WorldWideScience

Sample records for transport uniformity characterization

  1. Uniform Gauss-Weight Quadratures for Discrete Ordinate Transport Calculations

    International Nuclear Information System (INIS)

    Carew, John F.; Hu, Kai; Zamonsky, Gabriel

    2000-01-01

    Recently, a uniform equal-weight quadrature set, UE n , and a uniform Gauss-weight quadrature set, UG n , have been derived. These quadratures have the advantage over the standard level-symmetric LQ n quadrature sets in that the weights are positive for all orders,and the transport solution may be systematically converged by increasing the order of the quadrature set. As the order of the quadrature is increased,the points approach a uniform continuous distribution on the unit sphere,and the quadrature is invariant with respect to spatial rotations. The numerical integrals converge for continuous functions as the order of the quadrature is increased.The numerical characteristics of the UE n quadrature set have been investigated previously. In this paper, numerical calculations are performed to evaluate the application of the UG n quadrature set in typical transport analyses. A series of DORT transport calculations of the >1-MeV neutron flux have been performed for a set of pressure-vessel fluence benchmark problems. These calculations employed the UG n (n = 8, 12, 16, 24, and 32) quadratures and indicate that the UG n solutions have converged to within ∼0.25%. The converged UG n solutions are found to be comparable to the UE n results and are more accurate than the level-symmetric S 16 predictions

  2. Uniform risk functionals for characterization of strong earthquake ground motions

    International Nuclear Information System (INIS)

    Anderson, J.G.; Trifunac, M.D.

    1978-01-01

    A uniform risk functional (e.g., Fourier spectrum, response spectrum, duration, etc.) is defined so that the probability that it is exceeded by some earthquake during a selected period of time is independent of the frequency of seismic waves. Such a functional is derived by an independent calculation, at each frequency, for the probability that the quantity being considered will be exceeded. Different aspects of the seismicity can control the amplitude of a uniform risk functional in different frequency ranges, and a uniform risk functional does not necessarily describe the strong shaking from any single earthquake. To be useful for calculating uniform risk functionals, a scaling relationship must provide an independent estimate of amplitudes of the functional in several frequency bands. The scaling relationship of Trifunac (1976) for Fourier spectra satisfies this requirement and further describes the distribution of spectral amplitudes about the mean trend; here, it is applied to find uniform risk Fourier amplitude spectra. In an application to finding the uniform risk spectra at a realistic site, this method is quite sensitive to the description of seismicity. Distinct models of seismicity, all consistent with our current level of knowledge of an area, can give significantly different risk estimates

  3. Synthesis and magnetic characterizations of uniform iron oxide nanoparticles

    International Nuclear Information System (INIS)

    Jiang, FuYi; Li, XiaoYi; Zhu, Yuan; Tang, ZiKang

    2014-01-01

    Uniform iron oxide nanoparticles with a cubic shape were prepared by the decomposition of homemade iron oleate in 1-octadecene with the presence of oleic acid. The particle shape and size uniformity are sensitive to the quantity of oleic acid. XRD, HRTEM and SAED results indicated that the main phase content of as-prepared iron oxide nanoparticles is Fe 3 O 4 with an inverse spinel structure. Magnetic measurements revealed that the as-prepared iron oxide nanoparticles display a ferromagnetic behavior with a blocking temperature of 295 K. At low temperatures the magnetic anisotropy of the aligned nanoparticles caused the appearance of a hysteresis loop.

  4. Micro-cantilevers for non-destructive characterization of nanograss uniformity

    DEFF Research Database (Denmark)

    Petersen, Dirch Hjorth; Wang, Fei; Olesen, Mikkel Buster

    2011-01-01

    We demonstrate an application of three-way flexible micro four-point probes for indirect uniformity characterization of surface morphology. The mean sheet conductance of a quasi-planar 3D nanostructured surface is highly dependent on the surface morphology, and thus accurate sheet conductance...... measurements may be useful for process uniformity characterization. The method is applied for characterization of TiW coated nanograss uniformity. Three-way flexible L-shaped cantilever electrodes are used to avoid damage to the fragile surface, and a relative standard deviation on measurement repeatability...... of 0.12 % is obtained with a measurement yield of 97%. Finally, variations in measured sheet conductance are correlated to the surface morphology as characterized by electron microscopy....

  5. Impact of roof height non-uniformity on pollutant transport between a street canyon and intersections

    International Nuclear Information System (INIS)

    Nosek, Štěpán; Kukačka, Libor; Jurčáková, Klára; Kellnerová, Radka; Jaňour, Zbyněk

    2017-01-01

    This paper presents an extension of our previous wind-tunnel study (Nosek et al., 2016) in which we highlighted the need for investigation of the removal mechanisms of traffic pollution from all openings of a 3D street canyon. The extension represents the pollution flux (turbulent and advective) measurements at the lateral openings of three different 3D street canyons for the winds perpendicular and oblique to the along-canyon axis. The pollution was simulated by emitting a passive gas (ethane) from a homogeneous ground-level line source positioned along the centreline of the investigated street canyons. The street canyons were formed by courtyard-type buildings of two different regular urban-array models. The first model has a uniform building roof height, while the second model has a non-uniform roof height along each building's wall. The mean flow and concentration fields at the canyons' lateral openings confirm the findings of other studies that the buildings' roof-height variability at the intersections plays an important role in the dispersion of the traffic pollutants within the canyons. For the perpendicular wind, the non-uniform roof-height canyon appreciably removes or entrains the pollutant through its lateral openings, contrary to the uniform canyon, where the pollutant was removed primarily through the top. The analysis of the turbulent mass transport revealed that the coherent flow structures of the lateral momentum transport correlate with the ventilation processes at the lateral openings of all studied canyons. These flow structures coincide at the same areas and hence simultaneously transport the pollutant in opposite directions. - Highlights: • The pollutant transport strongly depends on the roof-height arrangement. • The non-uniform canyons also remove the pollutants through their lateral openings. • The higher the upstream wall, the more pollutant is removed through the top. • The lateral coherent structures correlate

  6. Impact of roof height non-uniformity on pollutant transport between a street canyon and intersections.

    Science.gov (United States)

    Nosek, Štěpán; Kukačka, Libor; Jurčáková, Klára; Kellnerová, Radka; Jaňour, Zbyněk

    2017-08-01

    This paper presents an extension of our previous wind-tunnel study (Nosek et al., 2016) in which we highlighted the need for investigation of the removal mechanisms of traffic pollution from all openings of a 3D street canyon. The extension represents the pollution flux (turbulent and advective) measurements at the lateral openings of three different 3D street canyons for the winds perpendicular and oblique to the along-canyon axis. The pollution was simulated by emitting a passive gas (ethane) from a homogeneous ground-level line source positioned along the centreline of the investigated street canyons. The street canyons were formed by courtyard-type buildings of two different regular urban-array models. The first model has a uniform building roof height, while the second model has a non-uniform roof height along each building's wall. The mean flow and concentration fields at the canyons' lateral openings confirm the findings of other studies that the buildings' roof-height variability at the intersections plays an important role in the dispersion of the traffic pollutants within the canyons. For the perpendicular wind, the non-uniform roof-height canyon appreciably removes or entrains the pollutant through its lateral openings, contrary to the uniform canyon, where the pollutant was removed primarily through the top. The analysis of the turbulent mass transport revealed that the coherent flow structures of the lateral momentum transport correlate with the ventilation processes at the lateral openings of all studied canyons. These flow structures coincide at the same areas and hence simultaneously transport the pollutant in opposite directions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Flow rate of transport network controls uniform metabolite supply to tissue.

    Science.gov (United States)

    Meigel, Felix J; Alim, Karen

    2018-05-01

    Life and functioning of higher organisms depends on the continuous supply of metabolites to tissues and organs. What are the requirements on the transport network pervading a tissue to provide a uniform supply of nutrients, minerals or hormones? To theoretically answer this question, we present an analytical scaling argument and numerical simulations on how flow dynamics and network architecture control active spread and uniform supply of metabolites by studying the example of xylem vessels in plants. We identify the fluid inflow rate as the key factor for uniform supply. While at low inflow rates metabolites are already exhausted close to flow inlets, too high inflow flushes metabolites through the network and deprives tissue close to inlets of supply. In between these two regimes, there exists an optimal inflow rate that yields a uniform supply of metabolites. We determine this optimal inflow analytically in quantitative agreement with numerical results. Optimizing network architecture by reducing the supply variance over all network tubes, we identify patterns of tube dilation or contraction that compensate sub-optimal supply for the case of too low or too high inflow rate. © 2018 The Authors.

  8. An examination of the Hazardous Materials Transportation Uniform Safety Act (HMTUSA): A southern perspective

    International Nuclear Information System (INIS)

    1992-03-01

    On November 16,1990, President Bush signed into law the most comprehensive amendments to the Hazardous Materials Transportation Act (HMTA) in 15 years. The Hazardous Materials Transportation Uniform Safety Act of 1990 (HMTUSA) was created by Congress in an effort to strengthen and clarify the HMTA. This paper will discuss the act's provisions as they affect shipments of spent fuel and high-level radioactive materials as well as the impact of those provisions on routing and emergency response issues in the southern region. HMTUSA consists of seven key provisions that affect radioactive materials: clarification of regulatory jurisdiction; highway routing standards; broadened industry registration; safety permits for motor carriers of high risk materials; expanded nuclear transportation requirements; new provisions for emergency response training and planning; and a public process for assessing the feasibility of a federally operated central reporting system and data center. In addition to amending various HMTA provisions, the new HMTUSA act provides appropriations to carry out the specific goals of the legislation. The act authorizes appropriations for the 1991, 1992 and 1993 fiscal years

  9. Characterization of placental cholesterol transport

    DEFF Research Database (Denmark)

    Lindegaard, Marie L; Wassif, Christopher A; Vaisman, Boris

    2008-01-01

    Patients with Smith-Lemli-Opitz syndrome (SLOS) are born with multiple congenital abnormalities. Postnatal cholesterol supplementation is provided; however, it cannot correct developmental malformations due to in utero cholesterol deficit. Increased transport of cholesterol from maternal to fetal...... circulation might attenuate congenital malformations. The cholesterol transporters Abca1, Abcg1, and Sr-b1 are present in placenta; however, their potential role in placental transport remains undetermined. In mice, expression analyses showed that Abca1 and Abcg1 transcripts increased 2-3-fold between...... embryonic days 13.5 and 18.5 in placental tissue; whereas, Sr-b1 expression decreased. To examine the functional role of Abca1, Abcg1 and Sr-b1 we measured the maternal-fetal transfer of (14)C-cholesterol in corresponding mutant embryos. Disruption of either Abca1 or Sr-b1 decreased cholesterol transfer...

  10. Characterization and Processing of Non-Uniformities in Back-Illuminated CCDs

    Science.gov (United States)

    Lemm, Alia D.; Della-Rose, Devin J.; Maddocks, Sally

    2018-01-01

    In astronomical photometry, Charged Coupled Device (CCD) detectors are used to achieve high precision photometry and must be properly calibrated to correct for noise and pixel non-uniformities. Uncalibrated images may contain bias offset, dark current, bias structure and uneven illumination. In addition, standard data reduction is often not sufficient to “normalize” imagery to single-digit millimagnitude (mmag) precision. We are investigating an apparent non-uniformity, or interference pattern, in a back-illuminated sensor, the Alta U-47, attached to a DFM Engineering 41-cm Ritchey-Chrétien f/8 telescope. Based on the amplitude of this effect, we estimate that instrument magnitude peak-to-valley deviations of 50 mmag or more may result. Our initial testing strongly suggests that reflected skylight from high pressure sodium city lights may be the cause of this interference pattern. Our research goals are twofold: to fully characterize this non-uniformity and to determine the best method to remove this interference pattern from our reduced CCD images.

  11. Experimental and Numerical Characterization of a Pulsed Supersonic Uniform Flow for Kinetics and Spectroscopy

    Science.gov (United States)

    Suas-David, Nicolas; Thawoos, Shameemah; Broderick, Bernadette M.; Suits, Arthur

    2017-06-01

    The current CPUF (Chirped Pulse Uniform Flow) and the new UF-CRDS (Uniform Flow Cavity Ring-Down Spectroscopy) setups relie mostly on the production of a good quality supersonic uniform flow. A supersonic uniform flow is produced by expanding a gas through a Laval nozzle - similar to the nozzles used in aeronautics - linked to a vacuum chamber. The expansion is characterized by an isentropic core where constant very low kinetic temperature (down to 20K) and constant density are observed. The relatively large diameter of the isentropic core associated with homogeneous thermodynamic conditions makes it a relevant tool for low temperature spectroscopy. On the other hand, the length along the axis of the flow of this core (could be longer than 50cm) allows kinetic studies which is one of the main interest of this setup (CRESU technique. The formation of a uniform flow requires an extreme accuracy in the design of the shape of the nozzle for a set of defined temperature/density. The design is based on a Matlab program which retrieves the shape of the isentropic core according to the method of characteristics prior to calculate the thickness of the boundary layer. Two different approaches are used to test the viability of a new nozzle derived from the program. First, a computational fluid dynamic software (OpenFOAM) models the distribution of the thermodynamic properties of the expansion. Then, fabricated nozzles using 3-D printing are tested based on Pitot measurements and spectroscopic analyses. I will present comparisons of simulation and measured performance for a range of nozzles. We will see how the high level of accuracy of numerical simulations provides a deeper knowledge of the experimental conditions. J. M. Oldham, C. Abeysekera, J. Joalland, L. N. Zack, K. Prozument, I. R. Sims, G. Barrat Park, R. W. Filed and A. G. Suits, J. Chem. Phys. 141, 154202, (2014). I. Sims, J. L. Queffelec, A. Defrance, C. Rebrion-Rowe, D. Travers, P. Bocherel, B. Rowe, I. W. Smith

  12. Probabilistic uniformities of uniform spaces

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez Lopez, J.; Romaguera, S.; Sanchis, M.

    2017-07-01

    The theory of metric spaces in the fuzzy context has shown to be an interesting area of study not only from a theoretical point of view but also for its applications. Nevertheless, it is usual to consider these spaces as classical topological or uniform spaces and there are not too many results about constructing fuzzy topological structures starting from a fuzzy metric. Maybe, H/{sup o}hle was the first to show how to construct a probabilistic uniformity and a Lowen uniformity from a probabilistic pseudometric /cite{Hohle78,Hohle82a}. His method can be directly translated to the context of fuzzy metrics and allows to characterize the categories of probabilistic uniform spaces or Lowen uniform spaces by means of certain families of fuzzy pseudometrics /cite{RL}. On the other hand, other different fuzzy uniformities can be constructed in a fuzzy metric space: a Hutton $[0,1]$-quasi-uniformity /cite{GGPV06}; a fuzzifiying uniformity /cite{YueShi10}, etc. The paper /cite{GGRLRo} gives a study of several methods of endowing a fuzzy pseudometric space with a probabilistic uniformity and a Hutton $[0,1]$-quasi-uniformity. In 2010, J. Guti/'errez Garc/'{/i}a, S. Romaguera and M. Sanchis /cite{GGRoSanchis10} proved that the category of uniform spaces is isomorphic to a category formed by sets endowed with a fuzzy uniform structure, i. e. a family of fuzzy pseudometrics satisfying certain conditions. We will show here that, by means of this isomorphism, we can obtain several methods to endow a uniform space with a probabilistic uniformity. Furthermore, these constructions allow to obtain a factorization of some functors introduced in /cite{GGRoSanchis10}. (Author)

  13. Classification of the Group Invariant Solutions for Contaminant Transport in Saturated Soils under Radial Uniform Water Flows

    Directory of Open Access Journals (Sweden)

    M. M. Potsane

    2014-01-01

    Full Text Available The transport of chemicals through soils to the groundwater or precipitation at the soils surfaces leads to degradation of these resources. Serious consequences may be suffered in the long run. In this paper, we consider macroscopic deterministic models describing contaminant transport in saturated soils under uniform radial water flow backgrounds. The arising convection-dispersion equation given in terms of the stream functions is analyzed using classical Lie point symmetries. A number of exotic Lie point symmetries are admitted. Group invariant solutions are classified according to the elements of the one-dimensional optimal systems. We analyzed the group invariant solutions which satisfy the physical boundary conditions.

  14. Reactive-transport model for the prediction of the uniform corrosion behaviour of copper used fuel containers

    International Nuclear Information System (INIS)

    King, F.; Kolar, M.; Maak, P.

    2008-01-01

    Used fuel containers in a deep geological repository will be subject to various forms of corrosion. For containers made from oxygen-free, phosphorus-doped copper, the most likely corrosion processes are uniform corrosion, underdeposit corrosion, stress corrosion cracking, and microbiologically influenced corrosion. The environmental conditions within the repository are expected to evolve with time, changing from warm and oxidizing initially to cool and anoxic in the long-term. In response, the corrosion behaviour of the containers will also change with time as the repository environment evolve. A reactive-transport model has been developed to predict the time-dependent uniform corrosion behaviour of the container. The model is based on an experimentally-based reaction scheme that accounts for the various chemical, microbiological, electrochemical, precipitation/dissolution, adsorption/desorption, redox, and mass-transport processes at the container surface and in the compacted bentonite-based sealing materials within the repository. Coupling of the electrochemical interfacial reactions with processes in the bentonite buffer material allows the effect of the evolution of the repository environment on the corrosion behaviour of the container to be taken into account. The Copper Corrosion Model for Uniform Corrosion predicts the time-dependent corrosion rate and corrosion potential of the container, as well as the evolution of the near-field environment

  15. Mask characterization for critical dimension uniformity budget breakdown in advanced extreme ultraviolet lithography

    Science.gov (United States)

    Nikolsky, Peter; Strolenberg, Chris; Nielsen, Rasmus; Nooitgedacht, Tjitte; Davydova, Natalia; Yang, Greg; Lee, Shawn; Park, Chang-Min; Kim, Insung; Yeo, Jeong-Ho

    2013-04-01

    As the International Technology Roadmap for Semiconductors critical dimension uniformity (CDU) specification shrinks, semiconductor companies need to maintain a high yield of good wafers per day and high performance (and hence market value) of finished products. This cannot be achieved without continuous analysis and improvement of on-product CDU as one of the main drivers for process control and optimization with better understanding of main contributors from the litho cluster: mask, process, metrology and scanner. We will demonstrate a study of mask CDU characterization and its impact on CDU Budget Breakdown (CDU BB) performed for advanced extreme ultraviolet (EUV) lithography with 1D (dense lines) and 2D (dense contacts) feature cases. We will show that this CDU contributor is one of the main differentiators between well-known ArFi and new EUV CDU budgeting principles. We found that reticle contribution to intrafield CDU should be characterized in a specific way: mask absorber thickness fingerprints play a role comparable with reticle CDU in the total reticle part of the CDU budget. Wafer CD fingerprints, introduced by this contributor, may or may not compensate variations of mask CDs and hence influence on total mask impact on intrafield CDU at the wafer level. This will be shown on 1D and 2D feature examples. Mask stack reflectivity variations should also be taken into account: these fingerprints have visible impact on intrafield CDs at the wafer level and should be considered as another contributor to the reticle part of EUV CDU budget. We also observed mask error enhancement factor (MEEF) through field fingerprints in the studied EUV cases. Variations of MEEF may play a role towards the total intrafield CDU and may need to be taken into account for EUV lithography. We characterized MEEF-through-field for the reviewed features, with results herein, but further analysis of this phenomenon is required. This comprehensive approach to quantifying the mask part of

  16. Effect of heterogeneity on the characterization of cell membrane compartments: I. Uniform size and permeability.

    Science.gov (United States)

    Hall, Damien

    2010-03-15

    Observations of the motion of individual molecules in the membrane of a number of different cell types have led to the suggestion that the outer membrane of many eukaryotic cells may be effectively partitioned into microdomains. A major cause of this suggested partitioning is believed to be due to the direct/indirect association of the cytosolic face of the cell membrane with the cortical cytoskeleton. Such intimate association is thought to introduce effective hydrodynamic barriers into the membrane that are capable of frustrating molecular Brownian motion over distance scales greater than the average size of the compartment. To date, the standard analytical method for deducing compartment characteristics has relied on observing the random walk behavior of a labeled lipid or protein at various temporal frequencies and different total lengths of time. Simple theoretical arguments suggest that the presence of restrictive barriers imparts a characteristic turnover to a plot of mean squared displacement versus sampling period that can be interpreted to yield the average dimensions of the compartment expressed as the respective side lengths of a rectangle. In the following series of articles, we used computer simulation methods to investigate how well the conventional analytical strategy coped with heterogeneity in size, shape, and barrier permeability of the cell membrane compartments. We also explored questions relating to the necessary extent of sampling required (with regard to both the recorded time of a single trajectory and the number of trajectories included in the measurement bin) for faithful representation of the actual distribution of compartment sizes found using the SPT technique. In the current investigation, we turned our attention to the analytical characterization of diffusion through cell membrane compartments having both a uniform size and permeability. For this ideal case, we found that (i) an optimum sampling time interval existed for the analysis

  17. Preparation and characterization of uniform-sized chitosan/silver microspheres with antibacterial activities.

    Science.gov (United States)

    An, Jing; Ji, Zhenxing; Wang, Desong; Luo, Qingzhi; Li, Xueyan

    2014-03-01

    The chitosan/silver microspheres (CAgMs), which possess effective inhibitory on microorganisms, were prepared by an inverse-emulsification cross-linking method using CS/Ag sol as dispersed phase, whiteruss as continuous phase, and glutaraldehyde as crosslinking agent. The size and shape of CAgMs, greatly affecting their antibacterial activities, were controlled by varying the concentrations of cross-linking agent, emulsifier and CS/Ag colloid. The preparation conditions for obtaining uniform-sized microspheres were optimized. The morphology of CAgMs was characterized by scanning electron microscopy (SEM) and laser particle size analysis. The spherical CAgMs with smooth surface in the mean size of ca. 5 μm exhibited a narrow particle size distribution. Energy Dispersive X-ray spectroscopy (EDX) revealed the elemental composition of the microspheres. Transmission electron micrographs (TEM) and Fourier transform infrared spectroscopy (FTIR) of the microspheres confirmed the formation of silver nanoparticles (AgNPs). The X-ray diffraction (XRD) patterns and UV-Visible diffuse reflectance spectroscopy (UV-vis DRS) of the sample showed that AgNPs with the diameter no more than 20 nm were face-centered cubic crystallites. X-ray photoelectron spectroscopy (XPS) proved that AgO bond existed in the microspheres. Thermogravimetric analysis (TGA) showed that the starting decomposition temperature of CAgMs (ca. 260°C) was much higher than that of CS (ca. 160°C), suggesting that the as-prepared CAgMs possessed better thermal stability than original CS did. Antimicrobial assays were performed using typical Gram bacteria and fungi. The inhibitory effect indicated that the as-prepared microspheres exerted a stronger antibacterial activity as the concentration of the AgNPs is increasing, and the microspheres in smaller size had much better antibacterial activity than those in the larger size. The antimicrobial mechanism of CAgMs was discussed. Copyright © 2013 Elsevier B.V. All

  18. Preparation and characterization of uniform-sized chitosan/silver microspheres with antibacterial activities

    Energy Technology Data Exchange (ETDEWEB)

    An, Jing; Ji, Zhenxing; Wang, Desong, E-mail: dswang06@126.com; Luo, Qingzhi; Li, Xueyan

    2014-03-01

    The chitosan/silver microspheres (CAgMs), which possess effective inhibitory on microorganisms, were prepared by an inverse-emulsification cross-linking method using CS/Ag sol as dispersed phase, whiteruss as continuous phase, and glutaraldehyde as crosslinking agent. The size and shape of CAgMs, greatly affecting their antibacterial activities, were controlled by varying the concentrations of cross-linking agent, emulsifier and CS/Ag colloid. The preparation conditions for obtaining uniform-sized microspheres were optimized. The morphology of CAgMs was characterized by scanning electron microscopy (SEM) and laser particle size analysis. The spherical CAgMs with smooth surface in the mean size of ca. 5 μm exhibited a narrow particle size distribution. Energy Dispersive X-ray spectroscopy (EDX) revealed the elemental composition of the microspheres. Transmission electron micrographs (TEM) and Fourier transform infrared spectroscopy (FTIR) of the microspheres confirmed the formation of silver nanoparticles (AgNPs). The X-ray diffraction (XRD) patterns and UV–Visible diffuse reflectance spectroscopy (UV–vis DRS) of the sample showed that AgNPs with the diameter no more than 20 nm were face-centered cubic crystallites. X-ray photoelectron spectroscopy (XPS) proved that Ag-O bond existed in the microspheres. Thermogravimetric analysis (TGA) showed that the starting decomposition temperature of CAgMs (ca. 260 °C) was much higher than that of CS (ca. 160 °C), suggesting that the as-prepared CAgMs possessed better thermal stability than original CS did. Antimicrobial assays were performed using typical Gram bacteria and fungi. The inhibitory effect indicated that the as-prepared microspheres exerted a stronger antibacterial activity as the concentration of the AgNPs is increasing, and the microspheres in smaller size had much better antibacterial activity than those in the larger size. The antimicrobial mechanism of CAgMs was discussed. - Highlights: • CAgM was

  19. Highly ordered uniform single-crystal Bi nanowires: fabrication and characterization

    International Nuclear Information System (INIS)

    Bisrat, Y; Luo, Z P; Davis, D; Lagoudas, D

    2007-01-01

    A mechanical pressure injection technique has been used to fabricate uniform bismuth (Bi) nanowires in the pores of an anodic aluminum oxide (AAO) template. The AAO template was prepared from general purity aluminum by a two-step anodization followed by heat treatment to achieve highly ordered nanochannels. The nanowires were then fabricated by an injection technique whereby the molten Bi was injected into the AAO template using a hydraulic pressure method. The Bi nanowires prepared by this method were found to be dense and continuous with uniform diameter throughout the length. Electron diffraction experiments using the transmission electron microscope on cross-sectional and free-standing longitudinal Bi nanowires showed that the majority of the individual nanowires were single crystalline, with preferred orientation of growth along the [011] zone axis of the pseudo-cubic structure. The work presented here provides an inexpensive and effective way of fabricating highly ordered single-crystalline Bi nanowires, with uniform size distributions

  20. Metabolism and transport studies of exogenous compounds thanks to 13C uniform isotopic enrichment

    International Nuclear Information System (INIS)

    Bravin, F.

    2008-12-01

    The study of many exogenous compounds does not raise difficulties when they are isolated, purified and in quantities sufficient for the usual detection methods used in biology (Chromatography, NMR, Mass Spectrometry, etc). When they are found in a biological fluid (blood, urines,..), they are often in infinitesimal amount such as the effect of their biological matrices or the background noise that make their detection and their quantification very delicate. The use of internal standards uniformly enriched with carbon 13 and/or nitrogen 15 makes it possible to obtain a signal more easily recognizable and identifiable thanks to the presence of the isotopes (peaks shifted in a mass spectrum for example). This is why, complementary to the analytical and biochemical studies of zearalenone (ZEN) metabolism, we were interested in building mass spectra of molecules enriched (rates between 0 and 1) by various isotopes ( 13 C, 15 N, 18 O and 2 H). In parallel we studied the influence of the 13 C enrichment on the reactivity of a given molecule, from a theoretical and an experimental point of view. (author)

  1. Spectral characterization of differential group delay in uniform fiber Bragg gratings.

    Science.gov (United States)

    Bette, S; Caucheteur, C; Wuilpart, M; Mégret, P; Garcia-Olcina, R; Sales, S; Capmany, J

    2005-12-12

    In this paper, we completely study the wavelength dependency of differential group delay (DGD) in uniform fiber Bragg gratings (FBG) exhibiting birefringence. An analytical expression of DGD is established. We analyze the impact of grating parameters (physical length, index modulation and apodization profile) on the wavelength dependency of DGD. Experimental results complete the paper. A very good agreement between theory and experience is reported.

  2. The effect of non-uniformities on the measured transport parameters of electron swarms in hydrogen

    International Nuclear Information System (INIS)

    Blevin, H.A.; Fletcher, J.; Hunter, S.R.

    1978-01-01

    Measurements of transport parameters of pulsed electron swarms moving through a low-pressure gas by observation of the photon flux resulting from electron-molecule collisions have been recently reported by Blevin et al. (J. Phys. D., 9:465, 471 and 1671 (1976)). One of the possible sources of error in this kind of experiment is the variation of mean electron energy through the swarm. This effect is considered here along with the resulting variation of ionisation and excitation frequency through the swarm. The validity of the experimental method is considered in the light of the above factors. (author)

  3. The effect of non-uniformities on the measured transport parameters of electron swarms in hydrogen

    International Nuclear Information System (INIS)

    Blevin, H.A.; Fletcher, J.; Hunter, S.R.

    1978-05-01

    Measurements of transport parameters of pulsed electron swarms moving through a low pressure gas by observation of the photon flux resulting from electron-molecule collisions have been recently reported. One of the possible sources of error in this kind of experiment is the variation of mean electron energy through the swarm. This effect is considered here along with the resulting variation of ionization and excitation frequency through the swarm. The validity of the experimental method is considered in the light of the above factors

  4. Radiometric Non-Uniformity Characterization and Correction of Landsat 8 OLI Using Earth Imagery-Based Techniques

    Directory of Open Access Journals (Sweden)

    Frank Pesta

    2014-12-01

    Full Text Available Landsat 8 is the first satellite in the Landsat mission to acquire spectral imagery of the Earth using pushbroom sensor instruments. As a result, there are almost 70,000 unique detectors on the Operational Land Imager (OLI alone to monitor. Due to minute variations in manufacturing and temporal degradation, every detector will exhibit a different behavior when exposed to uniform radiance, causing a noticeable striping artifact in collected imagery. Solar collects using the OLI’s on-board solar diffuser panels are the primary method of characterizing detector level non-uniformity. This paper reports on an approach for using a side-slither maneuver to estimate relative detector gains within each individual focal plane module (FPM in the OLI. A method to characterize cirrus band detector-level non-uniformity using deep convective clouds (DCCs is also presented. These approaches are discussed, and then, correction results are compared with the diffuser-based method. Detector relative gain stability is assessed using the side-slither technique. Side-slither relative gains were found to correct streaking in test imagery with quality comparable to diffuser-based gains (within 0.005% for VNIR/PAN; 0.01% for SWIR and identified a 0.5% temporal drift over a year. The DCC technique provided relative gains that visually decreased striping over the operational calibration in many images.

  5. Experimental characterization of MHD pressure drop of liquid sodium flow under uniform magnetic field

    International Nuclear Information System (INIS)

    Kim, Hee Reyoung; Park, Jon Ho; Kim, Jong Man; Nam, Ho Yoon; Choi, Jong Hyun

    2001-01-01

    Magnetic field has many effects on the hydraulic pressure drop of fluids with high electrical conductivity. The theoretical solution about MHD pressure drop is sought for the uniform current density model with simplified physical geometry. Using the MHD equation in the rectangular duct of the sodium liquid flow under a transverse magnetic field, the electrical potential is sought in terms of the duct geometry and the electrical parameters of the liquid metal and duct material. By the product of the induced current inside the liquid metal and transverse magnetic field, the pressure gradients is found as a function of the duct size and the electrical conductivity of the liquid metal. The theoretically predicted pressure drop is compared with experimental results on the change of flow velocity and magnetic flux density

  6. Uniformly distributed anatase TiO2 nanoparticles on graphene: Synthesis, characterization, and photocatalytic application

    International Nuclear Information System (INIS)

    Bai, Xue; Zhang, Xiaoyuan; Hua, Zulin; Ma, Wenqiang; Dai, Zhangyan; Huang, Xin; Gu, Haixin

    2014-01-01

    Highlights: • Uniform distributed TiO 2 nanoparticles on graphene by a modified method. • Reduced recombination rate of photogenerated electron–hole pairs. • Effective charge transfer from TiO 2 to graphene. • Better photocatalytic activity upon UV and visible irradiation. • A mechanism of bisphenol A degradation process is proposed. - Abstract: Graphene (GR)/TiO 2 nanocomposites are successfully synthesized using a simple and efficient hydrothermal method. Even-sized anatase TiO 2 nanoparticles are uniformly distributed on GR. The GR/TiO 2 nanocomposites exhibit an extended light absorption range and decreased electron–hole recombination rates. The photocatalytic activity of the as-prepared GR/TiO 2 nanocomposites for bisphenol A (BPA) degradation is investigated under UV (λ = 365 nm) and visible (λ ⩾ 400 nm) light irradiation. The results show that GR/TiO 2 nanocomposites have significantly higher photocatalytic activity than P25 (pure TiO 2 ). The large increase in photocatalytic activity is mostly attributed to effective charge transfer from TiO 2 nanoparticles to GR, which suppresses charge recombination during the photocatalytic process. After five successive cycles, the photodegradation activity of the GR/TiO 2 nanocomposites shows no significant decrease, which indicates that the nanocomposites are stable under UV and visible light. X-ray photoelectron spectroscopy (XPS) is used to investigate the chemical bonds of GR/TiO 2 nanocomposites before and after degradation to determine the degradation intermediate products of BPA under irradiation. A proposed degradation reaction pathway of BPA is also established. This study provides new insights into the fabrication and practical application of high-performance photocatalysts in wastewater treatment

  7. Characterization of chemical agent transport in paints.

    Science.gov (United States)

    Willis, Matthew P; Gordon, Wesley; Lalain, Teri; Mantooth, Brent

    2013-09-15

    A combination of vacuum-based vapor emission measurements with a mass transport model was employed to determine the interaction of chemical warfare agents with various materials, including transport parameters of agents in paints. Accurate determination of mass transport parameters enables the simulation of the chemical agent distribution in a material for decontaminant performance modeling. The evaluation was performed with the chemical warfare agents bis(2-chloroethyl) sulfide (distilled mustard, known as the chemical warfare blister agent HD) and O-ethyl S-[2-(diisopropylamino)ethyl] methylphosphonothioate (VX), an organophosphate nerve agent, deposited on to two different types of polyurethane paint coatings. The results demonstrated alignment between the experimentally measured vapor emission flux and the predicted vapor flux. Mass transport modeling demonstrated rapid transport of VX into the coatings; VX penetrated through the aliphatic polyurethane-based coating (100 μm) within approximately 107 min. By comparison, while HD was more soluble in the coatings, the penetration depth in the coatings was approximately 2× lower than VX. Applications of mass transport parameters include the ability to predict agent uptake, and subsequent long-term vapor emission or contact transfer where the agent could present exposure risks. Additionally, these parameters and model enable the ability to perform decontamination modeling to predict how decontaminants remove agent from these materials. Published by Elsevier B.V.

  8. Spatial correlation characterization of a uniform circular array in 3D MIMO systems

    KAUST Repository

    Nadeem, Qurrat-Ul-Ain

    2016-08-11

    In this paper, we consider a uniform circular array (UCA) of directional antennas at the base station (BS) and the mobile station (MS) and derive an exact closed-form expression for the spatial correlation present in the 3D multiple-input multiple-output (MIMO) channel constituted by these arrays. The underlying method leverages the mathematical convenience of the spherical harmonic expansion (SHE) of plane waves and the trigonometric expansion of Legendre and associated Legendre polynomials. In contrast to the existing results, this generalized closed-form expression is independent of the form of the underlying angular distributions and antenna patterns. Moreover, the incorporation of the elevation dimension into the antenna pattern and channel model renders the proposed expression extremely useful for the performance evaluation of 3D MIMO systems in the future. Verification is achieved with the help of simulation results, which highlight the dependence of the spatial correlation on channel and array parameters. An interesting interplay between the mean angle of departure (AoD), angular spread and the positioning of antennas in the array is demonstrated. © 2016 IEEE.

  9. Spatial correlation characterization of a uniform circular array in 3D MIMO systems

    KAUST Repository

    Nadeem, Qurrat-Ul-Ain; Kammoun, Abla; Debbah, Merouane; Alouini, Mohamed-Slim

    2016-01-01

    In this paper, we consider a uniform circular array (UCA) of directional antennas at the base station (BS) and the mobile station (MS) and derive an exact closed-form expression for the spatial correlation present in the 3D multiple-input multiple-output (MIMO) channel constituted by these arrays. The underlying method leverages the mathematical convenience of the spherical harmonic expansion (SHE) of plane waves and the trigonometric expansion of Legendre and associated Legendre polynomials. In contrast to the existing results, this generalized closed-form expression is independent of the form of the underlying angular distributions and antenna patterns. Moreover, the incorporation of the elevation dimension into the antenna pattern and channel model renders the proposed expression extremely useful for the performance evaluation of 3D MIMO systems in the future. Verification is achieved with the help of simulation results, which highlight the dependence of the spatial correlation on channel and array parameters. An interesting interplay between the mean angle of departure (AoD), angular spread and the positioning of antennas in the array is demonstrated. © 2016 IEEE.

  10. Characterization of SLC transporters in human skin

    Directory of Open Access Journals (Sweden)

    Marion Alriquet

    2015-03-01

    Full Text Available Most identified drug transporters belong to the ATP-binding Cassette (ABC and Solute Carrier (SLC families. Recent research indicates that some of these transporters play an important role in the absorption, distribution and excretion of drugs, and are involved in clinically relevant drug-drug interactions for systemic drugs. However, very little is known about the role of drug transporters in human skin in the disposition of topically applied drugs and their involvement in drug-drug interactions. The aim of this work was to compare the expression in human skin (vs human hepatocytes and kidney of SLC transporters included in the EMA guidance as the most likely clinical sources of drug interactions. The expression of SLC transporters in human tissues was analyzed by quantitative RT-PCR. Modulation of SLC47A1 and SLC47A2 (MATE1 and MATE2 expression was analyzed after treatment of human skin in organ-culture with rifampicin and UV irradiation. The expression of SLCO2B1 (OATPB, SLCO3A1 (OATPD, SLCO4A1 (OATPE, SLC47A1 and SLC47A2 (MATE1 and MATE2 was detected in human skin, OATPE and MATE1 being the most expressed. OATPE is about 70 times more expressed in human skin than in human hepatocytes. Moreover, the expression of SLC47A1 and SLC47A2 was down-regulated after treatment with rifampicin or after exposure to UV light. The present findings demonstrate that SLCO4A1 (OATPE and SLC47A1 (MATE1 are highly expressed in human skin and suggest the involvement of SLC transporters in the disposition of topically applied drugs.

  11. Identification and characterization of jasmonate transporters

    DEFF Research Database (Denmark)

    Lambertz, Sophie Konstanze

    of the stimulus but also in distal tissues. The systemic accumulation has been the focus of many studies, which proposed that jasmonate is transported over long and short distances to induce defense responses. However, our knowledge of jasmonate transporting elements is marginal. In this thesis, two jasmonate...... Spodoptera littoralis and the fungus Botrytis cinerea was tested. Wounding assays indicate that the JEFFs are involved in systemic induction of the defense compounds glucosinolates, which may be caused by a JEFF mediated shift of jasmonate precursors to the biologically active form of jasmonates. Further...

  12. Molecular cloning and characterization of glucose transporter 1 ...

    African Journals Online (AJOL)

    Glucose transporter type-1 (glut1) and citrate synthase plays crucial role in glucose transport and regulation of tricarboxylic acid cycle (TCA) cycle in mammalian energy metabolism. The present study was aimed to clone and characterize glut1 and citrate synthase cDNA in water buffalo (Bubalus bubalis). Total of 90 ...

  13. Characterizing the toughness of an epoxy resin after wet aging using compact tension specimens with non-uniform moisture content

    KAUST Repository

    Quino, Gustavo; El Yagoubi, Jalal; Lubineau, Gilles

    2014-01-01

    Characterizing the change in toughness of polymers subjected to wet aging is challenging because of the heterogeneity of the testing samples. Indeed, as wet aging is guided by a diffusion/reaction process, compact tension samples (defined by the ASTM D5045 standard), which are relevant for toughness characterization but are somewhat thick, display a non-uniform moisture content over the bulk material. We define here a rigorous procedure to extract meaningful data from such tests. Our results showed that the relation between the moisture uptake of the whole sample and the measured toughness was not a meaningful material property. In fact, we found that the measured toughness depended on the locally varying moisture uptake over the cracking path. Here, we propose a post-processing technique that relies on a validated reaction/diffusion model to predict the three-dimensional moisture state of the epoxy. This makes identification of the variation in toughness with respect to the local moisture content possible. In addition, we analyze the fracture surface using micrography and roughness measurements. The observed variations in toughness are correlated with the roughness in the vicinity of the crack tip. © 2014 Elsevier Ltd. All rights rese.

  14. Characterizing the toughness of an epoxy resin after wet aging using compact tension specimens with non-uniform moisture content

    KAUST Repository

    Quino, Gustavo

    2014-11-01

    Characterizing the change in toughness of polymers subjected to wet aging is challenging because of the heterogeneity of the testing samples. Indeed, as wet aging is guided by a diffusion/reaction process, compact tension samples (defined by the ASTM D5045 standard), which are relevant for toughness characterization but are somewhat thick, display a non-uniform moisture content over the bulk material. We define here a rigorous procedure to extract meaningful data from such tests. Our results showed that the relation between the moisture uptake of the whole sample and the measured toughness was not a meaningful material property. In fact, we found that the measured toughness depended on the locally varying moisture uptake over the cracking path. Here, we propose a post-processing technique that relies on a validated reaction/diffusion model to predict the three-dimensional moisture state of the epoxy. This makes identification of the variation in toughness with respect to the local moisture content possible. In addition, we analyze the fracture surface using micrography and roughness measurements. The observed variations in toughness are correlated with the roughness in the vicinity of the crack tip. © 2014 Elsevier Ltd. All rights rese.

  15. Tryptophan Transport in Human Fibroblast Cells—A Functional Characterization

    Directory of Open Access Journals (Sweden)

    Ravi Vumma

    2011-01-01

    Full Text Available There are indications that serotonergic neurotransmission is disturbed in several psychiatric disorders. One explanation may be disturbed transport of tryptophan (precursor for serotonin synthesis across cell membranes. Human fibroblast cells offer an advantageous model to study the transport of amino acids across cell membranes, since they are easy to propagate and the environmental factors can be controlled. The aim of this study was to functionally characterize tryptophan transport and to identify the main transporters of tryptophan in fibroblast cell lines from healthy controls. Tryptophan kinetic parameters ( V max and K m at low and high concentrations were measured in fibroblasts using the cluster tray method. Uptake of 3 H (5-L-tryptophan at different concentrations in the presence and absence of excess concentrations of inhibitors or combinations of inhibitors of amino acid transporters were also measured. Tryptophan transport at high concentration (0.5 mM had low affinity and high V max and the LAT1 isoform of system-L was responsible for approximately 40% of the total uptake of tryptophan. In comparison, tryptophan transport at low concentration (50 nM had higher affinity, lower V max and approximately 80% of tryptophan uptake was transported by system-L with LAT1 as the major isoform. The uptake of tryptophan at the low concentration was mainly sodium (Na + dependent, while uptake at high substrate concentration was mainly Na + independent. A series of different transporter inhibitors had varying inhibitory effects on tryptophan uptake. This study indicates that tryptophan is transported by multiple transporters that are active at different substrate concentrations in human fibroblast cells. The tryptophan transport trough system-L was mainly facilitated by the LAT1 isoform, at both low and high substrate concentrations of tryptophan.

  16. Development of Nanoscale Graphitic Devices and The Transport Characterization

    International Nuclear Information System (INIS)

    Gunasekaran, Venugopal

    2011-02-01

    This dissertation describes the development of graphitic based nanoscale devices with its fabrication and transport characterization results. It covers graphite nano-scale stacked-junctions fabricated using focused ion beam (FIB) 3-D etching technique, a single layer graphite layer (graphene) preparation and its electrical transport characterization results and the synthesis and investigation of electrical transport behavior of graphene oxide based thin film devices. The first chapter describes the basic information about the carbon family in detail in which the electronic properties and structure of graphite, graphene and graphene oxide are discussed. In addition, the necessity of developing nanoscale graphitic devices is given. The second chapter explains the experimental techniques used in this research for fabricating nanoscale devices which includes focused ion beam 3-D fabrication procedures, mechanical exfoliation technique and photolithographic methods. In third chapter, we have reported the results on temperature dependence of graphite planar-type structures fabricated along ab-plane. In the fourth and fifth chapters, the fabrication and electrical transport characteristics of large in-plane area graphite planar-type structures (fabricated along ab-plane and c-axis) were discussed and their transport anisotropy properties were investigated briefly. In the sixth chapter, we focused the fabrication of the submicron sized graphite stacked junctions and their electrical transport characterization studies. In which, FIB was used to fabricated the submicron junctions with various in-plane area (with same stack height) are and their transport characteristics were compared. The seventh chapter reports investigation of electrical transport results of nanoscale graphite stacked-junctions in which the temperature dependent transport (R-T) studies, current-voltage measurements for the various in-plane areas and for various stack height samples were analyzed. The

  17. Concentration polarization effects on the macromolecular transport in the presence of non-uniform magnetic field: A numerical study using a lumen-wall model

    Energy Technology Data Exchange (ETDEWEB)

    Mohammadpourfard, M., E-mail: Mohammadpour@azaruniv.edu [Department of Mechanical Engineering, Azarbaijan Shahid Madani University, Tabriz 53751-71379 (Iran, Islamic Republic of); Aminfar, H., E-mail: hh_aminfar@tabrizu.ac.ir [Faculty of Mechanical Engineering, University of Tabriz, Tabriz (Iran, Islamic Republic of); Khajeh, K., E-mail: khajeh.k.2005@gmail.com [Faculty of Mechanical Engineering, University of Tabriz, Tabriz (Iran, Islamic Republic of)

    2014-04-01

    In this paper, the concentration polarization phenomena in a two dimensional tube under steady state conditions containing ferrofluid (blood and 4 vol% Fe{sub 3}O{sub 4}) is reported in the presence of non-uniform magnetic field. Lumen-wall model has been used for solving the mass transport equation. Hemodynamics parameters such as flow rate, viscosity, wall shear stress (WSS) and the macromolecules surface concentration which accumulate on the blood vessel wall, influenced the formation and progression of atherosclerosis disease. Effective parameters on the low density lipoprotein (LDL) surface concentration (LSC) such as: the wall filtration velocity, inlet Reynolds number and WSS under applied non-uniform magnetic field have been examined. Numerical solution of governing equations of the flow field have been obtained by using the single-phase model and the control volume technique. Magnetic field is generated by an electric current going through a thin and straight wire oriented perpendicular to the tube. Results show WSS in the vicinity of magnetic field source increased and LSC decreased along the wall. - Highlights: • In this paper the concentration polarization phenomena of blood flow is reported in the presence of non-uniform magnetic field. • In presence of non-uniform magnetic field LSC will decrease along the wall due to the increasing the velocity gradients near the magnetic source. • When non-uniform magnetic field intensity increases, LSC along the wall becomes lower. • Non-uniform magnetic field can affects the flow more in low Reynolds numbers.

