to characterize human Rh variants resulting from non synonymous single nucleotide polymorphisms (nsSNPs with known or unknown clinical phenotypes and assessed their ammonium transport efficiency, protein level, localization and potential trans-dominant impact. The HsRhAG variants (I61R, F65S associated to overhydrated hereditary stomatocytosis (OHSt, a disease affecting erythrocytes, proved affected in intrinsic bidirectional ammonium transport. Moreover, this study reveals that the R202C variant of HsRhCG, the orthologue of mouse MmRhcg required for optimal urinary ammonium excretion and blood pH control, shows an impaired inherent ammonium transport activity. Urinary ammonium excretion was RHcg gene-dose dependent in mouse, highlighting MmRhcg as a limiting factor. HsRhCG(R202C may confer susceptibility to disorders leading to metabolic acidosis for instance. Finally, the analogous R211C mutation in the yeast ScMep2 homologue also impaired intrinsic activity consistent with a conserved functional role of the preserved arginine residue. The yeast expression assay used here constitutes an inexpensive, fast and easy tool to screen nsSNPs reported by high throughput sequencing or individual cases for functional alterations in Rh factors revealing potential causal variants.

Uniform emergency codes: will they improve safety?

Science.gov (United States)

2005-01-01

There are pros and cons to uniform code systems, according to emergency medicine experts. Uniformity can be a benefit when ED nurses and other staff work at several facilities. It's critical that your staff understand not only what the codes stand for, but what they must do when codes are called. If your state institutes a new system, be sure to hold regular drills to familiarize your ED staff.

Restricting uniformly open surjections

Czech Academy of Sciences Publication Activity Database

Kania, Tomasz; Rmoutil, M.

2017-01-01

Roč. 355, č. 9 (2017), s. 925-928 ISSN 1631-073X Institutional support: RVO:67985840 Keywords : Banach space * uniform spaces Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.396, year: 2016 http://www.sciencedirect.com/science/article/pii/S1631073X17302261?via%3Dihub

7 CFR 51.1447 - Fairly uniform in color.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Fairly uniform in color. 51.1447 Section 51.1447... color. Fairly uniform in color means that 90 percent or more of the kernels in the lot have skin color within the range of one or two color classifications. ...

7 CFR 51.1407 - Fairly uniform in color.

Science.gov (United States)

2010-01-01

... 7 Agriculture 2 2010-01-01 2010-01-01 false Fairly uniform in color. 51.1407 Section 51.1407 Agriculture Regulations of the Department of Agriculture AGRICULTURAL MARKETING SERVICE (Standards... in color. Fairly uniform in color means that the shells do not show sufficient variation in color to...

Experimental characterization of the water transport properties of PEM fuel cells diffusion media

Science.gov (United States)

Ramos-Alvarado, Bladimir; Sole, Joshua D.; Hernandez-Guerrero, Abel; Ellis, Michael W.

2012-11-01

A full experimental characterization of the liquid water transport properties of Toray TGP-090 paper is carried out in this work. Porosity, capillary pressure curves (capillary pressure-saturation relationships), absolute permeability, and relative permeability are obtained via experimental procedures. Porosity was determined using two methods, both aimed to obtain the solid volume of the network of fibers comprising the carbon paper. Capillary pressure curves were obtained using a gas displacement porosimeter where liquid water is injected using a syringe pump and the capillary pressure is recorded using a differential pressure transducer. Absolute and relative permeability were also measured with an apparatus designed at Virginia Tech. Absolute permeability was calculated at different flow rates using nitrogen. On the other hand, relative permeability was a more complicated task to carry out giving the complexity (two-phase flow condition) of this property. All of the water transport properties of Toray TGP-090 were studied under the effects of wet-proofing (PTFE treatment) and compression. Some observations were that wet-proofing reduces the porosity of the raw material, increases the hydrophobicity (Pc-S curves), and reduces the permeability of the material. Similar effects were observed for compression, where compressed material exhibited trends similar to those of wet-proofing effects. The results presented here will allow a more accurate modeling of PEMFCs, providing an experimentally verified alternative to the assumptions frequently employed.

Three dimensional peristaltic flow of hyperbolic tangent fluid in non-uniform channel having flexible walls

Directory of Open Access Journals (Sweden)

M. Ali Abbas

2016-03-01

Full Text Available In this present analysis, three dimensional peristaltic flow of hyperbolic tangent fluid in a non-uniform channel has been investigated. We have considered that the pressure is uniform over the whole cross section and the interial effects have been neglected. For this purpose we consider laminar flow under the assumptions of long wavelength (λ→∞ and creeping flow (Re→0 approximations. The attained highly nonlinear equations are solved with the help of Homotopy perturbation method. The influence of various physical parameters of interest is demonstrated graphically for wall tension, mass characterization, damping nature of the wall, wall rigidity, wall elastance, aspect ratio and the Weissenberg number. In this present investigation we found that the magnitude of the velocity is maximum in the center of the channel whereas it is minimum near the walls. Stream lines are also drawn to discuss the trapping mechanism for all the physical parameters. Comparison has also been presented between Newtonian and non-Newtonian fluid.

Preparation of data relevant to ''Equivalent Uniform Burnup'' and Equivalent Initial Enrichment'' for burnup credit evaluation

Energy Technology Data Exchange (ETDEWEB)

Nomura, Yasushi; Okuno, Hiroshi [Japan Atomic Energy Research Inst., Tokai, Ibaraki (Japan). Tokai Research Establishment; Murazaki, Minoru [Tokyo Nuclear Service Inc., Tokyo (Japan)

2001-11-01

Based on the PWR spent fuel composition data measured at JAERI, two kinds of simplified methods such as ''Equivalent Uniform Burnup'' and ''Equivalent Initial Enrichment'' have been introduced. And relevant evaluation curves have been prepared for criticality safety evaluation of spent fuel storage pool and transport casks, taking burnup of spent fuel into consideration. These simplified methods can be used to obtain an effective neutron multiplication factor for a spent fuel storage/transportation system by using the ORIGEN2.1 burnup code and the KENO-Va criticality code without considering axial burnup profile in spent fuel and other various factors introducing calculated errors. ''Equivalent Uniform Burnup'' is set up for its criticality analysis to be reactivity equivalent with the detailed analysis, in which the experimentally obtained isotopic composition together with a typical axial burnup profile and various factors such as irradiation history are considered on the conservative side. On the other hand, Equivalent Initial Enrichment'' is set up for its criticality analysis to be reactivity equivalent with the detailed analysis such as above when it is used in the so called fresh fuel assumption. (author)

Na cestě ke školní uniformě

OpenAIRE

Koudela, Jindřich

2014-01-01

This work describes a practical and easy way to grasp the steps that must be taken at state (public) elementary school in implementing school uniforms, which are becoming essential tool changes the quality of school culture. Also briefly summarizes the theoretical background and the history of school uniforms not only in Czech Republic but in part also abroad. Submitted known reasons for and against the introduction of school uniforms in elementary schools. It gives examples of public opinion...

EL TRANSPORTE DE CANTIDAD DE MOVIMIENTO EN CANALES

Directory of Open Access Journals (Sweden)

Francisco Jaime Mejía

Full Text Available Este artículo tiene por objeto aplicar el transporte de cantidad de movimiento al flujo en canales como una metodología independiente de otros principios físicos. Así se subsana una carencia de la literatura técnica cuando aborda la interpretación adicional de fenómenos hidráulicos que habitualmente se tratan desde la conservación de la energía. Concluye acerca del comportamiento de la profundidad de flujo en un canal ante diversas condiciones de flujo o variaciones de la profundidad o en presencia de controles hidráulicos. Con la ayuda de la ecuación de transporte de cantidad de movimiento a lo largo de un canal se interpreta el comportamiento del tirante hidráulico en flujo uniforme, en flujo no uniforme con variación gradual y en algunos fenómenos locales de flujo rápidamente variado como ocurre en las transiciones y en el resalto hidráulico. Se obtienen las ecuaciones del resalto hidráulico para calcular la profundidad inicial y secuente, conocida una de las dos, en diversas secciones transversales del canal.

Equivalent (uniform) square field sizes of flattening filter free photon beams

Science.gov (United States)

Lechner, Wolfgang; Kuess, Peter; Georg, Dietmar; Palmans, Hugo

2017-10-01

Various types of treatment units, such as CyberKnife, TomoTherapy and C-arm linear accelerators (LINACs) are operated using flattening filter free (FFF) photon beams. Their reference dosimetry, however, is currently based on codes of practice that provide data which were primarily developed and tested for high-energy photon beams with flattening filter (WFF). The aim of this work was to introduce equivalent uniform square field sizes of FFF beams to serve as a basis of a unified reference dosimetry procedure applicable to all aforementioned FFF machines. For this purpose, in-house determined experimental data together with published data of the ratio of doses at depths of 20 cm and 10 cm in water (D 20,10) were used to characterize the depth dose distribution of 6 and 10 MV WFF and FFF beams. These data were analyzed for field sizes ranging from 2  ×  2 cm2 to 40  ×  40 cm2. A scatter function that takes the lateral profiles of the individual beams into account was fitted to the experimental data. The lateral profiles of the WFF beams were assumed to be uniform, while those of the FFF beams were approximated using fourth or sixth order polynomials. The scatter functions of the FFF beams were recalculated using a uniform lateral profile (the same as the physical profile of the WFF beams), and are henceforth denoted as virtual uniform FFF beams (VUFFF). The field sizes of the VUFFF beams having the same scatter contribution as the corresponding FFF beams at a given field size were defined as the equivalent uniform square field (EQUSF) size. Data from four different LINACs with 18 different beams in total, as well as a CyberKnife beam, were analyzed. The average values of EQUSFs over all investigated LINACs of the conventional 10  ×  10 cm2 reference fields of 6 MV and 10 MV FFF beams for C-arm LINACs and machine-specific reference fields for CyberKnife and TomoTherapy were 9.5 cm, 9 cm, 5.0 cm and 6.5 cm respectively. The

Below-threshold harmonic generation from strong non-uniform fields

Science.gov (United States)

Yavuz, I.

2017-10-01

Strong-field photoemission below the ionization threshold is a rich/complex region where atomic emission and harmonic generation may coexist. We studied the mechanism of below-threshold harmonics (BTH) from spatially non-uniform local fields near the metallic nanostructures. Discrete harmonics are generated due to the broken inversion symmetry, suggesting enriched coherent emission in the vuv frequency range. Through the numerical solution of the time-dependent Schrödinger equation, we investigate wavelength and intensity dependence of BTH. Wavelength dependence identifies counter-regular resonances; individual contributions from the multi-photon emission and channel-closing effects due to quantum path interferences. In order to understand the underlying mechanism of BTH, we devised a generalized semi-classical model, including the influence of Coulomb and non-uniform field interactions. As in uniform fields, Coulomb potential in non-uniform fields is the determinant of BTH; we observed that the generation of BTH are due to returning trajectories with negative energies. Due to large distance effectiveness of the non-uniformity, only long trajectories are noticeably affected.

Uniform random number generators

Science.gov (United States)

Farr, W. R.

1971-01-01

Methods are presented for the generation of random numbers with uniform and normal distributions. Subprogram listings of Fortran generators for the Univac 1108, SDS 930, and CDC 3200 digital computers are also included. The generators are of the mixed multiplicative type, and the mathematical method employed is that of Marsaglia and Bray.

Site study plan for Transportation, Deaf Smith County Site, Texas: Preliminary draft

International Nuclear Information System (INIS)

1987-06-01

This site study plan describes transportation field studies to be conducted during the characterization of the Deaf Smith County, Texas, site for the US Department of Energy's Salt Repository Project. The studies are needed to identify and assess potential project impacts to transportation infrastructure and systems in the project vicinity and along potential transportation routes to the site across the State of Texas. The studies are also needed to locate and design project transportation facilities, and to evaluate and design impact mitigation. After identifying the transportation information requirements needed to comply with Federal, State, and local regulations and repository program requirements, the site study plan describes the study design and rationale, the field data collection procedures and equipment, the data analysis methods and application of results, the data management strategy, the schedule of field activities, the management of the study, and the study's quality assurance program. The field data collection activities are organized into programs for the characterization of site vicinity rail corridors and highway corridors, characterization of alternative statewide transportation routes, monitoring of site characterization effects on transportation, characterization of aircraft overflight patterns and hazardous material transportation patterns, and assessment of emergency response preparedness along alternative statewide transportation routes. 34 refs., 10 figs., 2 tabs

Action at sea: Transport security exercise conducted off the coast of Sweden

International Nuclear Information System (INIS)

Isaksson, Stig; Jawerth, Nicole

2015-01-01

As in an action movie, ships, helicopters and uniformed people set the scene off the coast of Sweden on 6 May 2015 when national authorities conducted an exercise on security while transporting spent nuclear fuel. The exercise was part of a joint project with the IAEA to test and evaluate a new IAEA guide on planning, conducting and evaluating transport security exercises. The test subject and model was the security framework of Sweden’s national nuclear transport system, which regularly ships used fuel from power plants along the coast to the country’s interim storage facility for spent nuclear fuel.