  18. Characterization of molecule and particle transport through nanoscale conduits

    Science.gov (United States)

    Alibakhshi, Mohammad Amin

    Nanofluidic devices have been of great interest due to their applications in variety of fields, including energy conversion and storage, water desalination, biological and chemical separations, and lab-on-a-chip devices. Although these applications cross the boundaries of many different disciplines, they all share the demand for understanding transport in nanoscale conduits. In this thesis, different elusive aspects of molecule and particle transport through nanofluidic conduits are investigated, including liquid and ion transport in nanochannels, diffusion- and reaction-governed enzyme transport in nanofluidic channels, and finally translocation of nanobeads through nanopores. Liquid or solvent transport through nanoconfinements is an essential yet barely characterized component of any nanofluidic systems. In the first chapter, water transport through single hydrophilic nanochannels with heights down to 7 nm is experimentally investigated using a new measurement technique. This technique has been developed based on the capillary flow and a novel hybrid nanochannel design and is capable of characterizing flow in both single nanoconduits as well as nanoporous media. The presence of a 0.7 nm thick hydration layer on hydrophilic surfaces and its effect on increasing the hydraulic resistance of the nanochannels is verified. Next, ion transport in a new class of nanofluidic rectifiers is theoretically and experimentally investigated. These so called nanofluidic diodes are nanochannels with asymmetric geometries which preferentially allow ion transport in one direction. A nondimensional number as a function of electrolyte concentration, nanochannel dimensions, and surface charge is derived that summarizes the rectification behavior of this system. In the fourth chapter, diffusion- and reaction-governed enzyme transport in nanofluidic channels is studied and the theoretical background necessary for understanding enzymatic activity in nanofluidic channels is presented. A

  19. Monitoring and characterization of radionuclide transport in the hydrogeologic system

    International Nuclear Information System (INIS)

    Phillips, S.J.; Raymond, J.R.

    1975-01-01

    The groundwater monitoring program provides information and data on groundwater quality required to evaluate the impact of waste disposal practices on the Hanford Reservation. The program includes: collection and analysis of groundwater samples on a routine basis; data processing, analysis and reporting; design, construction and maintenance of well sampling structures; and design and implementation of supporting research studies. Within the overall framework of the Groundwater Monitoring Program, the 300 Area and Wye Burial Ground Characterization Program was initiated to evaluate transport of radionuclides in the partially saturated zone above the water table and to provide site characterization at solid waste burial locations on the Reservation. Methods for collecting and analyzing program data include geophysical exploration by ground penetrating radar, refraction and reflection acoustics, magnetics, and metal detection; stratigraphic investigations by drilling and sample collection techniques; evaluation of transport phenomena by in situ psychrometric and gamma-neutron techniques; laboratory characterization of fluid and vapor transport-controlling mechanisms; and evaluation of biological radionuclide transport by organisms inhabiting contaminated areas

  20. A Non-Equilibrium Sediment Transport Model for Dam Break Flow over Moveable Bed Based on Non-Uniform Rectangular Mesh

    Directory of Open Access Journals (Sweden)

    Gangfeng Wu

    2018-05-01

    Full Text Available The use of multiple-level non-uniform rectangular mesh in coupled flow and sediment transport modeling is preferred to achieve high accuracy in important region without increasing computational cost greatly. Here, a robust coupled hydrodynamic and non-equilibrium sediment transport model is developed on non-uniform rectangular mesh to simulate dam break flow over movable beds. The enhanced shallow water and sediment transport equations are adopted to consider the mass and momentum exchange between the flow phase and sediment phase. The flux at the interface is calculated by the positivity preserving central upwind scheme, which belongs to Godunov-type Riemann-problem-solver-free central schemes and is less expensive than other popular Riemann solvers while still capable of tracking wet/dry fronts accurately. The nonnegative water depth reconstruction method is used to achieve second-order accuracy in space. The model was first verified against two laboratory experiments of dam break flow over irregular fixed bed. Then the quantitative performance of the model was further investigated by comparing the computational results with measurement data of dam break flow over movable bed. The good agreements between the measurements and the numerical simulations are found for the flow depth, velocity and bed changes.

  1. Coating strategy for enhancing illumination uniformity in a lithographic condenser

    International Nuclear Information System (INIS)

    Gaines, D.P.; Vernon, S.P.; Sommargren, G.E.; Kania, D.R.

    1995-01-01

    A three-element Koehler condenser system has been fabricated, characterized, and integrated into an EUV lithographic system. The multilayer coatings deposited on the optics were designed to provide optimal radiation transport efficiency and illumination uniformity. Extensive EUV characterization measurements performed on the individual optics and follow-on system measurements indicated that the condenser was operating close to design goals. Multilayer d-spacings were within 0.05 nm of specifications, and reflectances were approximately 60%. Illumination uniformity was better than ±10%. The broadband transport efficiency was 11%

  2. Size graded sediment dynamics: from the processes characterization to the transport modelling in the English Channel

    International Nuclear Information System (INIS)

    Blanpain, O.

    2009-10-01

    The purpose of this work is the implementation of a sediment transport model in the English Channel. The design of such a model requires the identification of the physical processes, their modelling and their in-situ validation. Because of the sedimentary particularities of the study area, modelling of the mechanical behaviour of a non uniform mixture of sediments and particularly of the fine grains within a coarse matrix is required. This study focused on the characterization of the relevant processes by acquisition of experimental and in-situ data. Data acquired in hydro-sedimentary conditions comparable to those found in the English Channel are scarce. A new instrument and image processing technique were specifically conceived and implemented in-situ to observe and measure, with a high temporal resolution, the dynamics of a strongly heterogeneous mixture of particles in a grain-size scale. The data collected compared well with several existing formulations. One of these formulations was chosen to be adapted. The transfer dynamics of fine grains in coarse sediments and their depth of penetration were acquired from stratigraphic samples. The sediment transport model deals with multi-size grains and multi sedimentary layers, it is forced by swell and currents, and accounts for bead load and suspended load transports. It was applied to realistic scenarios for the English Channel. (author)

  3. Workplace characterizations in case of rail transport of radioactive materials

    International Nuclear Information System (INIS)

    Donadille, L.; Itie, C.; Lahaye, T.; Muller, H.; Bottolier-Depois, J.F.

    2005-01-01

    Full text: Radioactive fuel and wastes are frequently transported for storage and/or reprocessing purposes. The main part of this transport is generally done by train. Before, during and after the journey, operators and drivers, who work directly in contact with and in the vicinity of the wagons, are exposed to external irradiations due to the radioactive materials that are confined inside the containers. In order to evaluate the dose that its personnel is liable to receive during such transports, the French National Railway Company (SNCF) has requested to the Institute of Radiological Protection and Nuclear Safety (IRSN) a series of workplaces characterizations for convoys of different types, that are considered to be representative of all types of possible transports. Each one is associated to a given radioactive material (low and medium activity wastes, new and used fuel, MOX, uranium fluoride, etc... ), involving photon or mixed neutron-photon fields. This measurement campaign has started in May 2004 and by the end of 2004 at least four types of radioactive convoys will have been investigated (three have already been measured). By using survey meters and spectrometers, the study consists in measuring the external exposure for different stages of the work that is done beside the wagons (for example coupling / decoupling two wagons, or checking the brakes) and inside the locomotive (driving). For each one of these workplaces, the exposure is estimated in terms of the ambient dose equivalent H*(10) by summing the dose all along the different phases carried out by the operator. In addition, a dosimetric characterization of each convoy is made by performing measurements along the wagons and spectrometric information about the photon and/or neutron fields are collected. This study provides helpful data to predict the dose that the operators are liable to integrate over long periods, typically one year. (author)

  4. Characterization of HR coatings for the megajoule laser transport mirrors

    International Nuclear Information System (INIS)

    Fornier, A.; Cordillot, C.; Bernardino, D.; Lam, O.; Roussel, A.

    1997-01-01

    One of the concerns with the Megajoule Laser design is the laser-induced damage threshold of the transport mirrors. Earlier studies have shown that the main constraint on the laser damage threshold comes from nodules at the mirror surface. It is therefore important to restrict the number of such nodules. SFIM-ODS, in close collaboration with CEL-V, has initiated a special study to characterize these nodules as precisely as possible. The objective of the study is twofold: (1) to determine the origin of the nodules and subsequently to adapt the mirror fabrication process in order to limit their formation, (2) to analyze their shapes and dimensions in order to ascertain which nodules are critical for laser-induced damage. To understand the origin of the nodules and their effect on the laser damage threshold, the mirrors are characterized using various methods, (3) absorption and scatter mapping: does the presence of nodules result in specific absorption patterns? (4) surface analysis by atomic force microscopy: to characterize nodule shape and dimensions, (5) Focused Ion Beam (FIB) cutting of nodules: to locate the seed initiating the nodule (on the substrate or in the stack), and to characterize the seed shape and composition (contamination, material spatter during evaporation, etc.), and (6) laser damage threshold measurements: to determine the laser damage threshold of the mirror and study the behavior of nodules under laser irradiation depending on their dimensions and shape

  5. The riboflavin transporter RibU in Lactococcus lactis : Molecular characterization of gene expression and the transport mechanism

    NARCIS (Netherlands)

    Burgess, CM; Slotboom, DJ; Geertsma, ER; Duurkens, Hinderika; Poolman, B; van Sinderen, D

    This study describes the characterization of the riboflavin transport protein RibU in the lactic acid bacterium Lactococcus lactis subsp. cremoris NZ9000. RibU is predicted to contain five membrane-spanning segments and is a member of a novel transport protein family, not described in the Transport

  6. Monitoring and characterization of radionuclide transport in the hydrogeologic system

    International Nuclear Information System (INIS)

    Phillips, S.J.; Raymond, J.R.

    1975-01-01

    Historical records pertaining to the 300 North and Wye Burial Grounds at the Hanford Reservation were reviewed as a prerequisite to determining programs for land reclamation. All available historical documents, agency communications, and engineering drawings related to the study areas were located, reviewed, and analyzed. An inventory of recorded location, type, and quantity of radionuclides and associated materials in each burial ground was completed and distributed to cooperating investigators. A geophysical survey of the 300 North Burial Ground was conducted as a basis for detecting the composition, size, distribution, and depth of buried objects and characterizing the sediments in which they are buried. Acoustic, radar, magnetic, and metal detection surveys were completed and their applicability evaluated; drilling techniques and equipment for recovering and characterizing sediments and radioactive contaminated material were developed. Drilling will also determine the amount and dimensional extent of radionuclide migration; sediment-fluid interaction and fluid migration through the unsaturated zone at the 300 North Burial Ground were characterized. A study to determine biological transport of radionuclides at the Wye Burial Ground was also initiated. This study involved a preliminary survey of present flora and fauna inhabiting the Wye Burial Ground site. Plant tissue was chemically and radiochemically analyzed to determine radionuclide migration and possible dose effects and population dynamics of burrowing animals that could potentially be exposed to buried waste materials were investigated

  7. Synthesis and characterization of uniform silica nanoparticles on nickel substrate by spin coating and sol-gel method

    Science.gov (United States)

    Ngoc Thi Le, Hien; Jeong, Hae Kyung

    2014-01-01

    Spin coating and sol-gel methods are proposed for the preparation of silica nanoparticles on a nickel substrate using silicon tetrachloride, 2-methoxyethanol, and four different types of alkaline solutions. The effects of the type of alkaline solution, concentration of silica solution, and speed of spin coating on the properties of silica nanoparticles are investigated systematically. Uniform spherical shape of silica nanoparticles on Ni with the smallest size are obtained with sodium carbonate among the alkaline solutions after stirring at 70 °C for 6 h and spin-coating at 7000 rpm. Physical and electrochemical properties of the silica particles are investigated.

  8. Functional expression and characterization of plant ABC transporters in Xenopus laevis oocytes for transport engineering purposes

    DEFF Research Database (Denmark)

    Xu, Deyang; Veres, Dorottya; Belew, Zeinu Mussa

    2016-01-01

    the question whether the oocytes system is suitable to express and characterize ABC transporters. Thus we have selected AtABCG25, previously characterized in insect cells as the exporter of commercially valuable abscisic acid—as case study for optimizing of characterization in Xenopus oocytes. The tools...

  9. Advances in methods for identification and characterization of plant transporter function

    DEFF Research Database (Denmark)

    Larsen, Bo; Xu, Deyang; Halkier, Barbara Ann

    2017-01-01

    Transport proteins are crucial for cellular function at all levels. Numerous importers and exporters facilitate transport of a diverse array of metabolites and ions intra- and intercellularly. Identification of transporter function is essential for understanding biological processes at both......-based approaches. In this review, we highlight examples that illustrate how new technology and tools have advanced identification and characterization of plant transporter functions....

  10. Characterizing the Role of Nanoparticle Design on Tumor Transport and Stability in the Extracellular Environment

    Science.gov (United States)

    Albanese, Alexandre

    Nanotechnology has emerged as an exciting strategy for the delivery of diagnostic and therapeutic agents into established tumors. Advancements in nanomaterial synthesis have generated an extensive number of nanoparticle designs made from different materials. Unfortunately, it remains impossible to predict a design's effectiveness for in vivo tumor accumulation. Little is known about how a nanoparticle's morphology and surface chemistry affect its interactions with cells and proteins inside the tumor tissue. This thesis focuses on the development of in vitro experimental tools to evaluate how nanoparticle design affects transport in a three-dimensional tumor tissue and stability in the tumor microenvironment. Nanoparticle transport was evaluated using a novel 'tumor-on-a-chip' system where multicellular tumor spheroids were immobilized in a microfluidic channel. This setup created a three-dimensional tumor environment displaying physiological cell density, extracellular matrix organization, and interstitial flow rates. The tumor-on-a-chip demonstrated that accumulation of nanoparticles was limited to diameters below 110 nm and was improved by receptor targeting. Nanoparticle stability in the tumor microenvironment was evaluated using media isolated from different tumor cell lines. Nanoparticle diameter and surface chemistry were important determinants of stability in cancer cell-conditioned media. Small nanoparticles with unstable surface chemistries adsorbed cellular proteins on their surface and were prone to aggregation. Nanoparticle aggregation altered cellular interactions leading to changes in cell uptake. Using a novel technique to generate different aggregate sizes possessing a uniform surface composition, it was determined that aggregation can change receptor affinity, cell internalization mechanisms and sub-cellular sequestration patterns. Data from this thesis characterize the behavior of nanoparticles within modeled tumor environments and provide some

  11. Genome-wide identification and expression characterization of ABCC-MRP transporters in hexaploid wheat.

    Science.gov (United States)

    Bhati, Kaushal K; Sharma, Shivani; Aggarwal, Sipla; Kaur, Mandeep; Shukla, Vishnu; Kaur, Jagdeep; Mantri, Shrikant; Pandey, Ajay K

    2015-01-01

    The ABCC multidrug resistance associated proteins (ABCC-MRP), a subclass of ABC transporters are involved in multiple physiological processes that include cellular homeostasis, metal detoxification, and transport of glutathione-conjugates. Although they are well-studied in humans, yeast, and Arabidopsis, limited efforts have been made to address their possible role in crop like wheat. In the present work, 18 wheat ABCC-MRP proteins were identified that showed the uniform distribution with sub-families from rice and Arabidopsis. Organ-specific quantitative expression analysis of wheat ABCC genes indicated significantly higher accumulation in roots (TaABCC2, TaABCC3, and TaABCC11 and TaABCC12), stem (TaABCC1), leaves (TaABCC16 and TaABCC17), flag leaf (TaABCC14 and TaABCC15), and seeds (TaABCC6, TaABCC8, TaABCC12, TaABCC13, and TaABCC17) implicating their role in the respective tissues. Differential transcript expression patterns were observed for TaABCC genes during grain maturation speculating their role during seed development. Hormone treatment experiments indicated that some of the ABCC genes could be transcriptionally regulated during seed development. In the presence of Cd or hydrogen peroxide, distinct molecular expression of wheat ABCC genes was observed in the wheat seedlings, suggesting their possible role during heavy metal generated oxidative stress. Functional characterization of the wheat transporter, TaABCC13 a homolog of maize LPA1 confirms its role in glutathione-mediated detoxification pathway and is able to utilize adenine biosynthetic intermediates as a substrate. This is the first comprehensive inventory of wheat ABCC-MRP gene subfamily.

  12. Chancellor Water Colloids: Characterization and Radionuclide Associated Transport

    Energy Technology Data Exchange (ETDEWEB)

    Reimus, Paul William [Los Alamos National Lab. (LANL), Los Alamos, NM (United States); Boukhalfa, Hakim [Los Alamos National Lab. (LANL), Los Alamos, NM (United States)

    2014-09-26

    Column transport experiments were conducted in which water from the Chancellor nuclear test cavity was transported through crushed volcanic tuff from Pahute Mesa. In one experiment, the cavity water was spiked with solute 137Cs, and in another it was spiked with 239/240Pu(IV) nanocolloids. A third column experiment was conducted with no radionuclide spike at all, although the 137Cs concentrations in the water were still high enough to quantify in the column effluent. The radionuclides strongly partitioned to natural colloids present in the water, which were characterized for size distribution, mass concentration, zeta potential/surface charge, critical coagulation concentration, and qualitative mineralogy. In the spiked water experiments, the unanalyzed portion of the high-concentration column effluent samples were combined and re-injected into the respective columns as a second pulse. This procedure was repeated again for a third injection. Measurable filtration of the colloids was observed after each initial injection of the Chancellor water into the columns, but the subsequent injections (spiked water experiments only) exhibited no apparent filtration, suggesting that the colloids that remained mobile after relatively short transport distances were more resistant to filtration than the initial population of colloids. It was also observed that while significant desorption of 137Cs from the colloids occurred after the first injection in both the spiked and unspiked waters, subsequent injections of the spiked water exhibited much less 137Cs desorption (much greater 137Cs colloid-associated transport). This result suggests that the 137Cs that remained associated with colloids during the first injection represented a fraction that was more strongly adsorbed to the mobile colloids than the initial 137Cs associated with the colloids. A greater amount of the 239/240

  13. Characterization of Nanoscale Gas Transport in Shale Formations

    Science.gov (United States)

    Chai, D.; Li, X.

    2017-12-01

    Non-Darcy flow behavior can be commonly observed in nano-sized pores of matrix. Most existing gas flow models characterize non-Darcy flow by empirical or semi-empirical methods without considering the real gas effect. In this paper, a novel layered model with physical meanings is proposed for both ideal and real gas transports in nanopores. It can be further coupled with hydraulic fracturing models and consequently benefit the storage evaluation and production prediction for shale gas recovery. It is hypothesized that a nanotube can be divided into a central circular zone where the viscous flow behavior mainly exists due to dominant intermolecular collisions and an outer annular zone where the Knudsen diffusion mainly exists because of dominant collisions between molecules and the wall. The flux is derived based on integration of two zones by applying the virtual boundary. Subsequently, the model is modified by incorporating slip effect, real gas effect, porosity distribution, and tortuosity. Meanwhile, a multi-objective optimization method (MOP) is applied to assist the validation of analytical model to search fitting parameters which are highly localized and contain significant uncertainties. The apparent permeability is finally derived and analyzed with various impact factors. The developed nanoscale gas transport model is well validated by the flux data collected from both laboratory experiments and molecular simulations over the entire spectrum of flow regimes. It has a decrease of as much as 43.8% in total molar flux when the real gas effect is considered in the model. Such an effect is found to be more significant as pore size shrinks. Knudsen diffusion accounts for more than 60% of the total gas flux when pressure is lower than 0.2 MPa and pore size is smaller than 50 nm. Overall, the apparent permeability is found to decrease with pressure, though it rarely changes when pressure is higher than 5.0 MPa and pore size is larger than 50 nm.

  14. Wafer scale imprint uniformity evaluated by LSPR spectroscopy: a high volume characterization method for nanometer scale structures

    DEFF Research Database (Denmark)

    Jeppesen, Claus; Lindstedt, Daniel Nilsson; Vig, Asger Laurberg

    2012-01-01

    numerical simulations of imprinted structures characterized by atomic force microscopy. There is a fair agreement between the two methods and the simulations enable the translation of optical spectra to critical dimensions of the physical structures, a concept known from scatterometry. The results...

  15. Characterization and Beam Tests Results of Non-Uniformly Irradiated 3D Pixel Sensors for HEP Experiments

    International Nuclear Information System (INIS)

    Lopez, I.; Grinstein, S.; Micelli, A.; Tsiskaridze, S.

    2013-06-01

    3D Pixel detectors, with cylindrical electrodes that penetrate the silicon substrate, offer advantages over standard planar sensors in terms of radiation hardness, since the charge collection distance can be reduced independently of the bulk thickness. In the framework of the ATLAS Forward Physics (AFP) program, work has been carried out to study the suitability of 3D pixel devices for forward proton tracking. The AFP tracker unit will consist of an array of five pixel sensors placed at 2-3 mm from the Large Hadron Collider (LHC) proton beam. The proximity to the beam is essential for the AFP physics program as it directly increases the sensitivity of the experiment. Thus, there are two critical requirements for the AFP pixel detector. First, the dead region of the sensor has to be minimized. Second, the device has to be able to cope with a very inhomogeneous radiation distribution. Recent results of the characterization and beam test studies of in-homogeneously irradiated 3D pixel sensors produced at CNM-Barcelona will be presented. (authors)

  16. Using heterologous expression systems to characterize potassium and sodium transport activities.

    Science.gov (United States)

    Rodríguez, Alonso; Benito, Begoña; Cagnac, Olivier

    2012-01-01

    The expression of plant transporters in simple well-characterized cell systems is an irreplaceable technique for gaining insights into the kinetic and energetic features of plant transporters. Among all the available expression systems, yeast cells offer the highest simplicity and have the capacity to mimic the in vivo properties of plant transporters. Here, we describe the use of yeast mutants to express K(+) and Na(+) plant transporters and discuss some experimental problems that can produce misleading results.

  17. Molecular cloning, expression and characterization of a bovine serotonin transporter

    DEFF Research Database (Denmark)

    Mortensen, O V; Kristensen, A S; Rudnick, G

    1999-01-01

    The serotonin transporter (SERT) is a member of a highly homologous family of sodium/chloride dependent neurotransmitter transporters responsible for reuptake of biogenic amines from the extracellular fluid. SERT constitutes the pharmacological target of several clinically important antidepressan......-methylenedioxymethamphetamine (MDMA) was mainly unchanged. RT-PCR amplification of RNA from different tissues demonstrated expression of SERT in placenta, brain stem, bone marrow, kidney, lung, heart, adrenal gland, liver, parathyroid gland, thyroid gland, small intestine and pancreas....

  18. Characterization and scaling of the tokamak edge transport barrier

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, Philip Adrian

    2012-04-24

    The high confinement regime (H-mode) in a tokamak plasma displays a remarkable edge region. On a small spatial scale of 1-2 cm the properties of the plasma change significantly. Certain parameters vary 1-2 orders of magnitude in this region, called the pedestal. Currently, there is no complete understanding of how the pedestal forms or how it is sustained. The goal of this thesis is to contribute to the theoretical understanding of the pedestal and provide scalings towards larger machines, like ITER and DEMO. A pedestal database was built with data from different tokamaks: ASDEX Upgrade, DIIID and JET. The pedestal was characterized with the same method for all three machines. This gives the maximum value, gradient and width of the pedestal in n{sub e}, T{sub e} and T{sub i}. These quantities were analysed along with quantities derived from them, such as the pressure or the confinement time. For this purpose two parameter sets were used: normalized parameters (pressure {beta}, time {nu}{sub *}, length {rho}{sub *}, shape f{sub q}) and machine parameters (size a, magnetic field B{sub t}, plasma current I{sub p}, heating P). All results are dependent on the choice of the coordinate system: normalized poloidal flux {Psi}{sub N} and real space r/a. The most significant result, which was obtained with both parameter sets, shows a different scaling of the pedestal width for the electron temperature and the electron density. The presented scalings predict that in ITER and DEMO the temperature pedestal will be appreciably wider than the density pedestal. The pedestal top scaling for the pressure reveals differences between the electron and the ion pressure. In extrapolations this results in values for T{sub e,ped} of 4 keV (ITER) and 10 keV (DEMO), but significantly lower values for the ion temperature. A two-term method was applied to use the pedestal pressure to determine the pedestal contribution to the global confinement time {tau}{sub E}. The dependencies in the

  19. Characterization and scaling of the tokamak edge transport barrier

    International Nuclear Information System (INIS)

    Schneider, Philip Adrian

    2012-01-01

    The high confinement regime (H-mode) in a tokamak plasma displays a remarkable edge region. On a small spatial scale of 1-2 cm the properties of the plasma change significantly. Certain parameters vary 1-2 orders of magnitude in this region, called the pedestal. Currently, there is no complete understanding of how the pedestal forms or how it is sustained. The goal of this thesis is to contribute to the theoretical understanding of the pedestal and provide scalings towards larger machines, like ITER and DEMO. A pedestal database was built with data from different tokamaks: ASDEX Upgrade, DIIID and JET. The pedestal was characterized with the same method for all three machines. This gives the maximum value, gradient and width of the pedestal in n e , T e and T i . These quantities were analysed along with quantities derived from them, such as the pressure or the confinement time. For this purpose two parameter sets were used: normalized parameters (pressure β, time ν * , length ρ * , shape f q ) and machine parameters (size a, magnetic field B t , plasma current I p , heating P). All results are dependent on the choice of the coordinate system: normalized poloidal flux Ψ N and real space r/a. The most significant result, which was obtained with both parameter sets, shows a different scaling of the pedestal width for the electron temperature and the electron density. The presented scalings predict that in ITER and DEMO the temperature pedestal will be appreciably wider than the density pedestal. The pedestal top scaling for the pressure reveals differences between the electron and the ion pressure. In extrapolations this results in values for T e,ped of 4 keV (ITER) and 10 keV (DEMO), but significantly lower values for the ion temperature. A two-term method was applied to use the pedestal pressure to determine the pedestal contribution to the global confinement time τ E . The dependencies in the scaling for τ E,ped are nearly identical to the IPB98 global

  20. Yucca Mountain transportation routes: Preliminary characterization and risk analysis

    International Nuclear Information System (INIS)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R.

    1991-01-01

    This report presents appendices related to the preliminary assessment and risk analysis for high-level radioactive waste transportation routes to the proposed Yucca Mountain Project repository. Information includes data on population density, traffic volume, ecologically sensitive areas, and accident history

  1. Effect of a uniform magnetic induction field upon the flow of an electrically conducting fluid placed in a straight rectangular cross section, one of the walls of which, characterized by an infinite conductivity, presents uniform translation movement

    International Nuclear Information System (INIS)

    Herve, Patrick

    1975-01-01

    This is a theoretical study of an electrically viscous fluid flowing in a straight rectangular cross section channel, a wall of which, infinitely conducting, is placed perpendicularly to the direction of a uniform magnetic induction field. The three other walls of the channel being electrically insulating, remain motionless. Formulas giving velocity distribution law in the straight section of the flow in relation to the Hartmann's number, curves illustrating the accelerating effect produced across the whole section, by the application of the magnetic induction field, and example for the distribution of the electric current lines in case of a square section are given [fr

  2. Characterization of a New Family of Metal Transporters

    Energy Technology Data Exchange (ETDEWEB)

    Mary Lou Geurinot; David Eide

    2002-04-29

    Metal ions are critical nutrients, yet overaccumulation of these same metals can also be toxic. To maintain appropriate intracellular levels, cells require specific metal uptake systems that are subject to precise homeostatic regulation. The long-range goal of our research is to define the molecular mechanism(s) and regulation of metal ion uptake in eukaryotic cells. Integrating genetic, molecular biological and biochemical approaches, we have examined these processes in the yeast Saccharomyces cerevisiae and the plant Arabidopsis thaliana. Both are proven model systems for studying fundamental cellular processes. Our work has focused on the ZIP family of metal transporters which we identified; this family has representatives in bacteria, fungi, plants and animals. IRT, one of the founding members of the ZIP family, is an essential cation transporter that is expressed in the epidermal cells of iron deficient plant roots and is responsible for uptake of iron from the soil. We now know that there are 15 ZIP genes in the Arabidopsis and the similarities among their encoded gene products. The ZIP family members display different substrate specificities for metals and different tissue distributions in Arabidopsis. Moreover, the family members respond differentially to metal deficiencies. For example, IRT1, ZIP6 and ZIP9 mRNA are expressed mainly in the roots of iron deficient plants whereas ZIP4 responds to both iron and zinc deficiency. Work in both yeast and Arabidopsis has addressed substrate specificity as well as how these transporters are regulated in response to metal availability

  3. Characterization of a New Family of Metal Transporters; FINAL

    International Nuclear Information System (INIS)

    Mary Lou Geurinot; David Eide

    2002-01-01

    Metal ions are critical nutrients, yet overaccumulation of these same metals can also be toxic. To maintain appropriate intracellular levels, cells require specific metal uptake systems that are subject to precise homeostatic regulation. The long-range goal of our research is to define the molecular mechanism(s) and regulation of metal ion uptake in eukaryotic cells. Integrating genetic, molecular biological and biochemical approaches, we have examined these processes in the yeast Saccharomyces cerevisiae and the plant Arabidopsis thaliana. Both are proven model systems for studying fundamental cellular processes. Our work has focused on the ZIP family of metal transporters which we identified; this family has representatives in bacteria, fungi, plants and animals. IRT, one of the founding members of the ZIP family, is an essential cation transporter that is expressed in the epidermal cells of iron deficient plant roots and is responsible for uptake of iron from the soil. We now know that there are 15 ZIP genes in the Arabidopsis and the similarities among their encoded gene products. The ZIP family members display different substrate specificities for metals and different tissue distributions in Arabidopsis. Moreover, the family members respond differentially to metal deficiencies. For example, IRT1, ZIP6 and ZIP9 mRNA are expressed mainly in the roots of iron deficient plants whereas ZIP4 responds to both iron and zinc deficiency. Work in both yeast and Arabidopsis has addressed substrate specificity as well as how these transporters are regulated in response to metal availability

  4. Characterization of sand lenses and their role for subsurface transport in low-permeability clay tills

    DEFF Research Database (Denmark)

    Kessler, Timo Christian; Klint, K. E.; Nilsson, B.

    2011-01-01

    Glacial sediments dominate large parts of the geological topology in Denmark. They predominantly consist of lowpermeability tills, but fractures and sand-lenses constitute zones of enhanced permeability facilitating preferential flow. This study focuses on characterization of sand deposits with r...... the sand lenses in hydro-geological models to successfully characterize subsurface flow and transport, e.g. for remediation activities....

  5. Transport processes investigation: A necessary first step in site scale characterization plans

    International Nuclear Information System (INIS)

    Roepke, C.; Glass, R.J.; Brainard, J.; Mann, M.; Kriel, K.; Holt, R.; Schwing, J.

    1995-01-01

    We propose an approach, which we call the Transport Processes Investigation or TPI, to identify and verify site-scale transport processes and their controls. The TPI aids in the formulation of an accurate conceptual model of flow and transport, an essential first step in the development of a cost effective site characterization strategy. The TPI is demonstrated in the highly complex vadose zone of glacial tills that underlie the Fernald Environmental Remediation Project (FEMP) in Fernald, Ohio. As a result of the TPI, we identify and verify the pertinent flow processes and their controls, such as extensive macropore and fracture flow through layered clays, which must be included in an accurate conceptual model of site-scale contaminant transport. We are able to conclude that the classical modeling and sampling methods employed in some site characterization programs will be insufficient to characterize contaminant concentrations or distributions at contaminated or hazardous waste facilities sited in such media

  6. Characterization of transport phenomena in porous transport layers using X-ray microtomography

    Science.gov (United States)

    Hasanpour, S.; Hoorfar, M.; Phillion, A. B.

    2017-06-01

    Among different methods available for estimating the transport properties of porous transport layers (PTLs) of polymer electrolyte membrane fuel cells, X-ray micro computed tomography (X-μCT) imaging in combination with image-based numerical simulation has been recognized as a viable tool. In this study, four commercially-available single-layer and dual-layer PTLs are analyzed using this method in order to compare and contrast transport properties between different PTLs, as well as the variability within a single sheet. Complete transport property datasets are created for each PTL. The simulation predictions indicate that PTLs with high porosity show considerable variability in permeability and effective diffusivity, while PTLs with low porosity do not. Furthermore, it is seen that the Tomadakis-Sotirchos (TS) analytical expressions for porous media match the image-based simulations when porosity is relatively low but predict higher permeability and effective diffusivity for porosity values greater than 80%. Finally, the simulations show that cracks within MPL of dual-layer PTLs have a significant effect on the overall permeability and effective diffusivity of the PTLs. This must be considered when estimating the transport properties of dual-layer PTLs. These findings can be used to improve macro-scale models of product and reactant transport within fuel cells, and ultimately, fuel cell efficiency.

  7. Advanced testing and characterization of transportation soils and bituminous sands

    CSIR Research Space (South Africa)

    Anochie-Boateng, Joseph

    2007-12-01

    Full Text Available This research study was intended to develop laboratory test procedures for advance testing and characterization of fine-grained cohesive soils and oil sand materials. The test procedures are based on typical field loading conditions and the loading...

  8. Contaminant Attenuation and Transport Characterization of 200-UP-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle MV [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Johnson, Kayla C. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-09-27

    Contaminants disposed of at the land surface migrate through the vadose zone, forming plumes in groundwater. Processes that occur in the groundwater can attenuate contaminant concentrations during transport through the aquifer. For this reason, quantifying contaminant attenuation and contaminant transport processes in the aquifer, in support of the conceptual site model (CSM) and fate and transport modeling, are important for assessing the need for, and type of, remediation in the groundwater, including monitored natural attenuation (MNA). The framework to characterize attenuation and transport processes provided in U.S. Environmental Protection Agency (EPA) guidance documents was used to guide the laboratory effort reported herein.

  9. Yucca Mountain transportation routes: Preliminary characterization and risk analysis

    International Nuclear Information System (INIS)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R.

    1991-01-01

    In this study, rail and highway routes which may be used for shipments of high-level nuclear waste to a proposed repository at Yucca Mountain, Nevada are characterized. This characterization facilitates three types of impact analysis: comparative study, limited worst-case assessment, and more sophisticated probabilistic risk assessment techniques. Data for relative and absolute impact measures are provided to support comparisons of routes based on selected characteristics. A worst-case scenario assessment is included to determine potentially critical and most likely places for accidents or incidents to occur. The assessment facilitated by the data in this study is limited because impact measures are restricted to the identification of potential areas or persons affected. No attempt is made to quantify the magnitude of these impacts. Most likely locations for accidents to occur are determined relative to other locations within the scope of this study. Independent factors and historical trends used to identify these likely locations are only proxies for accident probability

  10. Spacetime transformations from a uniformly accelerated frame

    International Nuclear Information System (INIS)

    Friedman, Yaakov; Scarr, Tzvi

    2013-01-01

    We use the generalized Fermi–Walker transport to construct a one-parameter family of inertial frames which are instantaneously comoving to a uniformly accelerated observer. We explain the connection between our approach and that of Mashhoon. We show that our solutions of uniformly accelerated motion have constant acceleration in the comoving frame. Assuming the weak hypothesis of locality, we obtain local spacetime transformations from a uniformly accelerated frame K′ to an inertial frame K. The spacetime transformations between two uniformly accelerated frames with the same acceleration are Lorentz. We compute the metric at an arbitrary point of a uniformly accelerated frame. (paper)

  11. The characterization of radiocaesium transport and retention in Nordic lakes

    International Nuclear Information System (INIS)

    Bjoernstad, H.E.; Brittain, J.E.; Saxen, R.; Sundblad, B.

    1994-01-01

    Fractionation studies of radiocaesium have been carried out in three Nordic lakes, Oevre Heimdalsvatn in Norway, Hillesjoen in Sweden and Saarisjaervi in Finland. These lakes differ markedly in several aspects and provide insight into the factors determining radionuclide transport in a range of lake ecosystems. Transport of 137 Cs in plant material (Coarse Particulate Organic Matter, CPOM) was about 17 times greater to Oevre Heimdalsvatn than Saarisjaervi, although over 99% of the inflow CPOM was retained in both lakes. Inflows to Hillesjoen were an order of magnitude lower than to Saarisjaervi and the net retention was only 71%, on account of the outflow of autochthonous production, largely water lily fragments. With regard to the water phase, the lakes differed in the activity of 137 Cs in the various molecular weight fractions. This was a function of catchment processes, resuspension and biological activity in the lakes. In Oevre Heimdalsvatn and Saarisjaervi 45% of the 137 Cs in the water phase was retained in the lake, while in Hillesjoen ten times more 137 Cs in the water phase was retained in the lake, while in Hillesjoen ten times more 137 Cs flowed out than flowed in, due to resuspension of 137 Cs-rich sediments. (orig.)

  12. Characterization of current transport in ferroelectric polymer devices

    KAUST Repository

    Hanna, Amir

    2014-01-01

    We report the charge injection characteristics in poly(vinylidene fluoride-trifluoroethylene), P(VDF-TrFE), as a function of electrode material in metal/ferroelectric/metal device structures. Symmetric and asymmetric devices with Al, Ag, Au and Pt electrodes were fabricated to determine the dominant carrier type, injection current density, and to propose transport mechanisms in the ferroelectric polymer. Higher work function metals such as Pt are found to inject less charges compared to lower work function metals, implying n-type conduction behavior for P(VDF-TrFE) with electrons as the dominant injected carrier. Two distinct charge transport regimes were identified in the P(VDF-TrFE) devices; a Schottky-limited conduction regime for low to intermediate fields (E < 20 MV/m), and a space-charge limited conduction (SCLC) regime for high fields (20 < E < 120 MV/m). Implication of these results for degradation in P(VDF-TrFE) memory performance are discussed. © 2013 Elsevier B.V. All rights reserved.

  13. Direct measurements of transport properties are essential for site characterization

    International Nuclear Information System (INIS)

    Wright, J.; Conca, J.L.

    1994-08-01

    Direct measurements of transport parameters on subsurface sediments using, the UFA method provided detailed hydrostratigraphic mapping, and subsurface flux distributions at a mixed-waste disposal site at Hanford. Seven hundred unsaturated conductivity measurements on fifty samples were obtained in only six months total of UFA run time. These data are used to provide realistic information to conceptual models, predictive models and restoration strategies. The UFA instrument consists of an ultracentrifuge with a constant, ultralow flow pump that provides fluid to the sample surface through a rotating seal assembly and microdispersal system. Effluent from the sample is collected in a transparent, volumetrically-calibrated chamber at the bottom of the sample assembly. Using a strobe light, an observer can check the chamber while the sample is being centrifuged. Materials can be run in the UFA as recomposited samples or in situ samples can be subcored directly into the sample UFA chamber

  14. Computational modeling and experimental characterization of indoor aerosol transport

    International Nuclear Information System (INIS)

    Konecni, Snezana; Whicker, Jeffrey J.; Martin, Richard A.

    2002-01-01

    When a hazardous aerosol or gas is inadvertently or deliberately released in an occupied facility, the airborne material presents a hazard to people. Inadvertent accidents and exposures continue to occur in Los Alamos and other nuclear facilities despite state-of-art engineering and administrative controls, and heightened diligence. Despite the obvious need in occupational settings and for homeland defense, the body of research in hazardous aerosol dispersion and control in large, complex, ventilated enclosures is extremely limited. The science governing generation, transport, inhalation, and detection of airborne hazards is lacking and must be developed to where it can be used by engineers or safety professionals in the prediction of worker exposure, in the prevention of accidents, or in the mitigation of terrorist actions. In this study, a commercial computational fluid dynamics (CFD) code, CFX5.4, and experiments were used to assess flow field characteristics, and to investigate aerosol release and transport in a large, ventilated workroom in a facility at Savannah River Site. Steady state CFD results illustrating a complex, ventilation-induced, flow field with vortices, velocity gradients, and quiet zones are presented, as are time-dependent CFD and experimental aerosol dispersion results. The comparison of response times between CFD and experimental results was favorable. It is believed that future applications of CFD and experiments can have a favorable impact on the design of ventilation (HVAC) systems and worker safety with consideration to facility costs. Ultimately, statistical methods will be used in conjunction with CFD calculations to determine the optimal number and location of detectors, as well as optimal egress routes in event of a release.

  15. Dynamic characterization of external and internal mass transport in heterotrophic biofilms from microsensors measurements.

    Science.gov (United States)

    Guimerà, Xavier; Dorado, Antonio David; Bonsfills, Anna; Gabriel, Gemma; Gabriel, David; Gamisans, Xavier

    2016-10-01

    Knowledge of mass transport mechanisms in biofilm-based technologies such as biofilters is essential to improve bioreactors performance by preventing mass transport limitation. External and internal mass transport in biofilms was characterized in heterotrophic biofilms grown on a flat plate bioreactor. Mass transport resistance through the liquid-biofilm interphase and diffusion within biofilms were quantified by in situ measurements using microsensors with a high spatial resolution (mass transport coefficients. The sensitivity of external and internal mass transport resistances to flow conditions within the range of typical fluid velocities over biofilms (Reynolds numbers between 0.5 and 7) was assessed. Estimated external mass transfer coefficients at different liquid phase flow velocities showed discrepancies with studies considering laminar conditions in the diffusive boundary layer near the liquid-biofilm interphase. The correlation of effective diffusivity with flow velocities showed that the heterogeneous structure of biofilms defines the transport mechanisms inside biofilms. Internal mass transport was driven by diffusion through cell clusters and aggregates at Re below 2.8. Conversely, mass transport was driven by advection within pores, voids and water channels at Re above 5.6. Between both flow velocities, mass transport occurred by a combination of advection and diffusion. Effective diffusivities estimated at different biofilm densities showed a linear increase of mass transport resistance due to a porosity decrease up to biofilm densities of 50 g VSS·L(-1). Mass transport was strongly limited at higher biofilm densities. Internal mass transport results were used to propose an empirical correlation to assess the effective diffusivity within biofilms considering the influence of hydrodynamics and biofilm density. Copyright © 2016 Elsevier Ltd. All rights reserved.

  16. Synthesis, characterization and charge transport mechanism of CdZnO nanorods

    International Nuclear Information System (INIS)

    Mahmoud, Waleed E.; Al-Ghamdi, A.A.; El-Tantawy, F.; Al-Heniti, S.

    2009-01-01

    ZnO and Cd-doped ZnO nanostructures were prepared by new facile method at 80 deg. C. XRD measurement indicated that both samples had typical hexagonal wurtzite structures. Transmission electron microscopy (TEM) measurement shows that rod-like crystals have been formed. EDX measurement confirms the incorporation of the cadmium ion into the crystalline lattice of ZnO and indicated that cadmium ions uniformly distributed on the surface of the rods. The doping with cadmium ions has a great influence on the optical properties of the ZnO. The electrical measurements of Cd-doped ZnO nanorod were measured. The current-voltage (I-V) characteristic curve revealed that the charge transport above 4 V is mainly non-linear due to grain boundary contribution. The complex impedance spectroscopy was confirmed that the grain boundary effect controls the charge transport mechanism through CdZnO ceramic material.

  17. Characterizing fate and transport properties in karst aquifers under different hydrologic conditions

    Science.gov (United States)

    Rodriguez, E.; Padilla, I. Y.

    2017-12-01

    Karst landscapes contain very productive aquifers. The hydraulic and hydrogeological characteristics of karst aquifers make these systems capable of storing and transporting large amount of water, but also highly vulnerable to contamination. Their extremely heterogeneous nature prevents accurate prediction in contaminant fate and transport. Even more challenging is to understand the impact of hydrologic conditions changes on fate and transport processes. This studies aims at characterizing fate and transport processes in the karst groundwater system of northern Puerto Rico under different hydrologic conditions. The study involves injecting rhodamine and uranine dyes into a sinkhole, and monitoring concentrations at a spring. Results show incomplete recovery of tracers, but breaking curves can be used to estimate advective, dispersive and mass transfer characteristic of the karst system. Preliminary results suggest significant differences in fate and transport characteristics under different hydrologic conditions.

  18. Functional characterization of water transport and cellular localization of three aquaporin paralogs in the salmonid intestine

    DEFF Research Database (Denmark)

    Madsen, Steffen S; Olesen, Jesper H; Bedal, Konstanze

    2011-01-01

    Intestinal water absorption is greatly enhanced in salmonids upon acclimation from freshwater (FW) to seawater (SW); however, the molecular mechanism for water transport is unknown. We conducted a pharmacological characterization of water absorption in the rainbow trout intestine along......%), 0.1 ouabain (72%), and 0.1 bumetanide (82%) suggesting that active transport, Na(+), K(+)-ATPase and Na(+), K(+), 2Cl(-)-co-transport are involved in establishing the driving gradient for water transport. J(v) was also inhibited by 1 mmol L(-1) HgCl(2), serosally (23% in M and 44% in P), mucosally...... (27% in M), or both (61% in M and 58% in P), suggesting involvement of both apical and basolateral aquaporins in water transport. The inhibition was antagonized by 5 mmol L(-1) mercaptoethanol. By comparison, 10 mmol L(-1) mucosal tetraethylammonium, an inhibitor of certain aquaporins, inhibited J...

  19. Quasi-uniform Space

    Directory of Open Access Journals (Sweden)

    Coghetto Roland

    2016-09-01

    Full Text Available In this article, using mostly Pervin [9], Kunzi [6], [8], [7], Williams [11] and Bourbaki [3] works, we formalize in Mizar [2] the notions of quasiuniform space, semi-uniform space and locally uniform space.

  20. Quasi-uniform Space

    OpenAIRE

    Coghetto Roland

    2016-01-01

    In this article, using mostly Pervin [9], Kunzi [6], [8], [7], Williams [11] and Bourbaki [3] works, we formalize in Mizar [2] the notions of quasiuniform space, semi-uniform space and locally uniform space.

  1. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-01-01

    Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  2. An Inverse Analysis Approach to the Characterization of Chemical Transport in Paints

    Science.gov (United States)

    Willis, Matthew P.; Stevenson, Shawn M.; Pearl, Thomas P.; Mantooth, Brent A.

    2014-01-01

    The ability to directly characterize chemical transport and interactions that occur within a material (i.e., subsurface dynamics) is a vital component in understanding contaminant mass transport and the ability to decontaminate materials. If a material is contaminated, over time, the transport of highly toxic chemicals (such as chemical warfare agent species) out of the material can result in vapor exposure or transfer to the skin, which can result in percutaneous exposure to personnel who interact with the material. Due to the high toxicity of chemical warfare agents, the release of trace chemical quantities is of significant concern. Mapping subsurface concentration distribution and transport characteristics of absorbed agents enables exposure hazards to be assessed in untested conditions. Furthermore, these tools can be used to characterize subsurface reaction dynamics to ultimately design improved decontaminants or decontamination procedures. To achieve this goal, an inverse analysis mass transport modeling approach was developed that utilizes time-resolved mass spectroscopy measurements of vapor emission from contaminated paint coatings as the input parameter for calculation of subsurface concentration profiles. Details are provided on sample preparation, including contaminant and material handling, the application of mass spectrometry for the measurement of emitted contaminant vapor, and the implementation of inverse analysis using a physics-based diffusion model to determine transport properties of live chemical warfare agents including distilled mustard (HD) and the nerve agent VX. PMID:25226346

  3. School Uniforms Redux.

    Science.gov (United States)

    Dowling-Sendor, Benjamin

    2002-01-01

    Reviews a recent decision in "Littlefield" by the 5th Circuit upholding a school uniform policy. Advises board member who wish to adopt a school uniform policy to solicit input from parents and students, research the experiences of other school districts with uniform policies, and articulate the interests they wish to promote through uniform…

  4. Do School Uniforms Fit?

    Science.gov (United States)

    White, Kerry A.

    2000-01-01

    In 1994, Long Beach (California) Unified School District began requiring uniforms in all elementary and middle schools. Now, half of all urban school systems and many suburban schools have uniform policies. Research on uniforms' effectiveness is mixed. Tightened dress codes may be just as effective and less litigious. (MLH)

  5. Mandatory School Uniforms.

    Science.gov (United States)

    Cohn, Carl A.