Levitation, coating, and transport of particulate materials

International Nuclear Information System (INIS)

Hendricks, C.D.

1981-01-01

Several processes in various fields require uniformly thick coatings and layers on small particles. The particles may be used as carriers of catalytic materials (platinum or other coatings), as laser fusion targets (various polymer or metallic coatings), or for biological or other tracer or interactive processes. We have devised both molecular beam and electro-dynamic techniques for levitation of the particles during coating and electrodynamic methods of controlling and transporting the particles between coating steps and to final use locations. Both molecular beam and electrodynamic techniques are described and several advantages and limitations of each will be discussed. A short movie of an operating electrodynamic levitation and transport apparatus will be shown

Vibronic coupling effect on the electron transport through molecules

Science.gov (United States)

Tsukada, Masaru; Mitsutake, Kunihiro

2007-03-01

Electron transport through molecular bridges or molecular layers connected to nano-electrodes is determined by the combination of coherent and dissipative processes, controlled by the electron-vibron coupling, transfer integrals between the molecular orbitals, applied electric field and temperature. We propose a novel theoretical approach, which combines ab initio molecular orbital method with analytical many-boson model. As a case study, the long chain model of the thiophene oligomer is solved by a variation approach. Mixed states of moderately extended molecular orbital states mediated and localised by dress of vibron cloud are found as eigen-states. All the excited states accompanied by multiple quanta of vibration can be solved, and the overall carrier transport properties including the conductance, mobility, dissipation spectra are analyzed by solving the master equation with the transition rates estimated by the golden rule. We clarify obtained in a uniform systematic way, how the transport mode changes from a dominantly coherent transport to the dissipative hopping transport.

Design and construction of a uniform magnetic field generator for a 32 channel cosmic ray detector

Science.gov (United States)

Herrera-Guzman, K. N.; Gutierrez-Sanchez, R. A.; Felix, J.; Arceo, L. J.; Araujo, C.

2017-10-01

The trajectory of a particle can be measured if some points of its track are known. This is applied to any kind of particle, including cosmic rays. We have designed and built a device for this purpose. We present the design, construction and characterization of a uniform magnetic field generator system in a finite volume. An array of Cerenkov detectors will be placed inside of it for determining the cosmic rays charge and to reconstruct their trajectories.

Fugitive emission source characterization using a gradient-based optimization scheme and scalar transport adjoint

Science.gov (United States)

Brereton, Carol A.; Joynes, Ian M.; Campbell, Lucy J.; Johnson, Matthew R.

2018-05-01

Fugitive emissions are important sources of greenhouse gases and lost product in the energy sector that can be difficult to detect, but are often easily mitigated once they are known, located, and quantified. In this paper, a scalar transport adjoint-based optimization method is presented to locate and quantify unknown emission sources from downstream measurements. This emission characterization approach correctly predicted locations to within 5 m and magnitudes to within 13% of experimental release data from Project Prairie Grass. The method was further demonstrated on simulated simultaneous releases in a complex 3-D geometry based on an Alberta gas plant. Reconstructions were performed using both the complex 3-D transient wind field used to generate the simulated release data and using a sequential series of steady-state RANS wind simulations (SSWS) representing 30 s intervals of physical time. Both the detailed transient and the simplified wind field series could be used to correctly locate major sources and predict their emission rates within 10%, while predicting total emission rates from all sources within 24%. This SSWS case would be much easier to implement in a real-world application, and gives rise to the possibility of developing pre-computed databases of both wind and scalar transport adjoints to reduce computational time.

Plasma-polymerized alkaline anion-exchange membrane: Synthesis and structure characterization

International Nuclear Information System (INIS)

Hu Jue; Meng Yuedong; Zhang Chengxu; Fang Shidong

2011-01-01

After-glow discharge plasma polymerization was developed for alkaline anion-exchange membranes synthesis using vinylbenzyl chloride as monomer. X-ray photoelectron spectroscopy and attenuated total reflection Fourier transform infrared spectroscopy were used to characterize the chemical structure properties of plasma-polymerized membranes. Ion-exchange capacities of quaternized poly(vinylbenzyl chloride) (QPVBC) membranes were measured to evaluate their capability of hydroxyl ion transport. A mechanism of plasma polymerization using VBC as monomer that accounts for the competitive effects of free radicals polymerization and plasma ablation in the plasma polymerization process was proposed. Our results indicate that plasma discharge power influences the contents of functional groups and the structure of the plasma polymer membranes, which attribute to the coactions of polymerization and ablation. The properties of uniform morphology, good adhesion to the substrate, high thermal stability and satisfying anion conduction level suggest the potential application of QPVBC membrane deposited at discharge power of 20 W in alkaline direct methanol fuel cells.

Ideal flood field images for SPECT uniformity correction

International Nuclear Information System (INIS)

Oppenheim, B.E.; Appledorn, C.R.

1984-01-01

Since as little as 2.5% camera non-uniformity can cause disturbing artifacts in SPECT imaging, the ideal flood field images for uniformity correction would be made with the collimator in place using a perfectly uniform sheet source. While such a source is not realizable the equivalent images can be generated by mapping the activity distribution of a Co-57 sheet source and correcting subsequent images of the source with this mapping. Mapping is accomplished by analyzing equal-time images of the source made in multiple precisely determined positions. The ratio of counts detected in the same region of two images is a measure of the ratio of the activities of the two portions of the source imaged in that region. The activity distribution in the sheet source is determined from a set of such ratios. The more source positions imaged in a given time, the more accurate the source mapping, according to results of a computer simulation. A 1.9 mCi Co-57 sheet source was shifted by 12 mm increments along the horizontal and vertical axis of the camera face to 9 positions on each axis. The source was imaged for 20 min in each position and 214 million total counts were accumulated. The activity distribution of the source, relative to the center pixel, was determined for a 31 x 31 array. The integral uniformity was found to be 2.8%. The RMS error for such a mapping was determined by computer simulation to be 0.46%. The activity distribution was used to correct a high count flood field image for non-uniformities attributable to the Co-57 source. Such a corrected image represents camera plus collimator response to an almost perfectly uniform sheet source

Defense Programs Transportation Risk Assessment

International Nuclear Information System (INIS)

Clauss, D.B.

1994-01-01

This paper provides an overview of the methodology used in a probabilistic transportation risk assessment conducted to assess the probabilities and consequences of inadvertent dispersal of radioactive materials arising from severe transportation accidents. The model was developed for the Defense Program Transportation Risk Assessment (DPTRA) study. The analysis incorporates several enhancements relative to previous risk assessments of hazardous materials transportation including newly-developed statistics on the frequencies and severities of tractor semitrailer accidents and detailed route characterization using the 1990 Census data

Prediction of bedload sediment transport for heterogeneous sediments in shape

Science.gov (United States)

Durafour, Marine; Jarno, Armelle; Le Bot, Sophie; Lafite, Robert; Marin, François

2015-04-01

agreement is found for the non-uniform site between measured fluxes and predictions given by the Wu et al. (2000) model. However, some discrepancies still remain, especially for granules. Hundreds of pictures of grains composing the sediment cover and the bedload discharges are performed. Particle shapes are statistically characterized by three 2D coefficients (circularity, roundness and elongation) after an image processing with the ImageJ software. Present results show a preferential transport of the most circular sediment particles available for transport and reveal that the consideration of particle shape, through the integration of the circularity index in formulations, enhanced the estimations of bedload rates. A new adjustment of the Wu et al. (2000) formula is proposed, which improves significantly the model predictions, especially for granules. Durafour M, Jarno A, Le Bot S, Lafite R, Marin F (2014) Bedload transport for heterogeneous sediments. Environmental Fluid Mechanics. doi: 10.1007/s10652-014-9380-1

Nurses' uniform color and feelings/emotions in school-aged children receiving health care.

Science.gov (United States)

Albert, Nancy M; Burke, Jane; Bena, James F; Morrison, Shannon M; Forney, Jennifer; Krajewski, Susan

2013-04-01

Children may fear nurses wearing white uniforms. When emotions and uniform color were studied in 233 children, many positive emotions were most often associated with blue, bold pink-patterned, or yellow-patterned tops (all p ≤ .002). Negative emotions were not associated with uniform top colors (all p uniform color does not matter," 8 negative emotions were most often associated with white uniform color (p uniform tops were preferred. In conclusion, children's emotions were associated with nurse uniform color. Copyright © 2013 Elsevier Inc. All rights reserved.

Das materialidades da escola: o uniforme escolar On the materialities of school: the school uniform

Directory of Open Access Journals (Sweden)

Ivanir Ribeiro

2012-09-01

Full Text Available Este texto dedica-se a situar o uniforme escolar como objeto histórico e como importante fonte do e no universo escolar. Para tanto, empreende-se uma revisão da literatura que aborda a temática e investe-se em uma reflexão que concebe esse artefato como uma das expressões da materialidade que dá contornos à forma escolar, tomando-o na perspectiva da cultura material. Alguns autores servem aqui de referência: Richard Bucaille, Jean-Marie Pesez e Ulpiano Bezerra de Meneses, nos estudos em que se dedicam à cultura material; Agustín Benito Escolano e Rosa Fátima de Souza, nos trabalhos em que voltam o olhar para cultura material escolar; Inês Dussel e Katiene Nogueira da Silva, autoras que abordam diretamente a questão dos uniformes escolares. Não menos importantes para efeitos deste artigo são os trabalhos que tratam do movimento higienista, particularmente aqueles levados a cabo por José Gondra. Os dados levantados e as reflexões efetuadas indiciam dois movimentos (ou tensões nada desprezíveis. Por um lado, são evidentes as dificuldades encontradas para adoção dos uniformes escolares por todos os alunos, tanto por parte do Estado quanto por parte das famílias, devido ao fato de eles representarem um custo elevado, principalmente os calçados, artigos pouco utilizados pela maioria da população até, no mínimo, meados do século XX. Por outro lado, há indícios de que esse traje desempenhava uma função niveladora importante. Por meio dele, criava-se uma ideia de padronização e democratização do ensino, mesmo que em aparência, além de se dar visibilidade pública a uma instituição social cada vez mais importante: a escola.This text is devoted to situate the school uniform as a historical object, and as an important source on and in the school universe. For that, a literature survey is carried out on this theme, and a reflection is conducted envisaging this artifact as one of the expressions of materiality that

Developing semi-analytical solution for multiple-zone transient storage model with spatially non-uniform storage

Science.gov (United States)

Deng, Baoqing; Si, Yinbing; Wang, Jia

2017-12-01

Transient storages may vary along the stream due to stream hydraulic conditions and the characteristics of storage. Analytical solutions of transient storage models in literature didn't cover the spatially non-uniform storage. A novel integral transform strategy is presented that simultaneously performs integral transforms to the concentrations in the stream and in storage zones by using the single set of eigenfunctions derived from the advection-diffusion equation of the stream. The semi-analytical solution of the multiple-zone transient storage model with the spatially non-uniform storage is obtained by applying the generalized integral transform technique to all partial differential equations in the multiple-zone transient storage model. The derived semi-analytical solution is validated against the field data in literature. Good agreement between the computed data and the field data is obtained. Some illustrative examples are formulated to demonstrate the applications of the present solution. It is shown that solute transport can be greatly affected by the variation of mass exchange coefficient and the ratio of cross-sectional areas. When the ratio of cross-sectional areas is big or the mass exchange coefficient is small, more reaches are recommended to calibrate the parameter.

Irradiation uniformity of spherical targets by multiple uv beams from OMEGA

International Nuclear Information System (INIS)

Beich, W.; Dunn, M.; Hutchison, R.