    1996-01-01

    Shortly after implementing a mandatory school uniform policy, the Long Beach (California) Public Schools can boast 99% compliance and a substantial reduction in school crime. The uniforms can't be confused with gang colors, save parents money, and help identify outsiders. A sidebar lists ingredients for a mandatory uniform policy. (MLH)

  6. 14 CFR Section 19 - Uniform Classification of Operating Statistics

    Science.gov (United States)

    2010-01-01

    ... Statistics Section 19 Section 19 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION... AIR CARRIERS Operating Statistics Classifications Section 19 Uniform Classification of Operating Statistics ...

  7. Preliminary characterization of materials for a reactive transport model validation experiment

    International Nuclear Information System (INIS)

    Siegel, M.D.; Ward, D.B.; Cheng, W.C.; Bryant, C.; Chocas, C.S.; Reynolds, C.G.

    1993-01-01

    The geochemical properties of a porous sand and several tracers (Ni, Br, and Li) have been characterized for use in a caisson experiment designed to validate sorption models used in models of inactive transport. The surfaces of the sand grains have been examined by a combination of techniques including potentiometric titration, acid leaching, optical microscopy, and scanning electron microscopy with energy-dispersive spectroscopy. The surface studies indicate the presence of small amounts of carbonate, kaolinite and iron-oxyhydroxides. Adsorption of nickel, lithium and bromide by the sand was measured using batch techniques. Bromide was not sorbed by the sand. A linear (K d ) or an isotherm sorption model may adequately describe transport of Li; however, a model describing the changes of pH and the concentrations of other solution species as a function of time and position within the caisson and the concomitant effects on Ni sorption may be required for accurate predictions of nickel transport

  8. Characterization of putative multidrug resistance transporters of the major facilitator-superfamily expressed in Salmonella Typhi

    DEFF Research Database (Denmark)

    Shaheen, Aqsa; Ismat, Fouzia; Iqbal, Mazhar

    2015-01-01

    Multidrug resistance mediated by efflux pumps is a well-known phenomenon in infectious bacteria. Although much work has been carried out to characterize multidrug efflux pumps in Gram-negative and Gram-positive bacteria, such information is still lacking for many deadly pathogens. The aim...... of this study was to gain insight into the substrate specificity of previously uncharacterized transporters of Salmonella Typhi to identify their role in the development of multidrug resistance. S. Typhi genes encoding putative members of the major facilitator superfamily were cloned and expressed in the drug......-hypersensitive Escherichia coli strain KAM42, and tested for transport of 25 antibacterial compounds, including representative antibiotics of various classes, antiseptics, dyes and detergents. Of the 15 tested putative transporters, STY0901, STY2458 and STY4874 exhibited a drug-resistance phenotype. Among these, STY4874...

  9. Automated fabrication, characterization and transport of ICF pellets. Final report, March 1, 1979-October 31, 1980

    International Nuclear Information System (INIS)

    Clifford, .D.W.; Boyd, B.A.; Lilienkamp, R.H.

    1980-12-01

    The near-term objectives of the contract were threefold: (1) evaluate techniques for the production of frozen hydrogen microspheres and demonstrate concepts for coating them; (2) develop and demonstrate an optical characterization system which could lead to automated pellet inspection; and (3) develop and demonstrate a preliminary electrostatic pellet transport control system. This report describes the equipment assembled for these experiments and the results obtained

  10. Synthesis and Characterization of Valyloxy Methoxy Luciferin for the Detection of Valacyclovirase and Peptide Transporter

    Science.gov (United States)

    Amidon, Gordon L.; Lee, Kyung-Dall

    2014-01-01

    An amino acid ester derivative of luciferin (valoluc) was synthesized to mimic the transport and activation of valacyclovir. This molecule was characterized in vitro for specificity and enzymatic constants, and then assayed in two different, physiologically-relevant conditions. It was demonstrated that valoluc activation is sensitive to the same cellular factors as valacyclovir and thus has the potential to elucidate the dynamics of amino acid ester prodrug therapies in a functional, high-throughput manner. PMID:25240255

  11. Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

    International Nuclear Information System (INIS)

    Ortega, P.; Custódio, M.R.; Zanotto, F.P.

    2014-01-01

    Highlights: • Cd 2+ gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd 2+ enter gill cells through Ca 2+ channels and is dependent of intracellular Ca 2+ levels. • Route of entry in gill cells also involves a Cd 2+ /Ca 2+ (2Na) exchanger. • Cd transport depends on Na + /K + -ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd 2+ transport and ouabain increase gill Cd 2+ transport. - Abstract: Membrane pathway for intracellular cadmium (Cd 2+ ) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd 2+ transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd 2+ concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd 2+ transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl 2 and different inhibitors. Addition of extracellular calcium (Ca 2+ ) to the cells affected little the fluorescence of FluoZin, confirming that Cd 2+ was the main ion increasing intracellular fluorescence. Ca 2+ channels blockers (nimodipine and verapamil) decreased Cd 2+ influx as well as vanadate, a Ca 2+ -ATPase blocker. Chelating intracellular Ca 2+ (BAPTA) decreased Cd 2+ influx in gill cells, while increasing intracellular Ca 2+ (caffeine) augmented Cd influx. Cd 2+ and ATP added at different temporal conditions were not effective at increasing intracellular Cd 2+ accumulation. Ouabain (Na + /K + -ATPase inhibitor) increased Cd 2+ influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd 2+ influx, a non-essential metal, through the gill cell plasma membrane of crabs are suggested

  12. Characterization of Newly Developed Semisolid Stir Joining Method for Cast Cu Base Alloy (Cu-Al-Si-Fe) and Effect of Stirrer Type on Uniformity of Microstructure

    Science.gov (United States)

    Ferasat, Keyvan; Aashuri, Hossein; Kokabi, Amir Hossein; Nikzad, Siamak; Shafizadeh, Mahdi

    2015-02-01

    In this research, the semisolid stir joining method was used to overcome the problem of hot cracking in welding aluminum and silicon bronzes. Moreover, the effects of grooved and cylindrical tools on the microstructure and mechanical properties of samples were examined. After welding specimens, mechanical tests were carried out to find differences between the cast and welded samples. Optical microscopy and scanning electron microscopy were used to study microstructure. X-ray diffraction was used to investigate compounds formed during casting and welding. The solidus and liquidus temperatures of the alloy were measured by differential scanning calorimetry. In this study, the temperature of the work pieces was raised to 1203 K (930 °C) that is in the semisolid region, and the weld seams were stirred by two different types of tools at the speed of 1600 rpm. Macro and micro-structural analyses show uniformity in the phase distribution for specimens welded by cylindrical tool. Desirable and uniform mechanical properties obtained when the cylindrical tool was used.

  13. A study of acute phase and transport protein synthesis in undernourished men using simulated infection and uniformly 15N-labelled Spirulina Platenses

    International Nuclear Information System (INIS)

    Kurpad, A.V.; Soares, M.J.; Sekhar, R.V.; Reeds, P.J.; Fjeld, C.R.

    1994-01-01

    This study was conducted to test the hypothesis that acute phase protein synthesis is accelerated and transport protein synthesis is decelerated in adult men in whom the stress of infection is superimposed upon undernutrition. As a pilot study, four chronically undernourished men and two well-nourished controls were studied on two occasions separated by four days; the second session was conducted 24 hours after the administration of typhoid vaccine. Basal urine and blood samples were collected and then subjects were given priming oral doses of 15 N-Spirulina (13.5mg/kg body weight) and oral doses (3.5mg/kg body weight) every 30 min for the next six hours. Meals were aliquoted during the dosing period. Blood samples were collected at four, five and six hours. 15 N enrichment in different fractions of plasma i.e., albumin, non-albumin and amino acids, was measured by combustion GC-IRMS. Total urinary nitrogen was measured by Kjeldahl. 5 refs, 2 figs, 3 tabs

  14. Synthesis and transport characterization of electrochemically deposited CdTe nanowires

    Science.gov (United States)

    Kaur, Jaskiran; Kaur, Harmanmeet; Singh, R. C.

    2018-04-01

    This paper reports the synthesis and characterization of CdTe nanowires. A thin polymeric films were irradiated with 80MeV Ag ions at a fluence of 8E7 ions/cm2, followed by UV irradiation and chemically etching in aqueous NaOH. Nanosizes go-through pores so formed were filled using a specially designed cell via electrodeposition. Nanowires so formed were further studied using SEM, I-V, UV and XRD analysis. SEM images show very smooth and uniform CdTe nanowires freely standing on the substrate. The in-situ I-V characteristics of nano-/micro structures was carried out at room temperature by leaving the structures embedded in the insulating template membrane itself.

  15. Functional characterization of apical transporters expressed in rat proximal tubular cells (PTCs) in primary culture.

    Science.gov (United States)

    Nakanishi, Takeo; Fukushi, Akimasa; Sato, Masanobu; Yoshifuji, Mayuko; Gose, Tomoka; Shirasaka, Yoshiyuki; Ohe, Kazuyo; Kobayashi, Masato; Kawai, Keiichi; Tamai, Ikumi

    2011-12-05

    Since in vitro cell culture models often show altered apical transporter expression, they are not necessarily suitable for the analysis of renal transport processes. Therefore, we aimed here to investigate the usefulness of primary-cultured rat proximal tubular cells (PTCs) for this purpose. After isolation of renal cortical cells from rat kidneys, PTCs were enriched and the gene expression and function of apical transporters were analyzed by means of microarray, RT-PCR and uptake experiments. RT-PCR confirmed that the major apical transporters were expressed in rat PTCs. Na(+)-dependent uptake of α-methyl-d-glucopyranoside (αMG), ergothioneine and carnitine by the PTCs suggests functional expression of Sglts, Octn1 and Octn2, respectively. Inhibition of pH-dependent glycylsarcosine uptake by low concentration of cephalexin, which is a β-lactam antibiotics recognized by Pepts, indicates a predominant role of high affinity type Pept2, but not low affinity type Pept1, in the PTCs. Moreover, the permeability ratio of [(14)C]αMG (apical to basolateral/basolateral to apical) across PTCs was 4.3, suggesting that Sglt-mediated reabsorptive transport is characterized. In conclusion, our results indicate that rat PTCs in primary culture are found to be a promising in vitro model to evaluate reabsorption processes mediated at least by Sglts, Pept2, Octn1 and Octn2.

  16. Characterization of vacuolar amino acid transporter from Fusarium oxysporum in Saccharomyces cerevisiae.

    Science.gov (United States)

    Lunprom, Siriporn; Pongcharoen, Pongsanat; Sekito, Takayuki; Kawano-Kawada, Miyuki; Kakinuma, Yoshimi; Akiyama, Koichi

    2015-01-01

    Fusarium oxysporum causes wilt disease in many plant families, and many genes are involved in its development or growth in host plants. A recent study revealed that vacuolar amino acid transporters play an important role in spore formation in Schizosaccharomyces pombe and Saccharomyces cerevisiae. To investigate the role of vacuolar amino acid transporters of this phytopathogenic fungus, the FOXG_11334 (FoAVT3) gene from F. oxysporum was isolated and its function was characterized. Transcription of FoAVT3 was upregulated after rapamycin treatment. A green fluorescent protein fusion of FoAvt3p was localized to vacuolar membranes in both S. cerevisiae and F. oxysporum. Analysis of the amino acid content of the vacuolar fraction and amino acid transport activities using vacuolar membrane vesicles from S. cerevisiae cells heterologously expressing FoAVT3 revealed that FoAvt3p functions as a vacuolar amino acid transporter, exporting neutral amino acids. We conclude that the FoAVT3 gene encodes a vacuolar neutral amino acid transporter.

  17. Functional characterization of Citrus macrophylla BOR1 as a boron transporter.

    Science.gov (United States)

    Cañon, Paola; Aquea, Felipe; Rodríguez-Hoces de la Guardia, Amparo; Arce-Johnson, Patricio

    2013-11-01

    Plants have evolved to develop an efficient system of boron uptake and transport using a range of efflux carriers named BOR proteins. In this work we isolated and characterized a boron transporter of citrus (Citrus macrophylla), which was named CmBOR1 for its high homology to AtBOR1. CmBOR1 has 4403 bp and 12 exons. Its coding region has 2145 bp and encodes for a protein of 714 amino acids. CmBOR1 possesses the molecular features of BORs such as an anion exchanger domain and the presence of 10 transmembrane domains. Functional analysis in yeast indicated that CmBOR1 has an efflux boron transporter activity, and transformants have increased tolerance to excess boron. CmBOR1 is expressed in leaves, stem and flowers and shows the greatest accumulation in roots. The transcript accumulation was significantly increased under boron deficiency conditions in shoots. In contrast, the accumulation of the transcript did not change in boron toxicity conditions. Finally, we observed that constitutive expression of CmBOR1 was able to increase tolerance to boron deficiency conditions in Arabidopsis thaliana, suggesting that CmBOR1 is a xylem loading boron transporter. Based on these results, it was determined that CmBOR1 encodes a boric acid/borate transporter involved in tolerance to boron deficiency in plants. © 2013 Scandinavian Plant Physiology Society.

  18. Experimental characterization of solid particle transport by slug flow using Particle Image Velocimetry

    International Nuclear Information System (INIS)

    Goharzadeh, A; Rodgers, P

    2009-01-01

    This paper presents an experimental study of gas-liquid slug flow on solid particle transport inside a horizontal pipe with two types of experiments conducted. The influence of slug length on solid particle transportation is characterized using high speed photography. Using combined Particle Image Velocimetry (PIV) with Refractive Index Matching (RIM) and fluorescent tracers (two-phase oil-air loop) the velocity distribution inside the slug body is measured. Combining these experimental analyses, an insight is provided into the physical mechanism of solid particle transportation due to slug flow. It was observed that the slug body significantly influences solid particle mobility. The physical mechanism of solid particle transportation was found to be discontinuous. The inactive region (in terms of solid particle transport) upstream of the slug nose was quantified as a function of gas-liquid composition and solid particle size. Measured velocity distributions showed a significant drop in velocity magnitude immediately upstream of the slug nose and therefore the critical velocity for solid particle lifting is reached further upstream.

  19. School Uniforms. Research Brief

    Science.gov (United States)

    Walker, Karen

    2007-01-01

    Does clothing make the person or does the person make the clothing? How does what attire a student wears to school affect their academic achievement? In 1996, President Clinton cited examples of school violence and discipline issues that might have been avoided had the students been wearing uniforms ("School uniforms: Prevention or suppression?").…

  20. Games Uniforms Unveiled

    Institute of Scientific and Technical Information of China (English)

    Linda

    2008-01-01

    The uniforms for Beijing Olympics’ workers, technical staff and volunteers have been unveiled to mark the 200-day countdown to the Games. The uniforms feature the key element of the clouds of promise and will be in three colors:red for Beijing Olympic Games Committee staff, blue

  1. Identification and Functional Characterization of the Caenorhabditis elegans Riboflavin Transporters rft-1 and rft-2

    Science.gov (United States)

    Biswas, Arundhati; Elmatari, Daniel; Rothman, Jason; LaMunyon, Craig W.; Said, Hamid M.

    2013-01-01

    Two potential orthologs of the human riboflavin transporter 3 (hRFVT3) were identified in the C. elegans genome, Y47D7A.16 and Y47D7A.14, which share 33.7 and 30.5% identity, respectively, with hRFVT3. The genes are tandemly arranged, and we assign them the names rft-1 (for Y47D7A.16) and rft-2 (for Y47D7A.14). Functional characterization of the coding sequences in a heterologous expression system demonstrated that both were specific riboflavin transporters, although the rft-1 encoded protein had greater transport activity. A more detailed examination of rft-1 showed its transport of riboflavin to have an acidic pH dependence, saturability (apparent Km = 1.4±0.5 µM), inhibition by riboflavin analogues, and Na+ independence. The expression of rft-1 mRNA was relatively higher in young larvae than in adults, and mRNA expression dropped in response to RF supplementation. Knocking down the two transporters individually via RNA interference resulted in a severe loss of fertility that was compounded in a double knockdown. Transcriptional fusions constructed with two fluorophores (rft-1::GFP, and rft-2::mCherry) indicated that rft-1 is expressed in the intestine and a small subset of neuronal support cells along the entire length of the animal. Expression of rft-2 is localized mainly to the intestine and pharynx. We also observed a drop in the expression of the two reporters in animals that were maintained in high riboflavin levels. These results report for the first time the identification of two riboflavin transporters in C. elegans and demonstrate their expression and importance to metabolic function in worms. Absence of transporter function renders worms sterile, making them useful in understanding human disease associated with mutations in hRFVT3. PMID:23483992

  2. 46 CFR 310.63 - Uniforms and textbooks.

    Science.gov (United States)

    2010-10-01

    ... 46 Shipping 8 2010-10-01 2010-10-01 false Uniforms and textbooks. 310.63 Section 310.63 Shipping MARITIME ADMINISTRATION, DEPARTMENT OF TRANSPORTATION TRAINING MERCHANT MARINE TRAINING Admission and Training of Midshipmen at the United States Merchant Marine Academy § 310.63 Uniforms and textbooks. The Academy shall supply midshipmen uniforms an...

  3. Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

    Energy Technology Data Exchange (ETDEWEB)

    Sá, M.G. [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Biosciences Institute, Department of Physiology, University of São Paulo, Rua do Matão, Travessa 14, 101, São Paulo 05508-900, SP (Brazil); Department of Biophysics, Escola Paulista de Medicina, Universidade Federal de Sao Paulo, Rua Três de Maio 100, Sao Paulo 04044-020 (Brazil)

    2013-11-15

    Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl{sub 2} (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V{sub max} for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10{sup 4} cells{sup −1} × 300 s{sup −1} respectively and K{sub m} values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K{sub m} for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that

  4. Characterization of copper transport in gill cells of a mangrove crab Ucides cordatus

    International Nuclear Information System (INIS)

    Sá, M.G.; Zanotto, F.P.

    2013-01-01

    Highlights: •Copper transport in gill cells of a mangrove crab Ucides cordatus is dependent of calcium. •Copper transport mechanism is ATP-dependent. •Transport was monitored second by second during 300 s. -- Abstract: The branchial epithelium of crustaceans is exposed to the environment and is the first site affected by metal pollution. The aim of this work was to characterize copper (Cu) transport using a fluorescent dye, Phen Green, in gill cells of a hypo-hyper-regulator mangrove crab Ucides cordatus. The results showed that added extracellular CuCl 2 (0, 0.025, 0.150, 0.275, 0.550 and 1.110 μM) showed typical Michaelis–Menten transport for Cu in anterior and posterior gill cells (V max for anterior and posterior gills: 0.41 ± 0.12 and 1.76 ± 0.27 intracellular Cu in μM × 22.10 4 cells −1 × 300 s −1 respectively and K m values: 0.44 ± 0.04 and 0.32 ± 0.13 μM, respectively). Intracellular Cu was significantly higher for posterior gill cells compared to anterior gill cells, suggesting differential accumulation for each gill type. Extracellular Ca at 20 mM decreased cellular Cu transport for both anterior and posterior gill cells. Nifedipine and verapamil, calcium channel inhibitors from plasma membrane, decreased Cu transport and affected K m for both gills. These results could be due to a competition between Cu and Ca. Amiloride, a Na/Ca exchanger inhibitor, as well as bafilomycin, a proton pump inhibitor, caused a decrease of intracellular Cu compared to control. Ouabain and KB-R 7943, acting on Na homeostasis, similarly decreased intracellular Cu in both gill cells. Besides that, gill cells exposed to ATP and Cu simultaneously, showed an increase in intracellular copper, which was inhibited by vanadate, an inhibitor of P-type ATPase. These results suggest either the presence of a Cu-ATPase in crab gill cells, responsible for Cu influx, or the effect of a change in electrochemical membrane potential that could also drive Cu to the gill cell

  5. Investigation on cryogenic laser fusion targets: fabrication, characterization, and transport. Annual report, December 1, 1978-November 30, 1979

    International Nuclear Information System (INIS)

    Kim, K.

    1979-01-01

    The research has been directed toward fabrication, characterization, and positioning of cryogenic shell laser fusion targets, with particular emphasis on the development of a scheme which would allow for continuous fabrication, inspection, and delivery of the targets. Specifically, progress has been made in the following areas: (1) Fabrication of a uniform spherical shell of DT-condensate using a cold-wall target-freezing-cell. (2) Fabrication of a uniform spherical shell of liquid DT using a room-temperature wall target-freezing-cell. (3) Support-free cryogenic target fabrication using cold-gas-levitation. (4) Continuous fabrication of cryogenic targets using free-fall method. (5) Automatic characterization of DT-layer uniformity. (6) Sorting of DT-filled glass microshells using an interference microscope. (7) Development of an a-c interference microscope for accurate characterization of moving targets. (8) Development of a machine which is capable of producing a continuous stream of uniform DT spheres of controllable sizes. (9) Theoretical study on the behavior of liquid hydrogen contained in a spherical shell

  6. Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport

    International Nuclear Information System (INIS)

    Cuesta, J.E.

    2006-06-01

    Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

  7. Creatine Transporter Deficiency: Screening of Males with Neurodevelopmental Disorders and Neurocognitive Characterization of a Case.

    Science.gov (United States)

    Thurm, Audrey; Himelstein, Daniel; DʼSouza, Precilla; Rennert, Owen; Jiang, Susanqi; Olatunji, Damilola; Longo, Nicola; Pasquali, Marzia; Swedo, Susan; Salomons, Gajja S; Carrillo, Nuria

    2016-05-01

    Creatine transporter deficiency (CTD) is an X-linked, neurometabolic disorder associated with intellectual disability that is characterized by brain creatine (Cr) deficiency and caused by mutations in SLC6A8, the Cr transporter 1 protein gene. CTD is identified by elevated urine creatine/creatinine (Cr/Crn) ratio or reduced Cr peak on brain magnetic resonance spectroscopy; the diagnosis is confirmed by decreased Cr uptake in cultured fibroblasts, and/or identification of a mutation in the SLC6A8 gene. Prevalence studies suggest this disorder may be underdiagnosed. We sought to identify cases from a well-characterized cohort of children diagnosed with neurodevelopmental disorders. Urine screening for CTD was performed on a cohort of 46 males with autism spectrum disorder (ASD) and 9 males with a history of non-ASD developmental delay (DD) classified with intellectual disability. We identified 1 patient with CTD in the cohort based on abnormal urine Cr/Crn, and confirmed the diagnosis by the identification of a novel frameshift mutation in the SLC6A8 gene. This patient presented without ASD but with intellectual disability, and was characterized by a nonspecific phenotype of early language delay and DD that persisted into moderate-to-severe intellectual disability, consistent with previous descriptions of CTD. Identification of patients with CTD is possible by measuring urine Cr and Crn levels and the current case adds to the growing literature of neurocognitive deficits associated with the disorder that affect cognition, language and behavior in childhood.

  8. Quantitative characterization of water transport and flooding in the diffusion layers of polymer electrolyte fuel cells

    Energy Technology Data Exchange (ETDEWEB)

    Casalegno, A.; Colombo, L.; Galbiati, S.; Marchesi, R. [Department of Energy, Politecnico di Milano, via Lambruschini 4, 20156 Milano (Italy)

    2010-07-01

    Optimization of water management in polymer electrolyte membrane fuel cells (PEMFC) and in direct methanol fuel cells (DMFC) is a very important factor for the achievement of high performances and long lifetime. A good hydration of the electrolyte membrane is essential for high proton conductivity; on the contrary water in excess may lead to electrode flooding and severe reduction in performances. Many studies on water transport across the gas diffusion layer (GDL) have been carried out to improve these components; anyway efforts in this field are affected by lack of effective experimental methods. The present work reports an experimental investigation with the purpose to determine the global coefficient of water transport across different diffusion layers under real operating conditions. An appropriate and accurate experimental apparatus has been designed and built to test the single GDL under a wide range of operating conditions. Data analysis has allowed quantification of both the water vapor transport across different diffusion layers, and the effects of micro-porous layers; furthermore flooding onset and its consequences on the mass transport coefficient have been characterized by means of suitably defined parameters. (author)

  9. Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric

    International Nuclear Information System (INIS)

    Silva Lobo, M.A. da; Kronemberger, B.M.E.

    1989-01-01

    Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs

  10. An integrated methodology for characterizing flow and transport processes in fractured rock

    International Nuclear Information System (INIS)

    Wu, Yu-Shu

    2007-01-01

    To investigate the coupled processes involved in fluid and heat flow and chemical transport in the highly heterogeneous, unsaturated-zone (UZ) fractured rock of Yucca Mountain, we present an integrated modeling methodology. This approach integrates a wide variety of moisture, pneumatic, thermal, and geochemical isotopic field data into a comprehensive three-dimensional numerical model for modeling analyses. The results of field applications of the methodology show that moisture data, such as water potential and liquid saturation, are not sufficient to determine in situ percolation flux, whereas temperature and geochemical isotopic data provide better constraints to net infiltration rates and flow patterns. In addition, pneumatic data are found to be extremely valuable in estimating large-scale fracture permeability. The integration of hydrologic, pneumatic, temperature, and geochemical data into modeling analyses is thereby demonstrated to provide a practical modeling approach for characterizing flow and transport processes in complex fractured formations

  11. Recent developments in the integrated approach toward characterization of radionuclide transport, Yucca Mountain, Nevada

    International Nuclear Information System (INIS)

    Simmons, A.M.; Canepa, J.A.

    1992-01-01

    The radionuclide migration program for the Yucca Mountain Site Characterization Project (YMP) includes studies of radionuclide solubility, sorption, diffusion, and transport. The study plans incorporate all possible parameters of investigation; decision-making strategies for prioritizing the parameters and evaluating their significance were developed in conjunction with the study plans. After definition of explicit research goals for each study, YMP evaluated the applicability of existing data and formulated experimental approaches for obtaining additional data. This resulted in development of individual testing strategies that were integrated into an overall strategy for the radionuclide migration program designed to provide input to credible performance assessments. The strategies allow for decision points at various steps of data collection and testing. They provide a streamlined process toward a defensible level of understanding of chemical retardation and transport processes that will be used to predict the mountain's ability to isolate waste. (author)

  12. Spatially distributed characterization of hyporheic solute transport during baseflow recession in a headwater mountain stream using electrical geophysical imaging

    Science.gov (United States)

    Adam S. Ward; Michael N. Gooseff; Michael Fitzgerald; Thomas J. Voltz; Kamini Singha

    2014-01-01

    The transport of solutes along hyporheic flowpaths is recognized as central to numerous biogeochemical cycles, yet our understanding of how this transport changes with baseflow recession, particularly in a spatially distributed manner, is limited. We conducted four steady-state solute tracer injections and collected electrical resistivity data to characterize hyporheic...

  13. Characterization of cadmium plasma membrane transport in gills of a mangrove crab Ucides cordatus

    Energy Technology Data Exchange (ETDEWEB)

    Ortega, P.; Custódio, M.R. [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Zanotto, F.P., E-mail: fzanotto@usp.br [Instituto de Biociências, Departamento de Fisiologia, Universidade de São Paulo, Rua do Matão, Travessa 14, #101, São Paulo 05508-900, SP (Brazil); Departamento de Biofísica, Escola Paulista de Medicina, Universidade Federal de São Paulo, Rua Três de Maio 100, São Paulo 04044-020 (Brazil)

    2014-12-15

    Highlights: • Cd{sup 2+} gill cell transport, a non-essential toxic metal, was characterized in a hypo-hyper-regulating mangrove crab Ucides cordatus. • Cd{sup 2+} enter gill cells through Ca{sup 2+} channels and is dependent of intracellular Ca{sup 2+} levels. • Route of entry in gill cells also involves a Cd{sup 2+}/Ca{sup 2+} (2Na) exchanger. • Cd transport depends on Na{sup +}/K{sup +}-ATPase and gill cell electrochemical gradient. • Vanadate inhibits gill Cd{sup 2+} transport and ouabain increase gill Cd{sup 2+} transport. - Abstract: Membrane pathway for intracellular cadmium (Cd{sup 2+}) accumulation is not fully elucidated in many organisms and has not been studied in crab gill cells. To characterize membrane Cd{sup 2+} transport of anterior and posterior gill cells of Ucides cordatus, a hypo-hyper-regulating crab, a change in intracellular Cd{sup 2+} concentration under various experimental conditions was examined by using FluoZin, a fluorescent probe. The membrane Cd{sup 2+} transport was estimated by the augmentation of FluoZin fluorescence induced by extracellular application of CdCl{sub 2} and different inhibitors. Addition of extracellular calcium (Ca{sup 2+}) to the cells affected little the fluorescence of FluoZin, confirming that Cd{sup 2+} was the main ion increasing intracellular fluorescence. Ca{sup 2+} channels blockers (nimodipine and verapamil) decreased Cd{sup 2+} influx as well as vanadate, a Ca{sup 2+}-ATPase blocker. Chelating intracellular Ca{sup 2+} (BAPTA) decreased Cd{sup 2+} influx in gill cells, while increasing intracellular Ca{sup 2+} (caffeine) augmented Cd influx. Cd{sup 2+} and ATP added at different temporal conditions were not effective at increasing intracellular Cd{sup 2+} accumulation. Ouabain (Na{sup +}/K{sup +}-ATPase inhibitor) increased Cd{sup 2+} influx probably through a change in intracellular Na and/or a change in cell membrane potential. Routes of Cd{sup 2+} influx, a non-essential metal, through the

  14. 49 CFR Appendix A to Part 1035 - Uniform Straight Bill of Lading

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 8 2010-10-01 2010-10-01 false Uniform Straight Bill of Lading A Appendix A to Part 1035 Transportation Other Regulations Relating to Transportation (Continued) SURFACE... Appendix A to Part 1035—Uniform Straight Bill of Lading Uniform Straight Bill of Lading Original—Not...

  15. Preparation, characterization, biological activity, and transport study of polystyrene based calcium–barium phosphate composite membrane

    Energy Technology Data Exchange (ETDEWEB)

    Khan, Mohammad Mujahid Ali; Rafiuddin,, E-mail: rafi_amu@rediffmail.com

    2013-10-15

    Calcium–barium phosphate (CBP) composite membrane with 25% polystyrene was prepared by co-precipitation method. Scanning electron microscopy (SEM), X-ray diffraction (XRD), Fourier transformed infrared (FTIR), and Thermogravimetric analysis (TGA) were used to characterize the membrane. The membrane was found to be crystalline in nature with consistent arrangement of particles and no indication of visible cracks. The electrical potentials measured across the composite membrane in contact with univalent electrolytes (KCl, NaCl and LiCl), have been found to increase with decrease in concentrations. Thus the membrane was found to be cation-selective. Transport properties of developed membranes may be utilized for the efficient desalination of saline water and more importantly demineralization process. The antibacterial study of this composite membrane shows good results for killing the disease causing bacteria along with waste water treatment. Highlights: • Transport properties of composite membrane are evaluated. • The composite membrane was found to be stable in all media. • TMS method is used for electrochemical characterization. • The membrane was found to be cation selective. • The order of surface charge density was found to be LiCl < NaCl < KCl.

  16. A nu-space for ICS: characterization and application to measure protein transport in live cells.

    Science.gov (United States)

    Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W

    2013-08-01

    We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency ( ν , nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for STICS that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins ( α 6- and αLβ 2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and ICAM ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrinligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

  17. Thermal transport characterization of hexagonal boron nitride nanoribbons using molecular dynamics simulation

    Directory of Open Access Journals (Sweden)

    Asir Intisar Khan

    2017-10-01

    Full Text Available Due to similar atomic bonding and electronic structure to graphene, hexagonal boron nitride (h-BN has broad application prospects such as the design of next generation energy efficient nano-electronic devices. Practical design and efficient performance of these devices based on h-BN nanostructures would require proper thermal characterization of h-BN nanostructures. Hence, in this study we have performed equilibrium molecular dynamics (EMD simulation using an optimized Tersoff-type interatomic potential to model the thermal transport of nanometer sized zigzag hexagonal boron nitride nanoribbons (h-BNNRs. We have investigated the thermal conductivity of h-BNNRs as a function of temperature, length and width. Thermal conductivity of h-BNNRs shows strong temperature dependence. With increasing width, thermal conductivity increases while an opposite pattern is observed with the increase in length. Our study on h-BNNRs shows considerably lower thermal conductivity compared to GNRs. To elucidate these aspects, we have calculated phonon density of states for both h-BNNRs and GNRs. Moreover, using EMD we have explored the impact of different vacancies, namely, point vacancy, edge vacancy and bi-vacancy on the thermal conductivity of h-BNNRs. With varying percentages of vacancies, significant reduction in thermal conductivity is observed and it is found that, edge and point vacancies are comparatively more destructive than bi-vacancies. Such study would contribute further into the growing interest for accurate thermal transport characterization of low dimensional nanostructures.

  18. UVIS Flat Field Uniformity

    Science.gov (United States)

    Quijano, Jessica Kim

    2009-07-01

    The stability and uniformity of the low-frequency flat fields {L-flat} of the UVIS detector will be assessed by using multiple-pointing observations of the globular clusters 47 Tucanae {NGC104} and Omega Centauri {NGC5139}, thus imaging moderately dense stellar fields. By placing the same star over different portions of the detector and measuring relative changes in its brightness, it will be possible to determine local variations in the response of the UVIS detector. Based on previous experience with STIS and ACS, it is deemed that a total of 9 different pointings will suffice to provide adequate characterization of the flat field stability in any given band. For each filter to be tested, the baseline consists of 9 pointings in a 3X3 box pattern with dither steps of about 25% of the FOV, or 40.5", in either the x or y direction {useful also for CTE measurements, if needed in the future}. During SMOV, the complement of filters to be tested is limited to the following 6 filters: F225W, F275W, F336W, for Omega Cen, and F438W, F606W, and F814W for 47 Tuc. Three long exposures for each target are arranged such that the initial dither position is observed with the appropriate filters for that target within one orbit at a single pointing, so that filter-to-filter differences in the observed star positions can be checked. In addition to the 9 baseline exposures, two sets of short exposures will be taken:a} one short exposure will be taken of OmegaCen with each of the visible filters {F438W, F606W and F814W} in order to check the geometric distortion solution to be obtained with the data from proposal 11444;b} for each target, a single short exposure will be taken with each filter to facilitate the study of the PSF as a function of position on the detector by providing unsaturated images of sparsely-spaced bright stars.This proposal corresponds to Activity Description ID WF39. It should execute only after the following proposal has executed:WF21 - 11434

  19. Morphological, Chemical Surface, and Diffusive Transport Characterizations of a Nanoporous Alumina Membrane

    Directory of Open Access Journals (Sweden)

    María I. Vázquez

    2015-12-01

    Full Text Available Synthesis of a nanoporous alumina membrane (NPAM by the two-step anodization method and its morphological and chemical surface characterization by analyzing Scanning Electron Microscopy (SEM micrographs and X-Ray Photoelectron Spectroscopy (XPS spectra is reported. Influence of electrical and diffusive effects on the NaCl transport across the membrane nanopores is determined from salt diffusion measurements performed with a wide range of NaCl concentrations, which allows the estimation of characteristic electrochemical membrane parameters such as the NaCl diffusion coefficient and the concentration of fixed charges in the membrane, by using an appropriated model and the membrane geometrical parameters (porosity and pore length. These results indicate a reduction of ~70% in the value of the NaCl diffusion coefficient through the membrane pores with respect to solution. The transport number of ions in the membrane pores (Na+ and Cl−, respectively were determined from concentration potential measurements, and the effect of concentration-polarization at the membrane surfaces was also considered by comparing concentration potential values obtained with stirred solutions (550 rpm and without stirring. From both kinds of results, a value higher than 0.05 M NaCl for the feed solution seems to be necessary to neglect the contribution of electrical interactions in the diffusive transport.

  20. Dopamine transporter; solubilization and characterization of [3H] GBR-12935 binding in canine caudate

    International Nuclear Information System (INIS)

    Sallee, F.R.

    1988-01-01

    The dopamine (DA) transporter protein, as indexed by [ 3 H]GBR-12935 binding, was solubilized from canine striatal membranes with the detergent digitonin. This solubilized protein retained the same pharmacological characteristics as membrane attached uptake sites. The binding of [ 3 H]GBR-12935 to solubilized preparations was specific, saturable and reversible with an equilibrium dissociation constant of approximately 3 nM and a maximum ligand binding (B max ) of 3.4 pmol/mg protein. [ 3 H]GBR-12935 also bound to solubilized sites in a sodium-independent manner with a K D of approximately 6 nM and a B max of 1.2 ± 0.2 pmol/mg protein. Dopamine uptake inhibitors and substrates of DA uptake inhibited [ 3 H]GBR-12935 binding in a stereoselective and concentration dependent manner. For these compounds rank order of potency for inhibition of [ 3 H]GBR-12935 binding correlated with their potency for inhibition of dopamine uptake. K D values for DA uptake inhibitors in solubilized preparations correlated with those obtained on [ 3 H]GBR-12935 binding in the native state. The dopamine transporter appears to be a transmembrane glycoprotein by virtue of its absorption and specific elution from wheat germ agglutinin (WGA)-lectin column. Solubilization of the putative dopamine transporter with full retention of binding activity now allows for the purification and biochemical characterization of this important membrane protein

  1. Pellicle transmission uniformity requirements

    Science.gov (United States)

    Brown, Thomas L.; Ito, Kunihiro

    1998-12-01

    Controlling critical dimensions of devices is a constant battle for the photolithography engineer. Current DUV lithographic process exposure latitude is typically 12 to 15% of the total dose. A third of this exposure latitude budget may be used up by a variable related to masking that has not previously received much attention. The emphasis on pellicle transmission has been focused on increasing the average transmission. Much less, attention has been paid to transmission uniformity. This paper explores the total demand on the photospeed latitude budget, the causes of pellicle transmission nonuniformity and examines reasonable expectations for pellicle performance. Modeling is used to examine how the two primary errors in pellicle manufacturing contribute to nonuniformity in transmission. World-class pellicle transmission uniformity standards are discussed and a comparison made between specifications of other components in the photolithographic process. Specifications for other materials or parameters are used as benchmarks to develop a proposed industry standard for pellicle transmission uniformity.

  2. Characterization of transport properties in uranium dioxide: the case of the oxygen auto-diffusion

    International Nuclear Information System (INIS)

    Fraczkiewicz, M.; Baldinozzi, G.

    2008-01-01

    Point defects in uranium dioxide which control the transport phenomena are still badly known. The aim of this work is to show how in carrying out several experimental techniques, it is possible to demonstrate both the existence and to determine the nature (charge and localization) of predominant defects responsible of the transport phenomena in a fluorite-type structure oxide. The oxygen diffusion in the uranium dioxide illustrates this. In the first part of this work, the accent is put on the electric properties of uranium dioxide and more particularly on the variation laws of the electric conductivity in terms of temperature, of oxygen potential and of the impurities amounts present in the material. These evolutions are connected to point and charged complex defects models and the pertinence of these models is discussed. Besides, it is shown how the electric conductivity measurements can allow to define oxygen potential domains in which the concentrations in electronic carriers are controlled. This characterization being made, it is shown that the determination of the oxygen intrinsic diffusion coefficient and particularly its dependence to the oxygen potential and to the amount of impurity, allows to determine the main defect responsible to the atomic diffusion as well as its nature and its charge. In the second part, the experimental techniques to determine the oxygen diffusion coefficient are presented: there are the isotopic exchange technique for introducing the tracer in the material, and two techniques to characterize the diffusion profiles (SIMS and NRA). Examples of preliminary results are given for mono and polycrystalline samples. At last, from this methodology on uranium dioxide, studies considered to quantify the thermal and physicochemical effects are presented. Experiments considered with the aim to characterize the radiation diffusion in uranium dioxide are presented too. (O.M.)

  3. Characterization of events of transport over the Mediterranean Basin during summer 2012

    Science.gov (United States)

    Bucci, Silvia; Fierli, Federico; Di Donfrancesco, Guido; Diliberto, Luca; Viterbini, Maurizio; Ravetta, François; Pap, Ines; Weinhold, Kay; Größ, Johannes; Wiedensohler, Alfred; Cairo, Francesco

    2014-05-01

    Long-range transport has a great influence on the atmospheric composition in the Mediterranean Basin (MB). This work focuses on the dust intrusion events and the outflows of polluted air from the Po Valley during the PEGASOS (Pan-European Gas-AeroSOls Climate Interaction Study), TRAQA (TRAnsport et Qualité de l'Air au dessus du bassin Méditerranéen) and Supersito Arpa (Emilia Romagna) measurements campaigns of June - July 2012. In order to investigate the sources and identify the transport patterns, numerical simulations, in-situ, remote sensing and airborne aerosol measurements were jointly used. The ground based lidar situated at the San Pietro Capofiume (SPC) station, in the eastern part of the Po Valley, provides continuous measurements of backscatter and depolarization profiles and the Aerodynamical Particle Sizer (APS), in the same site, gives the aerosol spectral distribution at the ground. Observations show two main events of mineral aerosol inflow over north Italy (19- 21 June and 29-01 July). Optical properties provide a primary discrimination between coarser (likely dust) and finer particles (probably anthropogenic). The vertical statistical distribution of the different aerosol classes shows that larger particles are mainly individuated over the Planetary Boundary Layer (PBL) level while smaller particles tend to follow the daily evolution of the PBL or remain confined under it. Dust events are also detected during the TRAQA airborne campaign in the area of the gulf of Genoa, contributing to the identification of the dust plume characterization. Cluster trajectories analysis coupled to mesoscale simulations highlights the effective export of air masses from the Sahara with frequent intrusions of dust over the Po Valley, as recorded in the observational SPC site. Transport analysis also indicates an inversion of the main advection pattern (the Po Valley outflow is mainly directed eastward in the Adriatic region) during 23th and 26th June, with a

  4. Characterization of Contaminant Transport using Naturally-Occurring U-Series Disequilibria - Final Report

    International Nuclear Information System (INIS)

    Murrell, Michael T.; Ku, Teh-Lung

    2001-01-01

    The interactions of mixed wastes containing radionuclides with solid rock surface and the mobility of the radionuclides in aquifer systems depend not only on the chemistry of the nuclides and the physico-chemical effects of radioactive decay, but also on the site-specific hydrogeology. Thus, to characterize contaminant transport, it is best to cross-check figures derived from any small-scale laboratory experiments over limited times with that obtained from field-oriented, natural analog studies. We propose such a study using the naturally-occurring U and Th decay-series disequilibria. The work of ours and other researchers have shown that the parent/daughter disequilibrium patterns existing in groundwater systems can be modeled in terms of local nuclide mass balance to arrive at such information as the rock-water contact time (fluid flow) and rates of contaminant transport, taking into account the retardation effect due to nuclide/rock interaction contaminants at INEL by grouping them into three categories, represented by isotopes of (1) Th and Pa, (2) U and (3) Ra. Mass spectrometric measurements of these elements will be emphasized in order to minimize sample size requirements and to maximize precision. Results will form the data base for a model code for computing: (1) Fluid residence time (transport rates) in the basalt aquifers at various locations, (2) The in-situ adsorption and desorption rate constants, as well as the retardation factors, of various radionuclide wastes, and (3) Rock dissolution rate and its relation to preferential flow and contamination transport in the fractured rock

  5. Design and characterization of a neutralized-transport experiment for heavy-ion fusion

    Directory of Open Access Journals (Sweden)

    Enrique Henestroza

    2004-08-01

    Full Text Available In heavy-ion inertial-confinement fusion systems, intense beams of ions must be transported from the exit of the final-focus magnet system through the fusion chamber to hit spots on the target with radii of about 2 mm. For the heavy-ion-fusion power-plant scenarios presently favored in the U.S., a substantial fraction of the ion-beam space charge must be neutralized during this final transport. The most effective neutralization technique found in numerical simulations is to pass each beam through a low-density plasma after the final focusing. To provide quantitative comparisons of these theoretical predictions with experiment, the Virtual National Laboratory for Heavy Ion Fusion has completed the construction and has begun experimentation with the neutralized-transport experiment. The experiment consists of three main sections, each with its own physics issues. The injector is designed to generate a very high-brightness, space-charge-dominated potassium beam, while still allowing variable perveance by a beam aperturing technique. The magnetic-focusing section, consisting of four pulsed quadrupoles, permits the study of magnet tuning, as well as the effects of phase-space dilution due to higher-order nonlinear fields. In the final section, the converging ion beam exiting the magnetic section is transported through a drift region with plasma sources for beam neutralization, and the final spot size is measured under various conditions of neutralization. In this paper, we discuss the design and characterization of the three sections in detail and present initial results from the experiment.

  6. Synthesis, characterization and evaluation of uniformly sized core-shell imprinted microspheres for the separation trans-resveratrol from giant knotweed

    International Nuclear Information System (INIS)

    Zhang Zhaohui; Liu Li; Li Hui; Yao Shouzhuo

    2009-01-01

    A novel core-shell molecularly imprinting microspheres (MIMs) with trans-resveratrol as the template molecule; acrylamide (AA) as functional monomer and ethylene glycol dimethacrylate (EGDMA) as cross-linker, was prepared based on SiO 2 microspheres with surface imprinting technique. These core-shell trans-resveratrol imprinted microspheres were characterized by infrared spectra (IR), scanning electron microscopy (SEM), thermogravimetric analysis (TGA), and high performance liquid chromatography (HPLC). The results showed that these core-shell imprinted microspheres, which take on perfect spherical shape with average shell thickness of 150 nm, exhibit especially selective recognition for trans-resveratrol. These imprinted microspheres were applied as solid-phase extraction materials for selective extraction of trans-resveratrol from giant knotweed extracting solution successfully.

  7. Synthesis, characterization and evaluation of uniformly sized core-shell imprinted microspheres for the separation trans-resveratrol from giant knotweed

    Energy Technology Data Exchange (ETDEWEB)

    Zhang Zhaohui, E-mail: zhaohuizhang77@hotmail.com [College of Chemistry and Chemical Engineering, Jishou University, Jishou, 416000 (China); State Key Laboratory of Chemo/Biosensing and Chemometrics, Hunan University, Changsha, 410082 (China); Liu Li; Li Hui [College of Chemistry and Chemical Engineering, Jishou University, Jishou, 416000 (China); Yao Shouzhuo [State Key Laboratory of Chemo/Biosensing and Chemometrics, Hunan University, Changsha, 410082 (China)

    2009-09-15

    A novel core-shell molecularly imprinting microspheres (MIMs) with trans-resveratrol as the template molecule; acrylamide (AA) as functional monomer and ethylene glycol dimethacrylate (EGDMA) as cross-linker, was prepared based on SiO{sub 2} microspheres with surface imprinting technique. These core-shell trans-resveratrol imprinted microspheres were characterized by infrared spectra (IR), scanning electron microscopy (SEM), thermogravimetric analysis (TGA), and high performance liquid chromatography (HPLC). The results showed that these core-shell imprinted microspheres, which take on perfect spherical shape with average shell thickness of 150 nm, exhibit especially selective recognition for trans-resveratrol. These imprinted microspheres were applied as solid-phase extraction materials for selective extraction of trans-resveratrol from giant knotweed extracting solution successfully.

  8. Uniform random number generators

    Science.gov (United States)

    Farr, W. R.

    1971-01-01

    Methods are presented for the generation of random numbers with uniform and normal distributions. Subprogram listings of Fortran generators for the Univac 1108, SDS 930, and CDC 3200 digital computers are also included. The generators are of the mixed multiplicative type, and the mathematical method employed is that of Marsaglia and Bray.

  9. Restricting uniformly open surjections

    Czech Academy of Sciences Publication Activity Database

    Kania, Tomasz; Rmoutil, M.

    2017-01-01

    Roč. 355, č. 9 (2017), s. 925-928 ISSN 1631-073X Institutional support: RVO:67985840 Keywords : Banach space * uniform spaces Subject RIV: BA - General Mathematics OBOR OECD: Pure mathematics Impact factor: 0.396, year: 2016 http://www.sciencedirect.com/science/article/pii/S1631073X17302261?via%3Dihub

  10. Uniformly irradiated polymer film

    International Nuclear Information System (INIS)

    Fowler, S.L.

    1979-01-01

    Irradiated film having substantial uniformity in the radiation dosage profile is produced by irradiating the film within a trough having lateral deflection blocks disposed adjacent the film edges for deflecting electrons toward the surface of the trough bottom for further deflecting the electrons toward the film edge

  11. Transportation

    National Research Council Canada - National Science Library

    Adams, James; Carr, Ron; Chebl, Maroun; Coleman, Robert; Costantini, William; Cox, Robert; Dial, William; Jenkins, Robert; McGovern, James; Mueller, Peter

    2006-01-01

    ...., trains, ships, etc.) and maximizing intermodal efficiency. A healthy balance must be achieved between the flow of international commerce and security requirements regardless of transportation mode...

  12. Characterization of biodegradation intermediates of nonionic surfactants by MALDI-MS. 2. Oxidative biodegradation profiles of uniform octylphenol polyethoxylate in 18O-labeled water.

    Science.gov (United States)

    Sato, Hiroaki; Shibata, Atsushi; Wang, Yang; Yoshikawa, Hiromichi; Tamura, Hiroto

    2003-01-01

    This paper reports the characterization of the biodegradation intermediates of octylphenol octaethoxylate (OP(8)EO) by means of matrix-assisted laser desorption/ionization mass spectrometry (MALDI-MS). The biodegradation test study was carried out in a pure culture (Pseudomonas putida S-5) under aerobic conditions using OP(8)EO as the sole carbon source and (18)O-labeled water as an incubation medium. In the MALDI-MS spectra of biodegraded samples, a series of OP(n)EO molecules with n = 2-8 EO units and their corresponding carboxylic acid products (OP(n)EC) were observed. The use of purified OP(8)EO enabled one to distinguish the shortened OPEO molecules as biodegradation intermediates. Furthermore, the formation of OP(8)EC (the oxidized product of OP(8)EO) supported the notion that terminal oxidation is a step in the biodegradation process. When biodegradation study was carried out in (18)O-labeled water, incorporation of (18)O atoms into the carboxyl group was observed for OPEC, while no incorporation was observed for the shortened OPEO products. These results could provide some rationale to the biodegradation mechanism of alkylphenol polyethoxylates.

  13. Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

    International Nuclear Information System (INIS)

    Fanning, J.J.; Kim, K.

    1981-01-01

    The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment

  14. Investigation of methods for fabricating, characterizing, and transporting cryogenic inertial-confinement-fusion tartets

    Energy Technology Data Exchange (ETDEWEB)

    Fanning, J.J.; Kim, K.

    1981-01-01

    The objective of this work is to investigate methods for fabricating, characterizing and transporting cryogenic inertial confinement fusion targets on a continuous basis. A microprocessor-based data acquisition system has been built that converts a complete target image to digital data, which are then analyzed by automated software procedures. The low temperatures required to freeze the hydrogen isotopes contained in a target is provided by a cryogenic cold chamber capable of attaining 15 K. A new method for target manipulation and positioning is studied that employs molecular gas beams to levitate a target and an electrostatic quadrupole structure to provide for its lateral containment. Since the electrostatic target-positioning scheme requires that the targets be charged, preliminary investigation has been carried out for a target-charging mechanism based on ion-bombardment.

  15. In silico characterization of boron transporter (BOR1 protein sequences in Poaceae species

    Directory of Open Access Journals (Sweden)

    Ertuğrul Filiz

    2013-01-01

    Full Text Available Boron (B is essential for the plant growth and development, and its primary function is connected with formation of the cell wall. Moreover, boron toxicity is a shared problem in semiarid and arid regions. In this study, boron transporter protein (BOR1 sequences from some Poaceae species (Hordeum vulgare subsp. vulgare, Zea mays, Brachypodium distachyon, Oryza sativa subsp. japonica, Oryza sativa subsp. indica, Sorghum bicolor, Triticum aestivum were evaluated by bioinformatics tools. Physicochemical analyses revealed that most of BOR1 proteins were basic character and had generally aliphatic amino acids. Analysis of the domains showed that transmembrane domains were identified constantly and three motifs were detected with 50 amino acids length. Also, the motif SPNPWEPGSYDHWTVAKDMFNVPPAYIFGAFIPATMVAGLYYFDHSVASQ was found most frequently with 25 repeats. The phylogenetic tree showed divergence into two main clusters. B. distachyon species were clustered separately. Finally, this study contributes to the new BOR1 protein characterization in grasses and create scientific base for in silico analysis in future.

  16. Transportation

    International Nuclear Information System (INIS)

    Anon.

    1998-01-01

    Here is the decree of the thirtieth of July 1998 relative to road transportation, to trade and brokerage of wastes. It requires to firms which carry out a road transportation as well as to traders and to brokers of wastes to declare their operations to the prefect. The declaration has to be renewed every five years. (O.M.)

  17. Characterization of Gene Candidates for Vacuolar Sodium Transport from Hordeum Vulgare

    KAUST Repository

    Scheu, Arne Hagen August

    2017-05-01

    Soil salinity is a major abiotic stress for land plants, and multiple mechanisms of salt tolerance have evolved. Tissue tolerance is one of these mechanisms, which involves the sequestration of sodium into the vacuole to retain low cytosolic sodium concentrations. This enables the plant to maintain cellular functions, and ultimately maintain growth and yield. However, the molecular components involved in tissue tolerance remain elusive. Several candidate genes for vacuolar sodium sequestration have recently been identified by proteome analysis of vacuolar membranes purified from the salt-tolerant cereal Hordeum vulgare (barley). In this study, I aimed to characterize these candidates in more detail. I successfully cloned coding sequences for the majority of candidate genes with primers designed based on the barley reference genome sequence. During the course of this study a newer genome sequence with improved annotations was published, to which I also compared my observations. To study the candidate genes, I used the heterologous expression system Saccharomyces cerevisiae (yeast). I used several salt sensitive yeast strains (deficient in intrinsic sodium transporters) to test whether the candidate genes would affect their salt tolerance by mediating the sequestration of sodium into the yeast vacuole. I observed a reduction in growth upon expression for several of the gene candidate under salt-stress conditions. However, confocal microscopy suggests that most gene products are subject to degradation, and did not localize to the vacuolar membrane (tonoplast). Therefore, growth effects cannot be linked to protein function without further evidence. Various potential causes are discussed, including inaccuracies in the genome resource used as reference for primer design and issues inherent to the model system. Finally, I make suggestions on how to proceed to further characterize the candidate genes and hopefully identify novel sodium transporters from barley.

  18. Fugitive emission source characterization using a gradient-based optimization scheme and scalar transport adjoint

    Science.gov (United States)

    Brereton, Carol A.; Joynes, Ian M.; Campbell, Lucy J.; Johnson, Matthew R.

    2018-05-01

    Fugitive emissions are important sources of greenhouse gases and lost product in the energy sector that can be difficult to detect, but are often easily mitigated once they are known, located, and quantified. In this paper, a scalar transport adjoint-based optimization method is presented to locate and quantify unknown emission sources from downstream measurements. This emission characterization approach correctly predicted locations to within 5 m and magnitudes to within 13% of experimental release data from Project Prairie Grass. The method was further demonstrated on simulated simultaneous releases in a complex 3-D geometry based on an Alberta gas plant. Reconstructions were performed using both the complex 3-D transient wind field used to generate the simulated release data and using a sequential series of steady-state RANS wind simulations (SSWS) representing 30 s intervals of physical time. Both the detailed transient and the simplified wind field series could be used to correctly locate major sources and predict their emission rates within 10%, while predicting total emission rates from all sources within 24%. This SSWS case would be much easier to implement in a real-world application, and gives rise to the possibility of developing pre-computed databases of both wind and scalar transport adjoints to reduce computational time.

  19. Experimental characterization of the water transport properties of PEM fuel cells diffusion media

    Science.gov (United States)

    Ramos-Alvarado, Bladimir; Sole, Joshua D.; Hernandez-Guerrero, Abel; Ellis, Michael W.

    2012-11-01

    A full experimental characterization of the liquid water transport properties of Toray TGP-090 paper is carried out in this work. Porosity, capillary pressure curves (capillary pressure-saturation relationships), absolute permeability, and relative permeability are obtained via experimental procedures. Porosity was determined using two methods, both aimed to obtain the solid volume of the network of fibers comprising the carbon paper. Capillary pressure curves were obtained using a gas displacement porosimeter where liquid water is injected using a syringe pump and the capillary pressure is recorded using a differential pressure transducer. Absolute and relative permeability were also measured with an apparatus designed at Virginia Tech. Absolute permeability was calculated at different flow rates using nitrogen. On the other hand, relative permeability was a more complicated task to carry out giving the complexity (two-phase flow condition) of this property. All of the water transport properties of Toray TGP-090 were studied under the effects of wet-proofing (PTFE treatment) and compression. Some observations were that wet-proofing reduces the porosity of the raw material, increases the hydrophobicity (Pc-S curves), and reduces the permeability of the material. Similar effects were observed for compression, where compressed material exhibited trends similar to those of wet-proofing effects. The results presented here will allow a more accurate modeling of PEMFCs, providing an experimentally verified alternative to the assumptions frequently employed.

  20. FRACTEX: an experiment aiming at characterizing the transport properties of a secondary fault

    International Nuclear Information System (INIS)

    Wittebroodt, C.; Matray, J.M.; Dick, P.; Cabrera, J.; Barnichon, J.D.

    2012-01-01

    Document available in extended abstract form only. Because of their favourable transport and retention properties, argillaceous rocks are considered as potential host rocks for radioactive waste repositories. At the request of the French Authority of Nuclear Safety (ASN), the French Institute for Radioprotection and Nuclear Safety (IRSN) is in charge of an independent expertise of the French industrial (Andra's) project. Therefore, IRSN develops experimental research programs in such geological formations at the Tournemire Underground Research Laboratory (URL, Aveyron, France). One of the objectives of this project is to evaluate the occurrence and the driving processes controlling the radionuclide migration through an argillaceous formation similar to those studied elsewhere for nuclear waste disposal. Since undisturbed argillaceous rocks display very low values for both hydraulic conductivity (K h ) and water content (θ e ), diffusion is considered to be the main transport mechanism governing radionuclide migration through the argillite. On the other hand, in the presence of fracture in the argillaceous formation, the flux of water through this preferential pathway could dramatically accelerate the migration of the radionuclide it contains. Thus, the implementation of a radwaste disposal facility requires a precise sedimentary and structural characterization of the preselected site to guarantee the presence of a regular, homogenous and fault-free clay layer over a large area and so to determine its ability to ensure an effective radionuclide confinement. The site characterization and fracture detection can be performed using complementary approaches such as geological studies, in situ measurements and non-destructive geophysical methods. In order to evaluate both the capacity and the limit of these seismic methods to detect a secondary fault in an argillaceous media, IRSN performed a 3D HR seismic survey from the surface of its Tournemire URL. Due to the weak

  1. Women in service uniforms

    OpenAIRE

    Hanna Karaszewska; Maciej Muskała

    2012-01-01

    The article discusses the problems of women who work in the uniformed services with the particular emphasis on the performing of the occupation of the prison service. It presents the legal issues relating to equal treatment of men and women in the workplace, formal factors influencing their employment, the status of women in prison, and the problems of their conducting in the professional role. The article also presents the results of research conducted in Poland and all over the world, on th...

  2. Forty years of 9Sr in situ migration: importance of soil characterization in modeling transport phenomena

    International Nuclear Information System (INIS)

    Fernandez, J.M.; Piault, E.; Macouillard, D.; Juncos, C.

    2006-01-01

    In 1960 experiments were carried out on the transfer of 9 Sr between soil, grapes and wine. The experiments were conducted in situ on a piece of land limited by two control strips. The 9 Sr migration over the last 40 years was studied by performing radiological and physico-chemical characterizations of the soil on eight 70 cm deep cores. The vertical migration modeling of 9 Sr required the definition of a triple layer conceptual model integrating the rainwater infiltration at constant flux as the only external factor of influence. Afterwards the importance of a detailed soil characterization for modeling was discussed and satisfactory simulation of the 9 Sr vertical transport was obtained and showed a calculated migration rate of about 1.0 cm year -1 in full agreement with the in situ measured values. The discussion was regarding some of the key parameters such as granulometry, organic matter content (in the Van Genuchten parameter determination), Kd and the efficient rainwater infiltration. Besides the experimental data, simplifying assumptions in modeling such as water-soil redistribution calculation and factual discontinuities in conceptual model were examined

  3. Characterization of a novel sialic acid transporter of the sodium solute symporter (SSS) family and in vivo comparison with known bacterial sialic acid transporters.

    Science.gov (United States)

    Severi, Emmanuele; Hosie, Arthur H F; Hawkhead, Judith A; Thomas, Gavin H

    2010-03-01

    The function of sialic acids in the biology of bacterial pathogens is reflected by the diverse range of solute transporters that can recognize these sugar acids. Here, we use an Escherichia coliDeltananT strain to characterize the function of known and proposed bacterial sialic acid transporters. We discover that the STM1128 gene from Salmonella enterica serovar Typhimurium, which encodes a member of the sodium solute symporter family, is able to restore growth on sialic acid to the DeltananT strain and is able to transport [(14)C]-sialic acid. Using the DeltananT genetic background, we performed a direct in vivo comparison of the transport properties of the STM1128 protein with those of sialic acid transporters of the major facilitator superfamily and tripartite ATP-independent periplasmic families, E. coli NanT and Haemophilus influenzae SiaPQM, respectively. This revealed that both STM1128 and SiaPQM are sodium-dependent and, unlike SiaPQM, both STM1128 and NanT are reversible secondary carriers, demonstrating qualitative functional differences in the properties of sialic acid transporters used by bacteria that colonize humans.

  4. Transportation

    National Research Council Canada - National Science Library

    Allshouse, Michael; Armstrong, Frederick Henry; Burns, Stephen; Courts, Michael; Denn, Douglas; Fortunato, Paul; Gettings, Daniel; Hansen, David; Hoffman, D. W; Jones, Robert

    2007-01-01

    .... The ability of the global transportation industry to rapidly move passengers and products from one corner of the globe to another continues to amaze even those wise to the dynamics of such operations...

  5. Characterization of Organic Anion Transporter 2 (SLC22A7): A Highly Efficient Transporter for Creatinine and Species-Dependent Renal Tubular Expression.

    Science.gov (United States)

    Shen, Hong; Liu, Tongtong; Morse, Bridget L; Zhao, Yue; Zhang, Yueping; Qiu, Xi; Chen, Cliff; Lewin, Anne C; Wang, Xi-Tao; Liu, Guowen; Christopher, Lisa J; Marathe, Punit; Lai, Yurong

    2015-07-01

    The contribution of organic anion transporter OAT2 (SLC22A7) to the renal tubular secretion of creatinine and its exact localization in the kidney are reportedly controversial. In the present investigation, the transport of creatinine was assessed in human embryonic kidney (HEK) cells that stably expressed human OAT2 (OAT2-HEK) and isolated human renal proximal tubule cells (HRPTCs). The tubular localization of OAT2 in human, monkey, and rat kidney was characterized. The overexpression of OAT2 significantly enhanced the uptake of creatinine in OAT2-HEK cells. Under physiologic conditions (creatinine concentrations of 41.2 and 123.5 µM), the initial rate of OAT2-mediated creatinine transport was approximately 11-, 80-, and 80-fold higher than OCT2, multidrug and toxin extrusion protein (MATE)1, and MATE2K, respectively, resulting in approximately 37-, 1850-, and 80-fold increase of the intrinsic transport clearance when normalized to the transporter protein concentrations. Creatinine intracellular uptake and transcellular transport in HRPTCs were decreased in the presence of 50 µM bromosulfophthalein and 100 µM indomethacin, which inhibited OAT2 more potently than other known creatinine transporters, OCT2 and multidrug and toxin extrusion proteins MATE1 and MATE2K (IC50: 1.3 µM vs. > 100 µM and 2.1 µM vs. > 200 µM for bromosulfophthalein and indomethacin, respectively) Immunohistochemistry analysis showed that OAT2 protein was localized to both basolateral and apical membranes of human and cynomolgus monkey renal proximal tubules, but appeared only on the apical membrane of rat proximal tubules. Collectively, the findings revealed the important role of OAT2 in renal secretion and possible reabsorption of creatinine and suggested a molecular basis for potential species difference in the transporter handling of creatinine. Copyright © 2015 by The American Society for Pharmacology and Experimental Therapeutics.

  6. Characterization of a novel variant of amino acid transport system asc in erythrocytes from Przewalski's horse (Equus przewalskii).

    Science.gov (United States)

    Fincham, D A; Ellory, J C; Young, J D

    1992-08-01

    In thoroughbred horses, red blood cell amino acid transport activity is Na(+)-independent and controlled by three codominant genetic alleles (h, l, s), coding for high-affinity system asc1 (L-alanine apparent Km for influx at 37 degrees C congruent to 0.35 mM), low-affinity system asc2 (L-alanine Km congruent to 14 mM), and transport deficiency, respectively. The present study investigated amino acid transport mechanisms in red cells from four wild species: Przewalski's horse (Equus przewalskii), Hartmann's zebra (Zebra hartmannae), Grevy's zebra (Zebra grevyi), and onager (Equus hemonius). Red blood cell samples from different Przewalski's horses exhibited uniformly high rates of L-alanine uptake, mediated by a high-affinity asc1-type transport system. Mean apparent Km and Vmax values (+/- SE) for L-alanine influx at 37 degrees C in red cells from 10 individual animals were 0.373 +/- 0.068 mM and 2.27 +/- 0.11 mmol (L cells.h), respectively. As in thoroughbreds, the Przewalski's horse transporter interacted with dibasic as well as neutral amino acids. However, the Przewalski asc1 isoform transported L-lysine with a substantially (6.4-fold) higher apparent affinity than its thoroughbred counterpart (Km for influx 1.4 mM at 37 degrees C) and was also less prone to trans-stimulation effects. The novel high apparent affinity of the Przewalski's horse transporter for L-lysine provides additional key evidence of functional and possible structural similarities between asc and the classical Na(+)-dependent system ASC and between these systems and the Na(+)-independent dibasic amino acid transport system y+. Unlike Przewalski's horse, zebra red cells were polymorphic with respect to L-alanine transport activity, showing high-affinity or low-affinity saturable mechanisms of L-alanine uptake. Onager red cells transported this amino acid with intermediate affinity (apparent Km for influx 3.0 mM at 37 degrees C). Radiation inactivation analysis was used to estimate the target

  7. Women in service uniforms

    Directory of Open Access Journals (Sweden)

    Hanna Karaszewska

    2012-12-01

    Full Text Available The article discusses the problems of women who work in the uniformed services with the particular emphasis on the performing of the occupation of the prison service. It presents the legal issues relating to equal treatment of men and women in the workplace, formal factors influencing their employment, the status of women in prison, and the problems of their conducting in the professional role. The article also presents the results of research conducted in Poland and all over the world, on the functioning of women in prison and their relations with officers of the Prison Service, as well as with inmates.

  8. Uniform gradient expansions

    CERN Document Server

    Giovannini, Massimo

    2015-01-01

    Cosmological singularities are often discussed by means of a gradient expansion that can also describe, during a quasi-de Sitter phase, the progressive suppression of curvature inhomogeneities. While the inflationary event horizon is being formed the two mentioned regimes coexist and a uniform expansion can be conceived and applied to the evolution of spatial gradients across the protoinflationary boundary. It is argued that conventional arguments addressing the preinflationary initial conditions are necessary but generally not sufficient to guarantee a homogeneous onset of the conventional inflationary stage.

  9. Characterization of dextran-grafted hydrophobic charge-induction resins: Structural properties, protein adsorption and transport.

    Science.gov (United States)

    Liu, Tao; Angelo, James M; Lin, Dong-Qiang; Lenhoff, Abraham M; Yao, Shan-Jing

    2017-09-29

    The structural and functional properties of a series of dextran-grafted and non-grafted hydrophobic charge-induction chromatographic (HCIC) agarose resins were characterized by macroscopic and microscopic techniques. The effects of dextran grafting and mobile phase conditions on the pore dimensions of the resins were investigated with inverse size exclusion chromatography (ISEC). A significantly lower pore radius (17.6nm) was found for dextran-grafted than non-grafted resins (29.5nm), but increased salt concentration would narrow the gap between the respective pore radii. Two proteins, human immunoglobulin G (hIgG) and bovine serum albumin (BSA), were used to examine the effect of protein characteristics. The results of adsorption isotherms showed that the dextran-grafted resin with high ligand density had substantially higher adsorption capacity and enhanced the salt-tolerance property for hIgG, but displayed a significantly smaller benefit for BSA adsorption. Confocal laser scanning microscopy (CLSM) showed that hIgG presented more diffuse and slower moving adsorption front compared to BSA during uptake into the resins because of the selective binding of multiple species from polyclonal IgG; polymer-grafting with high ligand density could enhance the rate of hIgG transport in the dextran-grafted resins without salt addition, but not for the case with high salt and BSA. The results indicate that microscopic analysis using ISEC and CLSM is useful to improve the mechanistic understanding of resin structure and of critical functional parameters involving protein adsorption and transport, which would guide the rational design of new resins and processes. Copyright © 2017. Published by Elsevier B.V.

  10. Characterization of inorganic phosphate transport in the triple-negative breast cancer cell line, MDA-MB-231.

    Science.gov (United States)

    Russo-Abrahão, Thais; Lacerda-Abreu, Marco Antônio; Gomes, Tainá; Cosentino-Gomes, Daniela; Carvalho-de-Araújo, Ayra Diandra; Rodrigues, Mariana Figueiredo; Oliveira, Ana Carolina Leal de; Rumjanek, Franklin David; Monteiro, Robson de Queiroz; Meyer-Fernandes, José Roberto

    2018-01-01

    Recent studies demonstrate that interstitial inorganic phosphate is significantly elevated in the breast cancer microenvironment as compared to normal tissue. In addition it has been shown that breast cancer cells express high levels of the NaPi-IIb carrier (SLC34A2), suggesting that this carrier may play a role in breast cancer progression. However, the biochemical behavior of inorganic phosphate (Pi) transporter in this cancer type remains elusive. In this work, we characterize the kinetic parameters of Pi transport in the aggressive human breast cancer cell line, MDA-MB-231, and correlated Pi transport with cell migration and adhesion. We determined the influence of sodium concentration, pH, metabolic inhibitors, as well as the affinity for inorganic phosphate in Pi transport. We observed that the inorganic phosphate is dependent on sodium transport (K0,5 value = 21.98 mM for NaCl). Furthermore, the transport is modulated by different pH values and increasing concentrations of Pi, following the Michaelis-Menten kinetics (K0,5 = 0.08 mM Pi). PFA, monensin, furosemide and ouabain inhibited Pi transport, cell migration and adhesion. Taken together, these results showed that the uptake of Pi in MDA-MB-231 cells is modulated by sodium and by regulatory mechanisms of intracellular sodium gradient. General Significance: Pi transport might be regarded as a potential target for therapy against tumor progression.

  11. Characterization of the serotonin transporter knockout rat : A selective change in the functioning of the serotonergic system

    NARCIS (Netherlands)

    Homberg, J. R.; Olivier, J.D.A.; Smits, B. M. G.; Mul, J. D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O. F. M.; Cools, A. R.; Ronken, E; Cremers, Thomas; Schoffelmeere, A. N. M.; Ellenbroeik, B. A.; Cuppen, E.

    2007-01-01

    Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

  12. Characterization of the serotonin transporter knockout rat: a selective change in the functioning of the serotonergic system.

    NARCIS (Netherlands)

    Homberg, J.R.; Olivier, J.D.A.; Smits, B.M.; Mul, J.D.; Mudde, J.; Verheul, M.; Nieuwenhuizen, O.F.; Cools, A.R.; Ronken, E.; Cremers, T.; Schoffelmeer, A.N.; Ellenbroek, B.A.; Cuppen, E.

    2007-01-01

    Serotonergic signaling is involved in many neurobiological processes and disturbed 5-HT homeostasis is implicated in a variety of psychiatric and addictive disorders. Here, we describe the functional characterization of the serotonin transporter (SERT) knockout rat model, that is generated by

  13. Molecular Characterization of CTR-type Copper Transporters in an Oceanic Diatom, Thalassiosira oceanica 1005

    Science.gov (United States)

    Kong, L.; Price, N. M.

    2016-02-01

    Copper is an essential micronutrient for phytoplankton growth because of its role as a redox cofactor in electron transfer proteins in photosynthesis and respiration, and a potentially limiting resource in parts of the open sea. Thalassiosira oceanica 1005 can grow at inorganic copper concentrations varying from 10 fmol/L to 10 nmol/L by regulating copper uptake across plasma membrane. Four putative CTR-type copper transporter genes (ToCTR1, ToCTR2, ToCTR3.1 and ToCTR3.2) were identified by BLASTP search against the T. oceanica genome. Predicted gene models were revised by assembled mRNA sequencing transcripts and updated gene models contained all conserved features of characterized CTR-type copper transporters. ToCTR3.1 and ToCTR3.2 may arise from one another by gene duplication as they shared a sequence similarity of 97.6% with a peptide insertion of 5 amino acids at N-terminus of ToCTR3.1. The expression of ToCTR1, ToCTR2 and ToCTR3.1/3.2 was upregulated in low copper concentrations, but only ToCTR3.1/3.2 showed a significant increase (2.5 fold) in copper-starved cells. Both ToCTR3.1 and ToCTR3.2 restored growth of a yeast double mutant, Saccharomyces cerevisiae ctr1Δctr3Δ, in copper deficient medium. GFP-fused ToCTR expression showed that some ToCTR3.1 localized to the plasma membrane but a large portion was retained in the endoplasmic reticulum. Inefficient targeting of ToCTR3.1 to the yeast outer membrane may explain poorer growth compared to the Saccharomyces native ScCTR1 transformant. Thus, diatom CTR genes encoding CTR-type copper transporters show high-affinity copper uptake and their regulation may enable diatoms to survive in ocean environments containing a wide range of copper concentrations.

  14. Characterization of contaminant transport by gravity, capillarity and barometric pumping in heterogeneous vadose regimes. 1998 annual progress report

    International Nuclear Information System (INIS)

    Carrigan, C.R.; Hudson, G.B.

    1998-01-01

    'The intent of this research program is to obtain an improved understanding of vadose zone transport processes and to develop field and modeling techniques required to characterize contaminant transport in the unsaturated zone at DOE sites. For surface spills and near-surface leaks of chemicals, the vadose zone may well become a long-term source of contamination for the underlying water table. Transport of contaminants can occur in both the liquid and gas phases of the unsaturated zone. This transport occurs naturally as a result of diffusion, buoyancy forces (gravity), capillarity and barometric pressure variations. In some cases transport can be enhanced by anisotropies present in hydrologic regimes. This is particularly true for gas-phase transport which may be subject to vertical pumping resulting from atmospheric pressure changes. For liquid-phase flows, heterogeneity may enhance the downward transport of contaminants to the water table depending on soil properties and the scale of the surface spill or near-surface leak. Characterization techniques based upon the dynamics of transport processes are likely to yield a better understanding of the potential for contaminant transport at a specific site than methods depending solely on hydrologic properties derived from a borehole. Such dynamic-characterization techniques can be useful for evaluating sites where contamination presently exists as well as for providing an objective basis to evaluate the efficacy of proposed as well as implemented clean-up technologies. The real-time monitoring of processes that may occur during clean-up of tank waste and the mobility of contaminants beneath the Hanford storage tanks during sluicing operations is one example of how techniques developed in this effort can be applied to current remediation problems. In the future, such dynamic-characterization methods might also be used as part of the site-characterization process for determining suitable locations of new DOE facilities

  15. Cloning and characterization of a functional human ¿-aminobutyric acid (GABA) transporter, human GAT-2

    DEFF Research Database (Denmark)

    Christiansen, Bolette; Meinild, Anne-Kristine; Jensen, Anders A.

    2007-01-01

    Plasma membrane gamma-aminobutyric acid (GABA) transporters act to terminate GABA neurotransmission in the mammalian brain. Intriguingly four distinct GABA transporters have been cloned from rat and mouse, whereas only three functional homologs of these transporters have been cloned from human....... The aim of this study therefore was to search for this fourth missing human transporter. Using a bioinformatics approach, we successfully identified and cloned the full-length cDNA of a so far uncharacterized human GABA transporter (GAT). The predicted protein displays high sequence similarity to rat GAT......-2 and mouse GAT3, and in accordance with the nomenclature for rat GABA transporters, we therefore refer to the transporter as human GAT-2. We used electrophysiological and cell-based methods to demonstrate that this protein is a functional transporter of GABA. The transport was saturable...

  16. Characterizing the Occurrence and Transport of Brackish Groundwater in Southwest Bangladesh

    Science.gov (United States)

    worland, S.; Hornberger, G. M.

    2013-12-01

    Bangladesh is host to the largest and the most active delta system in the world. The morphology of the southern part of the country is characterized by low lying deltaic plains partitioned by the distributary networks of the Ganges, Brahmaputra and Meghna river systems. Much of the tidal mangrove forest ecosystem of the lower delta has been converted into poldered islands that sustain shrimp farming and rice production. The polder inhabitants depend on shallow groundwater as a primary source for drinking water and sanitation. Understanding the origin and hydrologic controls on the distribution of the brackish water and freshwater on the polder is a necessary step to ensuring a sustainable and potable freshwater source for drinking and irrigation. Preliminary sampling from shallow tube wells on Polder 32 in southwest Bangladesh suggests sporadic lateral apportioning of fresh water in the primarily brackish aquifer. This research characterizes the occurrence, transport and fate of the brackish groundwater through a combination of 3H and 14C dating, geochemical signatures, subsurface mapping using inversions from electromagnetic induction, and a 1D finite difference model and a 2D finite element model. The geochemical analysis and radiometric dating suggest that the salt water originates from paleo-brackish estuarine water deposited ~5000 years ago along with the sediments that compose the shallow aquifer. Inversions of electromagnetic survey data show potential freshwater recharge areas where the clay cap pinches out. The finite difference model demonstrates that recharge from the distributary channels is unlikely due to the low transmissivity of the clay channel beds. The finite element model gives reasonable estimates of the flushing rates of the connate brackish water beneath the polder. Inversion of electromagnetic data from a two hundred meter transect taken on Polder 32 Head gradient and groundwater flow vectors for fixed head boundary conditions across Polder

  17. Characterization of nitride hole lateral transport in a charge trap flash memory by using a random telegraph signal method

    Science.gov (United States)

    Liu, Yu-Heng; Jiang, Cheng-Min; Lin, Hsiao-Yi; Wang, Tahui; Tsai, Wen-Jer; Lu, Tao-Cheng; Chen, Kuang-Chao; Lu, Chih-Yuan

    2017-07-01

    We use a random telegraph signal method to investigate nitride trapped hole lateral transport in a charge trap flash memory. The concept of this method is to utilize an interface oxide trap and its associated random telegraph signal as an internal probe to detect a local channel potential change resulting from nitride charge lateral movement. We apply different voltages to the drain of a memory cell and vary a bake temperature in retention to study the electric field and temperature dependence of hole lateral movement in a nitride. Thermal energy absorption by trapped holes in lateral transport is characterized. Mechanisms of hole lateral transport in retention are investigated. From the measured and modeled results, we find that thermally assisted trap-to-band tunneling is a major trapped hole emission mechanism in nitride hole lateral transport.

  18. Novel ion-exchange nanocomposite membrane containing in-situ formed FeOOH nanoparticles: Synthesis, characterization and transport properties

    Energy Technology Data Exchange (ETDEWEB)

    Heidary, Farhad; Kharat, Ali Nemati [University of Tehran, Tehran (Iran, Islamic Republic of); Khodabakhshi, Ali Reza [Faculty of Science, Arak University, Arak (Iran, Islamic Republic of)

    2016-04-15

    A new type of cation-exchange nanocomposite membrane was prepared via in-situ formation of FeOOH nanoparticles in a blend containing sulfonated poly (2,6-dimethyl-1,4-phenylene oxide) and sulfonated polyvinylchloride by a simple one-step chemical method. Prepared nanocomposite membranes were characterized using Fourier transform infrared spectroscopy, scanning electron microscopy and X-ray diffraction. The SEM images showed uniform dispersion of FeOOH nanoparticles throughout the polymeric matrices. The effect of additive loading on physicochemical and electrochemical properties of prepared cation-exchange nanocomposite membranes was studied. Various characterizations showed that the incorporation of different amounts of FeOOH nanoparticles into the basic membrane structure had a significant influence on the membrane performance and could improve the electrochemical properties.

  19. Should School Nurses Wear Uniforms?

    Science.gov (United States)

    Journal of School Health, 2001

    2001-01-01

    This 1958 paper questions whether school nurses should wear uniforms (specifically, white uniforms). It concludes that white uniforms are often associated with the treatment of ill people, and since many people have a fear reaction to them, they are not necessary and are even undesirable. Since school nurses are school staff members, they should…

  20. Transportation

    Science.gov (United States)

    2007-01-01

    Faculty ii INDUSTRY TRAVEL Domestic Assistant Deputy Under Secretary of Defense (Transportation Policy), Washington, DC Department of...developed between the railroad and trucking industries. Railroads: Today’s seven Class I freight railroad systems move 42% of the nation’s intercity ...has been successfully employed in London to reduce congestion and observed by this industry study during its travels . It is currently being

  1. An experimental test plan for the characterization of molten salt thermochemical properties in heat transport systems

    International Nuclear Information System (INIS)

    Calderoni, Pattrick

    2010-01-01

    Molten salts are considered within the Very High Temperature Reactor program as heat transfer media because of their intrinsically favorable thermo-physical properties at temperatures starting from 300 C and extending up to 1200 C. In this context two main applications of molten salt are considered, both involving fluoride-based materials: as primary coolants for a heterogeneous fuel reactor core and as secondary heat transport medium to a helium power cycle for electricity generation or other processing plants, such as hydrogen production. The reference design concept here considered is the Advanced High Temperature Reactor (AHTR), which is a large passively safe reactor that uses solid graphite-matrix coated-particle fuel (similar to that used in gas-cooled reactors) and a molten salt primary and secondary coolant with peak temperatures between 700 and 1000 C, depending upon the application. However, the considerations included in this report apply to any high temperature system employing fluoride salts as heat transfer fluid, including intermediate heat exchangers for gas-cooled reactor concepts and homogeneous molten salt concepts, and extending also to fast reactors, accelerator-driven systems and fusion energy systems. The purpose of this report is to identify the technical issues related to the thermo-physical and thermo-chemical properties of the molten salts that would require experimental characterization in order to proceed with a credible design of heat transfer systems and their subsequent safety evaluation and licensing. In particular, the report outlines an experimental R and D test plan that would have to be incorporated as part of the design and operation of an engineering scaled facility aimed at validating molten salt heat transfer components, such as Intermediate Heat Exchangers. This report builds on a previous review of thermo-physical properties and thermo-chemical characteristics of candidate molten salt coolants that was generated as part

  2. An experimental test plan for the characterization of molten salt thermochemical properties in heat transport systems

    Energy Technology Data Exchange (ETDEWEB)

    Pattrick Calderoni

    2010-09-01

    Molten salts are considered within the Very High Temperature Reactor program as heat transfer media because of their intrinsically favorable thermo-physical properties at temperatures starting from 300 C and extending up to 1200 C. In this context two main applications of molten salt are considered, both involving fluoride-based materials: as primary coolants for a heterogeneous fuel reactor core and as secondary heat transport medium to a helium power cycle for electricity generation or other processing plants, such as hydrogen production. The reference design concept here considered is the Advanced High Temperature Reactor (AHTR), which is a large passively safe reactor that uses solid graphite-matrix coated-particle fuel (similar to that used in gas-cooled reactors) and a molten salt primary and secondary coolant with peak temperatures between 700 and 1000 C, depending upon the application. However, the considerations included in this report apply to any high temperature system employing fluoride salts as heat transfer fluid, including intermediate heat exchangers for gas-cooled reactor concepts and homogenous molten salt concepts, and extending also to fast reactors, accelerator-driven systems and fusion energy systems. The purpose of this report is to identify the technical issues related to the thermo-physical and thermo-chemical properties of the molten salts that would require experimental characterization in order to proceed with a credible design of heat transfer systems and their subsequent safety evaluation and licensing. In particular, the report outlines an experimental R&D test plan that would have to be incorporated as part of the design and operation of an engineering scaled facility aimed at validating molten salt heat transfer components, such as Intermediate Heat Exchangers. This report builds on a previous review of thermo-physical properties and thermo-chemical characteristics of candidate molten salt coolants that was generated as part of the

  3. Characterizing the transplanar and in-plane water transport properties of fabrics under different sweat rate: Forced Flow Water Transport Tester

    Science.gov (United States)

    Tang, K. P. M.; Chau, K. H.; Kan, C. W.; Fan, J. T.

    2015-11-01

    The water absorption and transport properties of fabrics are critical to wear comfort, especially for sportswear and protective clothing. A new testing apparatus, namely Forced Flow Water Transport Tester (FFWTT), was developed for characterizing the transplanar and in-plane wicking properties of fabrics based on gravimetric and image analysis technique. The uniqueness of this instrument is that the rate of water supply is adjustable to simulate varying sweat rates with reference to the specific end-use conditions ranging from sitting, walking, running to other strenuous activities. This instrument is versatile in terms of the types of fabrics that can be tested. Twenty four types of fabrics with varying constructions and surface finishes were tested. The results showed that FFWTT was highly sensitive and reproducible in differentiating these fabrics and it suggests that water absorption and transport properties of fabrics are sweat rate-dependent. Additionally, two graphic methods were proposed to map the direction of liquid transport and its relation to skin wetness, which provides easy and direct comparison among different fabrics. Correlation analysis showed that FFWTT results have strong correlation with subjective wetness sensation, implying validity and usefulness of the instrument.

  4. Skin carcinogenesis following uniform and non-uniform β irradiation

    International Nuclear Information System (INIS)

    Charles, M.W.; Williams, J.P.; Coggle, J.E.

    1989-01-01

    Where workers or the general public may be exposed to ionising radiation, the irradiation is rarely uniform. The risk figures and dose limits recommended by the International Commission on Radiological Protection (ICRP) are based largely on clinical and epidemiological studies of reasonably uniform irradiated organs. The paucity of clinical or experimental data for highly non-uniform exposures has prevented the ICRP from providing adequate recommendations. This weakness has led on a number of occasions to the postulate that highly non-uniform exposures of organs could be 100,000 times more carcinogenic than ICRP risk figures would predict. This so-called ''hot-particle hypothesis'' found little support among reputable radiobiologists, but could not be clearly and definitively refuted on the basis of experiment. An experiment, based on skin tumour induction in mouse skin, is described which was developed to test the hypothesis. The skin of 1200 SAS/4 male mice has been exposed to a range of uniform and non-uniform sources of the β emitter 170 Tm (E max ∼ 1 MeV). Non-uniform exposures were produced using arrays of 32 or 8 2-mm diameter sources distributed over the same 8-cm 2 area as a uniform control source. Average skin doses varied from 2-100 Gy. The results for the non-uniform sources show a 30% reduction in tumour incidence by the 32-point array at the lower mean doses compared with the response from uniform sources. The eight-point array showed an order-of-magnitude reduction in tumour incidence compared to uniform irradiation at low doses. These results, in direct contradiction to the ''hot particle hypothesis'', indicate that non-uniform exposures produce significantly fewer tumours than uniform exposures. (author)

  5. Cloning, characterization and tissue distribution of the rat ATP-binding cassette (ABC) transporter ABC2/ABCA2.

    OpenAIRE

    Zhao, L X; Zhou, C J; Tanaka, A; Nakata, M; Hirabayashi, T; Amachi, T; Shioda, S; Ueda, K; Inagaki, N

    2000-01-01

    The ABC1 (ABCA) subfamily of the ATP-binding cassette (ABC) transporter superfamily has a structural feature that distinguishes it from other ABC transporters. Here we report the cloning, molecular characterization and tissue distribution of ABC2/ABCA2, which belongs to the ABC1 subfamily. Rat ABC2 is a protein of 2434 amino acids that has 44.5%, 40.0% and 40.8% identity with mouse ABC1/ABCA1, human ABC3/ABCA3 and human ABCR/ABCA4 respectively. Immunoblot analysis showed that proteins of 260 ...

  6. Characterization of airborne float coal dust emitted during continuous mining, longwall mining and belt transport.

    Science.gov (United States)

    Shahan, M R; Seaman, C E; Beck, T W; Colinet, J F; Mischler, S E

    2017-09-01

    Float coal dust is produced by various mining methods, carried by ventilating air and deposited on the floor, roof and ribs of mine airways. If deposited, float dust is re-entrained during a methane explosion. Without sufficient inert rock dust quantities, this float coal dust can propagate an explosion throughout mining entries. Consequently, controlling float coal dust is of critical interest to mining operations. Rock dusting, which is the adding of inert material to airway surfaces, is the main control technique currently used by the coal mining industry to reduce the float coal dust explosion hazard. To assist the industry in reducing this hazard, the Pittsburgh Mining Research Division of the U.S. National Institute for Occupational Safety and Health initiated a project to investigate methods and technologies to reduce float coal dust in underground coal mines through prevention, capture and suppression prior to deposition. Field characterization studies were performed to determine quantitatively the sources, types and amounts of dust produced during various coal mining processes. The operations chosen for study were a continuous miner section, a longwall section and a coal-handling facility. For each of these operations, the primary dust sources were confirmed to be the continuous mining machine, longwall shearer and conveyor belt transfer points, respectively. Respirable and total airborne float dust samples were collected and analyzed for each operation, and the ratio of total airborne float coal dust to respirable dust was calculated. During the continuous mining process, the ratio of total airborne float coal dust to respirable dust ranged from 10.3 to 13.8. The ratios measured on the longwall face were between 18.5 and 21.5. The total airborne float coal dust to respirable dust ratio observed during belt transport ranged between 7.5 and 21.8.

  7. Virus in Groundwater: Characterization of transport mechanisms and impacts on an agricultural area in Uruguay

    Science.gov (United States)

    Gamazo, P. A.; Colina, R.; Victoria, M.; Alvareda, E.; Burutaran, L.; Ramos, J.; Lopez, F.; Soler, J.

    2014-12-01

    In many areas of Uruguay groundwater is the only source of water for human consumption and for industrial-agricultural economic activities. Traditionally considered as a safe source, due to the "natural filter" that occurs in porous media, groundwater is commonly used without any treatment. The Uruguayan law requires bacteriological analysis for most water uses, but virological analyses are not mentioned in the legislation. In the Salto district, where groundwater is used for human consumption and for agricultural activities, bacterial contamination has been detected in several wells but no viruses analysis have been performed. The Republic University (UDELAR), with the support of the National Agency for Research and Innovation (ANII), is studying the incidence of virus in groundwater on an intensive agriculture area of the Salto district. In this area water is pumped from the "Salto Aquifer", a free sedimentary aquifer. Below this sedimentary deposit is the "Arapey" basaltic formation, which is also exploited for water productions on its fractured zones. A screening campaign has been performed searching for bacterial and viral contamination. Total and fecal coliforms have been found on several wells and Rotavirus and Adenovirus have been detected. A subgroup of the screening wells has been selected for an annual survey. On this subgroup, besides bacteria and viruses analysis, a standard physical and chemical characterization was performed. Results show a significant seasonal variation on microbiological contamination. In addition to field studies, rotavirus circulation experiments on columns are being performed. The objective of this experiments is to determinate the parameters that control virus transport in porous media. The results of the study are expected to provide an insight into the impacts of groundwater on Salto's viral gastroenterocolitis outbreaks.

  8. Characterization of maximally random jammed sphere packings. III. Transport and electromagnetic properties via correlation functions

    Science.gov (United States)

    Klatt, Michael A.; Torquato, Salvatore

    2018-01-01

    In the first two papers of this series, we characterized the structure of maximally random jammed (MRJ) sphere packings across length scales by computing a variety of different correlation functions, spectral functions, hole probabilities, and local density fluctuations. From the remarkable structural features of the MRJ packings, especially its disordered hyperuniformity, exceptional physical properties can be expected. Here we employ these structural descriptors to estimate effective transport and electromagnetic properties via rigorous bounds, exact expansions, and accurate analytical approximation formulas. These property formulas include interfacial bounds as well as universal scaling laws for the mean survival time and the fluid permeability. We also estimate the principal relaxation time associated with Brownian motion among perfectly absorbing traps. For the propagation of electromagnetic waves in the long-wavelength limit, we show that a dispersion of dielectric MRJ spheres within a matrix of another dielectric material forms, to a very good approximation, a dissipationless disordered and isotropic two-phase medium for any phase dielectric contrast ratio. We compare the effective properties of the MRJ sphere packings to those of overlapping spheres, equilibrium hard-sphere packings, and lattices of hard spheres. Moreover, we generalize results to micro- and macroscopically anisotropic packings of spheroids with tensorial effective properties. The analytic bounds predict the qualitative trend in the physical properties associated with these structures, which provides guidance to more time-consuming simulations and experiments. They especially provide impetus for experiments to design materials with unique bulk properties resulting from hyperuniformity, including structural-color and color-sensing applications.

  9. Riboflavin transport in the central nervous system. Characterization and effects of drugs.

    OpenAIRE

    Spector, R

    1980-01-01

    The relationship of riboflavin transport to the transport of other substances including drugs in rabbit choroid plexus, the anatomical locus of the blood-cerebrospinal fluid barrier, and brain cells were studied in vivo and in vitro. In vitro, the ability of rabbit choroid plexus to transport riboflavin from the medium (cerebrospinal fluid surface) through the choroid plexus epithelial cells into the extracellular and vascular spaces of the choroid plexus was documented using fluorescence mic...

  10. Contaminant Attenuation and Transport Characterization of 200-DV-1 Operable Unit Sediment Samples

    Energy Technology Data Exchange (ETDEWEB)

    Truex, Michael J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Szecsody, James E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Qafoku, Nikolla [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Strickland, Christopher E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Moran, James J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lee, Brady D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Snyder, Michelle M.V. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Lawter, Amanda R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Resch, Charles T. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Gartman, Brandy N. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Zhong, Lirong [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Nims, Megan K. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Saunders, Danielle L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Williams, Benjamin D. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Horner, Jacob A. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Leavy, Ian I. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Baum, Steven R. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Christiansen, Beren B. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Clayton, Ray E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); McElroy, Erin M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Appriou, Delphine [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Tyrrell, Kimberly J. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Striluk, Miranda L. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2017-05-15

    A laboratory study was conducted to quantify contaminant attenuation processes and associated contaminant transport parameters that are needed to evaluate transport of contaminants through the vadose zone to the groundwater. The laboratory study information, in conjunction with transport analyses, can be used as input to evaluate the feasibility of Monitored Natural Attenuation and other remedies for the 200-DV-1 Operable Unit at the Hanford Site.

  11. Assessment indices for uniform and non-uniform thermal environments

    Institute of Scientific and Technical Information of China (English)

    2008-01-01

    Different assessment indices for thermal environments were compared and selected for proper assessment of indoor thermal environments.30 subjects reported their overall thermal sensation,thermal comfort,and thermal acceptability in uniform and non-uniform conditions.The results show that these three assessment indices provide equivalent evaluations in uniform environments.However,overall thermal sensation differs from the other two indices and cannot be used as a proper index for the evaluation of non-uniform environments.The relationship between the percentage and the mean vote for each index is established.