1984-01-01

Direct-drive laser fusion demands extremely high levels of irradiation uniformity to ensure uniform compression of spherical targets. The assessment of illumination uniformity of targets irradiated by multiple beams from the OMEGA facility is made with the aid of multiple beams spherical superposition codes, which take into account ray tracing and absorption and a detailed knowledge of the intensity distribution of each beam in the target plane. In this report, recent estimates of the irradiation uniformity achieved with 6 and 12 uv beams of OMEGA will be compared with previous measurements in the IR, and predictions will be made for the uv illumination uniformity achievable with 24 beams of OMEGA

Washing and changing uniforms: is guidance being adhered to?

Science.gov (United States)

Potter, Yvonne Camilla; Justham, David

To allay public apprehension regarding the risk of nurses' uniforms transmitting healthcare-associated infections (HCAI), national and local guidelines have been issued to control use, laundry and storage. This paper aims to measure the knowledge of registered nurses (RNs) and healthcare assistants (HCAs) working within a rural NHS foundation Trust and their adherence to the local infection prevention and control (IPC) standard regarding uniforms through a Trust-wide audit. Stratified random sampling selected 597 nursing staff and 399 responded (67%) by completing a short questionnaire based on the local standard. Responses were coded and transferred to SPSS (v. 17) for analysis. The audit found that nursing staff generally adhere to the guidelines, changing their uniforms daily and immediately upon accidental soiling, and wearing plastic aprons where indicated. At home, staff normally machine-wash and then iron their uniforms at the hottest setting. Nevertheless, few observe the local direction to place their newly-laundered uniforms in protective covers. This paper recommends a re-audit to compare compliance rates with baseline figures and further research into the reasons why compliance is lacking to sanction interventions for improvement, such as providing relevant staff education and re-introducing appropriate changing facilities.

Leader propagation in uniform background fields in SF6

International Nuclear Information System (INIS)

Seeger, M; Niemeyer, L; Bujotzek, M

2009-01-01

The breakdown mechanism of compressed SF 6 in gas insulation is known to be controlled by stepped leader propagation. This process is still not well understood in uniform and weakly non-uniform background fields with small electrode protrusions, such as particles or surface roughness. In a previous publication an investigation of partial discharges and breakdown in uniform background fields that focused on streamer and leader inception mechanisms was presented (Seeger et al 2008 J. Phys. D: Appl. Phys. 41 185204). In this paper we present for the first time a physical leader propagation model that consistently describes the observed phenomena in uniform background fields in SF 6 . The model explains two different types of leader breakdown; these can be associated with the precursor and the stem mechanisms. It also yields the parameters of stepped leader propagation, which include step lengths, associated step charges, step times and fields and temperatures in the leader channel. Further, it explains the features of arrested leaders in uniform background fields. The model predicts the range of parameters under which arrested and breakdown leaders occur in good agreement with the experimental data.

Use of Radon for Evaluation of Atmospheric Transport Models: Sensitivity to Emissions

Science.gov (United States)

Gupta, Mohan L.; Douglass, Anne R.; Kawa, S. Randolph; Pawson, Steven

2004-01-01

This paper presents comparative analyses of atmospheric radon (Rn) distributions simulated using different emission scenarios and the observations. Results indicate that the model generally reproduces observed distributions of Rn but there are some biases in the model related to differences in large-scale and convective transport. Simulations presented here use an off-line three-dimensional chemical transport model driven by assimilated winds and two scenarios of Rn fluxes (atom/cm s) from ice-free land surfaces: (A) globally uniform flux of 1.0, and (B) uniform flux of 1.0 between 60 deg. S and 30 deg. N followed by a sharp linear decrease to 0.2 at 70 deg. N. We considered an additional scenario (C) where Rn emissions for case A were uniformly reduced by 28%. Results show that case A overpredicts observed Rn distributions in both hemispheres. Simulated northern hemispheric (NH) Rn distributions from cases B and C compare better with the observations, but are not discernible from each other. In the southern hemisphere, surface Rn distributions from case C compare better with the observations. We performed a synoptic scale source-receptor analysis for surface Rn to locate regions with ratios B/A and B/C less than 0.5. Considering an uncertainty in regional Rn emissions of a factor of two, our analysis indicates that additional measurements of surface Rn particularly during April-October and north of 50 deg. N over the Pacific as well as Atlantic regions would make it possible to determine if the proposed latitude gradient in Rn emissions is superior to a uniform flux scenario.

Modeling and Compensating Temperature-Dependent Non-Uniformity Noise in IR Microbolometer Cameras

Directory of Open Access Journals (Sweden)

Alejandro Wolf

2016-07-01

Full Text Available Images rendered by uncooled microbolometer-based infrared (IR cameras are severely degraded by the spatial non-uniformity (NU noise. The NU noise imposes a fixed-pattern over the true images, and the intensity of the pattern changes with time due to the temperature instability of such cameras. In this paper, we present a novel model and a compensation algorithm for the spatial NU noise and its temperature-dependent variations. The model separates the NU noise into two components: a constant term, which corresponds to a set of NU parameters determining the spatial structure of the noise, and a dynamic term, which scales linearly with the fluctuations of the temperature surrounding the array of microbolometers. We use a black-body radiator and samples of the temperature surrounding the IR array to offline characterize both the constant and the temperature-dependent NU noise parameters. Next, the temperature-dependent variations are estimated online using both a spatially uniform Hammerstein-Wiener estimator and a pixelwise least mean squares (LMS estimator. We compensate for the NU noise in IR images from two long-wave IR cameras. Results show an excellent NU correction performance and a root mean square error of less than 0.25 ∘ C, when the array’s temperature varies by approximately 15 ∘ C.

Characterization of the Temporal-Spatial Variability of Trans-Atlantic Dust Transport Based on CALIPSO Lidar Measurements

Science.gov (United States)

Yu, Hongbin

2015-01-01

The trans-Atlantic dust transport has important implications for human and ecosystem health, the terrestrial and oceanic biogeochemical cycle, weather systems, and climate. A reliable assessment of these influences requires the characterization of dust distributions in three dimensions and over long time periods. We provide an observation-based multiyear estimate of trans-Atlantic dust transport by using a 7-year (2007 - 2013) lidar record from the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) in both cloud-free and above-cloud conditions. We estimate that on a basis of the 7-year average and integration over 10S - 30N, 182 Tg a-1 dust leaves the coast of North Africa at 15W, of which 132 Tg a-1 and 43 Tg a-1 reaches 35W and 75W, respectively. These flux estimates have an overall known uncertainty of (45 - 70). The 7-year average of dust deposition into the Amazon Basin is estimated to be 28 (8 - 48) Tg a-1 or 29 (8 - 50) kg ha-1 a-1. This imported dust could provide about 0.022 (0.006 - 0.037) Tg P of phosphorus per year, equivalent to 23 (7 - 39) g P ha-1 a-1 to fertilize the Amazon rainforest, which is comparable to the loss of phosphorus to rainfall. Significant seasonal variations are observed in both the magnitude of total dust transport and its meridional and vertical distributions. The observed large interannual variability of annual dust transport is highly anti-correlated with the prior-year Sahel Precipitation Index. Comparisons of CALIPSO measurements with surface-based observations and model simulations will also be discussed.

MEASUREMENTS ON, AND MODELING OF DIFFUSIVE AND ADVECTIVE RADON TRANSPORT IN SOIL

NARCIS (Netherlands)

VANDERGRAAF, ER; WITTEMAN, GAA; VANDERSPOEL, WH; ANDERSEN, CE; DEMEIJER, RJ

1994-01-01

Results are presented of measurements on radon transport in soil under controlled conditions with a laboratory facility consisting of a stainless steel vessel (height and diameter 2 m) filled with a uniform column of sand. At several depths under the sand surface, probes are radially inserted into

Transport of Particle Swarms Through Variable Aperture Fractures

Science.gov (United States)

Boomsma, E.; Pyrak-Nolte, L. J.

2012-12-01

Particle transport through fractured rock is a key concern with the increased use of micro- and nano-size particles in consumer products as well as from other activities in the sub- and near surface (e.g. mining, industrial waste, hydraulic fracturing, etc.). While particle transport is often studied as the transport of emulsions or dispersions, particles may also enter the subsurface from leaks or seepage that lead to particle swarms. Swarms are drop-like collections of millions of colloidal-sized particles that exhibit a number of unique characteristics when compared to dispersions and emulsions. Any contaminant or engineered particle that forms a swarm can be transported farther, faster, and more cohesively in fractures than would be expected from a traditional dispersion model. In this study, the effects of several variable aperture fractures on colloidal swarm cohesiveness and evolution were studied as a swarm fell under gravity and interacted with the fracture walls. Transparent acrylic was used to fabricate synthetic fracture samples with (1) a uniform aperture, (2) a converging region followed by a uniform region (funnel shaped), (3) a uniform region followed by a diverging region (inverted funnel), and (4) a cast of a an induced fracture from a carbonate rock. All of the samples consisted of two blocks that measured 100 x 100 x 50 mm. The minimum separation between these blocks determined the nominal aperture (0.5 mm to 20 mm). During experiments a fracture was fully submerged in water and swarms were released into it. The swarms consisted of a dilute suspension of 3 micron polystyrene fluorescent beads (1% by mass) with an initial volume of 5μL. The swarms were illuminated with a green (525 nm) LED array and imaged optically with a CCD camera. The variation in fracture aperture controlled swarm behavior. Diverging apertures caused a sudden loss of confinement that resulted in a rapid change in the swarm's shape as well as a sharp increase in its velocity

A uniform geometrical optics and an extended uniform geometrical theory of diffraction for evaluating high frequency EM fields near smooth caustics and composite shadow boundaries

Science.gov (United States)

Constantinides, E. D.; Marhefka, R. J.

1994-01-01

A uniform geometrical optics (UGO) and an extended uniform geometrical theory of diffraction (EUTD) are developed for evaluating high frequency electromagnetic (EM) fields within transition regions associated with a two and three dimensional smooth caustic of reflected rays and a composite shadow boundary formed by the caustic termination or the confluence of the caustic with the reflection shadow boundary (RSB). The UGO is a uniform version of the classic geometrical optics (GO). It retains the simple ray optical expressions of classic GO and employs a new set of uniform reflection coefficients. The UGO also includes a uniform version of the complex GO ray field that exists on the dark side of the smooth caustic. The EUTD is an extension of the classic uniform geometrical theory of diffraction (UTD) and accounts for the non-ray optical behavior of the UGO reflected field near caustics by using a two-variable transition function in the expressions for the edge diffraction coefficients. It also uniformly recovers the classic UTD behavior of the edge diffracted field outside the composite shadow boundary transition region. The approach employed for constructing the UGO/EUTD solution is based on a spatial domain physical optics (PO) radiation integral representation for the fields which is then reduced using uniform asymptotic procedures. The UGO/EUTD analysis is also employed to investigate the far-zone RCS problem of plane wave scattering from two and three dimensional polynomial defined surfaces, and uniform reflection, zero-curvature, and edge diffraction coefficients are derived. Numerical results for the scattering and diffraction from cubic and fourth order polynomial strips are also shown and the UGO/EUTD solution is validated by comparison to an independent moment method (MM) solution. The UGO/EUTD solution is also compared with the classic GO/UTD solution. The failure of the classic techniques near caustics and composite shadow boundaries is clearly

Characterization of leaky faults

International Nuclear Information System (INIS)

Shan, Chao.

1990-05-01

Leaky faults provide a flow path for fluids to move underground. It is very important to characterize such faults in various engineering projects. The purpose of this work is to develop mathematical solutions for this characterization. The flow of water in an aquifer system and the flow of air in the unsaturated fault-rock system were studied. If the leaky fault cuts through two aquifers, characterization of the fault can be achieved by pumping water from one of the aquifers, which are assumed to be horizontal and of uniform thickness. Analytical solutions have been developed for two cases of either a negligibly small or a significantly large drawdown in the unpumped aquifer. Some practical methods for using these solutions are presented. 45 refs., 72 figs., 11 tabs

Lessons in the Design and Characterization Testing of the Semi-Span Super-Sonic Transport (S4T) Wind-Tunnel Model

Science.gov (United States)

2012-01-01

This paper focuses on some of the more challenging design processes and characterization tests of the Semi-Span Super-Sonic Transport (S4T)-Active Controls Testbed (ACT). The model was successfully tested in four entries in the National Aeronautics and Space Administration Langley Transonic Dynamics Tunnel to satisfy the goals and objectives of the Fundamental Aeronautics Program Supersonic Project Aero-Propulso-Servo-Elastic effort. Due to the complexity of the S4T-ACT, only a small sample of the technical challenges for designing and characterizing the model will be presented. Specifically, the challenges encountered in designing the model include scaling the Technology Concept Airplane to model scale, designing the model fuselage, aileron actuator, and engine pylons. Characterization tests included full model ground vibration tests, wing stiffness measurements, geometry measurements, proof load testing, and measurement of fuselage static and dynamic properties.

Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

KAUST Repository

Lemtiri-Chlieh, Fouad

2013-09-03

The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

KAUST Repository

Lemtiri-Chlieh, Fouad; Ali, Rashid Ayesha

2013-01-01

The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

Predictions of tracer transport in interwell tracer tests at the C-Hole complex. Yucca Mountain site characterization project report milestone 4077

International Nuclear Information System (INIS)

Reimus, P.W.

1996-09-01

This report presents predictions of tracer transport in interwell tracer tests that are to be conducted at the C-Hole complex at the Nevada Test Site on behalf of the Yucca Mountain Site Characterization Project. The predictions are used to make specific recommendations about the manner in which the tracer test should be conducted to best satisfy the needs of the Project. The objective of he tracer tests is to study flow and species transport under saturated conditions in the fractured tuffs near Yucca Mountain, Nevada, the site of a potential high-level nuclear waste repository. The potential repository will be located in the unsaturated zone within Yucca Mountain. The saturated zone beneath and around the mountain represents the final barrier to transport to the accessible environment that radionuclides will encounter if they breach the engineered barriers within the repository and the barriers to flow and transport provided by the unsaturated zone. Background information on the C-Holes is provided in Section 1.1, and the planned tracer testing program is discussed in Section 1.2

MS transport assays for γ-aminobutyric acid transporters--an efficient alternative for radiometric assays.

Science.gov (United States)

Schmitt, Sebastian; Höfner, Georg; Wanner, Klaus T

2014-08-05

Transport assays for neurotransmitters based on radiolabeled substrates are widely spread and often indispensable in basic research and the drug development process, although the use of radioisotopes is inherently coupled to issues concerning radioactive waste and safety precautions. To overcome these disadvantages, we developed mass spectrometry (MS)-based transport assays for γ-aminobutyric acid (GABA), which is the major inhibitory neurotransmitter in the central nervous system (CNS). These "MS Transport Assays" provide all capabilities of [(3)H]GABA transport assays and therefore represent the first substitute for the latter. The performance of our approach is demonstrated for GAT1, the most important GABA transporter (GAT) subtype. As GABA is endogenously present in COS-7 cells employed as hGAT1 expression system, ((2)H6)GABA was used as a substrate to differentiate transported from endogenous GABA. To record transported ((2)H6)GABA, a highly sensitive, short, robust, and reliable HILIC-ESI-MS/MS quantification method using ((2)H2)GABA as an internal standard was developed and validated according to the Center for Drug Evaluation and Research (CDER) guidelines. Based on this LC-MS quantification, a setup to characterize hGAT1 mediated ((2)H6)GABA transport in a 96-well format was established, that enables automated processing and avoids any sample preparation. The K(m) value for ((2)H6)GABA determined for hGAT1 is in excellent agreement with results obtained from [(3)H]GABA uptake assays. In addition, the established assay format enables efficient determination of the inhibitory potency of GAT1 inhibitors, is capable of identifying those inhibitors transported as substrates, and furthermore allows characterization of efflux. The approach described here combines the strengths of LC-MS/MS with the high efficiency of transport assays based on radiolabeled substrates and is applicable to all GABA transporter subtypes.

Uniform gradient expansions

CERN Document Server

Giovannini, Massimo

2015-01-01

Cosmological singularities are often discussed by means of a gradient expansion that can also describe, during a quasi-de Sitter phase, the progressive suppression of curvature inhomogeneities. While the inflationary event horizon is being formed the two mentioned regimes coexist and a uniform expansion can be conceived and applied to the evolution of spatial gradients across the protoinflationary boundary. It is argued that conventional arguments addressing the preinflationary initial conditions are necessary but generally not sufficient to guarantee a homogeneous onset of the conventional inflationary stage.

Uniform irradiation system using beam scanning method for cyclotron

International Nuclear Information System (INIS)

Agematsu, Takashi; Okumura, Susumu; Arakawa, Kazuo

1994-03-01

JAERI AVF-cyclotron is equipped with an ion beam scanner for large area irradiation. The two-dimensional fluence distribution of ion beam obtained using cellulose triacetate film dosimeter was not uniform. This is resulted from the distortion of excitation current for electromagnet of the scanner. So, the beam scanning condition, i.e., the relation between the ion species, the beam profile and the scanning width, was extremely limited to make a good uniformity. We have developed a beam scanning simulator to get fluence distributions by calculation and then compared the simulated distributions with the measured ones. It was revealed that the both of them are in good agreement and the beam scanning condition to get good uniformity was led by using this simulator. On the basis of these results, the power supply of scanner was improved. A good uniformity of beam distribution was available. (author)

X-ray radiographic technique for measuring density uniformity of silica aerogel

International Nuclear Information System (INIS)

Tabata, Makoto; Hatakeyama, Yoshikiyo; Adachi, Ichiro; Morita, Takeshi; Nishikawa, Keiko

2013-01-01

This paper proposes a new X-ray radiographic technique for measuring density uniformity of silica aerogels used as radiator in proximity-focusing ring-imaging Cherenkov detectors. To obtain high performance in a large-area detector, a key characteristic of radiator is the density (i.e. refractive index) uniformity of an individual aerogel monolith. At a refractive index of n=1.05, our requirement for the refractive index uniformity in the transverse plane direction of an aerogel tile is |δ(n−1)/(n−1)|<4% in a focusing dual layer radiator (with different refractive indices) scheme. We applied the radiographic technique to evaluate the density uniformity of our original aerogels from a trial production and that of Panasonic products (SP-50) as a reference, and to confirm they have sufficient density uniformity within ±1% along the transverse plane direction. The measurement results show that the proposed technique can quantitatively estimate the density uniformity of aerogels.

Uniform and non-uniform modes of nanosecond-pulsed dielectric barrier discharge in atmospheric air: fast imaging and spectroscopic measurements of electric field.

Science.gov (United States)

Liu, Chong; Dobrynin, Danil; Fridman, Alexander

2014-06-25

In this study, we report experimental results on fast ICCD imaging of development of nanosecond-pulsed dielectric barrier discharge (DBD) in atmospheric air and spectroscopic measurements of electric field in the discharge. Uniformity of the discharge images obtained with nanosecond exposure times were analyzed using chi-square test. The results indicate that DBD uniformity strongly depends on applied (global) electric field in the discharge gap, and is a threshold phenomenon. We show that in the case of strong overvoltage on the discharge gap (provided by fast rise times), there is transition from filamentary to uniform DBD mode which correlates to the corresponding decrease of maximum local electric field in the discharge.

Characterization of porous tungsten by microhardness

International Nuclear Information System (INIS)

Selcuk, C.; Wood, J.V.; Morley, N.; Bentham, R.

2001-01-01

One of the applications of tungsten is as high current density dispenser cathode in the form of porous tungsten. It is used as a cathode after being impregnated with an electron emissive material so pore distribution in the part is the most important parameter for its function as a uniform and controlled porosity will lead to a better performance. In this study, application of microhardness as a characterization method for uniformity of the pore distribution and homogeneity of the structure is introduced. Optical microscopy and SEM is used to relate the results and porous tungsten structure for a better understanding of the method applied. (author)

Compliance assurance for the safe transport of radioactive material. Safety guide

International Nuclear Information System (INIS)

2009-01-01

The objectives of this Safety Guide are to assist competent authorities in the development and maintenance of compliance assurance programmes in connection with the transport of radioactive material, and to assist applicants, licensees and organizations in their interactions with competent authorities. In order to increase cooperation between competent authorities and to promote the uniform application of international regulations and recommendations, it is desirable to adopt a common approach to regulatory activities. This Safety Guide is intended to assist in accomplishing such a uniform application by recommending most of the actions for which competent authorities need to provide in their programmes for ensuring compliance with the Transport Regulations. This Safety Guide addresses radiation safety aspects of the transport of radioactive material; that is, the subjects that are covered by the Transport Regulations. Radioactive material may have other dangerous properties, however, such as explosiveness, flammability, pyrophoricity, chemical toxicity and corrosiveness; these properties are required to be taken into account in the regulatory control of the design and transport of packages. Physical protection and systems for accounting for and control of nuclear material are also discussed in this Safety Guide. These subjects are not within the scope of the Transport Regulations, but information on them is included here because they must be taken into account in the overall regulatory control of transport, especially when the regulatory framework is being established. Section 1 informs about the background, the objective, the scope and the structure of this publication. Section 2 provides recommendations on the responsibilities and functions of the competent authority. Section 3 provides information on the various national and international regulations and guides for the transport of radioactive material. Section 4 provides recommendations on carrying out

Self-folding origami: shape memory composites activated by uniform heating

International Nuclear Information System (INIS)

Tolley, Michael T; Felton, Samuel M; Aukes, Daniel; Wood, Robert J; Miyashita, Shuhei; Rus, Daniela

2014-01-01

Self-folding is an approach used frequently in nature for the efficient fabrication of structures, but is seldom used in engineered systems. Here, self-folding origami are presented, which consist of shape memory composites that are activated with uniform heating in an oven. These composites are rapidly fabricated using inexpensive materials and tools. The folding mechanism based on the in-plane contraction of a sheet of shape memory polymer is modeled, and parameters for the design of composites that self-fold into target shapes are characterized. Four self-folding shapes are demonstrated: a cube, an icosahedron, a flower, and a Miura pattern; each of which is activated in an oven in less than 4 min. Self-sealing is also investigated using hot melt adhesive, and the resulting structures are found to bear up to twice the load of unsealed structures. (paper)

Synthesis and characterization of uniform silica nanoparticles on nickel substrate by spin coating and sol-gel method

Science.gov (United States)

Ngoc Thi Le, Hien; Jeong, Hae Kyung

2014-01-01

Spin coating and sol-gel methods are proposed for the preparation of silica nanoparticles on a nickel substrate using silicon tetrachloride, 2-methoxyethanol, and four different types of alkaline solutions. The effects of the type of alkaline solution, concentration of silica solution, and speed of spin coating on the properties of silica nanoparticles are investigated systematically. Uniform spherical shape of silica nanoparticles on Ni with the smallest size are obtained with sodium carbonate among the alkaline solutions after stirring at 70 °C for 6 h and spin-coating at 7000 rpm. Physical and electrochemical properties of the silica particles are investigated.

Seismic signal of near steady uniform flows

Science.gov (United States)

Mangeney, A.; Bachelet, V.; Toussaint, R.; de Rosny, J.

2017-12-01

The seismic signal generated by rockfalls, landslides or avalanches is a unique tool to detect, characterize and monitor gravitational flow activity. A major challenge in this domain is to retrieve the dynamic properties of the flow from the emitted seismic signal. In this study, we propose laboratory experiments where the dynamic properties of the flow (velocity, granular temperature, density, etc.) are measured together with the generated seismic signal. We investigate near steady uniform flows made of glass beads of 2mm diameter, flowing throughout a thin rectangular channel of 10 cm width, with tunable tilt angle and height flow, thanks to an adjustable opening gate. The flow is monitored from the spine with a fast camera (5000 fps), and the emitted waves are recorded by accelerometers (10Hz - 54 kHz), stuck on the back side of the bottom of the channel. Among others, three seismic parameters are analyzed: the power radiated by the flow, the mean frequency of the signal, and the modulation of its amplitude. We show that they are linked to three dynamical properties: the mean kinetic energy of the flow, the speed of collisions between beads and the vertical oscillation of the beads, respectively.

Facile Synthesis of Long, Straight and Uniform Copper Nanowires via a Solvothermal Method

Institute of Scientific and Technical Information of China (English)

Chunfu Lin; Hong Lin; Ning Wang; Xing Zhang; Jun Yang; Jianbo Li; Xiaozhan Yang

2006-01-01

Copper nanowires were facilely prepared via a solvothermal method. In this method, cetyltrimethylammonium bromide (CTAB) was used as a soft template, copper nitrate was an inorganic precursor, and absolute ethanol served as a reducing agent as well as a solvent. X-ray diffraction (XRD) and scanning electron microscopy (SEM) were used to characterize the as-prepared copper nanowires. The as-prepared copper nanowires are fairly uniform and long. The majority of them are longer than 100 μm and some even longer than 200 μm. Furthermore, most nanowires are quite straight. In addition,The mechanism of the growth process of copper nanowires was discussed.