  12. Subsurface Access, Characterization, Acquisition, Transport, Storage and Delivery in Microgravity, Phase I

    Data.gov (United States)

    National Aeronautics and Space Administration — This project will develop geotechnical measurements, sample extraction and transport equipment for subsurface regolith on NEOs, asteroids, moons and planets,...

  13. A mountain-scale model for characterizing unsaturated flow and transport in fractured tuffs of Yucca Mountain

    International Nuclear Information System (INIS)

    Wu, Yu-Shu; Lu, Guoping; Zhang, Keni; Bodvarsson, G.S.

    2003-01-01

    This paper presents a large-scale modeling study characterizing fluid flow and tracer transport in the unsaturated zone of Yucca Mountain, Nevada, the proposed underground repository site for storing high-level radioactive waste. The modeling study is conducted using a three-dimensional numerical model, which incorporates a wide variety of field data and takes into account the coupled processes of flow and transport in Yucca Mountain's highly heterogeneous, unsaturated, fractured porous rock. The modeling approach is based on a dual-continuum formulation. Using different conceptual models of unsaturated flow, various scenarios of current and future climate conditions and their effects on the unsaturated zone are evaluated to aid in the assessment of the repository's system performance. These models are calibrated against field-measured data. Model-predicted flow and transport processes under current and future climates are discussed

  14. Cytochemical characterization of gill and hepatopancreatic cells of the crab Ucides cordatus (Crustacea, Brachyura validated by cell metal transport

    Directory of Open Access Journals (Sweden)

    Priscila Ortega

    2014-09-01

    Full Text Available Ucides cordatus (Linnaeus, 1763 is a hypo-hyper-regulating mangrove crab possessing gills for respiratory and osmoregulatory processes, separated in anterior and posterior sections. They also have hepatopancreas, which is responsible for digestion and absorption of nutrients and detoxification of toxic metals. Each of these organs has specific cells that are important for in vitro studies in cell biology, ion and toxic metals transport. In order to study and characterize cells from gills and hepatopancreas, both were separated using a Sucrose Gradient (SG from 10 to 40% and cells in each gradient were characterized using the vital mitochondrial dye DASPEI (2-(4-dimethylaminostyryl-N- ethylpyridinium iodide and Trichrome Mallory's stain. Both in 20 and 40% SG for gill cells and 30% SG for hepatopancreatic cells, a greater number of cells were colored with DASPEI, indicating a larger number of mitochondria in these cells. It is concluded that the gill cells present in 20% and 40% SG are Thin cells, responsible for respiratory processes and Ionocytes responsible for ion transport, respectively. For hepatopancreatic cells, the 30% SG is composed of Fibrillar cells that possess larger number of membrane ion and nutrient transporters. Moreover, the transport of toxic metal cadmium (Cd by isolated hepatopancreatic cells was performed as a way of following cell physiological integrity after cell separation and to study differences in transport among the cells. All hepatopancreatic cells were able to transport Cd. These findings are the first step for further work on isolated cells of these important exchange epithelia of crabs, using a simple separation method and to further develop successful in vitro cell culture in crabs.

  15. Synthesis, spectroscopic characterization and acoustic, volumetric, transport and thermal properties of hydroxyl ammonium based ionic liquids

    International Nuclear Information System (INIS)

    Losetty, Venkatramana; Chennuri, Bharath Kumar; Gardas, Ramesh L.

    2016-01-01

    Graphical abstract: Density, ρ (■) in kg · m"−"3, speed of sound, u (●) in m · s"−"1, dynamic viscosity, η (▴) in mPa · s, electrical conductivity, σ (♦) in S · cm"−"1of [BHEA][TFA] as the function of temperature and at 0.1 MPa pressure. - Highlights: • N-butyl-(N-hydroxyethyl) ammonium based protic ionic liquids (PILs) were synthesized. • Density, speed of sound, electrical conductivity and viscosity were measured for studied PILs. • Transport property data were fitted to Vogel–Tammann–Fulcher (VTF) equation. • FT-IR spectrum was helpful to explain the hydrogen bonding between ions. • Measured and derived properties were analyzed in terms of chemical structure of PILs. - Abstract: In the present work, solvent-free synthesis of two hydroxyethyl ammonium-based ionic liquids (ILs) at room temperature was carried out namely, N-butyl-(N-hydroxyethyl) ammonium trifluoroacetate ([BHEA][TFA]) and N-butyl-(N-hydroxyethyl) ammonium nitrate ([BHEA][NO_3]). The synthesized ionic liquids were characterized by various spectroscopic techniques such as "1H-NMR, "1"3C-NMR and FTIR. Furthermore, density (ρ), speed of sound (u), electrical conductivity (σ) and viscosity (η) have been measured within the temperature range from T = (303.15 to 343.15) K and at 0.1 MPa pressure. The measured density and viscosity values were fitted to the linear and Vogel–Tammann–Fulcher (VTF) equation, respectively. The temperature dependence conductivity of the measured ILs was fitted to a similar equation type of viscosity (VTF). Furthermore, the refractive index was measured at T = 303.15 K, in turn molar refraction (R_m) and free volume (f_V) were calculated using the Lorentz–Lorenz equation. The thermodynamic properties such as thermal expansion coefficient (α), isentropic compressibility (β_S) and intermolecular free length (L_f) were calculated by using the experimental values of density and speed of sound. The thermal decomposition temperature (T

  16. Study of the distribution of maxima and minima in multiple sequential images of uniformity

    International Nuclear Information System (INIS)

    Llacer Martos, S.; Puchal Ane, R.

    2011-01-01

    To characterize the uniformity of a gamma camera extrinsic used integral uniformity coefficient is calculated with the value of two pixels, the maximum and minimum, single source acquisition of a flat and uniform. This method does not take into account the fact that if a gamma camera having a uniform response, the distribution of these items should be random. In this paper we study how these points are distributed in a succession of large numbers of uniform images.

  17. Molecular characterization of ABC transporters in marine ciliate, Euplotes crassus: Identification and response to cadmium and benzo[a]pyrene.

    Science.gov (United States)

    Kim, Hokyun; Yim, Bora; Kim, Jisoo; Kim, Haeyeon; Lee, Young-Mi

    2017-11-30

    ATP-binding cassette (ABC) transporters participate in transporting various substances, including xenobiotics, in or out of cells. However, their genetic information and function in ciliates remain still unclear. In this study, we sequenced and characterized two ABC transporter genes (EcABCB and EcABCC), and investigated the effect of cadmium (Cd) and benzo[a]pyrene (B[a]P) on their function and gene expression, using efflux assay and real-time reverse transcription-polymerase chain reaction (qRT-PCR), respectively, in the marine ciliate, Euplotes crassus. Sequencing analysis and efflux assay showed that EcABCB and EcABCC are typical ABC transporters, possessing conserved function. Exposure to Cd (≥5mg/L) and B[a]P (≥50.5μg/L) enhanced accumulation of a substrate. A significant increase in the expression of EcABCB and EcABC mRNA was observed at lower concentration in response to Cd and B[a]P. Our findings indicate that Cd and B[a]P could inhibit the efflux function of ABC transporters, leading to cellular toxicity in the ciliate. Copyright © 2017 Elsevier Ltd. All rights reserved.

  18. Characterizing the tradeoffs and costs associated with transportation congestion in supply chains.

    Science.gov (United States)

    2010-01-21

    We consider distribution and location-planning models for supply chains that explicitly : account for traffic congestion effects. The majority of facility location and transportation : planning models in the operations research literature consider fa...

  19. Formulation of confinement matrices and characterization of their transport properties from solid to melt state

    International Nuclear Information System (INIS)

    Grandjean, A.

    2006-07-01

    The author gives an overview of his research activity during which she worked on three main subjects. The first one dealt with the investigation of transport mechanisms in metal alloys (experimental investigation of diffusion in amorphous alloys, oxidation mechanism of Zircaloy-4 under temperature and in water or in dry oxygen). The second one dealt with the synthesis and properties of specific confinement matrices (effect of chemical composition on sintering of a carbonate powder, effect of microstructure of high Mo and P content vitro-crystals on lixiviation properties, incorporation of fluorine compounds in the case of borosilicate systems). The third one dealt with the transport in borosilicate glasses and melts (ionic transport, properties, and electrical transport glass-RuO 2 particles composites)

  20. ITE CHARACTERIZATION TO SUPPORT CONCEPTUAL MODEL DEVELOPMENT FOR SUBSURFACE RADIONUCLIDE TRANSPORT

    Science.gov (United States)

    Remediation of radionuclide contaminants in ground water often begins with the development of conceptual and analytical models that guide our understanding of the processes controlling radionuclide transport. The reliability of these models is often predicated on the collection o...

  1. Characterization of an allosteric citalopram-binding site at the serotonin transporter

    DEFF Research Database (Denmark)

    Chen, Fenghua; Breum Larsen, Mads; Neubauer, Henrik Amtoft

    2005-01-01

    The serotonin transporter (SERT), which belongs to a family of       sodium/chloride-dependent transporters, is the major pharmacological       target in the treatment of several clinical disorders, including       depression and anxiety. In the present study we show that the dissociation       r...

  2. Visualization of Fuel Cell Water Transport and Performance Characterization under Freezing Conditions

    Energy Technology Data Exchange (ETDEWEB)

    Kandlikar, Satish G. [Rochester Inst. of Technology, Rochester, NY (United States); Lu, Zijie [Rochester Inst. of Technology, Rochester, NY (United States); Rao, Navalgund [Rochester Inst. of Technology, Rochester, NY (United States); Sergi, Jacqueline [Rochester Inst. of Technology, Rochester, NY (United States); Rath, Cody [Rochester Inst. of Technology, Rochester, NY (United States); McDade, Christopher [Rochester Inst. of Technology, Rochester, NY (United States); Trabold, Thomas [General Motors, Honeoye Falls, NY (United States); Owejan, Jon [General Motors, Honeoye Falls, NY (United States); Gagliardo, Jeffrey [General Motors, Honeoye Falls, NY (United States); Allen, Jeffrey [Michigan Technological Univ., Houghton, MI (United States); Yassar, Reza S. [Michigan Technological Univ., Houghton, MI (United States); Medici, Ezequiel [Michigan Technological Univ., Houghton, MI (United States); Herescu, Alexandru [Michigan Technological Univ., Houghton, MI (United States)

    2010-05-30

    In this program, Rochester Institute of Technology (RIT), General Motors (GM) and Michigan Technological University (MTU) have focused on fundamental studies that address water transport, accumulation and mitigation processes in the gas diffusion layer and flow field channels of the bipolar plate. These studies have been conducted with a particular emphasis on understanding the key transport phenomena which control fuel cell operation under freezing conditions.

  3. School Uniforms: Esprit de Corps.

    Science.gov (United States)

    Ryan, Rosemary P.; Ryan, Thomas E.

    1998-01-01

    The benefits of school uniforms far outweigh their short-term costs. School uniforms not only keep students safe, but they increase their self-esteem, promote a more positive attitude toward school, lead to improved student behavior, and help blur social-class distinctions. Students are allowed to wear their own political or religious messages,…

  4. Uniform Single Valued Neutrosophic Graphs

    Directory of Open Access Journals (Sweden)

    S. Broumi

    2017-09-01

    Full Text Available In this paper, we propose a new concept named the uniform single valued neutrosophic graph. An illustrative example and some properties are examined. Next, we develop an algorithmic approach for computing the complement of the single valued neutrosophic graph. A numerical example is demonstrated for computing the complement of single valued neutrosophic graphs and uniform single valued neutrosophic graph.

  5. Comments on Beckmann's Uniform Reducts

    OpenAIRE

    Cook, Stephen

    2006-01-01

    Arnold Beckmann defined the uniform reduct of a propositional proof system f to be the set of those bounded arithmetical formulas whose propositional translations have polynomial size f-proofs. We prove that the uniform reduct of f + Extended Frege consists of all true bounded arithmetical formulas iff f + Extended Frege simulates every proof system.

  6. Impact of carbonation on the durability of cementitious materials: water transport properties characterization

    Directory of Open Access Journals (Sweden)

    Le Bescop P.

    2013-07-01

    Full Text Available Within the context of long-lived intermediate level radioactive waste geological disposal, reinforced concrete would be used. In service life conditions, the concrete structures would be subjected to drying and carbonation. Carbonation relates to the reaction between carbon dioxide (CO2 and the main hydrates of the cement paste (portlandite and C-S-H. Beyond the fall of the pore solution pH, indicative of steel depassivation, carbonation induces mineralogical and microstructural changes (due to portlandite and C-S-H dissolution and calcium carbonate precipitation. This results in the modification of the transport properties, which can impact the structure durability. Because concrete durability depends on water transport, this study focuses on the influence of carbonation on water transport properties. In fact, the transport properties of sound materials are known but they still remain to be assessed for carbonated ones. An experimental program has been designed to investigate the transport properties in carbonated materials. Four hardened cement pastes, differing in mineralogy, are carbonated in an accelerated carbonation device (in controlled environmental conditions at CO2 partial pressure of about 3%. Once fully carbonated, all the data needed to describe water transport, using a simplified approach, will be evaluated.

  7. A high mitochondrial transport rate characterizes CNS neurons with high axonal regeneration capacity.

    Directory of Open Access Journals (Sweden)

    Romain Cartoni

    Full Text Available Improving axonal transport in the injured and diseased central nervous system has been proposed as a promising strategy to improve neuronal repair. However, the contribution of each cargo to the repair mechanism is unknown. DRG neurons globally increase axonal transport during regeneration. Because the transport of specific cargos after axonal insult has not been examined systematically in a model of enhanced regenerative capacity, it is unknown whether the transport of all cargos would be modulated equally in injured central nervous system neurons. Here, using a microfluidic culture system we compared neurons co-deleted for PTEN and SOCS3, an established model of high axonal regeneration capacity, to control neurons. We measured the axonal transport of three cargos (mitochondria, synaptic vesicles and late endosomes in regenerating axons and found that the transport of mitochondria, but not the other cargos, was increased in PTEN/SOCS3 co-deleted axons relative to controls. The results reported here suggest a pivotal role for this organelle during axonal regeneration.

  8. Colloidal transport of uranium in soil: Size fractionation and characterization by field-flow fractionation-multi-detection

    International Nuclear Information System (INIS)

    Claveranne-Lamolere, C.; Lespes, G.; Dubascoux, St.; Potin-Gautier, M.; Claveranne-Lamolere, C.; Aupiais, J.; Pointurier, F.

    2009-01-01

    The aim of this study was to characterize colloids associated with uranium by using an on-line fractionation/multi-detection technique based on asymmetrical flow field-flow fractionation (As-Fl-FFF) hyphenated with UV detector, multi angle laser light scattering (MALLS) and inductively coupling plasma-mass spectrometry (ICP-MS). Moreover, thanks to the As-Fl-FFF, the different colloidal fractions were collected and characterized by a total organic carbon analyzer (TOC). Thus it is possible to determine the nature (organic or inorganic colloids), molar mass, size (gyration and hydrodynamic radii) and quantitative uranium distribution over the whole colloidal phase. In the case of the site studied, two populations are highlighted. The first population corresponds to humic-like substances with a molar mass of (1500 ± 300) g mol -1 and a hydrodynamic diameter of (2. 0 ± 0. 2) nm. The second one has been identified as a mix of carbonated nano-particles or clays with organic particles (aggregates and/or coating of the inorganic particles) with a size range hydrodynamic diameter between 30 and 450 nm. Each population is implied in the colloidal transport of uranium: maximum 1% of the uranium content in soil leachate is transported by the colloids in the site studied, according to the depth in the soil. Indeed, humic substances are the main responsible of this transport in sub-surface conditions whereas nano-particles drive the phenomenon in depth conditions. (authors)

  9. Label-free nanoscale characterization of red blood cell structure and dynamics using single-shot transport of intensity equation

    Science.gov (United States)

    Poola, Praveen Kumar; John, Renu

    2017-10-01

    We report the results of characterization of red blood cell (RBC) structure and its dynamics with nanometric sensitivity using transport of intensity equation microscopy (TIEM). Conventional transport of intensity technique requires three intensity images and hence is not suitable for studying real-time dynamics of live biological samples. However, assuming the sample to be homogeneous, phase retrieval using transport of intensity equation has been demonstrated with single defocused measurement with x-rays. We adopt this technique for quantitative phase light microscopy of homogenous cells like RBCs. The main merits of this technique are its simplicity, cost-effectiveness, and ease of implementation on a conventional microscope. The phase information can be easily merged with regular bright-field and fluorescence images to provide multidimensional (three-dimensional spatial and temporal) information without any extra complexity in the setup. The phase measurement from the TIEM has been characterized using polymeric microbeads and the noise stability of the system has been analyzed. We explore the structure and real-time dynamics of RBCs and the subdomain membrane fluctuations using this technique.

  10. Size graded sediment dynamics: from the processes characterization to the transport modelling in the English Channel; Dynamique sedimentaire multiclasse: de l'etude des processus a la modelisation en Manche

    Energy Technology Data Exchange (ETDEWEB)

    Blanpain, O.

    2009-10-15

    The purpose of this work is the implementation of a sediment transport model in the English Channel. The design of such a model requires the identification of the physical processes, their modelling and their in-situ validation. Because of the sedimentary particularities of the study area, modelling of the mechanical behaviour of a non uniform mixture of sediments and particularly of the fine grains within a coarse matrix is required. This study focused on the characterization of the relevant processes by acquisition of experimental and in-situ data. Data acquired in hydro-sedimentary conditions comparable to those found in the English Channel are scarce. A new instrument and image processing technique were specifically conceived and implemented in-situ to observe and measure, with a high temporal resolution, the dynamics of a strongly heterogeneous mixture of particles in a grain-size scale. The data collected compared well with several existing formulations. One of these formulations was chosen to be adapted. The transfer dynamics of fine grains in coarse sediments and their depth of penetration were acquired from stratigraphic samples. The sediment transport model deals with multi-size grains and multi sedimentary layers, it is forced by swell and currents, and accounts for bead load and suspended load transports. It was applied to realistic scenarios for the English Channel. (author)

  11. Generation and Characterization of Anti-VGLUT Nanobodies Acting as Inhibitors of Transport.

    Science.gov (United States)

    Schenck, Stephan; Kunz, Laura; Sahlender, Daniela; Pardon, Els; Geertsma, Eric R; Savtchouk, Iaroslav; Suzuki, Toshiharu; Neldner, Yvonne; Štefanić, Saša; Steyaert, Jan; Volterra, Andrea; Dutzler, Raimund

    2017-08-01

    The uptake of glutamate by synaptic vesicles is mediated by vesicular glutamate transporters (VGLUTs). The central role of these transporters in excitatory neurotransmission underpins their importance as pharmacological targets. Although several compounds inhibit VGLUTs, highly specific inhibitors were so far unavailable, thus limiting applications to in vitro experiments. Besides their potential in pharmacology, specific inhibitors would also be beneficial for the elucidation of transport mechanisms. To overcome this shortage, we generated nanobodies (Nbs) by immunization of a llama with purified rat VGLUT1 and subsequent selection of binders from a phage display library. All identified Nbs recognize cytosolic epitopes, and two of the binders greatly reduced the rate of uptake of glutamate by reconstituted liposomes and subcellular fractions enriched with synaptic vesicles. These Nbs can be expressed as functional green fluorescent protein fusion proteins in the cytosol of HEK cells for intracellular applications as immunocytochemical and biochemical agents. The selected binders thus provide valuable tools for cell biology and neuroscience.

  12. Characterization of diffusive transport in cementitious materials: influence of microstructure in mortars

    International Nuclear Information System (INIS)

    Larbi, B.

    2013-01-01

    Concrete durability is a subject of considerable interest, especially with the use of cement based materials on structures increasingly demanding on term of sustainability and resistance to aggressive ions penetration or radionuclide release. Diffusion is considered as one of the main transport phenomena that cause migration of aggressive solutes and radionuclide in a porous media according to most studies. In order to enable more effective prediction of structures service life, the understanding of the link between cement based materials microstructure and transport macro properties needed to be enhanced. In this context, the present study is undertaken to enhance our understanding of the links between microstructure and tritiated water diffusivity in saturated mortars. The effect of aggregates via the ITZ (Interfacial Transition Zone) on transport properties and materials durability is studied. (author) [fr

  13. Molecular and functional characterization of riboflavin specific transport system in rat brain capillary endothelial cells

    Science.gov (United States)

    Patel, Mitesh; Vadlapatla, Ramya Krishna; Pal, Dhananjay; Mitra, Ashim K.

    2012-01-01

    Riboflavin is an important water soluble vitamin (B2) required for metabolic reactions, normal cellular growth, differentiation and function. Mammalian brain cells cannot synthesize riboflavin and must import from systemic circulation. However, the uptake mechanism, cellular translocation and intracellular trafficking of riboflavin in brain capillary endothelial cells are poorly understood. The primary objective of this study is to investigate the existence of riboflavin-specific transport system and delineate the uptake and intracellular regulation of riboflavin in immortalized rat brain capillary endothelial cells (RBE4). The uptake of [3H]-Riboflavin is sodium, temperature and energy dependent but pH independent. [3H]-Riboflavin uptake is saturable with Km and Vmax values of 19 ± 3 µM and 0.235 ± 0.012 picomoles/min/mg protein, respectively. The uptake process is inhibited by unlabelled structural analogs (lumiflavin, lumichrome) but not by structurally unrelated vitamins. Ca++/calmodulin and protein kinase A (PKA) pathways are found to play an important role in the intracellular regulation of [3H]-Riboflavin. Apical and baso-lateral uptake of [3H]-Riboflavin clearly indicate that riboflavin specific transport system is predominantly localized on the apical side of RBE4 cells. A 628 bp band corresponding to riboflavin transporter is revealed in RT-PCR analysis. These findings, for the first time report the existence of a specialized and high affinity transport system for riboflavin in RBE4 cells. Blood-brain barrier (BBB) is a major obstacle limiting drug transport inside the brain as it regulates drug permeation from systemic circulation. This transporter can be utilized for targeted delivery in enhancing brain permeation of highly potent drugs on systemic administration. PMID:22683359

  14. Direct minority carrier transport characterization of InAs/InAsSb superlattice nBn photodetectors

    International Nuclear Information System (INIS)

    Zuo, Daniel; Liu, Runyu; Wasserman, Daniel; Mabon, James; He, Zhao-Yu; Liu, Shi; Zhang, Yong-Hang; Kadlec, Emil A.; Olson, Benjamin V.; Shaner, Eric A.

    2015-01-01

    We present an extensive characterization of the minority carrier transport properties in an nBn mid-wave infrared detector incorporating a Ga-free InAs/InAsSb type-II superlattice as the absorbing region. Using a modified electron beam induced current technique in conjunction with time-resolved photoluminescence, we were able to determine several important transport parameters of the absorber region in the device, which uses a barrier layer to reduce dark current. For a device at liquid He temperatures, we report a minority carrier diffusion length of 750 nm and a minority carrier lifetime of 200 ns, with a vertical diffusivity of 3 × 10 −2  cm 2 /s. We also report on the device's optical response characteristics at 78 K

  15. Exploring a potential energy surface by machine learning for characterizing atomic transport

    Science.gov (United States)

    Kanamori, Kenta; Toyoura, Kazuaki; Honda, Junya; Hattori, Kazuki; Seko, Atsuto; Karasuyama, Masayuki; Shitara, Kazuki; Shiga, Motoki; Kuwabara, Akihide; Takeuchi, Ichiro

    2018-03-01

    We propose a machine-learning method for evaluating the potential barrier governing atomic transport based on the preferential selection of dominant points for atomic transport. The proposed method generates numerous random samples of the entire potential energy surface (PES) from a probabilistic Gaussian process model of the PES, which enables defining the likelihood of the dominant points. The robustness and efficiency of the method are demonstrated on a dozen model cases for proton diffusion in oxides, in comparison with a conventional nudge elastic band method.

  16. Characterization of intracellular regions in the human serotonin transporter for phosphorylation sites

    DEFF Research Database (Denmark)

    Sørensen, Lena; Strømgaard, Kristian; Kristensen, Anders S

    2014-01-01

    In the central nervous system, synaptic levels of the monoamine neurotransmitter serotonin are mainly controlled by the serotonin transporter (SERT), and drugs used in the treatment of various psychiatric diseases have SERT as primary target. SERT is a phosphoprotein that undergoes phosphorylation....../dephosphorylation during transporter regulation by multiple pathways. In particular, activation and/or inhibition of kinases including PKC, PKG, p38MAPK, and CaMKII modulate SERT function and trafficking. The molecular mechanisms by which kinase activity is linked to SERT regulation are poorly understood, including...

  17. Growth and characterization of Bi2Se3 crystals by chemical vapor transport

    Directory of Open Access Journals (Sweden)

    W. H. Jiao

    2012-06-01

    Full Text Available Regularly-shaped high-quality Bi2Se3 crystals were grown by a chemical vapor transport using iodine as the transport agent. In addition to exhibiting a characteristic Dirac cone for a topological insulator, the Bi2Se3 crystals show some outstanding properties including additional crystallographic surfaces, large residual resistance ratio (∼10, and high mobility (∼8000 cm2·V−1·s−1. The low-temperature resistivity abnormally increases with applying pressures up to 1.7 GPa, and no superconductivity was observed down to 0.4 K.

  18. Functional characterization of the human multidrug transporter, ABCG2, expressed in insect cells

    DEFF Research Database (Denmark)

    Ozvegy, C.; Litman, Thomas; Szakacs, G.

    2001-01-01

    ABCG2 (also called MXR (3), BCRP (4), or ABCP (5) is a recently-identified ABC half-transporter, which causes multidrug resistance in cancer. Here we report that the expression of the ABCG2 protein in Sf9 insect cells resulted in a high-capacity, vanadate-sensitive ATPase activity in isolated...

  19. Cloning, Expression, and Functional Characterization of Secondary Amino Acid Transporters of Lactococcus lactis

    NARCIS (Netherlands)

    Trip, Hein; Mulder, Niels L.; Lolkema, Juke S.

    Fourteen genes encoding putative secondary amino acid transporters were identified in the genomes of Lactococcus lactis subsp. cremoris strains MG1363 and SK11 and L. lactis subsp. lactis strains IL1403 and KF147, 12 of which were common to all four strains. Amino acid uptake in L. lactis cells

  20. Characterization and regulation of glycine transport in Fusarium oxysporum var. lini.

    Science.gov (United States)

    Castro, I M; Lima, A A; Nascimento, A F; Ruas, M M; Nicoli, J R; Brandão, R L

    1996-08-01

    Glycine was transported in Fusarium oxysporum cells, grown on glycine as the sole source of carbon and nitrogen, by a facilitated diffusion transport system with a half-saturation constant (Ks) of 11 mM and a maximum velocity (Vmax) of 1.2 mM (g dry weight)-1 h-1 at pH 5.0 and 26 degrees C. Under conditions of nitrogen starvation, the same system was present together with a high-affinity one (Ks) of about 47 microM and Vmax of about 60 microM (g dry weight)-1 h-1). The low-affinity system was more specific than the high-affinity system. Cells grown on gelatine showed the same behavior. In cells grown on glucose-gelatine medium, the low-affinity system was poorly expressed even after carbon and nitrogen starvation. Moreover, addition of glucose to cells grown on glycine and resuspended in mineral medium caused an increase of the glycine transport probably due to a boost in protein synthesis. This stimulation did not affect the Ks of the low-affinity system. These results demonstrate that, as is the case for other eukaryotic systems, F. oxysporum glycine transport is under control of nitrogen sources but its regulation by carbon sources appears to be more complex.

  1. Synthetic approaches to uniform polymers.

    Science.gov (United States)

    Ali, Monzur; Brocchini, Steve

    2006-12-30

    Uniform polymers are characterised by a narrow molecular weight distribution (MWD). Uniformity is also defined by chemical structure in respect of (1) monomer orientation, sequence and stereo-regularity, (2) polymer shape and morphology and (3) chemical functionality. The function of natural polymers such as polypeptides and polynucleotides is related to their conformational structure (e.g. folded tertiary structure). This is only possible because of their high degree of uniformity. While completely uniform synthetic polymers are rare, polymers with broad structure and MWD are widely used in medicine and the biomedical sciences. They are integral components in final dosage forms, drug delivery systems (DDS) and in implantable devices. Increasingly uniform polymers are being used to develop more complex medicines (e.g. delivery of biopharmaceuticals, enhanced formulations or DDS's for existing actives). In addition to the function imparted by any new polymer it will be required to meet stringent specifications in terms of cost containment, scalability, biocompatibility and performance. Synthetic polymers with therapeutic activity are also being developed to exploit their polyvalent properties, which is not possible with low molecular weight molecules. There is need to utilise uniform polymers for applications where the polymer may interact with the systemic circulation, tissues or cellular environment. There are also potential applications (e.g. stimuli responsive coatings) where uniform polymers may be used for their more defined property profile. While it is not yet practical to prepare synthetic polymers to the same high degree of uniformity as proteins, nature also effectively utilises many polymers with lower degrees of uniformity (e.g. polysaccharides, poly(amino acids), polyhydroxyalkanoates). In recent years it has become possible to prepare with practical experimental protocols sufficient quantities of polymers that display many aspects of uniformity. This

  2. SNPs altering ammonium transport activity of human Rhesus factors characterized by a yeast-based functional assay.

    Directory of Open Access Journals (Sweden)

    Aude Deschuyteneer

    Full Text Available Proteins of the conserved Mep-Amt-Rh family, including mammalian Rhesus factors, mediate transmembrane ammonium transport. Ammonium is an important nitrogen source for the biosynthesis of amino acids but is also a metabolic waste product. Its disposal in urine plays a critical role in the regulation of the acid/base homeostasis, especially with an acid diet, a trait of Western countries. Ammonium accumulation above a certain concentration is however pathologic, the cytotoxicity causing fatal cerebral paralysis in acute cases. Alteration in ammonium transport via human Rh proteins could have clinical outcomes. We used a yeast-based expression assay to characterize human Rh variants resulting from non synonymous single nucleotide polymorphisms (nsSNPs with known or unknown clinical phenotypes and assessed their ammonium transport efficiency, protein level, localization and potential trans-dominant impact. The HsRhAG variants (I61R, F65S associated to overhydrated hereditary stomatocytosis (OHSt, a disease affecting erythrocytes, proved affected in intrinsic bidirectional ammonium transport. Moreover, this study reveals that the R202C variant of HsRhCG, the orthologue of mouse MmRhcg required for optimal urinary ammonium excretion and blood pH control, shows an impaired inherent ammonium transport activity. Urinary ammonium excretion was RHcg gene-dose dependent in mouse, highlighting MmRhcg as a limiting factor. HsRhCG(R202C may confer susceptibility to disorders leading to metabolic acidosis for instance. Finally, the analogous R211C mutation in the yeast ScMep2 homologue also impaired intrinsic activity consistent with a conserved functional role of the preserved arginine residue. The yeast expression assay used here constitutes an inexpensive, fast and easy tool to screen nsSNPs reported by high throughput sequencing or individual cases for functional alterations in Rh factors revealing potential causal variants.

  3. Design and validation of a uniform flow microreactor

    Energy Technology Data Exchange (ETDEWEB)

    Yi, Seung Jae; Kim, Kyung Chun; Chang, Seung Cheol [Pusan National University, Busan (Korea, Republic of); Park, Ji Min [Global HQ, Hankook Tire Co., Daejeon (Korea, Republic of)

    2014-01-15

    We present a design method to characterize uniform flows in a microreactor for high performance surface plasmon resonance (SPR) a general-purpose biosensor chips. The shape of the microreactor is designed based on an approximate pressure drop model. The number of micro-pillars and the slopes of the inlet and outlet linear chambers are two dominant parameters used to minimize the velocity difference in the microreactor. The flow uniformity was examined quantitatively by numerical and experimental visualization methods. A computational fluid dynamics (CFD) analysis demonstrates that the designed microreactor has a fairly uniform velocity profile in the reaction zone for a wide range of flow rates. The velocity field in the fabricated microreactor was measured using the micro-particle image velocimetry (μ-PIV) method, and the flow uniformity was confirmed experimentally. The performance of the uniform flow microreactor was verified using the fluorescence antibody technique.

  4. Weak completeness of the Bourbaki quasi-uniformity

    Directory of Open Access Journals (Sweden)

    M.A. Sánchez Granero

    2001-04-01

    Full Text Available The concept of semicompleteness (weaker than half-completeness is defined for the Bourbaki quasi-uniformity of the hyperspace of a quasi-uniform space. It is proved that the Bourbaki quasi-uniformity is semicomplete in the space of nonempty sets of a quasi-uniform space (X,U if and only if each stable filter on (X,U* has a cluster point in (X,U. As a consequence the space of nonempty sets of a quasi-pseudometric space is semicomplete if and only if the space itself is half-complete. It is also given a characterization of semicompleteness of the space of nonempty U*-compact sets of a quasi-uniform space (X,U which extends the well known Zenor-Morita theorem.

  5. Isolation and molecular characterization of methicillin-resistant Staphylococcus aureus from public transport.

    Science.gov (United States)

    Iwao, Yasuhisa; Yabe, Shizuka; Takano, Tomomi; Higuchi, Wataru; Nishiyama, Akihito; Yamamoto, Tatsuo

    2012-01-01

    Methicillin-resistant Staphylococcus aureus (MRSA) not only causes disease in hospitals, but also in the community. The characteristics of MRSA transmission in the environment remain uncertain. In this study, MRSA were isolated from public transport in Tokyo and Niigata, Japan. Of 349 trains examined, eight (2.3%) were positive for MRSA. The MRSA isolated belonged to sequence types (STs) 5, 8, 88, and 89, and included community infection-associated ST8 MRSA (with novel type IV staphylococcal cassette chromosome mec) and the ST5 New York/Japan hospital clone. The data indicate that public transport could contribute to the spread of community-acquired MRSA, and awareness of this mode of transmission is necessary. © 2012 The Societies and Blackwell Publishing Asia Pty Ltd.

  6. Characterization of Taurine Transporting Systems During Acquirement of Resistance to Platinum(II)-based, Chemotherapeutic Drugs

    DEFF Research Database (Denmark)

    Sørensen, Belinda Halling

    Although, cisplatin is one of the most effective broad-spectrum anticancer drugs, prolonged cisplatin treatment often results in development of chemoresistance and subsequent therapeutic failure. Dysregulation of the taurine transporting systems i.e., the taurine transporter (TauT) and volume....... Cisplatin resistance correlates with a reduction in the volume regulated anion current and taurine release mediated by VRACs, as well as an improved cellular accumulation of taurine through TauT. In human ovarian A2780 cancer cells, for instance, cisplatin resistance is associated with an absent swelling......-induced taurine release and inability to volume regulate. The dismissed taurine release was due to an almost absent leucin-rich-repeat containing 8A (LRRC8A) total protein expression. LRRC8A is an important component of VRACs. Cellular taurine contributes to the intracellular pool of organic osmolytes. Moreover...

  7. Characterization and expression profiling of ATP-binding cassette transporter genes in the diamondback moth, Plutella xylostella (L.).

    Science.gov (United States)

    Qi, Weiping; Ma, Xiaoli; He, Weiyi; Chen, Wei; Zou, Mingmin; Gurr, Geoff M; Vasseur, Liette; You, Minsheng

    2016-09-27

    ATP-binding cassette (ABC) transporters are one of the major transmembrane protein families found in all organisms and play important roles in transporting a variety of compounds across intra and extra cellular membranes. In some species, ABC transporters may be involved in the detoxification of substances such as insecticides. The diamondback moth, Plutella xylostella (L.), a destructive pest of cruciferous crops worldwide, is an important species to study as it is resistant to many types of insecticides as well as biological control Bacillus thuringiensis toxins. A total of 82 ABC genes were identified from our published P. xylostella genome, and grouped into eight subfamilies (ABCA-H) based on phylogenetic analysis. Genes of subfamilies ABCA, ABCC and ABCH were found to be expanded in P. xylostella compared with those in Bombyx mori, Manduca sexta, Heliconius melpomene, Danaus plexippus, Drosophila melanogaster, Tetranychus urticae and Homo sapiens. Phylogenetic analysis indicated that many of the ABC transporters in P. xylostella are orthologous to the well-studied ABC transporter genes in the seven other species. Transcriptome- and qRT-PCR-based analysis elucidated physiological effects of ABC gene expressions of P. xylostella which were developmental stage- and tissue-specific as well as being affected by whether or not the insects were from an insecticide-resistant strain. Two ABCC and one ABCA genes were preferentially expressed in midgut of the 4th-instar larvae of a susceptible strain (Fuzhou-S) suggesting their potential roles in metabolizing plant defensive chemicals. Most of the highly expressed genes in insecticide-resistant strains were also predominantly expressed in the tissues of Malpighian tubules and midgut. This is the most comprehensive study on identification, characterization and expression profiling of ABC transporter genes in P. xylostella to date. The diversified features and expression patterns of this gene family may be associated with

  8. Characterization of the Hanford 300 area burial grounds. Task IV. Biological transport

    International Nuclear Information System (INIS)

    Fitzner, R.E.; Gano, K.A.; Rickard, W.H.; Rogers, L.E.

    1979-10-01

    The characteristics of radioactive waste burial sites at the 300 area burial grounds on the Department of Energy's Hanford Site, southeastern Washington were studied. The potential vectors of radionuclide transport studied were vegetation and animals. The overall results showed a low potential for uptake and transport of radionuclides from the 300 area sites. However, additional methods to control physical and biological mechanisms may contribute to the effectiveness of waste burial practices. From the results, the Biological Transport task recommended field studies which include reduction of soil erosion and addition of biobarriers to plants and animals. Vegetation plays a major role in reducing soil erosion, and thereby maintaining the backfill over the burial sites. Of the several species found on the 300 area sites, cheatgrass (Bromus tectorum) appears to be the most desirable as a cover. Besides retarding erosion, it has a shallow root system (does not easily penetrate buried material); it has a low affinity for radionuclide uptake; and its tissues are not easily blown away. Small mammals (specifically, mice) appear to have the most potential for radionuclide exposure and uptake. Small mammals were live-trapped within 10 x 10-meter trap grids. Each animal trapped was surgically implanted with a thermoluminescent dosimeter. When the animal was recaptured, the dosimeter was removed and read for exposure. Exposures were reported in milli-Roentgens. The most consistently trapped small mammals were the Great Basin pocket mouse (Perognathus parvus) and the deer mouse (Peromyscus maniculatus). Results from the dosimeter readings showed that some of those animals had higher than background exposures. Biobarriers to animals could be considered as a mechanism to reduce the potential for radionuclide transport

  9. Characterization of the Hanford 300 area burial grounds. Task IV. Biological transport

    Energy Technology Data Exchange (ETDEWEB)

    Fitzner, R.E.; Gano, K.A.; Rickard, W.H.; Rogers, L.E.

    1979-10-01

    The characteristics of radioactive waste burial sites at the 300 area burial grounds on the Department of Energy's Hanford Site, southeastern Washington were studied. The potential vectors of radionuclide transport studied were vegetation and animals. The overall results showed a low potential for uptake and transport of radionuclides from the 300 area sites. However, additional methods to control physical and biological mechanisms may contribute to the effectiveness of waste burial practices. From the results, the Biological Transport task recommended field studies which include reduction of soil erosion and addition of biobarriers to plants and animals. Vegetation plays a major role in reducing soil erosion, and thereby maintaining the backfill over the burial sites. Of the several species found on the 300 area sites, cheatgrass (Bromus tectorum) appears to be the most desirable as a cover. Besides retarding erosion, it has a shallow root system (does not easily penetrate buried material); it has a low affinity for radionuclide uptake; and its tissues are not easily blown away. Small mammals (specifically, mice) appear to have the most potential for radionuclide exposure and uptake. Small mammals were live-trapped within 10 x 10-meter trap grids. Each animal trapped was surgically implanted with a thermoluminescent dosimeter. When the animal was recaptured, the dosimeter was removed and read for exposure. Exposures were reported in milli-Roentgens. The most consistently trapped small mammals were the Great Basin pocket mouse (Perognathus parvus) and the deer mouse (Peromyscus maniculatus). Results from the dosimeter readings showed that some of those animals had higher than background exposures. Biobarriers to animals could be considered as a mechanism to reduce the potential for radionuclide transport.

  10. Isolation and Characterization of the Colletotrichum acutatum ABC Transporter CaABC1

    Directory of Open Access Journals (Sweden)

    Suyoung Kim

    2014-12-01

    Full Text Available Fungi tolerate exposure to various abiotic stresses, including cytotoxic compounds and fungicides, via their ATP-driven efflux pumps belonging to ATP-binding cassette (ABC transporters. To clarify the molecular basis of interaction between the fungus and various abiotic stresses including fungicides, we constructed a cDNA library from germinated conidia of Colletotrichum acutatum, a major anthracnose pathogen of pepper (Capsicum annum L.. Over 1,000 cDNA clones were sequenced, of which single clone exhibited significant nucleotide sequence homology to ABC transporter genes. We isolated three fosmid clones containing the C. acutatum ABC1 (CaABC1 gene in full-length from genomic DNA library screening. The CaABC1 gene consists of 4,059 bp transcript, predicting a 1,353-aa protein. The gene contains the typical ABC signature and Walker A and B motifs. The 5′-flanking region contains a CAAT motif, a TATA box, and a Kozak region. Phylogenetic and structural analysis suggested that the CaABC1 is a typical ABC transporter gene highly conserved in various fungal species, as well as in Chromista, Metazoans, and Viridiplantae. We also found that CaABC1 was up-regulated during conidiation and a minimal medium condition. Moreover, CaABC1 was induced in iprobenfos, kresoxim-methyl, thiophanate-methyl, and hygromycin B. These results demonstrate that CaABC1 is necessary for conidiation, abiotic stress, and various fungicide resistances. These results will provide the basis for further study on the function of ABC transporter genes in C. acutatum.

  11. Characterization of bromine-76-labelled 5-bromo-6-nitroquipazine for PET studies of the serotonin transporter

    Energy Technology Data Exchange (ETDEWEB)

    Lundkvist, Camilla E-mail: Lundkvis@shfj.cea.fr; Loc' h, Christian; Halldin, Christer; Bottlaender, Michel; Ottaviani, Michele; Coulon, Christine; Fuseau, Chantal; Mathis, Chester; Farde, Lars; Maziere, Bernard

    1999-07-01

    The development of suitable radioligands for brain imaging of the serotonin transporter is of great importance for the study of depression and other affective disorders. The potent and selective serotonin transporter ligand, 5-iodo-6-nitro-2-piperazinylquinoline, has been labelled with iodine-123 and used as a radioligand for single photon emission computerized tomography. To evaluate the potential of the bromine-76-labelled analogue, 5-bromo-6-nitroquipazine, as a radioligand for positron emission tomography (PET), its brain distribution and binding characteristics were examined in rats. In vivo brain distribution and ex vivo autoradiography demonstrated that [{sup 76}Br]5-bromo-6-nitroquipazine enters the brain rapidly. The regional brain distribution of [{sup 76}Br]5-bromo-6-nitroquipazine was consistent with the known distribution of serotonin transporters in the midbrain, pons, thalamus, striatum, and neocortex. Specific binding was inhibited by the selective serotonin reuptake inhibitor citalopram. The peripheral metabolism in plasma was rapid, but more than 90% of the radioactivity in brain represented unchanged radioligand 2 h postinjection (p.i.). A preliminary PET study was also performed in a baboon. Following the intravenous injection of [{sup 76}Br]5-bromo-6-nitroquipazine in a baboon, there was a conspicuous accumulation of radioactivity in thalamus, striatum, and pons. The radioactivity in these brain regions was 1.5 times higher than in the cerebellum at 3 h and 2.5-4 times higher at 24 h. A rapid metabolism of the radioligand in plasma was observed (38% unchanged after 5 min). The results indicate that [{sup 76}Br]5-bromo-6-nitroquipazine has potential for PET imaging of the serotonin transporter.

  12. Characterization of a novel organic solute transporter homologue from Clonorchis sinensis.

    Directory of Open Access Journals (Sweden)

    Yanyan Lu

    2018-04-01

    Full Text Available Clonorchis sinensis is a liver fluke that can dwell in the bile ducts of mammals. Bile acid transporters function to maintain the homeostasis of bile acids in C. sinensis, as they induce physiological changes or have harmful effects on C. sinensis survival. The organic solute transporter (OST transports mainly bile acid and belongs to the SLC51 subfamily of solute carrier transporters. OST plays a critical role in the recirculation of bile acids in higher animals. In this study, we cloned full-length cDNA of the 480-amino acid OST from C. sinensis (CsOST. Genomic analysis revealed 11 exons and nine introns. The CsOST protein had a 'Solute_trans_a' domain with 67% homology to Schistosoma japonicum OST. For further analysis, the CsOST protein sequence was split into the ordered domain (CsOST-N at the N-terminus and disordered domain (CsOST-C at the C-terminus. The tertiary structure of each domain was built using a threading-based method and determined by manual comparison. In a phylogenetic tree, the CsOST-N domain belonged to the OSTα and CsOST-C to the OSTβ clade. These two domains were more highly conserved with the OST α- and β-subunits at the structure level than at sequence level. These findings suggested that CsOST comprised the OST α- and β-subunits. CsOST was localized in the oral and ventral suckers and in the mesenchymal tissues abundant around the intestine, vitelline glands, uterus, and testes. This study provides fundamental data for the further understanding of homologues in other flukes.

  13. Characterization of a novel organic solute transporter homologue from Clonorchis sinensis

    Science.gov (United States)

    Dai, Fuhong; Lee, Ji-Yun; Pak, Jhang Ho; Sohn, Woon-Mok

    2018-01-01

    Clonorchis sinensis is a liver fluke that can dwell in the bile ducts of mammals. Bile acid transporters function to maintain the homeostasis of bile acids in C. sinensis, as they induce physiological changes or have harmful effects on C. sinensis survival. The organic solute transporter (OST) transports mainly bile acid and belongs to the SLC51 subfamily of solute carrier transporters. OST plays a critical role in the recirculation of bile acids in higher animals. In this study, we cloned full-length cDNA of the 480-amino acid OST from C. sinensis (CsOST). Genomic analysis revealed 11 exons and nine introns. The CsOST protein had a ‘Solute_trans_a’ domain with 67% homology to Schistosoma japonicum OST. For further analysis, the CsOST protein sequence was split into the ordered domain (CsOST-N) at the N-terminus and disordered domain (CsOST-C) at the C-terminus. The tertiary structure of each domain was built using a threading-based method and determined by manual comparison. In a phylogenetic tree, the CsOST-N domain belonged to the OSTα and CsOST-C to the OSTβ clade. These two domains were more highly conserved with the OST α- and β-subunits at the structure level than at sequence level. These findings suggested that CsOST comprised the OST α- and β-subunits. CsOST was localized in the oral and ventral suckers and in the mesenchymal tissues abundant around the intestine, vitelline glands, uterus, and testes. This study provides fundamental data for the further understanding of homologues in other flukes. PMID:29702646

  14. Identification and Functional Characterization of a Tonoplast Dicarboxylate Transporter in Tomato (Solanum lycopersicum)

    OpenAIRE

    Liu, Ruiling; Li, Boqiang; Qin, Guozheng; Zhang, Zhanquan; Tian, Shiping

    2017-01-01

    Acidity plays an important role in flavor and overall organoleptic quality of fruit and is mainly due to the presence of organic acids. Understanding the molecular basis of organic acid metabolism is thus of primary importance for fruit quality improvement. Here, we cloned a putative tonoplast dicarboxylate transporter gene (SlTDT) from tomato, and submitted it to the NCBI database (GenBank accession number: KC733165). SlTDT protein contained 13 putative transmembrane domains in silico analys...