78 FR 50359 - Civilian Health and Medical Program of the Uniformed Services (CHAMPUS); TRICARE Uniform Health...

Science.gov (United States)

2013-08-19

... Organization (HMO) Benefit--Prime Enrollment Fee Exemption for Survivors of Active Duty Deceased Sponsors and... Enrollment Fee Exemption for Survivors of Active Duty Deceased Sponsors and Medically Retired Uniformed Services [[Page 50360

Policrystalline silicon used in microelectronic deposited in the LPCVD.-2: Uniformity and crystallinity

International Nuclear Information System (INIS)

Pastor, G.; Dominguez, C.; Lora-Tamayo, E.; Dominguez, E.

1987-01-01

The present work is a study about the uniformity of the silicon deposition in the LPCVD system starting out from the pure silane. It is concluded that it is necessary to take account of all the parameters involved (pressure, temperature, gas flow, number, position and spacing between wafers). From the point of view of the uniformity, three kinds of depositions are observed: poly uniform zone, poly non-uniform zone and amorphous precipitates zone. In the non-uniform zone the increase of the non-uniformity obeys an exponential low when only one of the parameters of the system changes. However, in the amorphous precipitates zone the non-uniformity tends to a constant value. By drawing the values of pressure (P) and gas flow (C), for a fixed temperature, that separates both the uniform/non-uniform and amorphous/policrystalline zones, the equation P n C m #alpha # K(T) are fulfilled where K is a function of temperature. 10 refs

Heme transport and erythropoiesis

Science.gov (United States)

Yuan, Xiaojing; Fleming, Mark D.; Hamza, Iqbal

2013-01-01

In humans, systemic heme homeostasis is achieved via coordinated regulation of heme synthesis, transport and degradation. Although the heme biosynthesis and degradation pathways have been well characterized, the pathways for heme trafficking and incorporation into hemoproteins remains poorly understood. In the past few years, researchers have exploited genetic, cellular and biochemical tools, to identify heme transporters and, in the process, reveal unexpected functions for this elusive group of proteins. However, given the complexity of heme trafficking pathways, current knowledge of heme transporters is fragmented and sometimes contradictory. This review seeks to focus on recent studies on heme transporters with specific emphasis on their functions during erythropoiesis. PMID:23415705

Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric; Experimento atmosferico no local da Usina Angra I para caracterizar o transporte de efluentes lancados na atmosfera

Energy Technology Data Exchange (ETDEWEB)

Silva Lobo, M.A. da [FURNAS, Rio de Janeiro, RJ (Brazil); Kronemberger, B M.E.

1990-12-31

Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs.

Preparation and characterization of nano-sized phase change emulsions as thermal energy storage and transport media

International Nuclear Information System (INIS)

Chen, J.; Zhang, P.

2017-01-01

Highlights: • The nano-sized phase change emulsions are prepared by using D-phase method. • The thermo-physical and transport properties are experimentally investigated. • The influence of surfactant on the melting temperature and latent heat of water is clarified. • The phase change emulsion can be used as the heat transfer fluid in a thermal energy storage system. - Abstract: Phase change emulsion (PCE) is a kind of two-phase heat transfer fluid with phase change material (PCM) dispersed in carrier fluid. It has received intensive attractions in recent years due to the fact that it can be used as both the thermal energy storage material and transport medium simultaneously in a thermal energy storage system. In the present study, nano-sized PCEs are prepared by the D-phase method with n-hexadecane and n-octadecane as PCMs. The thermo-physical and transport properties are characterized to facilitate the applications. The droplet size distribution of the PCE is measured by a Photon Correlation Spectroscopy, and the results show that the droplet size distributions are similar at different mass fractions. The rheological behavior and viscosity of the PCE are measured by a rheometer, which shows that the PCEs at mass fractions below 30.0 wt% are Newtonian fluids, and the viscosities are dependent on both the mass fraction and temperature. The differential scanning calorimetry (DSC) is employed to analyze the phase change characteristics of the PCE, and the results indicate large supercooling degree of water and PCM in the PCE. The melting temperature and latent heat of water in the PCE are much smaller than those of pure water. The thermal conductivities of the PCE with different mass fractions at different temperatures are measured by the transient hot-wire method. Furthermore, the energy transport characteristics of the PCEs are evaluated on the basis of the measured thermo-physical and transport properties. The results suggest that the PCEs show a drastic

Transport phenomena in strongly correlated Fermi liquids

International Nuclear Information System (INIS)

Kontani, Hiroshi

2013-01-01

Comprehensive overview. Written by an expert of this topic. Provides the reader with current developments in the field. In conventional metals, various transport coefficients are scaled according to the quasiparticle relaxation time, τ, which implies that the relaxation time approximation (RTA) holds well. However, such a simple scaling does not hold in many strongly correlated electron systems, reflecting their unique electronic states. The most famous example would be cuprate high-Tc superconductors (HTSCs), where almost all the transport coefficients exhibit a significant deviation from the RTA results. To better understand the origin of this discrepancy, we develop a method for calculating various transport coefficients beyond the RTA by employing field theoretical techniques. Near the magnetic quantum critical point, the current vertex correction (CVC), which describes the electron-electron scattering beyond the relaxation time approximation, gives rise to various anomalous transport phenomena. We explain anomalous transport phenomena in cuprate HTSCs and other metals near their magnetic or orbital quantum critical point using a uniform approach. We also discuss spin related transport phenomena in strongly correlated systems. In many d- and f-electron systems, the spin current induced by the spin Hall effect is considerably greater because of the orbital degrees of freedom. This fact attracts much attention due to its potential application in spintronics. We discuss various novel charge, spin and heat transport phenomena in strongly correlated metals.

Characterization and expression profiling of ATP-binding cassette transporter genes in the diamondback moth, Plutella xylostella (L.).

Science.gov (United States)

Qi, Weiping; Ma, Xiaoli; He, Weiyi; Chen, Wei; Zou, Mingmin; Gurr, Geoff M; Vasseur, Liette; You, Minsheng

2016-09-27

ATP-binding cassette (ABC) transporters are one of the major transmembrane protein families found in all organisms and play important roles in transporting a variety of compounds across intra and extra cellular membranes. In some species, ABC transporters may be involved in the detoxification of substances such as insecticides. The diamondback moth, Plutella xylostella (L.), a destructive pest of cruciferous crops worldwide, is an important species to study as it is resistant to many types of insecticides as well as biological control Bacillus thuringiensis toxins. A total of 82 ABC genes were identified from our published P. xylostella genome, and grouped into eight subfamilies (ABCA-H) based on phylogenetic analysis. Genes of subfamilies ABCA, ABCC and ABCH were found to be expanded in P. xylostella compared with those in Bombyx mori, Manduca sexta, Heliconius melpomene, Danaus plexippus, Drosophila melanogaster, Tetranychus urticae and Homo sapiens. Phylogenetic analysis indicated that many of the ABC transporters in P. xylostella are orthologous to the well-studied ABC transporter genes in the seven other species. Transcriptome- and qRT-PCR-based analysis elucidated physiological effects of ABC gene expressions of P. xylostella which were developmental stage- and tissue-specific as well as being affected by whether or not the insects were from an insecticide-resistant strain. Two ABCC and one ABCA genes were preferentially expressed in midgut of the 4th-instar larvae of a susceptible strain (Fuzhou-S) suggesting their potential roles in metabolizing plant defensive chemicals. Most of the highly expressed genes in insecticide-resistant strains were also predominantly expressed in the tissues of Malpighian tubules and midgut. This is the most comprehensive study on identification, characterization and expression profiling of ABC transporter genes in P. xylostella to date. The diversified features and expression patterns of this gene family may be associated with

Biosynthesis and characterization of layered iron phosphate

International Nuclear Information System (INIS)

Zhou Weijia; He Wen; Wang Meiting; Zhang Xudong; Yan Shunpu; Tian Xiuying; Sun Xianan; Han Xiuxiu; Li Peng

2008-01-01

Layered iron phosphate with uniform morphology has been synthesized by a precipitation method with yeast cells as a biosurfactant. The yeast cells are used to regulate the nucleation and growth of layered iron phosphate. The uniform layered structure is characterized by small-angle x-ray diffraction (SAXD), scanning electron microscopy (SEM) and atomic force microscopy (AFM) analyses. Fourier transform infrared spectroscopy (FT-IR) is used to analyze the chemical bond linkages in organic–inorganic hybrid iron phosphate. The likely synthetic mechanism of nucleation and oriented growth is discussed. The electrical conductivity of hybrid iron phosphate heat-treated at different temperatures is presented

Swarm analysis by using transport equations, 1

International Nuclear Information System (INIS)

Dote, Toshihiko; Shimada, Masatoshi

1980-01-01

By evolving Maxwell-Boltzmann transport equations, various quantities on swarm of charged particles have been analyzed. Although this treatment is properly general, and common transport equations for charged particles ought to be given, in particular, equations only for electrons were presented here. The relation between the random energy and the drift energy was first derived and the general expression of the electron velocity was deduced too. For a simple example, one dimensional steady-state electron swarm in a uniform medium was treated. Electron swarm characteristics numerically calculated in He, Ne or Ar exhibited some interesting properties, which were physically clearly elucidated. These results were also compared with several data already published. Agreements between them were qualitatively rather well in detailed structures. (author)

Thermal transport in oblique finned microminichannels

CERN Document Server

Fan, Yan; Singh, Pawan Kumar; Lee, Yong Jiun

2015-01-01

The main aim of this book is to introduce and give an overview of a novel, easy, and highly effective heat transfer augmentation technique for single-phase micro/minichannel heat sink. The specific objectives of the volume are to: Introduce a novel planar oblique fin microchannel and cylindrical oblique fin minichannel heat sink design using passive heat transfer enhancement techniques  Investigate the thermal transport in both planar and cylindrical oblique fin structures through numerical simulation and systematic experimental studies. Evaluate the feasibility of employing the proposed solution in cooling non-uniform heat fluxes and hotspot suppression Conduct the similarity analysis and parametric study to obtain empirical correlations to evaluate the total heat transfer rate of the oblique fin heat sink Investigate the flow mechanism and optimize the dimensions of cylindrical oblique fin heat sink Investigate the influence of edge effect on flow and temperature uniformity in these oblique fin chan...

Buttoned down: Are School Uniform Policies a Perfect Fit for All Students?

Science.gov (United States)

Messitt, Maggie

2013-01-01

In the 1999-2000 school year, only about 12 percent of U.S. public schools required their students to wear uniforms. Since then, the number of schools requiring uniforms has risen. Uniform policies are now in place at about a fifth of all public schools in the United States--but do school uniforms really level the playing field? New research has…

The Relationship of School Uniforms to Student Attendance, Achievement, and Discipline

Science.gov (United States)

Sowell, Russell Edward

2012-01-01

This causal-comparative study examined the relationship of school uniforms to attendance, academic achievement, and discipline referral rates, using data collected from two high schools in rural southwest Georgia county school systems, one with a uniforms program and one without a uniforms program. After accounting for race and students with…

Characterizing the Occurrence and Transport of Brackish Groundwater in Southwest Bangladesh

Science.gov (United States)

worland, S.; Hornberger, G. M.

2013-12-01

Bangladesh is host to the largest and the most active delta system in the world. The morphology of the southern part of the country is characterized by low lying deltaic plains partitioned by the distributary networks of the Ganges, Brahmaputra and Meghna river systems. Much of the tidal mangrove forest ecosystem of the lower delta has been converted into poldered islands that sustain shrimp farming and rice production. The polder inhabitants depend on shallow groundwater as a primary source for drinking water and sanitation. Understanding the origin and hydrologic controls on the distribution of the brackish water and freshwater on the polder is a necessary step to ensuring a sustainable and potable freshwater source for drinking and irrigation. Preliminary sampling from shallow tube wells on Polder 32 in southwest Bangladesh suggests sporadic lateral apportioning of fresh water in the primarily brackish aquifer. This research characterizes the occurrence, transport and fate of the brackish groundwater through a combination of 3H and 14C dating, geochemical signatures, subsurface mapping using inversions from electromagnetic induction, and a 1D finite difference model and a 2D finite element model. The geochemical analysis and radiometric dating suggest that the salt water originates from paleo-brackish estuarine water deposited ~5000 years ago along with the sediments that compose the shallow aquifer. Inversions of electromagnetic survey data show potential freshwater recharge areas where the clay cap pinches out. The finite difference model demonstrates that recharge from the distributary channels is unlikely due to the low transmissivity of the clay channel beds. The finite element model gives reasonable estimates of the flushing rates of the connate brackish water beneath the polder. Inversion of electromagnetic data from a two hundred meter transect taken on Polder 32 Head gradient and groundwater flow vectors for fixed head boundary conditions across Polder

Bayesian inference from count data using discrete uniform priors.

Directory of Open Access Journals (Sweden)

Federico Comoglio

Full Text Available We consider a set of sample counts obtained by sampling arbitrary fractions of a finite volume containing an homogeneously dispersed population of identical objects. We report a Bayesian derivation of the posterior probability distribution of the population size using a binomial likelihood and non-conjugate, discrete uniform priors under sampling with or without replacement. Our derivation yields a computationally feasible formula that can prove useful in a variety of statistical problems involving absolute quantification under uncertainty. We implemented our algorithm in the R package dupiR and compared it with a previously proposed Bayesian method based on a Gamma prior. As a showcase, we demonstrate that our inference framework can be used to estimate bacterial survival curves from measurements characterized by extremely low or zero counts and rather high sampling fractions. All in all, we provide a versatile, general purpose algorithm to infer population sizes from count data, which can find application in a broad spectrum of biological and physical problems.

Uniform irradiation of irregularly shaped cavities for photodynamic therapy

NARCIS (Netherlands)

Rem, A. I.; van Gemert, M. J.; van der Meulen, F. W.; Gijsbers, G. H.; Beek, J. F.

1997-01-01

It is difficult to achieve a uniform light distribution in irregularly shaped cavities. We have conducted a study on the use of hollow 'integrating' moulds for more uniform light delivery of photodynamic therapy in irregularly shaped cavities such as the oral cavity. Simple geometries such as a

Impedimetric Thiourea Sensing in Copper Electrorefining Bath based on DC Magnetron Sputtered Nanosilver as Highly Uniform Transducer

International Nuclear Information System (INIS)

Mozaffari, S.A.; Amoli, H. Salar; Simorgh, S.; Rahmanian, R.

2015-01-01

Highlights: • Fabrication of a novel disposable impedimetric thiourea sensor based on nanostructured Ag film transducer. • Exploiting sputtering as a high-tech method for preparation of highly uniform nanostructured Ag film. • A wonderful combination of nanostructured Ag film and carbon paper substrate as remarkably stable and reproducible sensor for thiourea detection in copper electrorefining bath. • Application of impedimetric assessment for thiourea monitoring due to its rapidity, sensitivity, and repeatability. - Abstract: Highly uniform sputtered nanostructured silver (Nano-Ag) film on the conductive carbon paper (CP) substrate (Nano-Ag/CP) was applied as a novel approach for thiourea (TU) measurement in copper electrorefining bath. Nano-Ag film was achieved by direct current (DC) magnetron sputtering system at the optimized instrumental deposition conditions. Characterization of the surface structure of Nano-Ag film by field emission-scanning electron microscopy (FE-SEM), exhibits uniform Nano-Ag film as an effective transducer for TU sensing. Step by step monitoring of Nano-Ag/CP electrode fabrication were performed using electrochemical methods such as cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS) techniques. Fabricated Nano-Ag/CP electrode was used for TU determination using EIS assessment. The impedimetric results show high sensitivity for TU sensing within 2.0–250 ppm.

Transportation radiological risk assessment for the programmatic environmental impact statement: An overview of methodologies, assumptions, and input parameters

International Nuclear Information System (INIS)

Monette, F.; Biwer, B.; LePoire, D.; Chen, S.Y.

1994-01-01

The U.S. Department of Energy is considering a broad range of alternatives for the future configuration of radioactive waste management at its network of facilities. Because the transportation of radioactive waste is an integral component of the management alternatives being considered, the estimated human health risks associated with both routine and accident transportation conditions must be assessed to allow a complete appraisal of the alternatives. This paper provides an overview of the technical approach being used to assess the radiological risks from the transportation of radioactive wastes. The approach presented employs the RADTRAN 4 computer code to estimate the collective population risk during routine and accident transportation conditions. Supplemental analyses are conducted using the RISKIND computer code to address areas of specific concern to individuals or population subgroups. RISKIND is used for estimating routine doses to maximally exposed individuals and for assessing the consequences of the most severe credible transportation accidents. The transportation risk assessment is designed to ensure -- through uniform and judicious selection of models, data, and assumptions -- that relative comparisons of risk among the various alternatives are meaningful. This is accomplished by uniformly applying common input parameters and assumptions to each waste type for all alternatives. The approach presented can be applied to all radioactive waste types and provides a consistent and comprehensive evaluation of transportation-related risk

Development of a conservation strategy for a collection of military uniforms

DEFF Research Database (Denmark)

Shashoua, Yvonne; Skals, Irene

2004-01-01

infrared spectroscopy, as: drying oils from plant and fish sources, bitumen, natural rubber and plasticised polyvinyl chloride (PVC). Despite the fact that most uniforms had never been worn, many exhibited extensive deterioration: oiltreated uniforms were tacky due to incomplete oxidation either because......-based films; suitable covering materials were polyethylene and Cryovac® BDF-200® . Uniforms treated with bitumen could be supported by polyethylene film and covered by polyethylene, Melinex® or Cryovac BDF-200. Natural rubber-treated uniforms had oxidised, developing cracks and crazes: oxygen-free storage...

Making the School Uniform Decision: Is It Right for "Your" School?

Science.gov (United States)

McDaniel, Thomas R.

2013-01-01

Do school uniforms make a difference in student academic performance, school spirit, discipline, and safety? What are the legal restrictions that bear on the school uniform decision in public schools? Do uniform policies lead to less school violence? Do they impose an economic hardship, outweighing the advantages, on low-income families? The…

Highly uniform parallel microfabrication using a large numerical aperture system

Energy Technology Data Exchange (ETDEWEB)

Zhang, Zi-Yu; Su, Ya-Hui, E-mail: ustcsyh@ahu.edu.cn, E-mail: dongwu@ustc.edu.cn [School of Electrical Engineering and Automation, Anhui University, Hefei 230601 (China); Zhang, Chen-Chu; Hu, Yan-Lei; Wang, Chao-Wei; Li, Jia-Wen; Chu, Jia-Ru; Wu, Dong, E-mail: ustcsyh@ahu.edu.cn, E-mail: dongwu@ustc.edu.cn [CAS Key Laboratory of Mechanical Behavior and Design of Materials, Department of Precision Machinery and Precision Instrumentation, University of Science and Technology of China, Hefei 230026 (China)

2016-07-11

In this letter, we report an improved algorithm to produce accurate phase patterns for generating highly uniform diffraction-limited multifocal arrays in a large numerical aperture objective system. It is shown that based on the original diffraction integral, the uniformity of the diffraction-limited focal arrays can be improved from ∼75% to >97%, owing to the critical consideration of the aperture function and apodization effect associated with a large numerical aperture objective. The experimental results, e.g., 3 × 3 arrays of square and triangle, seven microlens arrays with high uniformity, further verify the advantage of the improved algorithm. This algorithm enables the laser parallel processing technology to realize uniform microstructures and functional devices in the microfabrication system with a large numerical aperture objective.

Uniformity across 200 mm silicon wafers printed by nanoimprint lithography

International Nuclear Information System (INIS)

Gourgon, C; Perret, C; Tallal, J; Lazzarino, F; Landis, S; Joubert, O; Pelzer, R

2005-01-01

Uniformity of the printing process is one of the key parameters of nanoimprint lithography. This technique has to be extended to large size wafers to be useful for several industrial applications, and the uniformity of micro and nanostructures has to be guaranteed on large surfaces. This paper presents results of printing on 200 mm diameter wafers. The residual thickness uniformity after printing is demonstrated at the wafer scale in large patterns (100 μm), in smaller lines of 250 nm and in sub-100 nm features. We show that a mould deformation occurs during the printing process, and that this deformation is needed to guarantee printing uniformity. However, the mould deformation is also responsible for the potential degradation of the patterns

Application of Positron Doppler Broadening Spectroscopy to the Measurement of the Uniformity of Composite Materials

International Nuclear Information System (INIS)

Quarles, C. A.; Sheffield, Thomas; Stacy, Scott; Yang, Chun

2009-01-01

The uniformity of rubber-carbon black composite materials has been investigated with positron Doppler Broadening Spectroscopy (DBS). The number of grams of carbon black (CB) mixed into one hundred grams of rubber, phr, is used to characterize a sample. A typical concentration for rubber in tires is 50 phr. The S parameter measured by DBS has been found to depend on the phr of the sample as well as the type of rubber and carbon black. The variation in carbon black concentration within a surface area of about 5 mm diameter can be measured by moving a standard Na-22 or Ge-68 positron source over an extended sample. The precision of the concentration measurement depends on the dwell time at a point on the sample. The time required to determine uniformity over an extended sample can be reduced by running with much higher counting rate than is typical in DBS and correcting for the systematic variation of S parameter with counting rate. Variation in CB concentration with mixing time at the level of about 0.5% has been observed.

Uniform and non-uniform modes of nanosecond-pulsed dielectric barrier discharge in atmospheric air: fast imaging and spectroscopic measurements of electric field

Science.gov (United States)

Liu, Chong; Dobrynin, Danil; Fridman, Alexander

2014-01-01

In this study, we report experimental results on fast ICCD imaging of development of nanosecond-pulsed dielectric barrier discharge (DBD) in atmospheric air and spectroscopic measurements of electric field in the discharge. Uniformity of the discharge images obtained with nanosecond exposure times were analyzed using chi-square test. The results indicate that DBD uniformity strongly depends on applied (global) electric field in the discharge gap, and is a threshold phenomenon. We show that in the case of strong overvoltage on the discharge gap (provided by fast rise times), there is transition from filamentary to uniform DBD mode which correlates to the corresponding decrease of maximum local electric field in the discharge. PMID:25071294

Burnout in a channel with non-uniform circumferential heat flux

International Nuclear Information System (INIS)

Lee, D.H.

1966-03-01

Burnout experiments are reported for uniform flux and circumferential flux tilt (maximum/average flux about 1.25) with tubes and annuli, all the experiments having uniform axial heating. These show similar results, the burnout power with flux tilt being within 10% of that with uniform flux. For the same mean exit steam quality, the local maximum flux is higher than the predicted burnout value and generally a better prediction is obtained using the average flux. (author)

BLT-EC (Breach, Leach and Transport-Equilibrium Chemistry) data input guide. A computer model for simulating release and coupled geochemical transport of contaminants from a subsurface disposal facility

International Nuclear Information System (INIS)

MacKinnon, R.J.; Sullivan, T.M.; Kinsey, R.R.

1997-05-01

The BLT-EC computer code has been developed, implemented, and tested. BLT-EC is a two-dimensional finite element computer code capable of simulating the time-dependent release and reactive transport of aqueous phase species in a subsurface soil system. BLT-EC contains models to simulate the processes (container degradation, waste-form performance, transport, chemical reactions, and radioactive production and decay) most relevant to estimating the release and transport of contaminants from a subsurface disposal system. Water flow is provided through tabular input or auxiliary files. Container degradation considers localized failure due to pitting corrosion and general failure due to uniform surface degradation processes. Waste-form performance considers release to be limited by one of four mechanisms: rinse with partitioning, diffusion, uniform surface degradation, and solubility. Transport considers the processes of advection, dispersion, diffusion, chemical reaction, radioactive production and decay, and sources (waste form releases). Chemical reactions accounted for include complexation, sorption, dissolution-precipitation, oxidation-reduction, and ion exchange. Radioactive production and decay in the waste form is simulated. To improve the usefulness of BLT-EC, a pre-processor, ECIN, which assists in the creation of chemistry input files, and a post-processor, BLTPLOT, which provides a visual display of the data have been developed. BLT-EC also includes an extensive database of thermodynamic data that is also accessible to ECIN. This document reviews the models implemented in BLT-EC and serves as a guide to creating input files and applying BLT-EC

Uniform and Non-Uniform Optimum Scalar Quantizers Performances: A Comparative Study

Directory of Open Access Journals (Sweden)

Fendy Santoso

2008-05-01

Full Text Available The aim of this research is to investigate source coding, the representation of information source output by finite R bits/symbol. The performance of optimum quantisers subject to an entropy constraint has been studied. The definitive work in this area is best summarised by Shannon’s source coding theorem, that is, a source with entropy H can be encoded with arbitrarily small error probability at any rate R (bits/source output as long as R>H. Conversely, If R the error probability will be driven away from zero, independent of the complexity of the encoder and the decoder employed. In this context, the main objective of engineers is however to design the optimum code. Unfortunately, the rate-distortion theorem does not provide the recipe for such a design. The theorem does, however, provide the theoretical limit so that we know how close we are to the optimum. The full understanding of the theorem also helps in setting the direction to achieve such an optimum. In this research, we have investigated the performances of two practical scalar quantisers, i.e., a Lloyd-Max quantiser and the uniformly defined one and also a well-known entropy coding scheme, i.e., Huffman coding against their theoretically attainable optimum performance due to Shannon’s limit R. It has been shown that our uniformly defined quantiser could demonstrate superior performance. The performance improvements, in fact, are more noticeable at higher bit rates.