  15. Characterization of acetate transport in colorectal cancer cells and potential therapeutic implications

    Science.gov (United States)

    Ferro, Suellen; Azevedo-Silva, João; Casal, Margarida; Côrte-Real, Manuela; Baltazar, Fatima; Preto, Ana

    2016-01-01

    Acetate, together with other short chain fatty acids has been implicated in colorectal cancer (CRC) prevention/therapy. Acetate was shown to induce apoptosis in CRC cells. The precise mechanism underlying acetate transport across CRC cells membrane, that may be implicated in its selectivity towards CRC cells, is not fully understood and was addressed here. We also assessed the effect of acetate in CRC glycolytic metabolism and explored its use in combination with the glycolytic inhibitor 3-bromopyruvate (3BP). We provide evidence that acetate enters CRC cells by the secondary active transporters MCT1 and/or MCT2 and SMCT1 as well as by facilitated diffusion via aquaporins. CRC cell exposure to acetate upregulates the expression of MCT1, MCT4 and CD147, while promoting MCT1 plasma membrane localization. We also observed that acetate increases CRC cell glycolytic phenotype and that acetate-induced apoptosis and anti-proliferative effect was potentiated by 3BP. Our data suggest that acetate selectivity towards CRC cells might be explained by the fact that aquaporins and MCTs are found overexpressed in CRC clinical cases. Our work highlights the importance that acetate transport regulation has in the use of drugs such as 3BP as a new therapeutic strategy for CRC. PMID:28874966

  16. Site characterization and validation - monitoring of saline tracer transport by borehole radar measurements

    International Nuclear Information System (INIS)

    Olsson, O.; Andersson, P.; Gustafsson, E.

    1991-08-01

    The objective of this experiment was to map tracer transport in fractured crystalline rock through a combination of radar difference tomography and measurements of tracer concentration in boreholes and the validation drift. The experiment was performed twice, first the D-boreholes were used as a sink and then they were replaced by the validation drift and the experiment repeated. In both experiments saline tracer (200 ml/min, 2% salinity) was injected into fracture zone H about 25 m from the validation drift. The experiment revealed an inhomogeneous transmissivity distribution in Zone H. A significant portion of the tracer is transported upwards along Zone H and towards boreholes T1, T2, and W1. The breakthrough data from both experiments indicate that there are two major transport paths from borehole C2 to the D-boreholes/validation drift. One slow and diluted path to the bottom of the drift which carries the bulk of the mass and one fast path to the crown of the drift with high tracer concentration. The radar difference tomograms show that some tracer is lost through Zone S which intersects Zone H and is nearly perpendicular to it. The intersection between the two zones seems to constitute a preferred flow path. The breakthrough data and the radar difference tomograms have also been used to estimate flow porosity. The estimate obtained area of the same order approximately 10 -4 . (au) (28 refs.)

  17. Functional characterization of dopamine transporter in vivo using Drosophila melanogaster behavioral analysis.

    Directory of Open Access Journals (Sweden)

    Taro eUeno

    2014-09-01

    Full Text Available Dopamine mediates diverse functions such as motivation, reward, attention, learning/memory and sleep/arousal. Recent studies using model organisms including the fruit fly, have elucidated various physiological functions of dopamine, and identified specific neural circuits for these functions. Flies with mutations in the Drosophila dopamine transporter (dDAT gene show enhanced dopamine signaling, and short sleep and memory impairment phenotypes. However, understanding the mechanism by which dopamine signaling causes these phenotypes requires an understanding of the dynamics of dopamine release. Here we report the effects of dDAT expression on behavioral traits. We show that dDAT expression in a subset of dopaminergic neurons is sufficient for normal sleep. dDAT expression in other cell types such as Kenyon cells and glial cells can also rescue the short sleep phenotype of dDAT mutants. dDAT mutants also show a down-regulation of the D1-like dopamine receptor dDA1, and this phenotype is rescued when dDAT is expressed in the same cell types in which it rescues sleep. On the other hand, dDAT overexpression in mushroom bodies, which are the target of memory forming dopamine neurons, abolishes olfactory aversive memory. Our data demonstrate that expression of extrasynaptic dopamine transporters can rescue some aspects of dopamine signaling in dopamine transporter mutants. These results provide novel insights into regulatory systems that modulate dopamine signaling.

  18. Error characterization of CO2 vertical mixing in the atmospheric transport model WRF-VPRM

    Directory of Open Access Journals (Sweden)

    U. Karstens

    2012-03-01

    Full Text Available One of the dominant uncertainties in inverse estimates of regional CO2 surface-atmosphere fluxes is related to model errors in vertical transport within the planetary boundary layer (PBL. In this study we present the results from a synthetic experiment using the atmospheric model WRF-VPRM to realistically simulate transport of CO2 for large parts of the European continent at 10 km spatial resolution. To elucidate the impact of vertical mixing error on modeled CO2 mixing ratios we simulated a month during the growing season (August 2006 with different commonly used parameterizations of the PBL (Mellor-Yamada-Janjić (MYJ and Yonsei-University (YSU scheme. To isolate the effect of transport errors we prescribed the same CO2 surface fluxes for both simulations. Differences in simulated CO2 mixing ratios (model bias were on the order of 3 ppm during daytime with larger values at night. We present a simple method to reduce this bias by 70–80% when the true height of the mixed layer is known.

  19. A nu-space for image correlation spectroscopy: characterization and application to measure protein transport in live cells

    Science.gov (United States)

    Potvin-Trottier, Laurent; Chen, Lingfeng; Horwitz, Alan Rick; Wiseman, Paul W.

    2013-08-01

    We introduce a new generalized theoretical framework for image correlation spectroscopy (ICS). Using this framework, we extend the ICS method in time-frequency (ν, nu) space to map molecular flow of fluorescently tagged proteins in individual living cells. Even in the presence of a dominant immobile population of fluorescent molecules, nu-space ICS (nICS) provides an unbiased velocity measurement, as well as the diffusion coefficient of the flow, without requiring filtering. We also develop and characterize a tunable frequency-filter for spatio-temporal ICS (STICS) that allows quantification of the density, the diffusion coefficient and the velocity of biased diffusion. We show that the techniques are accurate over a wide range of parameter space in computer simulation. We then characterize the retrograde flow of adhesion proteins (α6- and αLβ2-GFP integrins and mCherry-paxillin) in CHO.B2 cells plated on laminin and intercellular adhesion molecule 1 (ICAM-1) ligands respectively. STICS with a tunable frequency filter, in conjunction with nICS, measures two new transport parameters, the density and transport bias coefficient (a measure of the diffusive character of a flow/biased diffusion), showing that molecular flow in this cell system has a significant diffusive component. Our results suggest that the integrin-ligand interaction, along with the internal myosin-motor generated force, varies for different integrin-ligand pairs, consistent with previous results.

  20. Functional characterization of the Bradyrhizobium japonicum modA and modB genes involved in molybdenum transport.

    Science.gov (United States)

    Delgado, María J; Tresierra-Ayala, Alvaro; Talbi, Chouhra; Bedmar, Eulogio J

    2006-01-01

    A modABC gene cluster that encodes an ABC-type, high-affinity molybdate transporter from Bradyrhizobium japonicum has been isolated and characterized. B. japonicum modA and modB mutant strains were unable to grow aerobically or anaerobically with nitrate as nitrogen source or as respiratory substrate, respectively, and lacked nitrate reductase activity. The nitrogen-fixing ability of the mod mutants in symbiotic association with soybean plants grown in a Mo-deficient mineral solution was severely impaired. Addition of molybdate to the bacterial growth medium or to the plant mineral solution fully restored the wild-type phenotype. Because the amount of molybdate required for suppression of the mutant phenotype either under free-living or under symbiotic conditions was dependent on sulphate concentration, it is likely that a sulphate transporter is also involved in Mo uptake in B. japonicum. The promoter region of the modABC genes has been characterized by primer extension. Reverse transcription and expression of a transcriptional fusion, P(modA)-lacZ, was detected only in a B. japonicum modA mutant grown in a medium without molybdate supplementation. These findings indicate that transcription of the B. japonicum modABC genes is repressed by molybdate.

  1. Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

    KAUST Repository

    Lemtiri-Chlieh, Fouad; Ali, Rashid Ayesha

    2013-01-01

    The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

  2. Characterizing and modelling the radionuclide transport properties of fracture zones in plutonic rocks of the Canadian Shield

    International Nuclear Information System (INIS)

    Davison, C.C.; Kozak, E.T.; Frost, L.H.; Everitt, R.A.; Brown, A.; Gascoyne, M.; Scheier, N.W.

    1999-01-01

    Plutonic rocks of the Canadian Shield were investigated as a potential host medium for nuclear fuel waste disposal of used CANDU nuclear fuel. Field investigations at several geologic research areas on the Shield have shown that major fracture zones are the dominant pathways for the large scale movement of groundwater and solutes through plutonic rock bodies. Because of this, a significant amount of the geoscience work has focused on methods to identify, characterize and model the radionuclide transport properties of major fracture zones in the fractured plutonic rocks of the Shield. In order to quantify the transport properties of such fracture zones a series of, groundwater tracer tests were performed over a period of several years in several major, low dipping fracture zones. Sixteen tracer tests were performed using dipole recirculation methods to evaluate transport over distance scales ranging from 17 m to 700 m. It was concluded that only tracer tests can provide useful estimates of the effective porosity and dispersivity characteristics of these large fracture zones in plutonic rocks of the Canadian Shield. (author)

  3. Characterization of heterologously expressed transporter genes by patch- and voltage-clamp methods: Application to cyclic nucleotide-dependent responses

    KAUST Repository

    Lemtiri-Chlieh, Fouad

    2013-09-03

    The application of patch- and voltage-clamp methods to study ion transport can be limited by many hurdles: the size of the cells to be patched and/or stabbed, the subcellular localization of the molecule of interest, and its density of expression that could be too low even in their own native environment. Functional expression of genes using recombinant DNA technology not only overcomes those hurdles but also affords additional and elegant investigations such as single-point mutation studies and subunit associations/regulations. In this chapter, we give a step-by-step description of two electrophysiological methods, patch clamp and two-electrode voltage clamp (TEVC), that are routinely used in combination with heterologous gene expression to assist researchers interested in the identification and characterization of ion transporters. We describe how to (1) obtain and maintain the cells suitable for the use with each of the above-mentioned methods (i.e., HEK-293 cells and yeast spheroplasts to use with the patch-clamp methodology and Xenopus laevis oocytes with TEVC), (2) transfect/inject them with the gene of interest, and (3) record ion transport activities. © Springer Science+Business Media New York 2013.

  4. Characterization of crushed tuff for the evaluation of the fate of tracers in transport studies in the unsaturated zone

    International Nuclear Information System (INIS)

    Polzer, W.L.; Fuentes, H.R.; Raymond, R.; Bish, D.L.; Gladney, E.S.; Lopez, E.A.

    1987-03-01

    Results of field-scale (caisson) transport studies under unsaturated moisture and steady and nonsteady flow conditions indicate variability and a lack of conservation of mass in solute transport. The tuff materials used in that study were analyzed for the presence of tracers and of freshly precipitated material to help explain the variability and lack of conservation of mass. Selected tuff samples were characterized by neutron activation analysis for tracer identification, by x-ray diffraction for mineral identification, by petrographic analysis for identification of freshly precipitated material, and by x-ray fluorescence analysis for identification of major and trace elements. The results of these analyses indicate no obvious presence of freshly precipitated material that would retard tracer movement. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of the nonsorbing tracers (bromide and iodide) suggest the retention of these tracers in immobile water. The presence of sorbing and nonsorbing tracers on the tuff at some locations (even cesium at the 415-cm depth) and not at others suggests variability in transport. 15 refs., 14 figs., 9 tabs

  5. Multixenobiotic resistance in Mytilus edulis: Molecular and functional characterization of an ABCG2- type transporter in hemocytes and gills.

    Science.gov (United States)

    Ben Cheikh, Yosra; Xuereb, Benoit; Boulangé-Lecomte, Céline; Le Foll, Frank

    2018-02-01

    Among the cellular protection arsenal, ABC transporters play an important role in xenobiotic efflux in marine organisms. Two pumps belonging to B and C subfamily has been identified in Mytilus edulis. In this study, we investigated the presence of the third major subtype ABCG2/BCRP protein in mussel tissues. Transcript was expressed in hemocytes and with higher level in gills. Molecular characterization revealed that mussel ABCG2 transporter shares the sequence and organizational structure with mammalian and molluscan orthologs. Overall identity of the predicted amino acid sequence with corresponding homologs from other organisms was between 49% and 98%. Moreover, protein efflux activity was demonstrated using a combination of fluorescent allocrites and specific inhibitors. The accumulation of bodipy prazosin and pheophorbide A was heterogeneous in gills and hemocytes. Most of the used blockers enhanced probe accumulation at different levels, most significantly for bodipy prazosin. Moreover, Mrp classical blocker MK571 showed a polyspecificity. In conclusion, our data demonstrate that several ABC transporters contribute to MXR phenotype in the blue mussel including ABCG2 that forms an active pump in hemocytes and gills. Efforts are needed to distinguish between the different members and to explore their single function and specificity towards allocrites and chemosensitizers. Copyright © 2017 Elsevier B.V. All rights reserved.

  6. Characterization of ion heat conduction in JET and ASDEX Upgrade plasmas with and without internal transport barriers

    Energy Technology Data Exchange (ETDEWEB)

    Wolf, R C [Institut fuer Plasmaphysik, Forschungszentrum Juelich, Association EURATOM/FZJ, Trilateral Euregio Cluster, D-52425 Juelich (Germany); Baranov, Y [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Garbet, X [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Hawkes, N [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Peeters, A G [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Challis, C [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom); Baar, M de [FOM Instituut voor Plasmafyisica Rijnhuizen, Association EURATO-FOM, Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Giroud, C [FOM Instituut voor Plasmafyisica Rijnhuizen, Association EURATO-FOM, Trilateral Euregio Cluster, PO Box 1207, 3430 BE Nieuwegein (Netherlands); Joffrin, E [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Mantsinen, M [Helsinki University of Technology, Association-EURATOM Tekes, FIN-02015 HUT (Finland); Mazon, D [Association EURATOM-CEA sur la fusion, CEA Cadarache, F-13108 St Paul lez Durance (France); Meister, H [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Suttrop, W [Max-Planck-Institut fuer Plasmaphysik, EURATOM-Assoziation, D-85748 Garching (Germany); Zastrow, K-D [UKAEA/EURATOM Fusion Association, Culham Science Centre, Abingdon, OX14 3DB (United Kingdom)

    2003-09-01

    In ASDEX Upgrade and JET, the ion temperature profiles can be described by R/L{sub Ti} which exhibits only little variations, both locally, when comparing different discharges, and radially over a wide range of the poloidal cross-section. Considering a change of the local ion heat flux of more than a factor of two, this behaviour indicates some degree of profile stiffness. In JET, covering a large ion temperature range from 1 to 25 keV, the normalized ion temperature gradient, R/L{sub Ti}, shows a dependence on the electron to ion temperature ratio or toroidal rotational shear. In particular, in hot ion plasmas, produced predominantly by neutral beam heating at low densities, in which large T{sub i}/T{sub e} is coupled to strong toroidal rotation, the effect of the two quantities cannot be distinguished. Both in ASDEX Upgrade and JET, plasmas with internal transport barriers (ITBs), including the PEP mode in JET, are characterized by a significant increase of R/L{sub Ti} above the value of L- and H-mode plasmas. In agreement with previous ASDEX Upgrade results, no increase of the ion heat transport in reversed magnetic shear ITB plasmas is found in JET when raising the electron heating. Evidence is presented that magnetic shear directly influences R/L{sub Ti}, namely decreasing the ion heat transport when going from weakly positive to negative magnetic shear.

  7. Synthesis, characterization, and monoamine transporter activity of the new psychoactive substance 3',4'-methylenedioxy-4-methylaminorex (MDMAR).

    Science.gov (United States)

    McLaughlin, Gavin; Morris, Noreen; Kavanagh, Pierce V; Power, John D; Twamley, Brendan; O'Brien, John; Talbot, Brian; Dowling, Geraldine; Mahony, Olivia; Brandt, Simon D; Patrick, Julian; Archer, Roland P; Partilla, John S; Baumann, Michael H

    2015-07-01

    The recent occurrence of deaths associated with the psychostimulant cis-4,4'-dimethylaminorex (4,4'-DMAR) in Europe indicated the presence of a newly emerged psychoactive substance on the market. Subsequently, the existence of 3,4-methylenedioxy-4-methylaminorex (MDMAR) has come to the authors' attention and this study describes the synthesis of cis- and trans-MDMAR followed by extensive characterization by chromatographic, spectroscopic, mass spectrometric platforms and crystal structure analysis. MDMAR obtained from an online vendor was subsequently identified as predominantly the cis-isomer (90%). Exposure of the cis-isomer to the mobile phase conditions (acetonitrile/water 1:1 with 0.1% formic acid) employed for high performance liquid chromatography analysis showed an artificially induced conversion to the trans-isomer, which was not observed when characterized by gas chromatography. Monoamine release activities of both MDMAR isomers were compared with the non-selective monoamine releasing agent (+)-3,4-methylenedioxymethamphetamine (MDMA) as a standard reference compound. For additional comparison, both cis- and trans-4,4'-DMAR, were assessed under identical conditions. cis-MDMAR, trans-MDMAR, cis-4,4'-DMAR and trans-4,4'-DMAR were more potent than MDMA in their ability to function as efficacious substrate-type releasers at the dopamine (DAT) and norepinephrine (NET) transporters in rat brain tissue. While cis-4,4'-DMAR, cis-MDMAR and trans-MDMAR were fully efficacious releasing agents at the serotonin transporter (SERT), trans-4,4'-DMAR acted as a fully efficacious uptake blocker. Currently, little information is available about the presence of MDMAR on the market but the high potency of ring-substituted methylaminorex analogues at all three monoamine transporters investigated here might be relevant when assessing the potential for serious side-effects after high dose exposure. Copyright © 2014 John Wiley & Sons, Ltd.

  8. Molecular cloning and functional characterization of an ATP-binding cassette transporter OtrC from Streptomyces rimosus

    Directory of Open Access Journals (Sweden)

    Yu Lan

    2012-08-01

    Full Text Available Abstract Background The otrC gene of Streptomyces rimosus was previously annotated as an oxytetracycline (OTC resistance protein. However, the amino acid sequence analysis of OtrC shows that it is a putative ATP-binding cassette (ABC transporter with multidrug resistance function. To our knowledge, none of the ABC transporters in S. rimosus have yet been characterized. In this study, we aimed to characterize the multidrug exporter function of OtrC and evaluate its relevancy to OTC production. Results In order to investigate OtrC’s function, otrC is cloned and expressed in E. coli The exporter function of OtrC was identified by ATPase activity determination and ethidium bromide efflux assays. Also, the susceptibilities of OtrC-overexpressing cells to several structurally unrelated drugs were compared with those of OtrC-non-expressing cells by minimal inhibitory concentration (MIC assays, indicating that OtrC functions as a drug exporter with a broad range of drug specificities. The OTC production was enhanced by 1.6-fold in M4018 (P = 0.000877 and 1.4-fold in SR16 (P = 0.00973 duplication mutants, while it decreased to 80% in disruption mutants (P = 0.0182 and 0.0124 in M4018 and SR16, respectively. Conclusions The results suggest that OtrC is an ABC transporter with multidrug resistance function, and plays an important role in self-protection by drug efflux mechanisms. This is the first report of such a protein in S. rimosus, and otrC could be a valuable target for genetic manipulation to improve the production of industrial antibiotics.

  9. Characterization of SiaA, a streptococcal heme-binding protein associated with a heme ABC transport system.

    Science.gov (United States)

    Sook, Brian R; Block, Darci R; Sumithran, Suganya; Montañez, Griselle E; Rodgers, Kenton R; Dawson, John H; Eichenbaum, Zehava; Dixon, Dabney W

    2008-02-26

    Many pathogenic bacteria require heme and obtain it from their environment. Heme transverses the cytoplasmic membrane via an ATP binding cassette (ABC) pathway. Although a number of heme ABC transport systems have been described in pathogenic bacteria, there is as yet little biophysical characterization of the proteins in these systems. The sia (hts) gene cluster encodes a heme ABC transporter in the Gram positive Streptococcus pyogenes. The lipoprotein-anchored heme binding protein (HBP) of this transporter is SiaA (HtsA). In the current study, resonance Raman (rR), magnetic circular dichroism (MCD), and nuclear magnetic resonance (NMR) spectroscopies were used to determine the coordination state and spin state of both the ferric and ferrous forms of this protein. Identifiers from these techniques suggest that the heme is six-coordinate and low-spin in both oxidation states of the protein, with methionine and histidine as axial ligands. SiaA has a pKa of 9.7 +/- 0.1, attributed to deprotonation of the axial histidine. Guanidinium titration studies show that the ferric state is less stable than the ferrous state, with DeltaG(H2O) values for the oxidized and reduced proteins of 7.3 +/- 0.8 and 16.0 +/- 3.6 kcal mol-1, respectively. The reductive and oxidative midpoint potentials determined via spectroelectrochemistry are 83 +/- 3 and 64 +/- 3 mV, respectively; the irreversibility of heme reduction suggests that redox cycling of the heme is coupled to a kinetically sluggish change in structure or conformation. The biophysical characterization described herein will significantly advance our understanding of structure-function relationships in HBP.

  10. Quantitative characterization of solute transport processes in the laboratory using electrical resistivity tomography

    NARCIS (Netherlands)

    Korteland, S.

    2013-01-01

    The shallow subsurface is an important zone from a social, economical, and environmental point of view. The increased use of the shallow subsurface together with the call for its protection and sustainable exploitation have increased the need for tools to monitor and characterize the subsurface, as

  11. Biophysical characterization of the proton-coupled oligopeptide transporter YjdL

    DEFF Research Database (Denmark)

    Jensen, Johanne Mørch; Simonsen, Fie C.; Mastali, Amir

    2012-01-01

    significantly different from prototypical POTs such as the human hPepT1. Nonetheless YjdL contains several highly conserved POT residues, which include Glu388 that is located in the putative substrate binding cavity. Here we present biophysical characterization of WT-YjdL and Glu388Gln. Isothermal titration...

  12. Synthesis of bulk quantity BN nanotubes with uniform morphology

    International Nuclear Information System (INIS)

    Wen, G.; Zhang, T.; Huang, X.X.; Zhong, B.; Zhang, X.D.; Yu, H.M.

    2010-01-01

    Bulk quantity hexagonal BN nanotubes (h-BNNTs) with uniform morphology were synthesized via an improved ball-milling and annealing method. The sample was characterized by X-ray photoelectron spectrometry, electron energy loss spectroscopy, X-ray diffraction, scanning electron microscopy, conventional transmission electron microscopy (TEM) and high-resolution TEM. The results show that the fabricated BNNTs have a uniform diameter ranging from 80 to 100 nm and a length of about 50-60 μm.

  13. Beam uniformity of flat top lasers

    Science.gov (United States)

    Chang, Chao; Cramer, Larry; Danielson, Don; Norby, James

    2015-03-01

    Many beams that output from standard commercial lasers are multi-mode, with each mode having a different shape and width. They show an overall non-homogeneous energy distribution across the spot size. There may be satellite structures, halos and other deviations from beam uniformity. However, many scientific, industrial and medical applications require flat top spatial energy distribution, high uniformity in the plateau region, and complete absence of hot spots. Reliable standard methods for the evaluation of beam quality are of great importance. Standard methods are required for correct characterization of the laser for its intended application and for tight quality control in laser manufacturing. The International Organization for Standardization (ISO) has published standard procedures and definitions for this purpose. These procedures have not been widely adopted by commercial laser manufacturers. This is due to the fact that they are unreliable because an unrepresentative single-pixel value can seriously distort the result. We hereby propose a metric of beam uniformity, a way of beam profile visualization, procedures to automatically detect hot spots and beam structures, and application examples in our high energy laser production.

  14. Characterization of the Hanford 300 Area Burial Grounds. Task III: fluid transport and modeling

    International Nuclear Information System (INIS)

    Gee, G.W.; Simmons, C.S.

    1979-08-01

    In Task III, Fluid Transport and Modeling, a computer model was developed and applied to the 300 Area Burial Grounds to analyze the influence of potential evaporation and rainfall patterns on drainage. The model describes one-dimensional unsaturated flow. Fluid transport equations were evaluated to describe the driving forces of fluid flow. The data indicate that the major processes are evaporative drying, capillarity, and gravity flow. Thermally induced transport does not appear significant in the subsurface sediments of the area. Several empirical evaporation methods are available for assessing potential evaporation/evapotranspiration. Four methods were used with the unsaturated flow model. Ultimately, the Blaney-Criddle method was chosen for subsequent simulation examples because it relies only on the climatic data available and gave results comparable to the other methods tested. Simulations showed that a dry layer formation is important in controlling the soil-water balance in the profile. The surface dry layer acts as a mulch to retard the evaporative water losses and increase water storage. The most important climatic factor in determining drainage appears to be yearly rainfall distribution. When rainfall is distributed in fall or winter, during periods of low potential evaporation, both water storage and drainage are increased. Summer showers, on the other hand, were shown to add little to the annual water storage. Rainfall occurring in one year influences the subsequent annual drainage for several succeeding years because of annual changes in water storage capacity and the transient nature of unsaturated flow in the storage zone. 47 figures, 9 tables

  15. Cloning and characterization of the promoter regions from the parent and paralogous creatine transporter genes.

    Science.gov (United States)

    Ndika, Joseph D T; Lusink, Vera; Beaubrun, Claudine; Kanhai, Warsha; Martinez-Munoz, Cristina; Jakobs, Cornelis; Salomons, Gajja S

    2014-01-10

    Interconversion between phosphocreatine and creatine, catalyzed by creatine kinase is crucial in the supply of ATP to tissues with high energy demand. Creatine's importance has been established by its use as an ergogenic aid in sport, as well as the development of intellectual disability in patients with congenital creatine deficiency. Creatine biosynthesis is complemented by dietary creatine uptake. Intracellular transport of creatine is carried out by a creatine transporter protein (CT1/CRT/CRTR) encoded by the SLC6A8 gene. Most tissues express this gene, with highest levels detected in skeletal muscle and kidney. There are lower levels of the gene detected in colon, brain, heart, testis and prostate. The mechanism(s) by which this regulation occurs is still poorly understood. A duplicated unprocessed pseudogene of SLC6A8-SLC6A10P has been mapped to chromosome 16p11.2 (contains the entire SLC6A8 gene, plus 2293 bp of 5'flanking sequence and its entire 3'UTR). Expression of SLC6A10P has so far only been shown in human testis and brain. It is still unclear as to what is the function of SLC6A10P. In a patient with autism, a chromosomal breakpoint that intersects the 5'flanking region of SLC6A10P was identified; suggesting that SLC6A10P is a non-coding RNA involved in autism. Our aim was to investigate the presence of cis-acting factor(s) that regulate expression of the creatine transporter, as well as to determine if these factors are functionally conserved upstream of the creatine transporter pseudogene. Via gene-specific PCR, cloning and functional luciferase assays we identified a 1104 bp sequence proximal to the mRNA start site of the SLC6A8 gene with promoter activity in five cell types. The corresponding 5'flanking sequence (1050 bp) on the pseudogene also had promoter activity in all 5 cell lines. Surprisingly the pseudogene promoter was stronger than that of its parent gene in 4 of the cell lines tested. To the best of our knowledge, this is the first

  16. Characterization of single crystalline ZnTe and ZnSe grown by vapor phase transport

    Energy Technology Data Exchange (ETDEWEB)

    Trigubo, A B; Di Stefano, M C [FRBA-UTN, (1179) Buenos Aires (Argentina); Aguirre, M H [Dpto de Quim Inorg, Fac de Cs Quim, Univ Complutense, (28040) Madrid (Spain); Martinez, A M; D' Elia, R; Canepa, H; Heredia, E, E-mail: atrigubo@citefa.gov.a [CINSO-CITEFA: (1603) Villa Martelli, Pcia de Buenos Aires (Argentina)

    2009-05-01

    Tubular furnaces were designed and built to obtain single crystalline ZnTe and ZnSe ingots using respectively physical and chemical transport methods. Different temperature profiles and growth rates were analyzed in order to optimize the necessary crystalline quality for device development. Optical and scanning electron micrographs of the corrosion figures produced by chemical etching were used to obtain the dislocation density and the misorientation between adjacent subgrains in ZnTe and ZnSe wafers. Structural quality of the single crystalline material was determined by transmission electronic microscopy. Optical transmittance was measured by infrared transmission spectrometry and the resulting values were compared to commercial samples.

  17. Functional characterization of folic acid transport in the intestine of the laying hen using the everted intestinal sac model.

    Science.gov (United States)

    Tactacan, G B; Rodriguez-Lecompte, J C; Karmin, O; House, J D

    2011-01-01

    Absorption at the level of the intestine is likely a primary regulatory mechanism for the deposition of dietary supplemented folic acid into the chicken egg. Therefore, factors affecting the intestinal transport of folic acid in the laying hen may influence the level of egg folate concentrations. To this end, a series of experiments using intestinal everted sacs were conducted to characterize intestinal folic acid absorption processes in laying hens. Effects of naturally occurring folate derivatives (5-methyl and 10-formyltetrahydrofolate) as well as heme on folic acid absorption were also investigated. Folic acid absorption was measured based on the rate of uptake of (3)H-labeled folic acid in the everted sac from various segments of the small and large intestines. Folic acid concentration, incubation length, and pH condition were optimized before the performance of uptake experiments. The distribution profile of folic acid transport along the intestine was highest in the upper half of the small intestine. Maximum uptake rate (nmol·100 g tissue(-1)·min(-1)) was observed in the duodenum (20.6 ± 1.9) and jejunum (22.3 ± 2.0) and decreased significantly in the ileum (15.3 ± 1.1) and cecum (9.3 ± 0.9). Transport increased proportionately (P methyl and 10-formyltetrahydrofolate as well as heme impeded folic acid uptake, reducing intestinal folic acid absorption when added at concentrations ranging from 0 to 100 µM. Overall, these data indicated the presence of a folic acid transport system in the entire intestine of the laying hen. Uptake of folic acid in the cecum raises the likelihood of absorption of bacterial-derived folate.

  18. Characterization of the Temporal-Spatial Variability of Trans-Atlantic Dust Transport Based on CALIPSO Lidar Measurements

    Science.gov (United States)

    Yu, Hongbin

    2015-01-01

    The trans-Atlantic dust transport has important implications for human and ecosystem health, the terrestrial and oceanic biogeochemical cycle, weather systems, and climate. A reliable assessment of these influences requires the characterization of dust distributions in three dimensions and over long time periods. We provide an observation-based multiyear estimate of trans-Atlantic dust transport by using a 7-year (2007 - 2013) lidar record from the Cloud-Aerosol Lidar and Infrared Pathfinder Satellite Observations (CALIPSO) in both cloud-free and above-cloud conditions. We estimate that on a basis of the 7-year average and integration over 10S - 30N, 182 Tg a-1 dust leaves the coast of North Africa at 15W, of which 132 Tg a-1 and 43 Tg a-1 reaches 35W and 75W, respectively. These flux estimates have an overall known uncertainty of (45 - 70). The 7-year average of dust deposition into the Amazon Basin is estimated to be 28 (8 - 48) Tg a-1 or 29 (8 - 50) kg ha-1 a-1. This imported dust could provide about 0.022 (0.006 - 0.037) Tg P of phosphorus per year, equivalent to 23 (7 - 39) g P ha-1 a-1 to fertilize the Amazon rainforest, which is comparable to the loss of phosphorus to rainfall. Significant seasonal variations are observed in both the magnitude of total dust transport and its meridional and vertical distributions. The observed large interannual variability of annual dust transport is highly anti-correlated with the prior-year Sahel Precipitation Index. Comparisons of CALIPSO measurements with surface-based observations and model simulations will also be discussed.

  19. The H2 receptor antagonist nizatidine is a P-glycoprotein substrate: characterization of its intestinal epithelial cell efflux transport.

    Science.gov (United States)

    Dahan, Arik; Sabit, Hairat; Amidon, Gordon L

    2009-06-01

    The aim of this study was to elucidate the intestinal epithelial cell efflux transport processes that are involved in the intestinal transport of the H(2) receptor antagonist nizatidine. The intestinal epithelial efflux transport mechanisms of nizatidine were investigated and characterized across Caco-2 cell monolayers, in the concentration range 0.05-10 mM in both apical-basolateral (AP-BL) and BL-AP directions, and the transport constants of P-glycoprotein (P-gp) efflux activity were calculated. The concentration-dependent effects of various P-gp (verapamil, quinidine, erythromycin, ketoconazole, and cyclosporine A), multidrug resistant-associated protein 2 (MRP2; MK-571, probenecid, indomethacin, and p-aminohipuric acid), and breast cancer resistance protein (BCRP; Fumitremorgin C) inhibitors on nizatidine bidirectional transport were examined. Nizatidine exhibited 7.7-fold higher BL-AP than AP-BL Caco-2 permeability, indicative of net mucosal secretion. All P-gp inhibitors investigated displayed concentration-dependent inhibition on nizatidine secretion in both directions. The IC(50) of verapamil on nizatidine P-gp secretion was 1.2 x 10(-2) mM. In the absence of inhibitors, nizatidine displayed concentration-dependent secretion, with one saturable (J(max) = 5.7 x 10(-3) nmol cm(-2) s(-1) and K(m) = 2.2 mM) and one nonsaturable component (K(d) = 7 x 10(-4) microL cm(-2) s(-1)). Under complete P-gp inhibition, nizatidine exhibited linear secretory flux, with a slope similar to the nonsaturable component. V(max) and K(m) estimated for nizatidine P-gp-mediated secretion were 4 x 10(-3) nmol cm(-2) s(-1) and 1.2 mM, respectively. No effect was obtained with the MRP2 or the BCRP inhibitors. Being a drug commonly used in pediatrics, adults, and elderly, nizatidine susceptibility to efflux transport by P-gp revealed in this paper may be of significance in its absorption, distribution, and clearance, as well as possible drug-drug interactions.

  20. Evaluate and characterize mechanisms controlling transport, fate, and effects of army smokes in the aerosol wind tunnel: Transport, transformations, fate, and terrestrial ecological effects of hexachloroethane obscurant smokes

    Energy Technology Data Exchange (ETDEWEB)

    Cataldo, D.A.; Ligotke, M.W.; Bolton, H. Jr.; Fellows, R.J.; Van Voris, P.; McVeety, B.D.; Li, Shu-mei W.; McFadden, K.M.

    1989-09-01

    The terrestrial transport, chemical fate, and ecological effects of hexachloroethane (HC) smoke were evaluated under controlled wind tunnel conditions. The primary objectives of this research program are to characterize and assess the impacts of smoke and obscurants on: (1) natural vegetation characteristic of US Army training sites in the United States; (2) physical and chemical properties of soils representative of these training sites; and (3) soil microbiological and invertebrate communities. Impacts and dose/responses were evaluated based on exposure scenarios, including exposure duration, exposure rate, and sequential cumulative dosing. Key to understanding the environmental impacts of HC smoke/obscurants is establishing the importance of environmental parameters such as relative humidity and wind speed on airborne aerosol characteristics and deposition to receptor surfaces. Direct and indirect biotic effects were evaluated using five plant species and two soil types. HC aerosols were generated in a controlled atmosphere wind tunnel by combustion of hexachloroethane mixtures prepared to simulate normal pot burn rates and conditions. The aerosol was characterized and used to expose plant, soil, and other test systems. Particle sizes of airborne HC ranged from 1.3 to 2.1 {mu}m mass median aerodynamic diameter (MMAD), and particle size was affected by relative humidity over a range of 20% to 85%. Air concentrations employed ranged from 130 to 680 mg/m{sup 3}, depending on exposure scenario. Chlorocarbon concentrations within smokes, deposition rates for plant and soil surfaces, and persistence were determined. The fate of principal inorganic species (Zn, Al, and Cl) in a range of soils was assessed.

  1. Acoustic characterization of a CANDU primary heat transport pump at the blade-passing frequency

    International Nuclear Information System (INIS)

    Rzentkowski, G.; Zbroja, S.

    2000-01-01

    In this paper, we examine the acoustics of a single-stage, double-volute CANDU heat transport pump based on a full-scale experimental investigation. We estimate the strength of source variables (acoustic pressure and velocity) and establish the pump characteristics as an acoustic source at the blade-passing frequency. We conduct this analysis by first assessing the resonance effects in the test loop, and then decomposing the measured signal into the components associated with pump action and loop acoustics with the use of a simple pump model. The pump model is based on a linear superposition of pressure wave transmission and excitation. The results of this analysis indicate that the pump source variables are nearly free of acoustic resonance effects in the test loop. The source pressure and velocity are each estimated at approximately 10 kPa (zero-to-peak). The results also indicate that the pump may act as both a pressure and a velocity source. At the loop resonance, the pump acoustic behavior is exclusively governed by the pressure term. This observation leads to the conclusion that the maximum amplification of pressure pulsations in a reactor heat transport system may be predicted by modeling the pump as a pressure source. (orig.)

  2. Characterization of transport of calcium by microsomal membranes from roots maize

    International Nuclear Information System (INIS)

    Vaughan, M.A.

    1985-01-01

    This study investigates calcium transport by membranes of roots of maize isolated by differential centrifugation. The preparation was determined to be enriched in plasma membrane using market enzyme and electron microscopy. Using the 45 Ca filtration technique and liquid scintillation counting, vesicular calcium uptake was shown to be stimulated by added calmodulin and specific for and dependent on ATP. Conditions for maximal calcium accumulation were found to be 30 min incubation in the presence of 5 mM ATP, 5 mM MgCl 2 , 50 μM CaCl 2 , at 23 0 C, and at pH 6.5. Calcium uptake was inhibited by the ionophores A23187, X-537A, and ionomycin. Sodium fluoride, ruthenium red, and p-chloromercuribenzoate completely inhibited transport: diamide and vanadate produced slight inhibition; caffeine, caffeic acid, oligomycin, and ouabain produced little or no inhibition. Chlorpromazine, W7, trifluoperazine, and R 24 571 inhibit calcium uptake irrespective of added calmodulin, while W5 showed little effect on uptake. Verapamil, nifedipine, cinnarizine, flunarizine, lidoflazine, and diltiazem decreased calcium uptake by 17%-50%. Electron microscopic localization of calcium by pyroantimonate showed vesicles incubated with calmodulin and ATP showed the greatest amount of precipitate. These results suggest that these vesicles accumulate calcium in an ATP-dependent, calmodulin-stimulated manner

  3. Functional and evolution characterization of SWEET sugar transporters in Ananas comosus.

    Science.gov (United States)

    Guo, Chengying; Li, Huayang; Xia, Xinyao; Liu, Xiuyuan; Yang, Long

    2018-02-05

    Sugars will eventually be exported transporters (SWEETs) are a group of recently identified sugar transporters in plants that play important roles in diverse physiological processes. However, currently, limited information about this gene family is available in pineapple (Ananas comosus). The availability of the recently released pineapple genome sequence provides the opportunity to identify SWEET genes in a Bromeliaceae family member at the genome level. In this study, 39 pineapple SWEET genes were identified in two pineapple cultivars (18 AnfSWEET and 21 AnmSWEET) and further phylogenetically classified into five clades. A phylogenetic analysis revealed distinct evolutionary paths for the SWEET genes of the two pineapple cultivars. The MD2 cultivar might have experienced a different expansion than the F153 cultivar because two additional duplications exist, which separately gave rise to clades III and IV. A gene exon/intron structure analysis showed that the pineapple SWEET genes contained highly conserved exon/intron numbers. An analysis of public RNA-seq data and expression profiling showed that SWEET genes may be involved in fruit development and ripening processes. AnmSWEET5 and AnmSWEET11 were highly expressed in the early stages of pineapple fruit development and then decreased. The study increases the understanding of the roles of SWEET genes in pineapple. Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Characterization of an allosteric citalopram-binding site at the serotonin transporter

    DEFF Research Database (Denmark)

    Chen, Fenghua; Breum Larsen, Mads; Neubauer, Henrik Amtoft

    2005-01-01

    The serotonin transporter (SERT), which belongs to a family of       sodium/chloride-dependent transporters, is the major pharmacological       target in the treatment of several clinical disorders, including       depression and anxiety. In the present study we show that the dissociation......       rate, of [3H]S-citalopram from human SERT, is retarded by the presence of       serotonin, as well as by several antidepressants, when present in the       dissociation buffer. Dissociation of [3H]S-citalopram from SERT is most       potently inhibited by S-citalopram followed by R......-citalopram, sertraline,       serotonin and paroxetine. EC50 values for S- and R-citalopram are 3.6 +/-       0.4 microm and 19.4 +/- 2.3 microm, respectively. Fluoxetine, venlafaxine       and duloxetine have no significant effect on the dissociation of       [3H]S-citalopram. Allosteric modulation of dissociation...

  5. Characterization of thermal, optical and carrier transport properties of porous silicon using the photoacoustic technique

    International Nuclear Information System (INIS)

    Sheng, Chan Kok; Mahmood Mat Yunus, W.; Yunus, Wan Md. Zin Wan; Abidin Talib, Zainal; Kassim, Anuar

    2008-01-01

    In this work, the porous silicon layer was prepared by the electrochemical anodization etching process on n-type and p-type silicon wafers. The formation of the porous layer has been identified by photoluminescence and SEM measurements. The optical absorption, energy gap, carrier transport and thermal properties of n-type and p-type porous silicon layers were investigated by analyzing the experimental data from photoacoustic measurements. The values of thermal diffusivity, energy gap and carrier transport properties have been found to be porosity-dependent. The energy band gap of n-type and p-type porous silicon layers was higher than the energy band gap obtained for silicon substrate (1.11 eV). In the range of porosity (50-76%) of the studies, our results found that the optical band-gap energy of p-type porous silicon (1.80-2.00 eV) was higher than that of the n-type porous silicon layer (1.70-1.86 eV). The thermal diffusivity value of the n-type porous layer was found to be higher than that of the p-type and both were observed to increase linearly with increasing layer porosity

  6. Chemical and toxicological characterization of exhaust emissions from alternative fuels for urban public transport

    International Nuclear Information System (INIS)

    Turrio Baldassarri, L.; Conti, R.; Crebelli, B.; Iamicelli, A.L.; De Berardis, M.; Gambino, A.L.; Iannaccone, S.

    2008-01-01

    The Istituto Superiore di Sanita (ISS, the National Institute of Health of Italy) and the Istituto dei Motori (IM) of the Consiglio Nazionale delle Ricerche (CNR, National Research Council) have carried out this study, jointly funded by the two institutes together with the Ministry of Environment. The chemical and toxicological characteristics of emissions from two urban bus engines were studied: a diesel engine fueled with both diesel oil and bio diesel blend and an equivalent spark-ignition one fuelled with compressed natural gas, operating in steady-state conditions. Regulated and unregulated pollutants, such as carcinogenic polycyclic aromatic hydrocarbons and nitrated derivatives, carbonyl compounds and light aromatic hydrocarbons were quantified. Mutagenicity of the emissions was evaluated by the Salmonella typhimurium/mammalian microsome assay. The effect of the fuels under study on the size distribution of particulate matter was also evaluated. The impact of diesel-powered transport on urban air quality, and the potential benefits for human health deriving from the use of natural gas for public transport, are discussed [it

  7. Uniform excitations in magnetic nanoparticles

    DEFF Research Database (Denmark)

    Mørup, Steen; Frandsen, Cathrine; Hansen, Mikkel Fougt

    2010-01-01

    We present a short review of the magnetic excitations in nanoparticles below the superparamagnetic blocking temperature. In this temperature regime, the magnetic dynamics in nanoparticles is dominated by uniform excitations, and this leads to a linear temperature dependence of the magnetization...... and the magnetic hyperfine field, in contrast to the Bloch T3/2 law in bulk materials. The temperature dependence of the average magnetization is conveniently studied by Mössbauer spectroscopy. The energy of the uniform excitations of magnetic nanoparticles can be studied by inelastic neutron scattering....

  8. Uniform excitations in magnetic nanoparticles

    Directory of Open Access Journals (Sweden)

    Steen Mørup

    2010-11-01

    Full Text Available We present a short review of the magnetic excitations in nanoparticles below the superparamagnetic blocking temperature. In this temperature regime, the magnetic dynamics in nanoparticles is dominated by uniform excitations, and this leads to a linear temperature dependence of the magnetization and the magnetic hyperfine field, in contrast to the Bloch T3/2 law in bulk materials. The temperature dependence of the average magnetization is conveniently studied by Mössbauer spectroscopy. The energy of the uniform excitations of magnetic nanoparticles can be studied by inelastic neutron scattering.

  9. Characterization of Gas Transport Properties of Fractured Rocks By Borehole and Chamber Tests.

    Science.gov (United States)

    Shimo, M.; Shimaya, S.; Maejima, T.

    2014-12-01

    Gas transport characteristics of fractured rocks is a great concern to variety of engineering applications such as underground storage of LPG, nuclear waste disposal, CCS and gas flooding in the oil field. Besides absolute permeability, relative permeability and capillary pressure as a function of water saturation have direct influences to the results of two phase flow simulation. However, number of the reported gas flow tests for fractured rocks are limited, therefore, the applicability of the conventional two-phase flow functions used for porous media, such as Mualem-van Genuchten model, to prediction of the gas transport in the fractured rock mass are not well understood. The authors conducted the two types of in-situ tests, with different scales, a borehole gas-injection test and a chamber gas-injection test in fractured granitic rock. These tests were conducted in the Cretaceous granitic rocks at the Namikata underground LPG storage cavern construction site in Ehime Prefecture in Japan, preceding to the cavern scale gas-tightness test. A borehole injection test was conducted using vertical and sub-vertical boreholes drilled from the water injection tunnel nearly at the depth of the top of the cavern, EL-150m. A new type downhole gas injection equipment that is capable to create a small 'cavern' within a borehole was developed. After performing a series of preliminary tests to investigate the hydraulic conductivity and gas-tightness, i.e. threshold pressure, gas injection tests were conducted under different gas pressure. Fig.1 shows an example of the test results From a chamber test using a air pressurizing chamber with volume of approximately166m3, the gas-tightness was confirmed within the uncertainty of 22Pa under the storage pressure of 0.7MPa, however, significant air leakage occurred possibly through an open fracture intersecting the chamber just after cavern pressure exceeds the initial hydrostatic pressure at the ceiling level of the chamber. Anomalies

  10. Characterization of Uranium Contamination, Transport, and Remediation at Rocky Flats - Across Remediation into Post-Closure

    Science.gov (United States)

    Janecky, D. R.; Boylan, J.; Murrell, M. T.