Uniform stability for time-varying infinite-dimensional discrete linear systems

International Nuclear Information System (INIS)

Kubrusly, C.S.

1988-09-01

Stability for time-varying discrete linear systems in a Banach space is investigated. On the one hand, it established a fairly complete collection of necessary and sufficient conditions for uniform asymptotic equistability for input-free systems. This includes uniform and strong power equistability, and uniform and strong l p -equistability, among other technical conditions which also play essential role in stability theory. On other hand, it is shown that uniform asymptotic equistability for input-free systems is equivalent to each of the following concepts of uniform stability for forced systems: l p -input l p -state, c o -input c o -state, bounded-input bounded-state, l p>1 -input bounded-state, c sub (o)-input bounded-state, and convergent-input bounded-state; which are also equivalent to their nonuniform counterparts. For time-varying convergent systems, the above is also equivalent to convergent-input convergent-state stability. The proofs presented here are all ''elementary'' in the sense that they are based essentially only on the Banach-Steinhaus theorem. (autor) [pt

Uniform peanut performance test 2017

Science.gov (United States)

The Uniform Peanut Performance Tests (UPPT) are designed to evaluate the commercial potential of advanced breeding peanut lines not formally released. The tests are performed in ten locations across the peanut production belt. In this study, 2 controls and 14 entries were evaluated at 8 locations....

School Uniforms: Guidelines for Principals.

Science.gov (United States)

Essex, Nathan L.

2001-01-01

Principals desiring to develop a school-uniform policy should involve parents, teachers, community leaders, and student representatives; beware restrictions on religious and political expression; provide flexibility and assistance for low-income families; implement a pilot program; align the policy with school-safety issues; and consider legal…

Liquid jets injected into non-uniform crossflow

Science.gov (United States)

Tambe, Samir

An experimental study has been conducted with liquid jets injected transversely into a crossflow to study the effect of non-uniformities in the crossflow velocity distribution to the jet behavior. Two different non-uniform crossflows were created during this work, a shear-laden crossflow and a swirling crossflow. The shear-laden crossflow was generated by merging two independent, co-directional, parallel airstreams creating a shear mixing layer at the interface between them. The crossflow exhibited a quasi-linear velocity gradient across the height of the test chamber. By varying the velocities of the two airstreams, the sense and the slope of the crossflow velocity gradient could be changed. Particle Image Velocimetry (PIV) studies were conducted to characterize the crossflow. The parameter, UR, is defined as the ratio of the velocities of the two streams and governs the velocity gradient. A positive velocity gradient was observed for UR > 1 and a negative velocity gradient for UR Phase Doppler Particle Anemometry (PDPA) studies were conducted to study the penetration and atomization of 0.5 mm diameter water jets injected into this crossflow. The crossflow velocity gradient was observed to have a significant effect on jet penetration as well as the post breakup spray. For high UR (> 1), jet penetration increased and the Sauter Mean Diameter (SMD) distribution became more uniform. For low UR (Doppler Velocimetry (LDV) was used to study the crossflow velocities. The axial (Ux) and the tangential (Utheta) components of the crossflow velocity were observed to decrease with increasing radial distance away from the centerbody. The flow angle of the crossflow was smaller than the vane exit angle, with the difference increasing with the vane exit angle. Water jets were injected from a 0.5 mm diameter orifice located on a cylindrical centerbody. Multi-plane PIV measurements were conducted to study the penetration and droplet velocity distribution of the jets. The jets were

Non-uniformity Correction of Infrared Images by Midway Equalization

Directory of Open Access Journals (Sweden)

Yohann Tendero

2012-07-01

Full Text Available The non-uniformity is a time-dependent noise caused by the lack of sensor equalization. We present here the detailed algorithm and on line demo of the non-uniformity correction method by midway infrared equalization. This method was designed to suit infrared images. Nevertheless, it can be applied to images produced for example by scanners, or by push-broom satellites. The obtained single image method works on static images, is fully automatic, having no user parameter, and requires no registration. It needs no camera motion compensation, no closed aperture sensor equalization and is able to correct for a fully non-linear non-uniformity.

Activity uniformity of Ir-192 seeds

International Nuclear Information System (INIS)

Ling, C.C.; Gromadzki, Z.C.

1981-01-01

A simple device that uses materials and apparatus commonly available in a radiotherapy department has been designed, fabricated and used in routine quality control relative to the activity uniformity of clinical Ir-192 seeds in ribbons. Detailed evaluation indicated that this system is easy to use and can yield relative activity measurements of individual Ir-192 seeds accurate to within 2%. With this device, activity uniformity of commercial Ir-192 seeds from two manufacturers has been assessed. For the seven shipments of Ir-192 seeds studied, the root mean square variations of individual seed strength from the average of each shipment ranged from 3.4 to 7.1%. Variation in seed activity by more than +- 10% from the average is not uncommon

Uniform Title in Theory and in Slovenian and Croatian Cataloguing Practice

Directory of Open Access Journals (Sweden)

Marija Petek

2013-09-01

Full Text Available ABSTRACTPurpose:  The paper investigates the importance and development of uniform title that enables collocation in the library catalogue. Research results on use of uniform titles in two union catalogues, the Slovenian COBISS and the Croatian CROLIST are also presented.Methodology/approach:  Theoretical apects of the uniform title are treated: for the first time by Panizzi, then in the Paris Principles being the basis for the Verona's cataloguing code; in the latest International Cataloguing Principles including conceptual models Functional Requirements for Bibliographic Records (FRBR and Functional Requirements for Authority Data (FRAD; and last but not least in the international cataloguing code Resource Description and Access (RDA. To find out whether the uniform titles are used consistently according to the Verona's cataloguing code and to the requirements of the bibliographic formats COMARC and UNIMARC, the frequency of tags 300 and 500 in bibliographic records is explored.Results:  The research results indicate that the use of uniform titles in COBISS and CROLIST is not satisfactory and that the tags 300 and 500 are often missing in bibliographic recods. In online catalogues a special attention should be given to the uniform title as it is considered an efficient linking device in the catalogue and as it enables collocation.Research limitations:  The research is limited to bibliographic records for translations of works of personal authors and of anonymous works; corporate authors are not included.Originality/practical implications:  Presenting development of the uniform title from the very beginning up to now and the first research on the uniform title in COBISS.

Influencing factors of GaN growth uniformity through orthogonal test analysis

International Nuclear Information System (INIS)

Zhang, Zhi; Fang, Haisheng; Yan, Han; Jiang, Zhimin; Zheng, Jiang; Gan, Zhiyin

2015-01-01

Gallium nitride (GaN) is widely used in light-emitting diode (LED) devices due to its wide bandgap and excellently optoelectronic performance. The efficiency and lifetime of LEDs are critically determined by quality of GaN, for example, growth uniformity. Metal-organic chemical vapor deposition (MOCVD) is the most popular technique to grow high-quality GaN epitaxial layers. Growth uniformity is influenced by fluid flow, heat transfer and chemical reactions in the reactor. In this paper, the growth process in a close-coupled showerhead (CCS) MOCVD reactor is investigated based on 3D numerical simulation. Influences of the operating parameters on the growth uniformity are presented. To evaluate the role of the parameters systematically and efficiently on the growth uniformity, orthogonal test method is introduced. The results reveal that the growth rate and uniformity are strongly related to the total gas flow rate, the showerhead height and the inlet gas temperature, but are weakly affected by the isothermal wall temperature, the rotating speed and the susceptor temperature under the ranges of the current study. The optimized combination of the parameters is further proposed as a useful reference for obtaining the LED layers with a balance between the growth rate and the growth uniformity in industry. - Highlights: • Fluid flow, heat transfer, chemical reactions are calculated for a 3D CCS reactor. • The effects of process parameters on growth rate and uniformity are investigated. • Orthogonal test method is introduced to analyze the effect of multi-factors. • Optimal combinations can be obtained for the best growth rate and uniformity.

Comparative study of active plasma lenses in high-quality electron accelerator transport lines

Science.gov (United States)

van Tilborg, J.; Barber, S. K.; Benedetti, C.; Schroeder, C. B.; Isono, F.; Tsai, H.-E.; Geddes, C. G. R.; Leemans, W. P.

2018-05-01

Electrically discharged active plasma lenses (APLs) are actively pursued in compact high-brightness plasma-based accelerators due to their high-gradient, tunable, and radially symmetric focusing properties. In this manuscript, the APL is experimentally compared with a conventional quadrupole triplet, highlighting the favorable reduction in the energy dependence (chromaticity) in the transport line. Through transport simulations, it is explored how the non-uniform radial discharge current distribution leads to beam-integrated emittance degradation and a charge density reduction at focus. However, positioning an aperture at the APL entrance will significantly reduce emittance degradation without additional loss of charge in the high-quality core of the beam. An analytical model is presented that estimates the emittance degradation from a short beam driving a longitudinally varying wakefield in the APL. Optimizing laser plasma accelerator operation is discussed where emittance degradation from the non-uniform discharge current (favoring small beams inside the APL) and wakefield effects (favoring larger beam sizes) is minimized.

Politicas de uniformes y codigos de vestuario (Uniforms and Dress-Code Policies). ERIC Digest.

Science.gov (United States)

Lumsden, Linda

This digest in Spanish examines schools' dress-code policies and discusses the legal considerations and research findings about the effects of such changes. Most revisions to dress codes involve the use of uniforms, typically as a way to curb school violence and create a positive learning environment. A recent survey of secondary school principals…

Wavelet-based Adaptive Mesh Refinement Method for Global Atmospheric Chemical Transport Modeling

Science.gov (United States)

Rastigejev, Y.

2011-12-01

Numerical modeling of global atmospheric chemical transport presents enormous computational difficulties, associated with simulating a wide range of time and spatial scales. The described difficulties are exacerbated by the fact that hundreds of chemical species and thousands of chemical reactions typically are used for chemical kinetic mechanism description. These computational requirements very often forces researches to use relatively crude quasi-uniform numerical grids with inadequate spatial resolution that introduces significant numerical diffusion into the system. It was shown that this spurious diffusion significantly distorts the pollutant mixing and transport dynamics for typically used grid resolution. The described numerical difficulties have to be systematically addressed considering that the demand for fast, high-resolution chemical transport models will be exacerbated over the next decade by the need to interpret satellite observations of tropospheric ozone and related species. In this study we offer dynamically adaptive multilevel Wavelet-based Adaptive Mesh Refinement (WAMR) method for numerical modeling of atmospheric chemical evolution equations. The adaptive mesh refinement is performed by adding and removing finer levels of resolution in the locations of fine scale development and in the locations of smooth solution behavior accordingly. The algorithm is based on the mathematically well established wavelet theory. This allows us to provide error estimates of the solution that are used in conjunction with an appropriate threshold criteria to adapt the non-uniform grid. Other essential features of the numerical algorithm include: an efficient wavelet spatial discretization that allows to minimize the number of degrees of freedom for a prescribed accuracy, a fast algorithm for computing wavelet amplitudes, and efficient and accurate derivative approximations on an irregular grid. The method has been tested for a variety of benchmark problems

Urban transportation: Perspectives on mobility and choice

Science.gov (United States)

Sincoff, M. Z. (Editor); Dajani, J. S. (Editor); Arnold, G. R.; Bird, J. W.; Brooks, C. M. (Editor); Cobb, W. E.; Cross, J. E.; Darby, L. F.; Erb, N. H.; Ficht, J. C.

1974-01-01

A study of urban transportation systems are presented characterized by intensive scrutiny of many ideas, philosophies, and academic perspectives. This report is intended to communicate some dimensions of the urban transportation problem to the general public.

Busted Butte Unsaturated Zone Transport Test: Fiscal Year 1998 Status Report Yucca Mountain Site Characterization Program Deliverable SPU85M4

International Nuclear Information System (INIS)

Bussod, G.Y.; Turin, H.J.; Lowry, W.E.

1999-01-01

This report describes the status of the Busted Butte Unsaturated Zone Transport Test (UZTT) and documents the progress of construction activities and site and laboratory characterization activities undertaken in fiscal year 1998. Also presented are predictive flow-and-transport simulations for Test Phases 1 and 2 of testing and the preliminary results and status of these test phases. Future anticipated results obtained from unsaturated-zone (UZ) transport testing in the Calico Hills Formation at Busted Butte are also discussed in view of their importance to performance assessment (PA) needs to build confidence in and reduce the uncertainty of site-scale flow-and-transport models and their abstractions for performance for license application. The principal objectives of the test are to address uncertainties associated with flow and transport in the UZ site-process models for Yucca Mountain, as identified by the PA working group in February 1997. These include but are not restricted to: (1) The effect of heterogeneities on flow and transport in unsaturated and partially saturated conditions in the Calico Hills Formation. In particular, the test aims to address issues relevant to fracture-matrix interactions and permeability contrast boundaries; (2) The migration behavior of colloids in fractured and unfractured Calico Hills rocks; (3) The validation through field testing of laboratory sorption experiments in unsaturated Calico Hills rocks; (4) The evaluation of the 3-D site-scale flow-and-transport process model (i.e., equivalent-continuum/dual-permeability/discrete-fracture-fault representations of flow and transport) used in the PA abstractions for license application; and (5) The effect of scaling from lab scale to field scale and site scale

Characteristics of nonlocally-coupled transition of the heat transport in LHD

International Nuclear Information System (INIS)

Tamura, N.; Ida, K.; Tanaka, K.; Tokuzawa, T.; Itoh, K.; Shimozuma, T.; Kubo, S.; Tsuchiya, H.; Nagayama, Y.; Kawahata, K.; Sudo, S.; Yamada, H.; Inagaki, S.

2010-01-01

A comparison of characteristics between a nonlocal transport phenomenon and an electron internal transport barrier (ITB) in the Large Helical Device is performed with a transient transport analysis and from the viewpoint of a dynamic behavior of transport state. The electron ITB is characterized by a jump of electron temperature gradient. In contrast, the transient transport analysis indicates the nonlocal transport phenomenon is characterized by a jump of electron heat flux. And seen from the viewpoint of the dynamic behavior of transport state, the physical mechanism of the appearance of the nonlocal transport phenomenon is found to be qualitatively different from that of the formation of the electron ITB. (copyright 2010 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)

Pharmacological characterization of human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 in a fluorescence-based membrane potential assay

DEFF Research Database (Denmark)

Jensen, Anders A.; Bräuner-Osborne, Hans

2004-01-01

We have expressed the human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 stably in HEK293 cells and characterized the transporters pharmacologically in a conventional [(3) H]-d-aspartate uptake assay and in a fluorescence-based membrane potential assay, the FLIPR Membrane Potential...... (FMP) assay. The K(m) and K(i) values obtained for 12 standard EAAT ligands at EAAT1, EAAT2 and EAAT3 in the FMP assay correlated well with the K(i) values obtained in the [(3) H]-d-aspartate assay (r(2) values of 0.92, 0.92, and 0.95, respectively). Furthermore, the pharmacological characteristics...

The effect of transport on the quality of rabbit meat.

Science.gov (United States)

Składanowska-Baryza, Joanna; Ludwiczak, Agnieszka; Pruszyńska-Oszmałek, Ewa; Kołodziejski, Paweł; Bykowska, Marta; Stanisz, Marek

2018-04-01

The analyzed material included 40 hybrid rabbits slaughtered at the age of 90 days. The control group was transported directly after weaning, while the transport group was transported directly prior to slaughter. The experiment was designed to assess the transport stress, carcass and meat quality implications, taking into account the muscle type and sex. The transported animals were characterized by a higher level of blood cortisol, glucose and triglycerides (P meat were affected by the transport (P meat from the control group was characterized by greater plasticity compared to the transport group (P = 0.003). The chemical composition of rabbit meat was not changed by the effect of transport (P = 0.643-0.979). To conclude, the quality traits of meat from the transported hybrid rabbits clearly indicated the development of dark firm and dry-like lower quality of meat. © 2018 Japanese Society of Animal Science.

Influence of turbulent horseshoe vortex and associated bed shear stress on sediment transport in front of a cylinder

DEFF Research Database (Denmark)

Li, Jinzhao; Qi, Meilan; Fuhrman, David R.

2018-01-01

-normal distribution for uniform channel-open flows. The comparisons of sediment transport rates where turbulent fluctuations in the bed shear stress are, or are not, taken into account show that the sediment transport rates calculated by the mean bed shear stress are under-predicted. Furthermore, a new sediment......This study concerns the flow and associated sediment transport in front of a cylinder in steady currents. The study comprises (i) flow characteristics induced by the turbulent horseshoe vortex (THV), (ii) bed shear stress within the THV region, and (iii) predicted sediment transport rates...

Dipeptide transporters in Fusarium graminearum

DEFF Research Database (Denmark)

Droce, Aida; Giese, Henriette; Søndergaard, Teis

Fungi have evolved different transport mechanisms in order to utilize both inorganic and organic nitrogen sources because nitrogen availability often is one of the limiting factors in pathogenic processes. In this study we have characterized four di/tripeptide transporters in the necrotrophic plant...... pathogen Fusarium graminearum Fusarium that causes head blight (FHB) in wheat and barley....

In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

Directory of Open Access Journals (Sweden)

Ertuğrul Filiz

2013-01-01

Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

Uniform and non-uniform modes of nanosecond-pulsed dielectric barrier discharge in atmospheric air: fast imaging and spectroscopic measurements of electric fields

International Nuclear Information System (INIS)

Liu, Chong; Dobrynin, Danil; Fridman, Alexander

2014-01-01

In this study, we report experimental results on fast intensified charge-coupled device (ICCD) imaging of the development of nanosecond-pulsed dielectric barrier discharge (DBD) in atmospheric air and spectroscopic measurements of the electric field in the discharge. The uniformity of the discharge images obtained with nanosecond exposure times was analysed using chi-square test. The results indicate that DBD uniformity strongly depends on the applied (global) electric field in the discharge gap, which is a threshold phenomenon. We show that in the case of strong overvoltage on the discharge gap (provided by fast rise times), there is a transition from filamentary to uniform DBD mode that correlates to the corresponding decrease of the maximum local electric field in the discharge. (fast track communication)

Interacting effects of uniform flow, plane shear, and near-wall proximity on the heat and mass transfer of respiratory aerosols

Energy Technology Data Exchange (ETDEWEB)

Worth Longest, P. [Virginia Commonwealth University, Richmond, VA (United States). Dept. of Mechanical Engineering; Kleinstreuer, C. [North Carolina State University, Raleigh, NC (United States). Dept. of Mechanical and Aerospace Engineering

2004-10-01

Individual and interacting effects of uniform flow, plane shear, and near-wall proximity on spherical droplet heat and mass transfer have been assessed for low Reynolds number conditions beyond the creeping flow regime. Validated resolved volume simulations were used to compute heat and mass transfer surface gradients of two-dimensional axisymmetric droplets and three-dimensional spherical droplets near planar wall boundaries for conditions consistent with inhalable aerosols (5 {<=} d {<=} 300 {mu}m) in the upper respiratory tract. Results indicate that planar shear significantly impacts droplet heat and mass transfer for shear-based Reynolds numbers greater than 1, which occur for near-wall respiratory aerosols with diameters in excess of 50 {mu}m. Wall proximity is shown to significantly enhance heat and mass transfer due to conduction and diffusion at separation distances less than five particle diameters and for small Reynolds numbers. For the Reynolds number conditions of interest, significant non-linear effects arise due to the concurrent interaction of uniform flow and shear such that linear superposition of Sherwood or Nusselt number terms is not allowable. Based on the validated numeric simulations, multivariable Sherwood and Nusselt number correlations are provided to account for individual flow characteristics and concurrent non-linear interactions of uniform flow, planar shear, and near-wall proximity. These heat and mass transfer correlations can be applied to effectively compute condensation and evaporation rates of potentially toxic or therapeutic aerosols in the upper respiratory tract, where non-uniform flow and wall proximity are expected to significantly affect droplet transport, deposition, and vapor formation. (author)

Crystallographically uniform arrays of ordered (In)GaN nanocolumns

Energy Technology Data Exchange (ETDEWEB)

Gačević, Ž., E-mail: gacevic@isom.upm.es; Bengoechea-Encabo, A.; Albert, S.; Calleja, E. [ETSIT-ISOM, Universidad Politécnica de Madrid, Avda. Complutense s/n, 28040 Madrid (Spain); Torres-Pardo, A.; González-Calbet, J. M. [Dept. Química Inorgánica, Universidad Complutense, 28040 Madrid (Spain); CEI Campus Moncloa, UCM-UPM, Madrid (Spain)

2015-01-21

In this work, through a comparative study of self-assembled (SA) and selective area grown (SAG) (In)GaN nanocolumn (NC) ensembles, we first give a detailed insight into improved crystallographic uniformity (homogeneity of crystallographic tilts and twists) of the latter ones. The study, performed making use of: reflective high energy electron diffraction, X-ray diffraction and scanning electron microscopy, reveals that unlike their SA counterparts, the ensembles of SAG NCs show single epitaxial relationship to both sapphire(0001) and Si(111) underlying substrates. In the second part of the article, making use of X-ray diffraction, we directly show that the selective area growth leads to improved compositional uniformity of InGaN NC ensembles. This further leads to improved spectral purity of their luminescence, as confirmed by comparative macro-photoluminescence measurements performed on SA and SAG InGaN NC ensembles. An improved crystallographic uniformity of NC ensembles facilitates their integration into optoelectronic devices, whereas their improved compositional uniformity allows for their employment in single-color optoelectronic applications.

Characterization of crushed tuff for the evaluation of the fate of tracers in transport studies in the unsaturated zone

International Nuclear Information System (INIS)

Polzer, W.L.; Fuentes, H.R.; Raymond, R.; Bish, D.L.; Gladney, E.S.; Lopez, E.A.

1987-03-01

Results of field-scale (caisson) transport studies under unsaturated moisture and steady and nonsteady flow conditions indicate variability and a lack of conservation of mass in solute transport. The tuff materials used in that study were analyzed for the presence of tracers and of freshly precipitated material to help explain the variability and lack of conservation of mass. Selected tuff samples were characterized by neutron activation analysis for tracer identification, by x-ray diffraction for mineral identification, by petrographic analysis for identification of freshly precipitated material, and by x-ray fluorescence analysis for identification of major and trace elements. The results of these analyses indicate no obvious presence of freshly precipitated material that would retard tracer movement. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of sorbing and nonsorbing tracers on the tuff at some locations (even cesium at the 415-cm depth) and not at others suggests variability in transport. 15 refs., 14 figs., 9 tabs

Uniform design based SVM model selection for face recognition

Science.gov (United States)

Li, Weihong; Liu, Lijuan; Gong, Weiguo

2010-02-01

Support vector machine (SVM) has been proved to be a powerful tool for face recognition. The generalization capacity of SVM depends on the model with optimal hyperparameters. The computational cost of SVM model selection results in application difficulty in face recognition. In order to overcome the shortcoming, we utilize the advantage of uniform design--space filling designs and uniformly scattering theory to seek for optimal SVM hyperparameters. Then we propose a face recognition scheme based on SVM with optimal model which obtained by replacing the grid and gradient-based method with uniform design. The experimental results on Yale and PIE face databases show that the proposed method significantly improves the efficiency of SVM model selection.

Synthesis of uniform-sized bimetallic iron-nickel phosphide nanorods