    2009-12-01

    The Rocky Flats Site is a former nuclear weapons production facility approximately 16 miles northwest of Denver, Colorado. Built in 1952 and operated by the Atomic Energy Commission and then Department of Energy, the Site was remediated and closed in 2005, and is currently undergoing long-term surveillance and monitoring by the DOE Office of Legacy Management. Areas of contamination resulted from roughly fifty years of operation. Of greatest interest, surface soils were contaminated with plutonium, americium, and uranium; groundwater was contaminated with chlorinated solvents, uranium, and nitrates; and surface waters, as recipients of runoff and shallow groundwater discharge, have been contaminated by transport from both regimes. A region of economic mineralization that has been referred to as the Colorado Mineral Belt is nearby, and the Schwartzwalder uranium mine is approximately five miles upgradient of the Site. Background uranium concentrations are therefore elevated in many areas. Weapons-related activities included work with enriched and depleted uranium, contributing anthropogenic content to the environment. Using high-resolution isotopic analyses, Site-related contamination can be distinguished from natural uranium in water samples. This has been instrumental in defining remedy components, and long-term monitoring and surveillance strategies. Rocky Flats hydrology interlinks surface waters and shallow groundwater (which is very limited in volume and vertical and horizontal extent). Surface water transport pathways include several streams, constructed ponds, and facility surfaces. Shallow groundwater has no demonstrated connection to deep aquifers, and includes natural preferential pathways resulting primarily from porosity in the Rocky Flats alluvium, weathered bedrock, and discontinuous sandstones. In addition, building footings, drains, trenches, and remedial systems provide pathways for transport at the site. Removal of impermeable surfaces (buildings

  11. Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters

    International Nuclear Information System (INIS)

    Němcová-Fürstová, Vlasta; Kopperová, Dana; Balušíková, Kamila; Ehrlichová, Marie; Brynychová, Veronika; Václavíková, Radka; Daniel, Petr; Souček, Pavel; Kovář, Jan

    2016-01-01

    Development of taxane resistance has become clinically very important issue. The molecular mechanisms underlying the resistance are still unclear. To address this issue, we established paclitaxel-resistant sublines of the SK-BR-3 and MCF-7 breast cancer cell lines that are capable of long-term proliferation in 100 nM and 300 nM paclitaxel, respectively. Application of these concentrations leads to cell death in the original counterpart cells. Both sublines are cross-resistant to doxorubicin, indicating the presence of the MDR phenotype. Interestingly, resistance in both paclitaxel-resistant sublines is circumvented by the second-generation taxane SB-T-1216. Moreover, we demonstrated that it was not possible to establish sublines of SK-BR-3 and MCF-7 cells resistant to this taxane. It means that at least the tested breast cancer cells are unable to develop resistance to some taxanes. Employing mRNA expression profiling of all known human ABC transporters and subsequent Western blot analysis of the expression of selected transporters, we demonstrated that only the ABCB1/PgP and ABCC3/MRP3 proteins were up-regulated in both paclitaxel-resistant sublines. We found up-regulation of ABCG2/BCRP and ABCC4 proteins only in paclitaxel-resistant SK-BR-3 cells. In paclitaxel-resistant MCF-7 cells, ABCB4/MDR3 and ABCC2/MRP2 proteins were up-regulated. Silencing of ABCB1 expression using specific siRNA increased significantly, but did not completely restore full sensitivity to both paclitaxel and doxorubicin. Thus we showed a key, but not exclusive, role for ABCB1 in mechanisms of paclitaxel resistance. It suggests the involvement of multiple mechanisms in paclitaxel resistance in tested breast cancer cells. - Highlights: • Expression of all ABC transporters in paclitaxel-resistant sublines of SK-BR-3 and MCF-7 cells was analyzed. • SK-BR-3 and MCF-7 cells are unable to develop resistance to some taxanes. • Some taxanes are able to overcome developed resistance to

  12. Characterization of acquired paclitaxel resistance of breast cancer cells and involvement of ABC transporters

    Energy Technology Data Exchange (ETDEWEB)

    Němcová-Fürstová, Vlasta, E-mail: vlasta.furstova@lf3.cuni.cz [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Kopperová, Dana; Balušíková, Kamila [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Ehrlichová, Marie; Brynychová, Veronika; Václavíková, Radka [Toxicogenomics Unit, National Institute of Public Health, Prague (Czech Republic); Daniel, Petr [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic); Souček, Pavel [Toxicogenomics Unit, National Institute of Public Health, Prague (Czech Republic); Kovář, Jan [Division of Cell and Molecular Biology, Third Faculty of Medicine, Charles University, Prague (Czech Republic)

    2016-11-01

    Development of taxane resistance has become clinically very important issue. The molecular mechanisms underlying the resistance are still unclear. To address this issue, we established paclitaxel-resistant sublines of the SK-BR-3 and MCF-7 breast cancer cell lines that are capable of long-term proliferation in 100 nM and 300 nM paclitaxel, respectively. Application of these concentrations leads to cell death in the original counterpart cells. Both sublines are cross-resistant to doxorubicin, indicating the presence of the MDR phenotype. Interestingly, resistance in both paclitaxel-resistant sublines is circumvented by the second-generation taxane SB-T-1216. Moreover, we demonstrated that it was not possible to establish sublines of SK-BR-3 and MCF-7 cells resistant to this taxane. It means that at least the tested breast cancer cells are unable to develop resistance to some taxanes. Employing mRNA expression profiling of all known human ABC transporters and subsequent Western blot analysis of the expression of selected transporters, we demonstrated that only the ABCB1/PgP and ABCC3/MRP3 proteins were up-regulated in both paclitaxel-resistant sublines. We found up-regulation of ABCG2/BCRP and ABCC4 proteins only in paclitaxel-resistant SK-BR-3 cells. In paclitaxel-resistant MCF-7 cells, ABCB4/MDR3 and ABCC2/MRP2 proteins were up-regulated. Silencing of ABCB1 expression using specific siRNA increased significantly, but did not completely restore full sensitivity to both paclitaxel and doxorubicin. Thus we showed a key, but not exclusive, role for ABCB1 in mechanisms of paclitaxel resistance. It suggests the involvement of multiple mechanisms in paclitaxel resistance in tested breast cancer cells. - Highlights: • Expression of all ABC transporters in paclitaxel-resistant sublines of SK-BR-3 and MCF-7 cells was analyzed. • SK-BR-3 and MCF-7 cells are unable to develop resistance to some taxanes. • Some taxanes are able to overcome developed resistance to

  13. Characterization of intermittency of impurity turbulent transport in tokamak edge plasmas

    International Nuclear Information System (INIS)

    Futatani, S.; Benkadda, S.; Nakamura, Y.; Kondo, K.

    2008-01-01

    The statistical properties of impurity transport of a tokamak edge plasma embedded in a dissipative drift-wave turbulence are investigated using structure function analysis. The impurities are considered as a passive scalar advected by the plasma flow. Two cases of impurity advection are studied and compared: A decaying impurities case (given by a diffusion-advection equation) and a driven case (forced by a mean scalar gradient). The use of extended self-similarity enables us to show that the relative scaling exponent of structure functions of impurity density and vorticity exhibit similar multifractal scaling in the decaying case and follows the She-Leveque model. However, this property is invalidated for the impurity driven advection case. For both cases, potential fluctuations are self-similar and exhibit a monofractal scaling in agreement with Kolmogorov-Kraichnan theory for two-dimensional turbulence. These results obtained with a passive scalar model agree also with test-particle simulations.

  14. Simulation of tracer transport for the site characterization and validation site in the Stripa Mine

    International Nuclear Information System (INIS)

    Long, J.C.S.; Karasaki, K.

    1992-01-01

    This report describes a series of numerical simulations of tracer tests that were performed in a fracture zone (the H-zone) at the Stripa Mine in Sweden. The tracer simulations are bases on Equivalent Discontinuum models which were developed bases on geophysical measurements and hydraulic interference data (Long et al., 1992). The transport simulations are calibrated to one set of saline tracer breakthrough curves (from the first radar/saline experiment, RSI) and these calibrated models are used to predict another series of breakthrough curves. Predicted breakthrough curves can be compared to the actual data and simulated ''snapshots'' of concentration in the plan of the fracture zone can be compared to radar difference tomograms made during the saline tracer experiments

  15. Characterization of road freight transportation and its impact on the national emission inventory in China

    Science.gov (United States)

    Yang, X. F.; Liu, H.; Man, H. Y.; He, K. B.

    2014-06-01

    Mobile source emission inventories serve as critical input for atmospheric chemical transport models, which are used to simulate air quality and understand the role of mobile source emissions. The significance of mobile sources is even more important in China because the country has the largest vehicle population in the world, and that population continues to grow rapidly. Estimating emissions from diesel trucks is a critical work in mobile source emission inventories due to the importance and difficulties associated with estimating emissions from diesel trucks. Although diesel trucks are major contributors of nitrogen oxide (NOx) and primary particulate matter smaller than 2.5 μm (PM2.5), there are still more obstacles on the existing estimation of diesel truck emissions compared with that of cars; long-range freight transportation activities are complicated, and much of the basic data remain unclear. Most of existing inventories were based on local registration number. However, according to our research, a large number of trucks are conducting long-distance inter-city or inter province transportation. Instead of the local registration number based approach, a road emission intensity-based (REIB) approach is introduced in this research. To provide efficient data for the REIB approach, 1060 questionnaire responses and approximately 1.7 million valid seconds of onboard GPS monitoring data were collected. Both the questionnaire answers and GPS monitoring results indicated that the driving conditions on different types of road have significant impacts on the emission levels of freight trucks. We present estimated emissions of NOx and primary PM2.5 from diesel freight trucks for China in 2011. Using the REIB approach, the activity level and distribution data are obtained from the questionnaire answers. Emission factors are calculated with the International Vehicle Emission (IVE) model that interpolated local on-board measurement results in China according to the GPS

  16. Experimental characterization of X-ray transverse coherence in the presence of beam transport optics

    DEFF Research Database (Denmark)

    Chubar, O.; Fluerasu, A.; Chu, Y.S.

    2013-01-01

    A simple Boron fiber based interference scheme [1] and other similar schemes are currently routinely used for X-ray coherence estimation at 3rd generation synchrotron radiation sources. If such a scheme is applied after a perfect monochromator and without any focusing / transport optics...... in the optical path, the interpretation of the measured interference pattern is relatively straightforward and can be done in terms of the basic parameters of the source [2]. However, if the interference scheme is used after some focusing optics, e.g. close to the X-ray beam waist, the visibility of fringes can...... be significantly affected by the new shape of the focused beam phase-space. At the same time, optical element imperfections still have a negative impact on the transverse coherence. In such situations, which are frequently encountered in experiments at beamlines, the quantitative interpretation of a measured...

  17. Characterization of cesium uptake mediated by a potassium transport system of bacteria in a soil conditioner

    International Nuclear Information System (INIS)

    Zhang, Pengyao; Idota, Yoko; Yano, Kentaro; Negishi, Masayuki; Kawabata, Hideaki; Arakawa, Hiroshi; Ogihara, Takuo; Morimoto, Kaori; Tsuji, Akira

    2014-01-01

    We found that bacteria in a commercial soil conditioner sold in Ishinomaki, Miyagi, exhibited concentrative and saturable cesium ion (Cs + ) uptake in the natural range of pH and temperature. The concentration of intracellular Cs + could be condensed at least a few times higher compared with the outside medium of the cells. This uptake appeared to be mediated by a K + transport system, since Cs + uptake was dose-dependently inhibited by potassium ion (K + ). Eadie-Hofstee plot analysis indicated that the Cs + uptake involved a single saturable process. The maximum uptake amount (J max ) was the same in the presence and absence of K + , suggesting that Cs + and K + uptakes were competitive with respect to each other. These bacteria might be useful for bioremediation of cesium-contaminated soil. (author)

  18. Multi-path transportation futures study : vehicle characterization and scenario analyses.

    Energy Technology Data Exchange (ETDEWEB)

    Plotkin, S. E.; Singh, M. K.; Energy Systems; TA Engineering; ORNL

    2009-12-03

    Projecting the future role of advanced drivetrains and fuels in the light vehicle market is inherently difficult, given the uncertainty (and likely volatility) of future oil prices, inadequate understanding of likely consumer response to new technologies, the relative infancy of several important new technologies with inevitable future changes in their performance and costs, and the importance - and uncertainty - of future government marketplace interventions (e.g., new regulatory standards or vehicle purchase incentives). This Multi-Path Transportation Futures (MP) Study has attempted to improve our understanding of this future role by examining several scenarios of vehicle costs, fuel prices, government subsidies, and other key factors. These are projections, not forecasts, in that they try to answer a series of 'what if' questions without assigning probabilities to most of the basic assumptions.

  19. Expression, purification, and functional characterization of the insulin-responsive facilitative glucose transporter GLUT4.

    Science.gov (United States)

    Kraft, Thomas E; Hresko, Richard C; Hruz, Paul W

    2015-12-01

    The insulin-responsive facilitative glucose transporter GLUT4 is of fundamental importance for maintenance of glucose homeostasis. Despite intensive effort, the ability to express and purify sufficient quantities of structurally and functionally intact protein for biophysical analysis has previously been exceedingly difficult. We report here the development of novel methods to express, purify, and functionally reconstitute GLUT4 into detergent micelles and proteoliposomes. Rat GLUT4 containing FLAG and His tags at the amino and carboxy termini, respectively, was engineered and stably transfected into HEK-293 cells. Overexpression in suspension culture yielded over 1.5 mg of protein per liter of culture. Systematic screening of detergent solubilized GLUT4-GFP fusion protein via fluorescent-detection size exclusion chromatography identified lauryl maltose neopentyl glycol (LMNG) as highly effective for isolating monomeric GLUT4 micelles. Preservation of structural integrity and ligand binding was demonstrated via quenching of tryptophan fluorescence and competition of ATB-BMPA photolabeling by cytochalasin B. GLUT4 was reconstituted into lipid nanodiscs and proper folding was confirmed. Reconstitution of purified GLUT4 with amphipol A8-35 stabilized the transporter at elevated temperatures for extended periods of time. Functional activity of purified GLUT4 was confirmed by reconstitution of LMNG-purified GLUT4 into proteoliposomes and measurement of saturable uptake of D-glucose over L-glucose. Taken together, these data validate the development of an efficient means to generate milligram quantities of stable and functionally intact GLUT4 that is suitable for a wide array of biochemical and biophysical analyses. © 2015 The Protein Society.

  20. Fracture Characterization in Reactive Fluid-Fractured Rock Systems Using Tracer Transport Data

    Science.gov (United States)

    Mukhopadhyay, S.

    2014-12-01

    Fractures, whether natural or engineered, exert significant controls over resource exploitation from contemporary energy sources including enhanced geothermal systems and unconventional oil and gas reserves. Consequently, fracture characterization, i.e., estimating the permeability, connectivity, and spacing of the fractures is of critical importance for determining the viability of any energy recovery program. While some progress has recently been made towards estimating these critical fracture parameters, significant uncertainties still remain. A review of tracer technology, which has a long history in fracture characterization, reveals that uncertainties exist in the estimated parameters not only because of paucity of scale-specific data but also because of knowledge gaps in the interpretation methods, particularly in interpretation of tracer data in reactive fluid-rock systems. We have recently demonstrated that the transient tracer evolution signatures in reactive fluid-rock systems are significantly different from those in non-reactive systems (Mukhopadhyay et al., 2013, 2014). For example, the tracer breakthrough curves in reactive fluid-fractured rock systems are expected to exhibit a long pseudo-state condition, during which tracer concentration does not change by any appreciable amount with passage of time. Such a pseudo-steady state condition is not observed in a non-reactive system. In this paper, we show that the presence of this pseudo-steady state condition in tracer breakthrough patterns in reactive fluid-rock systems can have important connotations for fracture characterization. We show that the time of onset of the pseudo-steady state condition and the value of tracer concentration in the pseudo-state condition can be used to reliably estimate fracture spacing and fracture-matrix interface areas.

  1. Purification and biochemical characterization of NpABCG5/NpPDR5, a plant pleiotropic drug resistance transporter expressed in Nicotiana tabacum BY-2 suspension cells.

    Science.gov (United States)

    Toussaint, Frédéric; Pierman, Baptiste; Bertin, Aurélie; Lévy, Daniel; Boutry, Marc

    2017-05-04

    Pleiotropic drug resistance (PDR) transporters belong to the ABCG subfamily of ATP-binding cassette (ABC) transporters and are involved in the transport of various molecules across plasma membranes. During evolution, PDR genes appeared independently in fungi and in plants from a duplication of a half-size ABC gene. The enzymatic properties of purified PDR transporters from yeast have been characterized. This is not the case for any plant PDR transporter, or, incidentally, for any purified plant ABC transporter. Yet, plant PDR transporters play important roles in plant physiology such as hormone signaling or resistance to pathogens or herbivores. Here, we describe the expression, purification, enzymatic characterization and 2D analysis by electron microscopy of NpABCG5/NpPDR5 from Nicotiana plumbaginifolia , which has been shown to be involved in the plant defense against herbivores. We constitutively expressed NpABCG5/NpPDR5, provided with a His-tag in a homologous system: suspension cells from Nicotiana tabacum (Bright Yellow 2 line). NpABCG5/NpPDR5 was targeted to the plasma membrane and was solubilized by dodecyl maltoside and purified by Ni-affinity chromatography. The ATP-hydrolyzing specific activity (27 nmol min -1  mg -1 ) was stimulated seven-fold in the presence of 0.1% asolectin. Electron microscopy analysis indicated that NpABCG5/NpPDR5 is monomeric and with dimensions shorter than those of known ABC transporters. Enzymatic data (optimal pH and sensitivity to inhibitors) confirmed that plant and fungal PDR transporters have different properties. These data also show that N. tabacum suspension cells are a convenient host for the purification and biochemical characterization of ABC transporters. © 2017 The Author(s); published by Portland Press Limited on behalf of the Biochemical Society.

  2. Preparation and characterization of nano-sized phase change emulsions as thermal energy storage and transport media

    International Nuclear Information System (INIS)

    Chen, J.; Zhang, P.

    2017-01-01

    Highlights: • The nano-sized phase change emulsions are prepared by using D-phase method. • The thermo-physical and transport properties are experimentally investigated. • The influence of surfactant on the melting temperature and latent heat of water is clarified. • The phase change emulsion can be used as the heat transfer fluid in a thermal energy storage system. - Abstract: Phase change emulsion (PCE) is a kind of two-phase heat transfer fluid with phase change material (PCM) dispersed in carrier fluid. It has received intensive attractions in recent years due to the fact that it can be used as both the thermal energy storage material and transport medium simultaneously in a thermal energy storage system. In the present study, nano-sized PCEs are prepared by the D-phase method with n-hexadecane and n-octadecane as PCMs. The thermo-physical and transport properties are characterized to facilitate the applications. The droplet size distribution of the PCE is measured by a Photon Correlation Spectroscopy, and the results show that the droplet size distributions are similar at different mass fractions. The rheological behavior and viscosity of the PCE are measured by a rheometer, which shows that the PCEs at mass fractions below 30.0 wt% are Newtonian fluids, and the viscosities are dependent on both the mass fraction and temperature. The differential scanning calorimetry (DSC) is employed to analyze the phase change characteristics of the PCE, and the results indicate large supercooling degree of water and PCM in the PCE. The melting temperature and latent heat of water in the PCE are much smaller than those of pure water. The thermal conductivities of the PCE with different mass fractions at different temperatures are measured by the transient hot-wire method. Furthermore, the energy transport characteristics of the PCEs are evaluated on the basis of the measured thermo-physical and transport properties. The results suggest that the PCEs show a drastic

  3. Chamber transport

    International Nuclear Information System (INIS)

    Olson, Craig L.

    2001-01-01

    Heavy ion beam transport through the containment chamber plays a crucial role in all heavy ion fusion (HIF) scenarios. Here, several parameters are used to characterize the operating space for HIF beams; transport modes are assessed in relation to evolving target/accelerator requirements; results of recent relevant experiments and simulations of HIF transport are summarized; and relevant instabilities are reviewed. All transport options still exist, including (1) vacuum ballistic transport, (2) neutralized ballistic transport, and (3) channel-like transport. Presently, the European HIF program favors vacuum ballistic transport, while the US HIF program favors neutralized ballistic transport with channel-like transport as an alternate approach. Further transport research is needed to clearly guide selection of the most attractive, integrated HIF system

  4. Uniformity calibration for ICT image

    International Nuclear Information System (INIS)

    Zeng Gang; Liu Li; Que Jiemin; Zhang Yingping; Yin Yin; Wang Yanfang; Yu Zhongqiang; Yan Yonglian

    2004-01-01

    The uniformity of ICT image is impaired by beam hardening and the inconsistency of detector units responses. The beam hardening and the nonlinearity of the detector's output have been analyzed. The correction factors are determined experimentally by the detector's responses with different absorption length. The artifacts in the CT image of a symmetrical aluminium cylinder have been eliminated after calibration. (author)

  5. School Uniforms: Guidelines for Principals.

    Science.gov (United States)

    Essex, Nathan L.

    2001-01-01

    Principals desiring to develop a school-uniform policy should involve parents, teachers, community leaders, and student representatives; beware restrictions on religious and political expression; provide flexibility and assistance for low-income families; implement a pilot program; align the policy with school-safety issues; and consider legal…

  6. Uniform peanut performance test 2017

    Science.gov (United States)

    The Uniform Peanut Performance Tests (UPPT) are designed to evaluate the commercial potential of advanced breeding peanut lines not formally released. The tests are performed in ten locations across the peanut production belt. In this study, 2 controls and 14 entries were evaluated at 8 locations....

  7. Temporally resolved characterization of shock-heated foam target with Al absorption spectroscopy for fast electron transport study

    Energy Technology Data Exchange (ETDEWEB)

    Yabuuchi, T.; Sawada, H.; Wei, M. S.; Beg, F. N. [Center for Energy Research, University of California, San Diego, La Jolla, California 92093 (United States); Regan, S. P.; Anderson, K.; Betti, R. [Laboratory for Laser Energetics, University of Rochester, Rochester, New York 14623 (United States); Hund, J.; Paguio, R. R.; Saito, K. M.; Stephens, R. B. [General Atomics, San Diego, California 92186 (United States); Key, M. H.; Mackinnon, A. J.; McLean, H. S.; Patel, P. K.; Wilks, S. C. [Lawrence Livermore National Laboratory, Livermore, California 94551 (United States)

    2012-09-15

    The CH foam plasma produced by a laser-driven shock wave has been characterized by a temporally resolved Al 1s-2p absorption spectroscopy technique. A 200 mg/cm{sup 3} foam target with Al dopant was developed for this experiment, which used an OMEGA EP [D. D. Meyerhofer et al., J. Phys.: Conf. Ser. 244, 032010 (2010)] long pulse beam with an energy of 1.2 kJ and 3.5 ns pulselength. The plasma temperatures were inferred with the accuracy of 5 eV from the fits to the measurements using an atomic physics code. The results show that the inferred temperature is sustained at 40-45 eV between 6 and 7 ns and decreases to 25 eV at 8 ns. 2-D radiation hydrodynamic simulations show a good agreement with the measurements. Application of the shock-heated foam plasma platform toward fast electron transport experiments is discussed.

  8. Transport and structural characterization of solution-processable doped ZnO nanowires

    KAUST Repository

    Noriega, Rodrigo

    2009-08-18

    The use of ZnO nanowires has become a widespread topic of interest in optoelectronics. In order to correctly assess the quality, functionality, and possible applications of such nanostructures it is important to accurately understand their electrical and optical properties. Aluminum- and gallium-doped crystalline ZnO nanowires were synthesized using a low-temperature solution-based process, achieving dopant densities of the order of 1020 cm-3. A non-contact optical technique, photothermal deflection spectroscopy, is used to characterize ensembles of ZnO nanowires. By modeling the free charge carrier absorption as a Drude metal, we are able to calculate the free carrier density and mobility. Determining the location of the dopant atoms in the ZnO lattice is important to determine the doping mechanisms of the ZnO nanowires. Solid-state NMR is used to distinguish between coordination environments of the dopant atoms.

  9. X-rays diffraction characterization of corrosion products transported by secondary side of a CANDU NPP

    International Nuclear Information System (INIS)

    Dinu, A.; Tunaru, M.; Velciu, L.

    2016-01-01

    To verify the chemistry of secondary side of CANDU steam generators, Millipore filters are used to sampling from condensing extraction pump, from feed water header and blow down of steam generator. These filters retain the corrosion products as very fine particles and are used as samples in chemistry water control. X-Ray diffraction technique is the able to distinguish the different crystallographic compounds present in oxide films deposited on the Millipore filters and gives information referring to the nature of corrosion products transported in secondary side. The XRD analysis has identified the following substance in deposited layer: magnetite (Fe_3O_4), hematite (Fe_2O_3), and iron oxide hydroxide (FeOOH). By optical microscopy it was observed a brown-reddish background specific to hematite and iron oxide hydroxide, especially for filters extracted from condensing extraction pump. The black colour of crud present on filters extracted from feed water header and blow down of steam generator shows the presence of magnetite. (authors)

  10. Walkability and walking for transport: characterizing the built environment using space syntax.

    Science.gov (United States)

    Koohsari, Mohammad Javad; Owen, Neville; Cerin, Ester; Giles-Corti, Billie; Sugiyama, Takemi

    2016-11-24

    Neighborhood walkability has been shown to be associated with walking behavior. However, the availability of geographical data necessary to construct it remains a limitation. Building on the concept of space syntax, we propose an alternative walkability index, space syntax walkability (SSW). This study examined associations of the full walkability index and SSW with walking for transport (WT). Data were collected in 2003-2004 from 2544 adults living in 154 Census Collection Districts (CCD) in Adelaide, Australia. Participants reported past week WT frequency. Full walkability (consisting of net residential density, intersection density, land use mix, and net retail area ratio) and SSW (consisting of gross population density and a space syntax measure of street integration) were calculated for each CCD using geographic information systems and space syntax software. Generalized linear models with negative binomial variance and logarithmic link functions were employed to examine the associations of each walkability index with WT frequency, adjusting for socio-demographic variables. Two walkability indices were closely correlated (ρ = 0.76, p walkability and SSW with WT frequency were positive, with regression coefficients of 1.12 (95% CI: 1.08, 1.17) and 1.14 (95% CI: 1.10, 1.19), respectively. SSW employs readily-available geographic data, yet is comparable to full walkability in its association with WT. The concept and methods of space syntax provide a novel approach to further understanding how urban design influences walking behaviors.

  11. Electrical characterization of non‐Fickian transport in groundwater and hyporheic systems

    Science.gov (United States)

    Singha, Kamini; Pidlisecky, Adam; Day-Lewis, Frederick D.; Gooseff, Michael N.

    2008-01-01

    Recent work indicates that processes controlling solute mass transfer between mobile and less mobile domains in porous media may be quantified by combining electrical geophysical methods and electrically conductive tracers. Whereas direct geochemical measurements of solute preferentially sample the mobile domain, electrical geophysical methods are sensitive to changes in bulk electrical conductivity (bulk EC) and therefore sample EC in both the mobile and immobile domains. Consequently, the conductivity difference between direct geochemical samples and remotely sensed electrical geophysical measurements may provide an indication of mass transfer rates and mobile and immobile porosities in situ. Here we present (1) an overview of a theoretical framework for determining parameters controlling mass transfer with electrical resistivity in situ; (2) a review of a case study estimating mass transfer processes in a pilot‐scale aquifer storage recovery test; and (3) an example application of this method for estimating mass transfer in watershed settings between streams and the hyporheic corridor. We demonstrate that numerical simulations of electrical resistivity studies of the stream/hyporheic boundary can help constrain volumes and rates of mobile‐immobile mass transfer. We conclude with directions for future research applying electrical geophysics to understand field‐scale transport in aquifer and fluvial systems subject to rate‐limited mass transfer.

  12. Neurochemical and behavioral characterization of neuronal glutamate transporter EAAT3 heterozygous mice

    Directory of Open Access Journals (Sweden)

    Luis F. González

    2017-10-01

    Full Text Available Abstract Background Obsessive–compulsive disorder (OCD is a severe neuropsychiatric condition affecting 1–3% of the worldwide population. OCD has a strong genetic component, and the SLC1A1 gene that encodes neuronal glutamate transporter EAAT3 is a strong candidate for this disorder. To evaluate the impact of reduced EAAT3 expression in vivo, we studied male EAAT3 heterozygous and wild-type littermate mice using a battery of behavioral paradigms relevant to anxiety (open field test, elevated plus maze and compulsivity (marble burying, as well as locomotor activity induced by amphetamine. Using high-performance liquid chromatography, we also determined tissue neurotransmitter levels in cortex, striatum and thalamus—brain areas that are relevant to OCD. Results Compared to wild-type littermates, EAAT3 heterozygous male mice have unaltered baseline anxiety-like, compulsive-like behavior and locomotor activity. Administration of acute amphetamine (5 mg/kg intraperitoneally increased locomotion with no differences across genotypes. Tissue levels of glutamate, GABA, dopamine and serotonin did not vary between EAAT3 heterozygous and wild-type mice. Conclusions Our results indicate that reduced EAAT3 expression does not impact neurotransmitter content in the corticostriatal circuit nor alter anxiety or compulsive-like behaviors.

  13. Characterization of the hole transport and electrical properties in poly(9,9-dioctylfluorene)

    International Nuclear Information System (INIS)

    Wang, L.G.; Zhang, H.W.; Tang, X.L.; Song, Y.Q.

    2011-01-01

    A systematic study of the hole transport and electrical properties in blue-emitting polymers as poly(9,9-dioctylfluorene) (PFO) has been performed. We show that the temperature dependent and thickness dependent current density versus voltage characteristics of PFO hole-only devices can be accurately described using our recently introduced improved mobility model based on both the Arrhenius temperature dependence and non-Arrhenius temperature dependence. Within the improved model, the mobility depends on three important physical quantities: temperature, carrier density, and electric field. For the polymer studied, we find the width of the density of states σ=0.115 eV and the lattice constant a=1.2 nm. Furthermore, we show that the boundary carrier density has an important effect on the current density versus voltage characteristics. Too large or too small values of the boundary carrier density lead to incorrect current density versus voltage characteristics. The numerically calculated carrier density is a decreasing function of distance from the interface. The numerically calculated electric field is an increasing function of distance. Both the maximum of carrier density and minimum of electric field appear near the interface.

  14. Electrical characterization of 6H-SiC grown by physical vapor transport method

    Energy Technology Data Exchange (ETDEWEB)

    Zaremba, G., E-mail: gzaremba@ite.waw.p [Institute of Electron Technology, Department of Analysis of Semiconductor Nanostructures, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Kaniewska, M.; Jung, W. [Institute of Electron Technology, Department of Analysis of Semiconductor Nanostructures, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Guziewicz, M. [Institute of Electron Technology, Department of Semiconductor Processing for Photonics, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Grasza, K. [Institute of Physics, Polish Academy of Sciences, Al. Lotnikow 32/46, 02-668 Warsaw (Poland); Institute of Electronic Materials Technology, ul. Wolczynska 133, 01-919 Warsaw (Poland)

    2009-11-25

    Deep level transient spectroscopy (DLTS) and capacitance versus voltage (C-V) measurements have been used to study the electrical properties of electron traps in n-type 6H-silicon carbide (SiC) grown by physical vapor transport (PVT) technique, designed as Schottky diodes. Ir Schottky- and Ni ohmic-contacts were deposited by sputtering. Current versus voltage (I-V) measurements showed that sputter deposition of the Schottky contact yields diodes with a reduced barrier height and poor rectification characteristics. Four main electron traps revealed in DLTS spectra have activation energies at 0. 39, 0.41, 0,66, and 0.74 eV below the conduction band. Based on a comparison made with electron traps reported in the literature, we conclude that three of them are well-known traps found in the as-grown or irradiated material. There was no emission signature in the literature to make such a correspondence for the trap at 0.74 eV. Strongly nonhomogenous spatial distribution with a tendency of the trap to accumulation at the surface was found by DLTS and C-V profiling. This together with the fact that the trap at 0.74 eV has not been previously reported in as-grown or processed material makes it possible that the trap is sputter deposition induced defect.

  15. Demonstrating Hybrid Heat Transport and Energy Conversion System Performance Characterization Using Intelligent Control Systems

    International Nuclear Information System (INIS)

    Ostrum, Lee; Manic, Milos

    2017-01-01

    The debate continues on the magnitude and validity of climate change caused by human activities. However, there is no debate about the need to make buildings, modes of transportation, factories, and homes as energy efficient as possible. Given that climate change could occur with the wasteful use of fossil fuel and the fact that fossil energy costs could and will swing wildly, it is imperative that every effort be made to utilize energy sources to their fullest. Hybrid energy systems (HES) are two or more separate energy producers used together to produce energy commodities. The HES this report focuses on is the use of nuclear reactor waste heat as a source of further energy utilization. Nuclear reactors use a fluid to cool the core and produce the steam needed for the production of electricity. Traditionally this steam, or coolant, is used to convert the energy then cooled elsewhere. The heat is released into the environment without being used further. By adding technologies to nuclear reactors to use the wasted heat, a system can be developed to make more than just electricity and allow for loading following capabilities.

  16. Khnifiss Beach's Black Sand: Provenance and Transport Pathways Investigation Using Heavy Minerals' Characterization

    Science.gov (United States)

    Adnani, M.; Elbelrhiti, H.; Ahmamou, M.; Masmoudi, L.

    2014-12-01

    Arid areas in south of Morocco suffer from silting problem causing destruction of villages infrastructure, roads, agriculture land and oasis heritage. Black sand on Khnifiss beach near Tarfaya city (S-W Morocco) is marked by enrichment of heavy minerals. This later is an important fraction that could help to assess the provenance and transport pathways of sediment. The sand's origin investigation could be useful to fight against erosion and silting problems from the source of supply, to this end, mineralogical analysis was carried out in Khnifiss beach's sand using Optic Microscope and Scanning Electronic Microscope with dispersive energy (SEM- EDS), in addition to physico-chemical analysis provided by Electronic Microprobe. The results revealed: (i) a high grade of oxides (Rutile, Ilmenite, Magnetite, Ulvöspinel) in samples, (ii) silicates (Quartz, Clinopyroxene, feldspar, Zircon), (iii) phosphate (apatite) and (iv) carbonate (calcite). The dominance of iron oxides justifies the black sand's colour. Then, the mineral composition supposes interference between different origins: proximal source (Calcareous cliff) for calcite, distal sources of oxides and silicates are supposed to be eroded and carried by Drâa valley from granite and igneous rocks in Anti-Atlasic field. Another source supposed might be a proximal volcanic island (Canaries island).

  17. Characterization of corrosive bacterial consortia isolated from petroleum-product-transporting pipelines

    Energy Technology Data Exchange (ETDEWEB)

    Rajasekar, Aruliah; Ting, Yen-Peng [National Univ. of Singapore (Singapore). Dept. of Chemical and Biomolecular Engineering; Anandkumar, Balakrishnan [Sourashtra Coll., Madurai (India). Dept. of Biotechnology; Maruthamuthu, Sundaram [Central Electrochemical Research Inst., Karaikudi (India). Biocorrosion Group; Rahman, Pattanathu K.S.M. [Teesside Univ., Tees Valley (United Kingdom). Chemical and Bioprocess Engineering Group

    2010-01-15

    Microbiologically influenced corrosion is a problem commonly encountered in facilities in the oil and gas industries. The present study describes bacterial enumeration and identification in diesel and naphtha pipelines located in the northwest and southwest region in India, using traditional cultivation technique and 16S rDNA gene sequencing. Phylogenetic analysis of 16S rRNA sequences of the isolates was carried out, and the samples obtained from the diesel and naphtha-transporting pipelines showed the occurrence of 11 bacterial species namely Serratia marcescens ACE2, Bacillus subtilis AR12, Bacillus cereus ACE4, Pseudomonas aeruginosa AI1, Klebsiella oxytoca ACP, Pseudomonas stutzeri AP2, Bacillus litoralis AN1, Bacillus sp., Bacillus pumilus AR2, Bacillus carboniphilus AR3, and Bacillus megaterium AR4. Sulfate-reducing bacteria were not detected in samples from both pipelines. The dominant bacterial species identified in the petroleum pipeline samples were B. cereus and S. marcescens in the diesel and naphtha pipelines, respectively. Therefore, several types of bacteria may be involved in biocorrosion arising from natural biofilms that develop in industrial facilities. In addition, localized (pitting) corrosion of the pipeline steel in the presence of the consortia was observed by scanning electron microscopy analysis. The potential role of each species in biofilm formation and steel corrosion is discussed. (orig.)

  18. Identification and Functional Characterization of a Tonoplast Dicarboxylate Transporter in Tomato (Solanum lycopersicum).

    Science.gov (United States)

    Liu, Ruiling; Li, Boqiang; Qin, Guozheng; Zhang, Zhanquan; Tian, Shiping

    2017-01-01

    Acidity plays an important role in flavor and overall organoleptic quality of fruit and is mainly due to the presence of organic acids. Understanding the molecular basis of organic acid metabolism is thus of primary importance for fruit quality improvement. Here, we cloned a putative tonoplast dicarboxylate transporter gene ( SlTDT ) from tomato, and submitted it to the NCBI database (GenBank accession number: KC733165). SlTDT protein contained 13 putative transmembrane domains in silico analysis. Confocal microscopic study using green fluorescent fusion proteins revealed that SlTDT was localized on tonoplast. The expression patterns of SlTDT in tomato were analyzed by RT-qPCR. The results indicated that SlTDT expressed in leaves, roots, flowers and fruits at different ripening stages, suggesting SlTDT may be associated with the development of different tissues. To further explore the function of SlTDT , we constructed both overexpression and RNAi vectors and obtained transgenic tomato plants by agrobacterium-mediated method. Gas chromatography-mass spectrometer (GC-MS) analysis showed that overexpression of SlTDT significantly increased malate content, and reduced citrate content in tomato fruit. By contrast, repression of SlTDT in tomato reduced malate content of and increased citrate content. These results indicated that SlTDT played an important role in remobilization of malate and citrate in fruit vacuoles.

  19. Demonstrating Hybrid Heat Transport and Energy Conversion System Performance Characterization Using Intelligent Control Systems

    Energy Technology Data Exchange (ETDEWEB)

    Ostrum, Lee [Univ. of Idaho and Idaho Falls Center, Idaho Falls, ID (United States); Manic, Milos [Virginia Commonwealth Univ., Richmond, VA (United States)

    2017-09-28

    The debate continues on the magnitude and validity of climate change caused by human activities. However, there is no debate about the need to make buildings, modes of transportation, factories, and homes as energy efficient as possible. Given that climate change could occur with the wasteful use of fossil fuel and the fact that fossil energy costs could and will swing wildly, it is imperative that every effort be made to utilize energy sources to their fullest. Hybrid energy systems (HES) are two or more separate energy producers used together to produce energy commodities. The HES this report focuses on is the use of nuclear reactor waste heat as a source of further energy utilization. Nuclear reactors use a fluid to cool the core and produce the steam needed for the production of electricity. Traditionally this steam, or coolant, is used to convert the energy then cooled elsewhere. The heat is released into the environment without being used further. By adding technologies to nuclear reactors to use the wasted heat, a system can be developed to make more than just electricity and allow for loading following capabilities.

  20. Inward open characterization of EmrD transporter with molecular dynamics simulation

    International Nuclear Information System (INIS)

    Tan, Xianwei; Wang, Boxiong

    2016-01-01

    EmrD is a member of the multidrug resistance exporter family. Up to now, little is known about the structural dynamics that underline the function of the EmrD protein in inward-facing open state and how the EmrD transits from an occluded state to an inward open state. For the first time the article applied the AT simulation to investigate the membrane transporter protein EmrD, and described the dynamic features of the whole protein, the domain, the helices, and the amino acid residues during an inward-open process from its occluded state. The gradual inward-open process is different from the current model of rigid-body domain motion in alternating-access mechanism. Simulation results show that the EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. In addition, it is observed that the helices exposed to the surrounding membrane show a higher level of flexibility than the other regions, and the protonated E227 plays a key role in the transition from the occluded to the open state. -- Highlights: •This study described the dynamic features of the whole EmrD protein, during an inward-open process from its occluded state. •The EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. •The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. •The protonated E227 plays a key role in the transition from the occluded to the open state.

  1. Inward open characterization of EmrD transporter with molecular dynamics simulation

    Energy Technology Data Exchange (ETDEWEB)

    Tan, Xianwei [School of Life Sciences, Tsinghua University, Beijing 100084 (China); Wang, Boxiong, E-mail: boxiong_wang@yahoo.com [Department of Precision Instrument, Tsinghua University, Beijing 100084 (China)

    2016-06-10

    EmrD is a member of the multidrug resistance exporter family. Up to now, little is known about the structural dynamics that underline the function of the EmrD protein in inward-facing open state and how the EmrD transits from an occluded state to an inward open state. For the first time the article applied the AT simulation to investigate the membrane transporter protein EmrD, and described the dynamic features of the whole protein, the domain, the helices, and the amino acid residues during an inward-open process from its occluded state. The gradual inward-open process is different from the current model of rigid-body domain motion in alternating-access mechanism. Simulation results show that the EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. In addition, it is observed that the helices exposed to the surrounding membrane show a higher level of flexibility than the other regions, and the protonated E227 plays a key role in the transition from the occluded to the open state. -- Highlights: •This study described the dynamic features of the whole EmrD protein, during an inward-open process from its occluded state. •The EmrD inward-open conformational fluctuation propagates from a C-terminal domain to an N-terminal domain via the linker region during the transition from its occluded state. •The conformational fluctuation of the C-terminal domain is larger than that of the N-terminal domain. •The protonated E227 plays a key role in the transition from the occluded to the open state.

  2. Numerical characterization of the edge transport conditions and limiter fluxes of the HIDRA stellarator

    Science.gov (United States)

    Marcinko, Steven; Curreli, Davide

    2018-02-01

    The Hybrid Illinois Device for Research and Applications (HIDRA) is a new device for education and Plasma-Material Interaction research at the University of Illinois at Urbana-Champaign. In advance of its first operational campaign, EMC3-EIRENE simulations have been run on the device. EMC3-EIRENE has been modified to calculate a per-plasma-cell relaxed Bohm-like diffusivity simultaneously with the electron temperature at each iteration. In our characterization, the electron temperature, diffusivity, heat fluxes, and particle fluxes have been obtained for varying power levels on a HIDRA magnetic grid, and scaling laws have been extracted, using constraints from previous experimental data taken when the device was operated in Germany (WEGA facility). Peak electron temperatures and heat fluxes were seen to follow a power-law dependence on the deposited radiofrequency (RF) power of type f (PR F)∝a PRF b , with typical exponents in the range of b ˜0.55 to 0.60. Higher magnetic fields have the tendency to linearize the heat flux dependence on the RF power, with exponents in the range of b ˜ 0.75. Particle fluxes are seen to saturate first, and then slightly decline for RF powers above 120 kW in the low-field case and 180 kW in the high-field case.

  3. 46 CFR 310.11 - Cadet uniforms.

    Science.gov (United States)

    2010-10-01

    ... for State, Territorial or Regional Maritime Academies and Colleges § 310.11 Cadet uniforms. Cadet uniforms shall be supplied at the school in accordance with the uniform regulations of the School. Those... 46 Shipping 8 2010-10-01 2010-10-01 false Cadet uniforms. 310.11 Section 310.11 Shipping MARITIME...

  4. Characterizing aerosol transport into the Canadian High Arctic using aerosol mass spectrometry and Lagrangian modelling

    Science.gov (United States)

    Kuhn, T.; Damoah, R.; Bacak, A.; Sloan, J. J.

    2010-05-01

    We report the analysis of measurements made using an aerosol mass spectrometer (AMS; Aerodyne Research Inc.) that was installed in the Polar Environment Atmospheric Research Laboratory (PEARL) in summer 2006. PEARL is located in the Canadian high Arctic at 610 m above sea level on Ellesmere Island (80° N 86° W). PEARL is unique for its remote location in the Arctic and because most of the time it is situated within the free troposphere. It is therefore well suited as a receptor site to study the long range tropospheric transport of pollutants into the Arctic. Some information about the successful year-round operation of an AMS at a high Arctic site such as PEARL will be reported here, together with design considerations for reliable sampling under harsh low-temperature conditions. Computational fluid dynamics calculations were made to ensure that sample integrity was maintained while sampling air at temperatures that average -40 °C in the winter and can be as low as -55 °C. Selected AMS measurements of aerosol mass concentration, size, and chemical composition recorded during the months of August, September and October 2006 will be reported. During this period, sulfate was at most times the predominant aerosol component with on average 0.115 μg m-3 (detection limit 0.003 μg m-3). The second most abundant component was undifferentiated organic aerosol, with on average 0.11 μg m-3 detection limit (0.04 μg m-3). The nitrate component, which averaged 0.007 μg m-3, was above its detection limit (0.002 μg m-3), whereas the ammonium ion had an apparent average concentration of 0.02 μg m-3, which was approximately equal to its detection limit. A few episodes having increased mass concentrations and lasting from several hours to several days are apparent in the data. These were investigated further using a statistical analysis to determine their common characteristics. High correlations among some of the components arriving during the short term episodes provide

  5. Transversals in 4-uniform hypergraphs

    DEFF Research Database (Denmark)

    Henning, Michael A; Yeo, Anders

    2016-01-01

    with maximum degree ∆(H) ≤ 3, then τ (H) ≤ n/4 + m/6, which proves a known conjecture. We show that an easy corollary of our main result is that if H is a 4-uniform hypergraph with n vertices and n edges, then τ (H) ≤3/7 n, which was the main result of the Thomassé-Yeo paper [Combinatorica 27 (2007), 473...

  6. ESPRIT And Uniform Linear Arrays

    Science.gov (United States)

    Roy, R. H.; Goldburg, M.; Ottersten, B. E.; Swindlehurst, A. L.; Viberg, M.; Kailath, T.

    1989-11-01

    Abstract ¬â€?ESPRIT is a recently developed and patented technique for high-resolution estimation of signal parameters. It exploits an invariance structure designed into the sensor array to achieve a reduction in computational requirements of many orders of magnitude over previous techniques such as MUSIC, Burg's MEM, and Capon's ML, and in addition achieves performance improvement as measured by parameter estimate error variance. It is also manifestly more robust with respect to sensor errors (e.g. gain, phase, and location errors) than other methods as well. Whereas ESPRIT only requires that the sensor array possess a single invariance best visualized by considering two identical but other-wise arbitrary arrays of sensors displaced (but not rotated) with respect to each other, many arrays currently in use in various applications are uniform linear arrays of identical sensor elements. Phased array radars are commonplace in high-resolution direction finding systems, and uniform tapped delay lines (i.e., constant rate A/D converters) are the rule rather than the exception in digital signal processing systems. Such arrays possess many invariances, and are amenable to other types of analysis, which is one of the main reasons such structures are so prevalent. Recent developments in high-resolution algorithms of the signal/noise subspace genre including total least squares (TLS) ESPRIT applied to uniform linear arrays are summarized. ESPRIT is also shown to be a generalization of the root-MUSIC algorithm (applicable only to the case of uniform linear arrays of omni-directional sensors and unimodular cisoids). Comparisons with various estimator bounds, including CramerRao bounds, are presented.

  7. Uniform-droplet spray forming

    Energy Technology Data Exchange (ETDEWEB)

    Blue, C.A.; Sikka, V.K. [Oak Ridge National Lab., TN (United States); Chun, Jung-Hoon [Massachusetts Institute of Technology, Cambridge, MA (United States); Ando, T. [Tufts Univ., Medford, MA (United States)

    1997-04-01

    The uniform-droplet process is a new method of liquid-metal atomization that results in single droplets that can be used to produce mono-size powders or sprayed-on to substrates to produce near-net shapes with tailored microstructure. The mono-sized powder-production capability of the uniform-droplet process also has the potential of permitting engineered powder blends to produce components of controlled porosity. Metal and alloy powders are commercially produced by at least three different methods: gas atomization, water atomization, and rotating disk. All three methods produce powders of a broad range in size with a very small yield of fine powders with single-sized droplets that can be used to produce mono-size powders or sprayed-on substrates to produce near-net shapes with tailored microstructures. The economical analysis has shown the process to have the potential of reducing capital cost by 50% and operating cost by 37.5% when applied to powder making. For the spray-forming process, a 25% savings is expected in both the capital and operating costs. The project is jointly carried out at Massachusetts Institute of Technology (MIT), Tuffs University, and Oak Ridge National Laboratory (ORNL). Preliminary interactions with both finished parts and powder producers have shown a strong interest in the uniform-droplet process. Systematic studies are being conducted to optimize the process parameters, understand the solidification of droplets and spray deposits, and develop a uniform-droplet-system (UDS) apparatus appropriate for processing engineering alloys.

  8. Characterization of the fate and transport of nitroaromatic compounds at a former DoD ordnance depot site

    Energy Technology Data Exchange (ETDEWEB)

    Klausmeier, M.E.; Yoon, J.

    1999-07-01

    The 975-acre Former Nansemond Ordnance Depot (FNOD) in Suffolk, Virginia was used by the Department of Defense (DoD) from 1917 until the mid-1950's for preparation, storage, transportation, inspection and demilitarization of many classes of ammunition and ordnance. Approximately 28 areas of Concern (AOC) have been identified by the EPA as areas that could pose potential risk to human health or the environment. The primary contaminants of concern are some trace metals and explosive compounds. During a summer 1987 field investigation, a slab of crystalline TNT was found which was estimated to weigh several tons. An enhanced MODFLOW model is being used to identify subsurface flow patterns. The calibrated model will be used to identify contaminant fate and transport behavior at the site. Enhancements to the MODFLOW model include an updated block-centered flow package (BCF4) and an updated recharge-seepage face boundary package (RSF4) to utilize for the FNOD site flow characterization. BCF4 package accurately delineates the water table without relying on an ad hoc rewetting procedure. This is accomplished by calculating the hydraulic head value required to transmit recharging water through the unsaturated zone without inactivating dry cells. The recharge-seepage face package eliminates the projection of heads above the ground surface by adjusting recharge to a cell when a user supplied ponding depth is reached. Using a regional model, a telescoping grid refinement technique was implemented to calculate the boundary conditions around the area of interest and to model quantity and quality interactions between surface and subsurface water regimes in a realistic manner.

  9. Functional characterization of the vertebrate primary ureter: Structure and ion transport mechanisms of the pronephric duct in axolotl larvae (Amphibia

    Directory of Open Access Journals (Sweden)

    Prehn Lea R

    2010-05-01

    Full Text Available Abstract Background Three kidney systems appear during vertebrate development: the pronephroi, mesonephroi and metanephroi. The pronephric duct is the first or primary ureter of these kidney systems. Its role as a key player in the induction of nephrogenic mesenchyme is well established. Here we investigate whether the duct is involved in urine modification using larvae of the freshwater amphibian Ambystoma mexicanum (axolotl as model. Results We investigated structural as well as physiological properties of the pronephric duct. The key elements of our methodology were: using histology, light and transmission electron microscopy as well as confocal laser scanning microscopy on fixed tissue and applying the microperfusion technique on isolated pronephric ducts in combination with single cell microelectrode impalements. Our data show that the fully differentiated pronephric duct is composed of a single layered epithelium consisting of one cell type comparable to the principal cell of the renal collecting duct system. The cells are characterized by a prominent basolateral labyrinth and a relatively smooth apical surface with one central cilium. Cellular impalements demonstrate the presence of apical Na+ and K+ conductances, as well as a large K+ conductance in the basolateral cell membrane. Immunolabeling experiments indicate heavy expression of Na+/K+-ATPase in the basolateral labyrinth. Conclusions We propose that the pronephric duct is important for the subsequent modification of urine produced by the pronephros. Our results indicate that it reabsorbs sodium and secretes potassium via channels present in the apical cell membrane with the driving force for ion movement provided by the Na+/K+ pump. This is to our knowledge the first characterization of the pronephric duct, the precursor of the collecting duct system, which provides a model of cell structure and basic mechanisms for ion transport. Such information may be important in understanding

  10. Characterization of SLCO5A1/OATP5A1, a solute carrier transport protein with non-classical function.

    Directory of Open Access Journals (Sweden)

    Katrin Sebastian

    Full Text Available Organic anion transporting polypeptides (OATP/SLCO have been identified to mediate the uptake of a broad range of mainly amphipathic molecules. Human OATP5A1 was found to be expressed in the epithelium of many cancerous and non-cancerous tissues throughout the body but protein characterization and functional analysis have not yet been performed. This study focused on the biochemical characterization of OATP5A1 using Xenopus laevis oocytes and Flp-In T-REx-HeLa cells providing evidence regarding a possible OATP5A1 function. SLCO5A1 is highly expressed in mature dendritic cells compared to immature dendritic cells (∼6.5-fold and SLCO5A1 expression correlates with the differentiation status of primary blood cells. A core- and complex- N-glycosylated polypeptide monomer of ∼105 kDa and ∼130 kDa could be localized in intracellular membranes and on the plasma membrane, respectively. Inducible expression of SLCO5A1 in HeLa cells led to an inhibitory effect of ∼20% after 96 h on cell proliferation. Gene expression profiling with these cells identified immunologically relevant genes (e.g. CCL20 and genes implicated in developmental processes (e.g. TGM2. A single nucleotide polymorphism leading to the exchange of amino acid 33 (L→F revealed no differences regarding protein expression and function. In conclusion, we provide evidence that OATP5A1 might be a non-classical OATP family member which is involved in biological processes that require the reorganization of the cell shape, such as differentiation and migration.

  11. Vote par sondage uniforme incorruptible

    OpenAIRE

    Blanchard , Nicolas

    2016-01-01

    International audience; Introduit en 2012 par David Chaum, le vote par sondage uniforme (random-sample voting) est un protocole de vote basé sur un choix d'une sous-population représentative , permettant de limiter les coûts tout en ayant de nombreux avantages, principalement lorsqu'il est couplé a d'autres techniques comme ThreeBallot. Nous analysons un problème de corruptibilité potentielle où les votants peuvent vendre leur vote au plus offrant et proposons une variation du protocole reméd...

  12. Boundary-artifact-free phase retrieval with the transport of intensity equation II: applications to microlens characterization.

    Science.gov (United States)

    Zuo, Chao; Chen, Qian; Li, Hongru; Qu, Weijuan; Asundi, Anand

    2014-07-28

    Boundary conditions play a crucial role in the solution of the transport of intensity equation (TIE). If not appropriately handled, they can create significant boundary artifacts across the reconstruction result. In a previous paper [Opt. Express 22, 9220 (2014)], we presented a new boundary-artifact-free TIE phase retrieval method with use of discrete cosine transform (DCT). Here we report its experimental investigations with applications to the micro-optics characterization. The experimental setup is based on a tunable lens based 4f system attached to a non-modified inverted bright-field microscope. We establish inhomogeneous Neumann boundary values by placing a rectangular aperture in the intermediate image plane of the microscope. Then the boundary values are applied to solve the TIE with our DCT-based TIE solver. Experimental results on microlenses highlight the importance of boundary conditions that often overlooked in simplified models, and confirm that our approach effectively avoid the boundary error even when objects are located at the image borders. It is further demonstrated that our technique is non-interferometric, accurate, fast, full-field, and flexible, rendering it a promising metrological tool for the micro-optics inspection.

  13. Identification and Characterization of Key Human Performance Issues and Research in the Next Generation Air Transportation System (NextGen)

    Science.gov (United States)

    Lee, Paul U.; Sheridan, Tom; Poage, james L.; Martin, Lynne Hazel; Jobe, Kimberly K.

    2010-01-01

    This report identifies key human-performance-related issues associated with Next Generation Air Transportation System (NextGen) research in the NASA NextGen-Airspace Project. Four Research Focus Areas (RFAs) in the NextGen-Airspace Project - namely Separation Assurance (SA), Airspace Super Density Operations (ASDO), Traffic Flow Management (TFM), and Dynamic Airspace Configuration (DAC) - were examined closely. In the course of the research, it was determined that the identified human performance issues needed to be analyzed in the context of NextGen operations rather than through basic human factors research. The main gaps in human factors research in NextGen were found in the need for accurate identification of key human-systems related issues within the context of specific NextGen concepts and better design of the operational requirements for those concepts. By focusing on human-system related issues for individual concepts, key human performance issues for the four RFAs were identified and described in this report. In addition, mixed equipage airspace with components of two RFAs were characterized to illustrate potential human performance issues that arise from the integration of multiple concepts.

  14. Raman and electronic transport characterization of few- and single-layer-thick α-RuCl3

    Science.gov (United States)

    Zhou, Boyi; Henriksen, Erik

    The layered magnetic semiconductor α-RuCl3, having a honeycomb lattice of spin-1/2 moments, has been identified as a potential candidate material to realize the Kitaev quantum spin liquid. In particular, bulk RuCl3 crystals have been studied and found to be on the cusp of manifesting QSL behavior. As the QSL is primarily a two-dimensional phenomenon, and since the layers of RuCl3 are weakly coupled, we propose to create and study a 2D spin-1/2 honeycomb system by isolating single sheets. Here we report the exfoliation of RuCl3 down to few- and single-layer-thick samples, which we characterize by Raman spectroscopy and atomic force microscopy at room temperature. We will also report our progress on measurements of basic electronic transport properties in the 2D RuCl3 system by controlling the chemical potential via gating in a field-effect configuration.

  15. Characterization of a putative grapevine Zn transporter, VvZIP3, suggests its involvement in early reproductive development in Vitis vinifera L

    Directory of Open Access Journals (Sweden)

    Gainza-Cortés Felipe

    2012-07-01

    Full Text Available Abstract Background Zinc (Zn deficiency is one of the most widespread mineral nutritional problems that affect normal development in plants. Because Zn cannot passively diffuse across cell membranes, it must be transported into intracellular compartments for all biological processes where Zn is required. Several members of the Zinc-regulated transporters, Iron-regulated transporter-like Protein (ZIP gene family have been characterized in plants, and have shown to be involved in metal uptake and transport. This study describes the first putative Zn transporter in grapevine. Unravelling its function may explain an important symptom of Zn deficiency in grapevines, which is the production of clusters with fewer and usually smaller berries than normal. Results We identified and characterized a putative Zn transporter from berries of Vitis vinifera L., named VvZIP3. Compared to other members of the ZIP family identified in the Vitis vinifera L. genome, VvZIP3 is mainly expressed in reproductive tissue - specifically in developing flowers - which correlates with the high Zn accumulation in these organs. Contrary to this, the low expression of VvZIP3 in parthenocarpic berries shows a relationship with the lower Zn accumulation in this tissue than in normal seeded berries where its expression is induced by Zn. The predicted protein sequence indicates strong similarity with several members of the ZIP family from Arabidopsis thaliana and other species. Moreover, VvZIP3 complemented the growth defect of a yeast Zn-uptake mutant, ZHY3, and is localized in the plasma membrane of plant cells, suggesting that VvZIP3 has the function of a Zn uptake transporter. Conclusions Our results suggest that VvZIP3 encodes a putative plasma membrane Zn transporter protein member of the ZIP gene family that might play a role in Zn uptake and distribution during the early reproductive development in Vitis vinifera L., indicating that the availability of this micronutrient

  16. Decidability of uniform recurrence of morphic sequences

    OpenAIRE

    Durand , Fabien

    2012-01-01

    We prove that the uniform recurrence of morphic sequences is decidable. For this we show that the number of derived sequences of uniformly recurrent morphic sequences is bounded. As a corollary we obtain that uniformly recurrent morphic sequences are primitive substitutive sequences.

  17. Uniform Statistical Convergence on Time Scales

    Directory of Open Access Journals (Sweden)

    Yavuz Altin

    2014-01-01

    Full Text Available We will introduce the concept of m- and (λ,m-uniform density of a set and m- and (λ,m-uniform statistical convergence on an arbitrary time scale. However, we will define m-uniform Cauchy function on a time scale. Furthermore, some relations about these new notions are also obtained.

  18. Toward a Mechanistic Source Term in Advanced Reactors: Characterization of Radionuclide Transport and Retention in a Sodium Cooled Fast Reactor

    Energy Technology Data Exchange (ETDEWEB)

    Brunett, Acacia J.; Bucknor, Matthew; Grabaskas, David

    2016-04-17

    A vital component of the U.S. reactor licensing process is an integrated safety analysis in which a source term representing the release of radionuclides during normal operation and accident sequences is analyzed. Historically, source term analyses have utilized bounding, deterministic assumptions regarding radionuclide release. However, advancements in technical capabilities and the knowledge state have enabled the development of more realistic and best-estimate retention and release models such that a mechanistic source term assessment can be expected to be a required component of future licensing of advanced reactors. Recently, as part of a Regulatory Technology Development Plan effort for sodium cooled fast reactors (SFRs), Argonne National Laboratory has investigated the current state of knowledge of potential source terms in an SFR via an extensive review of previous domestic experiments, accidents, and operation. As part of this work, the significant sources and transport processes of radionuclides in an SFR have been identified and characterized. This effort examines all stages of release and source term evolution, beginning with release from the fuel pin and ending with retention in containment. Radionuclide sources considered in this effort include releases originating both in-vessel (e.g. in-core fuel, primary sodium, cover gas cleanup system, etc.) and ex-vessel (e.g. spent fuel storage, handling, and movement). Releases resulting from a primary sodium fire are also considered as a potential source. For each release group, dominant transport phenomena are identified and qualitatively discussed. The key product of this effort was the development of concise, inclusive diagrams that illustrate the release and retention mechanisms at a high level, where unique schematics have been developed for in-vessel, ex-vessel and sodium fire releases. This review effort has also found that despite the substantial range of phenomena affecting radionuclide release, the

  19. Detailed characterization and preliminary adsorption model for materials for an intermediate-scale reactive-transport experiment

    International Nuclear Information System (INIS)

    Ward, D.B.; Bryan, C.R.

    1994-01-01

    An experiment involving migration of fluid and tracers (Li, Br, Ni) through a 6-m-high x 3-m-dia caisson Wedron 510 sand, is being carried out for Yucca Mountain Site Characterization Project. Sand's surface chemistry of the sand was studied and a preliminary surface-complexation model of Ni adsorption formulated for transport calculations. XPS and leaching suggest that surface of the quartz sand is partially covered by thin layers of Fe-oxyhydroxide and Ca-Mg carbonate and by flakes of kaolinite. Ni adsorption by the sand is strongly pH-dependent, showing no adsorption at pH 5 and near-total adsorption at pH 7. Location of adsorption edge is independent of ionic strength and dissolved Ni concentration; it is shifted to slightly lower pH with higher pCO2 and to slightly higher pH by competition with Li. Diminished adsorption at alkiline pH with higher pCO2 implies formation of dissolved Ni-carbonato complexes. Ni adsorption edges for goethite and quartz, two components of the sand were also measured. Ni adsorption on pure quartz is only moderately pH-dependent and differs in shape and location from that of the sand, whereas Ni adsorption by goethite is strongly pH-dependent. A triple-layer surface-complexation model developed for goethite provides a good fit to the Ni-adsorption curve of the sand. Based on this model, the apparent surface area of the Fe-oxyhydroxide coating is estimated to be 560 m 2 /g, compatible with its occurrence as amorphous Fe-oxyhydroxide. Potentiometric titrations on sand also differ from pure quartz and suggest that effective surface area of sand may be much greater than that measured by N 2 -BET gas adsorption. Attempts to model the adsorption of bulk sand in terms of properties of pure end member components suggest that much of the sand surface is inert. Although the exact Ni adsorption mechanisms remain ambiguous, this preliminary adsorption model provides an initial set of parameters that can be used in transport calculations

  20. Uniform magnetic excitations in nanoparticles

    DEFF Research Database (Denmark)

    Mørup, Steen; Hansen, Britt Rosendahl

    2005-01-01

    We have used a spin-wave model to calculate the temperature dependence of the (sublattice) magnetization of magnetic nanoparticles. The uniform precession mode, corresponding to a spin wave with wave vector q=0, is predominant in nanoparticles and gives rise to an approximately linear temperature...... dependence of the (sublattice) magnetization well below the superparamagnetic blocking temperature for both ferro-, ferri-, and antiferromagnetic particles. This is in accordance with the results of a classical model for collective magnetic excitations in nanoparticles. In nanoparticles of antiferromagnetic...... materials, quantum effects give rise to a small deviation from the linear temperature dependence of the (sublattice) magnetization at very low temperatures. The complex nature of the excited precession states of nanoparticles of antiferromagnetic materials, with deviations from antiparallel orientation...

  1. Uniform shock waves in disordered granular matter.

    Science.gov (United States)

    Gómez, Leopoldo R; Turner, Ari M; Vitelli, Vincenzo

    2012-10-01

    The confining pressure P is perhaps the most important parameter controlling the properties of granular matter. Strongly compressed granular media are, in many respects, simple solids in which elastic perturbations travel as ordinary phonons. However, the speed of sound in granular aggregates continuously decreases as the confining pressure decreases, completely vanishing at the jamming-unjamming transition. This anomalous behavior suggests that the transport of energy at low pressures should not be dominated by phonons. In this work we use simulations and theory to show how the response of granular systems becomes increasingly nonlinear as pressure decreases. In the low-pressure regime the elastic energy is found to be mainly transported through nonlinear waves and shocks. We numerically characterize the propagation speed, shape, and stability of these shocks and model the dependence of the shock speed on pressure and impact intensity by a simple analytical approach.

  2. A novel radioligand for glycine transporter 1: characterization and use in autoradiographic and in vivo brain occupancy studies

    Energy Technology Data Exchange (ETDEWEB)

    Zeng Zhizhen [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States)], E-mail: zhizhen_zeng@merck.com; O' Brien, Julie A. [Sleep and Psychiatric Disorders, Merck Research Laboratories, West Point, PA 19486 (United States); Lemaire, Wei [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); O' Malley, Stacey S.; Miller, Patricia J. [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States); Zhao Zhijian [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); Wallace, Michael A. [Drug Metabolism, Merck Research Laboratories, Rahway, NJ 07065 (United States); Raab, Conrad [Drug Metabolism, Merck Research Laboratories, West Point, PA 19486 (United States); Lindsley, Craig W. [Medicinal Chemistry, Merck Research Laboratories, West Point, PA 19486 (United States); Departments of Pharmacology and Chemistry, Vanderbilt University, Nashville, TN 37232 (United States); Sur, Cyrille; Williams, David L. [Imaging, Merck Research Laboratories, West Point, PA 19486 (United States)

    2008-04-15

    Introduction: In an effort to develop agents to test the NMDA hypofunction hypothesis of schizophrenia, benchmark compounds from a program to discover potent, selective, competitive glycine transporter 1 (GlyT1) inhibitors were radiolabeled in order to further study the detailed pharmacology of these inhibitors and the distribution of GlyT1 in brain. We here report the in vitro characterization of [{sup 35}S](S)-2-amino-4-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl) ethyl)benzamide ([{sup 35}S]ACPPB), a radiotracer developed from a potent and selective non-sarcosine-derived GlyT1 inhibitor, its use in autoradiographic studies to localize (S)-2-amino-6-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl)ethyl) benzamide (ACPPB) binding sites in rat and rhesus brain and for in vivo occupancy assays of competitive GlyT1 inhibitors. Methods: Functional potencies of unlabeled compounds were characterized by [{sup 14}C]glycine uptake into JAR (human placental choriocarcinoma) cells and synaptosomes. Radioligand binding studies were performed with tissue homogenates. Autoradiographic studies were performed on tissue slices. Results: ACPPB is a potent (K{sub d}=1.9 nM), selective, GlyT1 inhibitor that, when radiolabeled with [{sup 35}S], is a well-behaved radioligand with low nondisplaceable binding. Autoradiographic studies of rat and rhesus brain slices with this ligand showed that specific binding sites were plentiful and nonhomogeneously distributed, with high levels of binding in the brainstem, cerebellar white matter, thalamus, cortical white matter and spinal cord gray matter. In vivo studies demonstrate displaceable binding of [{sup 35}S]ACPPB in rat brain tissues following iv administration of this radioligand. Conclusions: This is the first report of detailed anatomical localization of GlyT1 using direct radioligand binding, and the first demonstration that an in vivo occupancy assay is feasible, suggesting that it may also be feasible to develop

  3. A novel radioligand for glycine transporter 1: characterization and use in autoradiographic and in vivo brain occupancy studies

    International Nuclear Information System (INIS)

    Zeng Zhizhen; O'Brien, Julie A.; Lemaire, Wei; O'Malley, Stacey S.; Miller, Patricia J.; Zhao Zhijian; Wallace, Michael A.; Raab, Conrad; Lindsley, Craig W.; Sur, Cyrille; Williams, David L.

    2008-01-01

    Introduction: In an effort to develop agents to test the NMDA hypofunction hypothesis of schizophrenia, benchmark compounds from a program to discover potent, selective, competitive glycine transporter 1 (GlyT1) inhibitors were radiolabeled in order to further study the detailed pharmacology of these inhibitors and the distribution of GlyT1 in brain. We here report the in vitro characterization of [ 35 S](S)-2-amino-4-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl) ethyl)benzamide ([ 35 S]ACPPB), a radiotracer developed from a potent and selective non-sarcosine-derived GlyT1 inhibitor, its use in autoradiographic studies to localize (S)-2-amino-6-chloro-N-(1-(4-phenyl-1-(propylsulfonyl)piperidin-4-yl)ethyl) benzamide (ACPPB) binding sites in rat and rhesus brain and for in vivo occupancy assays of competitive GlyT1 inhibitors. Methods: Functional potencies of unlabeled compounds were characterized by [ 14 C]glycine uptake into JAR (human placental choriocarcinoma) cells and synaptosomes. Radioligand binding studies were performed with tissue homogenates. Autoradiographic studies were performed on tissue slices. Results: ACPPB is a potent (K d =1.9 nM), selective, GlyT1 inhibitor that, when radiolabeled with [ 35 S], is a well-behaved radioligand with low nondisplaceable binding. Autoradiographic studies of rat and rhesus brain slices with this ligand showed that specific binding sites were plentiful and nonhomogeneously distributed, with high levels of binding in the brainstem, cerebellar white matter, thalamus, cortical white matter and spinal cord gray matter. In vivo studies demonstrate displaceable binding of [ 35 S]ACPPB in rat brain tissues following iv administration of this radioligand. Conclusions: This is the first report of detailed anatomical localization of GlyT1 using direct radioligand binding, and the first demonstration that an in vivo occupancy assay is feasible, suggesting that it may also be feasible to develop positron emission

  4. Shelter Index and a simple wind speed parameter to characterize vegetation control of sand transport threshold and Flu

    Science.gov (United States)

    Gillies, J. A.; Nield, J. M.; Nickling, W. G.; Furtak-Cole, E.

    2014-12-01

    Wind erosion and dust emissions occur in many dryland environments from a range of surfaces with different types and amounts of vegetation. Understanding how vegetation modulates these processes remains a research challenge. Here we present results from a study that examines the relationship between an index of shelter (SI=distance from a point to the nearest upwind vegetation/vegetation height) and particle threshold expressed as the ratio of wind speed measured at 0.45 times the mean plant height divided by the wind speed at 17 m when saltation commences, and saltation flux. The results are used to evaluate SI as a parameter to characterize the influence of vegetation on local winds and sediment transport conditions. Wind speed, wind direction, saltation activity and point saltation flux were measured at 35 locations in defined test areas (~13,000 m2) in two vegetation communities: mature streets of mesquite covered nebkhas and incipient nebkhas dominated by low mesquite plants. Measurement positions represent the most open areas, and hence those places most susceptible to wind erosion among the vegetation elements. Shelter index was calculated for each measurement position for each 10° wind direction bin using digital elevation models for each site acquired using terrestrial laser scanning. SI can show the susceptibility to wind erosion at different time scales, i.e., event, seasonal, or annual, but in a supply-limited system it can fail to define actual flux amounts due to a lack of knowledge of the distribution of sediment across the surface of interest with respect to the patterns of SI.

  5. Pharmacological Characterization of [3H]ATPCA as a Substrate for Studying the Functional Role of the Betaine/GABA Transporter 1 and the Creatine Transporter

    DEFF Research Database (Denmark)

    Al-Khawaja, Anas; Haugaard, Anne S; Marek, Ales

    2018-01-01

    for BGT1 among the four GATs (Km and Vmax values of 21 µM and 3.6 nmol ATPCA/(min×mg protein), respectively), but was also found to be a substrate for the creatine transporter (CreaT). In experiments with mouse cortical cell cultures, we observed a Na(+)H-dependent [(3)HH]ATPCA uptake in neurons...

  6. Uniform Thin Films of CdSe and CdSe(ZnS) Core(shell) Quantum Dots by Sol-Gel Assembly: Enabling Photoelectrochemical Characterization and Electronic Applications

    Science.gov (United States)

    Korala, Lasantha; Wang, Zhijie; Liu, Yi; Maldonado, Stephen; Brock, Stephanie L.

    2013-01-01

    Optoelectronic properties of quantum dot (QD) films are limited by (1) poor interfacial chemistry and (2) non-radiative recombination due to surface traps. To address these performance issues, sol-gel methods are applied to fabricate thin films of CdSe and core(shell) CdSe(ZnS) QDs. High-angle annular dark-field scanning transmission electron microscopy (HAADF-STEM) imaging with chemical analysis confirms that the surface of the QDs in the sol-gel thin films are chalcogen-rich, consistent with an oxidative-induced gelation mechanism in which connectivity is achieved by formation of dichalcogenide covalent linkages between particles. The ligand removal and assembly process is probed by thermogravimetric, spectroscopic and microscopic studies. Further enhancement of inter-particle coupling via mild thermal annealing, which removes residual ligands and reinforces QD connectivity, results in QD sol-gel thin films with superior charge transport properties, as shown by a dramatic enhancement of electrochemical photocurrent under white light illumination relative to thin films composed of ligand-capped QDs. A more than 2-fold enhancement in photocurrent, and a further increase in photovoltage can be achieved by passivation of surface defects via overcoating with a thin ZnS shell. The ability to tune interfacial and surface characteristics for the optimization of photophysical properties suggests that the sol-gel approach may enable formation of QD thin films suitable for a range of optoelectronic applications. PMID:23350924

  7. Busted Butte Unsaturated Zone Transport Test: Fiscal Year 1998 Status Report Yucca Mountain Site Characterization Program Deliverable SPU85M4

    International Nuclear Information System (INIS)

    Bussod, G.Y.; Turin, H.J.; Lowry, W.E.

    1999-01-01

    This report describes the status of the Busted Butte Unsaturated Zone Transport Test (UZTT) and documents the progress of construction activities and site and laboratory characterization activities undertaken in fiscal year 1998. Also presented are predictive flow-and-transport simulations for Test Phases 1 and 2 of testing and the preliminary results and status of these test phases. Future anticipated results obtained from unsaturated-zone (UZ) transport testing in the Calico Hills Formation at Busted Butte are also discussed in view of their importance to performance assessment (PA) needs to build confidence in and reduce the uncertainty of site-scale flow-and-transport models and their abstractions for performance for license application. The principal objectives of the test are to address uncertainties associated with flow and transport in the UZ site-process models for Yucca Mountain, as identified by the PA working group in February 1997. These include but are not restricted to: (1) The effect of heterogeneities on flow and transport in unsaturated and partially saturated conditions in the Calico Hills Formation. In particular, the test aims to address issues relevant to fracture-matrix interactions and permeability contrast boundaries; (2) The migration behavior of colloids in fractured and unfractured Calico Hills rocks; (3) The validation through field testing of laboratory sorption experiments in unsaturated Calico Hills rocks; (4) The evaluation of the 3-D site-scale flow-and-transport process model (i.e., equivalent-continuum/dual-permeability/discrete-fracture-fault representations of flow and transport) used in the PA abstractions for license application; and (5) The effect of scaling from lab scale to field scale and site scale

  8. Characterization of injection instabilities in electrohydrodynamics by numerical modelling: comparison of particle in cell and flux corrected transport methods for electroconvection between two plates

    International Nuclear Information System (INIS)

    Vazquez, P A; Georghiou, G E; Castellanos, A

    2006-01-01

    Numerical simulations are carried out for the characterization of injection instabilities in electrohydrodynamics and, in particular, the development of electroconvection between two parallel plates. The particle-in-cell and the finite element-flux corrected transport methods are used for the simulation of the test case, as they have proved very powerful and accurate in the solution of complex transport problems. Results are presented for unipolar injection (both strong and weak injections) between two plane electrodes immersed in a dielectric liquid, and the good agreement obtained by the two methods demonstrates not only their theoretical validity but also their practical ability to deal with transport problems in the presence of steep gradients. Some differences appear mainly in the prediction of small oscillations of the velocity and consequently of the electric current. These differences are highlighted and an explanation of their source is given

  9. Discovery of Uniformly Expanding Universe

    Directory of Open Access Journals (Sweden)

    Cahill R. T.

    2012-01-01

    Full Text Available Saul Perlmutter and the Brian Schmidt – Adam Riess teams reported that their Friedmann-model GR-based analysis of their supernovae magnitude-redshift data re- vealed a new phenomenon of “dark energy” which, it is claimed, forms 73% of the energy / matter density of the present-epoch universe, and which is linked to the further claim of an accelerating expansion of the universe. In 2011 Perlmutter, Schmidt and Riess received the Nobel Prize in Physics “for the discovery of the accelerating ex- pansion of the Universe through observations of distant supernovae”. Here it is shown that (i a generic model-independent analysis of this data reveals a uniformly expanding universe, (ii their analysis actually used Newtonian gravity, and finally (iii the data, as well as the CMB fluctuation data, does not require “dark energy” nor “dark matter”, but instead reveals the phenomenon of a dynamical space, which is absent from the Friedmann model.

  10. Ordered mesoporous MFe(2)O(4) (M = Co, Cu, Mg, Ni, Zn) thin films with nanocrystalline walls, uniform 16 nm diameter pores and high thermal stability: template-directed synthesis and characterization of redox active trevorite.

    Science.gov (United States)

    Haetge, Jan; Suchomski, Christian; Brezesinski, Torsten

    2010-12-20

    In this paper, we report on ordered mesoporous NiFe(2)O(4) thin films synthesized via co-assembly of hydrated ferric nitrate and nickel chloride with an amphiphilic diblock copolymer, referred to as KLE. We establish that the NiFe(2)O(4) samples are highly crystalline after calcination at 600 °C, and that the conversion of the amorphous inorganic framework comes at little cost to the ordering of the high quality cubic network of pores averaging 16 nm in diameter. We further show that the synthesis method employed in this work can be readily extended to other ferrites, such as CoFe(2)O(4), CuFe(2)O(4), MgFe(2)O(4), and ZnFe(2)O(4), which could pave the way for innovative device design. While this article focuses on the self-assembly and characterization of these materials using various state-of-the-art techniques, including electron microscopy, grazing incidence small-angle X-ray scattering (GISAXS), time-of-flight secondary ion mass spectrometry (TOF-SIMS), X-ray photoelectron spectroscopy (XPS), as well as UV-vis and Raman spectroscopy, we also examine the electrochemical properties and show the benefits of combining a continuous mesoporosity with nanocrystalline films. KLE-templated NiFe(2)O(4) electrodes exhibit reasonable levels of lithium ion storage at short charging times which stem from facile pseudocapacitance.

  11. Characterization of atmospheric aerosols in Ile-de-France: Local contribution and Long range transport; Caracteisation des aeosols atmospheiques en Ile-de-France: contribution locale et transport a longues distances

    Energy Technology Data Exchange (ETDEWEB)

    Cuesta, J.E

    2006-06-15

    Atmospheric aerosols interact directly in a great number of processes related to climate change and public health, modifying the energy budget and partly determining the quality of the air we breathe. In my PhD, I chose to study the perturbation, if not the aggravation, of the living conditions in Ile-de-France associated to aerosol transport episodes in the free troposphere. This situation is rather frequent and still badly known. To achieve my study, I developed the observation platform 'TReSS' Transportable Remote Sensing Station, whose instruments were developed at the Laboratoire de Meteorology Dynamique by the LiMAG team. 'TReSS' consists of a new high-performance 'Mini-Lidar' and of two standard radiometers: a sun photometer and a thermal infrared radiometer. The principle of my experimental approach is the synergy of the vertical Lidar profiles and the particle size distributions over the column, obtained by the 'Almucantar' inversion of sun photometer data. The new 'Lidar and Almucantar' method characterizes the vertical distribution by layer and the optical micro-physical properties of the local and transported aerosols. Firstly, I undertook the characterization of the Paris aerosol, mainly of anthropogenic origin. Their radiative properties were analyzed in the daily and yearly scales. Then, I conducted a statistical multi-year study of transport episodes and a two-week study case, representative of a succession of desert dust intrusion in Ile-de-France. My PhD work concludes by a study on the impact of biomass burning aerosols during the heat wave on August 2003. I study the impact of the transported aerosols into the local radiative budget and the possible consequences on the diurnal cycle of the atmospheric boundary layer. (author)

  12. The yeast plasma membrane ATP binding cassette (ABC) transporter Aus1: purification, characterization, and the effect of lipids on its activity.

    Science.gov (United States)

    Marek, Magdalena; Milles, Sigrid; Schreiber, Gabriele; Daleke, David L; Dittmar, Gunnar; Herrmann, Andreas; Müller, Peter; Pomorski, Thomas Günther

    2011-06-17

    The ATP binding cassette (ABC) transporter Aus1 is expressed under anaerobic growth conditions at the plasma membrane of the yeast Saccharomyces cerevisiae and is required for sterol uptake. These observations suggest that Aus1 promotes the translocation of sterols across membranes, but the precise transport mechanism has yet to be identified. In this study, an extraction and purification procedure was developed to characterize the Aus1 transporter. The detergent-solubilized protein was able to bind and hydrolyze ATP. Mutagenesis of the conserved lysine to methionine in the Walker A motif abolished ATP hydrolysis. Likewise, ATP hydrolysis was inhibited by classical inhibitors of ABC transporters. Upon reconstitution into proteoliposomes, the ATPase activity of Aus1 was specifically stimulated by phosphatidylserine (PS) in a stereoselective manner. We also found that Aus1-dependent sterol uptake, but not Aus1 expression and trafficking to the plasma membrane, was affected by changes in cellular PS levels. These results suggest a direct interaction between Aus1 and PS that is critical for the activity of the transporter.

  13. Characterization of contaminant transport by gravity, capilliarity and barometric pumping in heterogeneous vadose regimes. 1997 annual progress report

    International Nuclear Information System (INIS)

    Carrigan, C.R.

    1997-01-01

    'Vadose regimes can be the sites of complex interactions between the atmosphere and groundwater. When a volatile contaminant exists as free product or in dissolved form in the vadose environment, upward transport can occur with the contaminant ultimately being vented as a vapor into the atmosphere. This transport happens naturally and can be enhanced by anisotropy resulting from heterogenities in the vadose regime. Several stages in the transport process are involved in going from a volatile, liquid state contaminant to a contaminant vapor vented at the surface. In a three-year effort, called the Vadose Zone Transport Study, the authors are investigating, with the aid of existing data, new field studies involving dissolved tracer gases and 3-D diagnostic computer simulations that provide a framework to interpret the observations, the detailed nature of each of these stages of transport in several different kinds of vadose regimes. They are emphasizing the impact of features specific to a site, that is, the local geology and hydrology, on each stage of the transport process. In particular they want to better understand how the time scales for (1) partitioning contaminants from the liquid to the vapor states and then (2) transporting the vapor out of the vadose regime are dependent on the specific character of a site. Such time-scale information will be important for evaluating the potential of contaminant sources as well as remediation strategies including natural remediation approaches.'

  14. School uniforms: tradition, benefit or predicament?

    OpenAIRE

    Van Aardt, Annette Marie; Wilken, Ilani

    2012-01-01

    This article focuses on the controversies surrounding school uniforms. Roleplayers in this debate in South Africa are parents, learners and educators, and arguments centre on aspects such as identity, economy and the equalising effect of school uniforms, which are considered in the literature to be benefits. Opposing viewpoints highlight the fact that compulsory uniforms infringe on learners’ constitutional rights to self-expression. The aim of this research was to determine the perspectives ...

  15. 3-D Characterization of Detrital Zircon Grains and its Implications for Fluvial Transport, Mixing, and Preservation Bias

    Science.gov (United States)

    Markwitz, V.; Kirkland, C. L.; Mehnert, A.; Gessner, K.; Shaw, J.

    2017-12-01

    Detrital zircon studies can suffer from selective loss of provenance information due to U-Pb age discordance, metamictization, metamorphic overprinting and fluviatile transport processes. The relationship between isotopic composition and zircon grain shape, and how grain shape is modified during transport, is largely unknown. We combine X-ray tomography with U-Pb geochronology to quantify how fluvial transport affects 3-D zircon shape, detrital age signature, and grain density along the Murchison River, whose catchment comprises Eoarchean to Early Paleozoic source rocks in Western Australia. We acquired tomographic volumes and isotopic data from 373 detrital zircons to document changes in size, shape and density in transport direction, and explore how grain shape, age spectra and the proportion of discordant material vary along the channel. Results show that shape characteristics are sensitive to transport distance, stream gradient, proximity to source material, and whether the source consists of primary or recycled zircons. With increasing transport distance, grain lengths decrease more than their widths. Furthermore, the loss of metamict grains occurs at a near constant rate, resulting in a linear increase of mean calculated zircon density by ca. 0.03 g/cm3 per 100 km transport distance. 3-D grain shape is therefore strongly linked to detrital age signature, and mean grain density is a function of the absolute transport distance. 3-D shape characteristics provide valuable information on detrital zircon populations, including the interaction between source materials with fluvial transport processes, which significantly affects preservation bias and, by inference, the representativeness of the sampled data.

  16. Experimental study on generation of large area uniform electron beam

    International Nuclear Information System (INIS)

    Tang Ying; Yi Aiping; Liu Jingru; Qian Hang; Huang Xin; Yu Li; Su Jiancang; Ding Zhenjie; Ding Yongzhong; Yu Jianguo

    2007-01-01

    In the experiment of gas laser pumped by electron beam, large area uniform electron beam is important to generate high efficiency laser output. The experimental study on generation of large area uniform electron beam with SPG-200 pulsed power generator is introduced. SPG-200 is an all-solid-state components pulsed power generator based on SOS, and its open voltage is more than 350 kV. The cathode have the area of 24 mm x 294 mm, and the anode-cathode(A-C)gap spacing is adjustable from 0 to 49 mm. The electron beam of cathode emission is transported to the laser chamber through the diode pressure foil, which sepa-rates the vacuum chamber from the laser chamber. Velvet and graphite cathodes are studied, each generates large area electron beam. The diode parameters are presented, and the uniformity of e-beam is diagnosed. The experimental results show that the diode voltage of the graphite cathode is 240-280 kV, and the diode current is 0.7-1.8 kA. The diode voltage of the velvet cathode is 200-250 kV, and the diode current is 1.5-1.7 kA. The uniformity of the velvet cathode emission is better than that of the graphite cathode. (authors)

  17. Lessons in the Design and Characterization Testing of the Semi-Span Super-Sonic Transport (S4T) Wind-Tunnel Model

    Science.gov (United States)

    2012-01-01

    This paper focuses on some of the more challenging design processes and characterization tests of the Semi-Span Super-Sonic Transport (S4T)-Active Controls Testbed (ACT). The model was successfully tested in four entries in the National Aeronautics and Space Administration Langley Transonic Dynamics Tunnel to satisfy the goals and objectives of the Fundamental Aeronautics Program Supersonic Project Aero-Propulso-Servo-Elastic effort. Due to the complexity of the S4T-ACT, only a small sample of the technical challenges for designing and characterizing the model will be presented. Specifically, the challenges encountered in designing the model include scaling the Technology Concept Airplane to model scale, designing the model fuselage, aileron actuator, and engine pylons. Characterization tests included full model ground vibration tests, wing stiffness measurements, geometry measurements, proof load testing, and measurement of fuselage static and dynamic properties.

  18. Seismic signal of near steady uniform flows

    Science.gov (United States)

    Mangeney, A.; Bachelet, V.; Toussaint, R.; de Rosny, J.

    2017-12-01

    The seismic signal generated by rockfalls, landslides or avalanches is a unique tool to detect, characterize and monitor gravitational flow activity. A major challenge in this domain is to retrieve the dynamic properties of the flow from the emitted seismic signal. In this study, we propose laboratory experiments where the dynamic properties of the flow (velocity, granular temperature, density, etc.) are measured together with the generated seismic signal. We investigate near steady uniform flows made of glass beads of 2mm diameter, flowing throughout a thin rectangular channel of 10 cm width, with tunable tilt angle and height flow, thanks to an adjustable opening gate. The flow is monitored from the spine with a fast camera (5000 fps), and the emitted waves are recorded by accelerometers (10Hz - 54 kHz), stuck on the back side of the bottom of the channel. Among others, three seismic parameters are analyzed: the power radiated by the flow, the mean frequency of the signal, and the modulation of its amplitude. We show that they are linked to three dynamical properties: the mean kinetic energy of the flow, the speed of collisions between beads and the vertical oscillation of the beads, respectively.

  19. Study of the distribution of maxima and minima in multiple sequential images of uniformity; Estudio de la distribucion de maximos y minimos en multiples imagenes secuenciales de uniformidad

    Energy Technology Data Exchange (ETDEWEB)

    Llacer Martos, S.; Puchal Ane, R.

    2011-07-01

    To characterize the uniformity of a gamma camera extrinsic used integral uniformity coefficient is calculated with the value of two pixels, the maximum and minimum, single source acquisition of a flat and uniform. This method does not take into account the fact that if a gamma camera having a uniform response, the distribution of these items should be random. In this paper we study how these points are distributed in a succession of large numbers of uniform images.

  20. Identification and characterization of potential discharge areas for radionuclide transport by groundwater from a nuclear waste repository in Sweden.

    Science.gov (United States)

    Berglund, Sten; Bosson, Emma; Selroos, Jan-Olof; Sassner, Mona

    2013-05-01

    This paper describes solute transport modeling carried out as a part of an assessment of the long-term radiological safety of a planned deep rock repository for spent nuclear fuel in Forsmark, Sweden. Specifically, it presents transport modeling performed to locate and describe discharge areas for groundwater potentially carrying radionuclides from the repository to the surface where man and the environment could be affected by the contamination. The modeling results show that topography to large extent determines the discharge locations. Present and future lake and wetland objects are central for the radionuclide transport and dose calculations in the safety assessment. Results of detailed transport modeling focusing on the regolith and the upper part of the rock indicate that the identification of discharge areas and objects considered in the safety assessment is robust in the sense that it does not change when a more detailed model representation is used.

  1. Final technical report for project titled Quantitative Characterization of Cell Aggregation/Adhesion as Predictor for Distribution and Transport of Microorganisms in Subsurface Environment

    Energy Technology Data Exchange (ETDEWEB)

    Gu, April Z. [Northeastern Univ., Boston, MA (United States); Wan, Kai-tak [Northeastern Univ., Boston, MA (United States)

    2014-09-02

    This project aims to explore and develop enabling methodology and techniques for nano-scale characterization of microbe cell surface contact mechanics, interactions and adhesion quantities that allow for identification and quantification of indicative properties related to microorganism migration and transport behavior in porous media and in subsurface environments. Microbe transport has wide impact and therefore is of great interest in various environmental applications such as in situ or enhanced subsurface bioremediation,filtration processes for water and wastewater treatments and protection of drinking water supplies. Although great progress has been made towards understanding the identities and activities of these microorganisms in the subsurface, to date, little is known of the mechanisms that govern the mobility and transport of microorganisms in DOE’s contaminated sites, making the outcomes of in situ natural attenuation or contaminant stability enhancement unpredictable. Conventionally, movement of microorganisms was believed to follows the rules governing solute (particle) transport. However, recent studies revealed that cell surface properties, especially those pertaining to cell attachment/adhesion and aggregation behavior, can cause the microbe behavior to deviate from non-viable particles and hence greatly influence the mobility and distribution of microorganisms in porous media.This complexity highlights the need to obtain detailed information of cell-cell and cell-surface interactions in order to improve and refine the conceptual and quantitative model development for fate and transport of microorganisms and contaminant in subsurface. Traditional cell surface characterization methods are not sufficient to fully predict the deposition rates and transport behaviors of microorganism observed. A breakthrough of methodology that would allow for quantitative and molecular-level description of intrinsic cell surface properties indicative for cell

  2. Characterization of hexose transporters in Yarrowia lipolytica reveals new groups of Sugar Porters involved in yeast growth.

    Science.gov (United States)

    Lazar, Zbigniew; Neuvéglise, Cécile; Rossignol, Tristan; Devillers, Hugo; Morin, Nicolas; Robak, Małgorzata; Nicaud, Jean-Marc; Crutz-Le Coq, Anne-Marie

    2017-03-01

    Sugar assimilation has been intensively studied in the model yeast S. cerevisiae, and for two decades, it has been clear that the homologous HXT genes, which encode a set of hexose transporters, play a central role in this process. However, in the yeast Yarrowia lipolytica, which is well-known for its biotechnological applications, sugar assimilation is only poorly understood, even though this yeast exhibits peculiar intra-strain differences in fructose uptake: some strains (e.g., W29) are known to be slow-growing in fructose while others (e.g., H222) grow rapidly under the same conditions. Here, we retrieved 24 proteins of the Sugar Porter family from these two strains, and determined that at least six of these proteins can function as hexose transporters in the heterologous host Saccharomyces cerevisiae EBY.VW4000. Transcriptional studies and deletion analysis in Y. lipolytica indicated that two genes, YHT1 and YHT4, are probably the main players in both strains, with a similar role in the uptake of glucose, fructose, and mannose at various concentrations. The other four genes appear to constitute a set of 'reservoir' hexose transporters with an as-yet unclear physiological role. Furthermore, through examining Sugar Porters of the entire Yarrowia clade, we show that they constitute a dynamic family, within which hexose transport genes have been duplicated and lost several times. Our phylogenetic analyses support the existence of at least three distinct evolutionary groups of transporters which allow yeasts to grow on hexoses. In addition to the well-known and widespread Hxt-type transporters (which are not essential in Y. lipolytica), we highlight a second group of transporters, represented by Yht1, which are phylogenetically related to sensors that play a regulatory role in S. cerevisiae, and a third group, represented by Yht4, previously thought to contain only high-affinity glucose transporters related to Hgt1of Kluyveromyces lactis. Copyright © 2017

  3. Atmospherical experiment in Angra I plant for characterizing the effluent transport threw in the atmospheric; Experimento atmosferico no local da Usina Angra I para caracterizar o transporte de efluentes lancados na atmosfera

    Energy Technology Data Exchange (ETDEWEB)

    Silva Lobo, M.A. da [FURNAS, Rio de Janeiro, RJ (Brazil); Kronemberger, B M.E.

    1990-12-31

    Available as short communication only. The Environmental Safety Division of the Nuclear Safety and Fuel Department from FURNAS Electric Station S.A. joint with the National Oceanic and Atmospheric Administration (NOAA), achieved a field experiment for characterizing the atmospheric transport and diffusion in the site complex of Angra I Nuclear Power Plant. The complex topography with the thick vegetation and the neighbour building bring problems for the modelling of the effluent transport and the dispersion. The actual meteorological measure system is automatic and compound with four towers. An intensive atmospheric measure with captive balloon is included, and the collected data shows that the site flux is strongly influenced by the topography and insolation. (C.G.C.). 2 figs.

  4. Genome-wide identification, characterization and phylogenetic analysis of 50 catfish ATP-binding cassette (ABC) transporter genes.

    Science.gov (United States)

    Liu, Shikai; Li, Qi; Liu, Zhanjiang

    2013-01-01

    Although a large set of full-length transcripts was recently assembled in catfish, annotation of large gene families, especially those with duplications, is still a great challenge. Most often, complexities in annotation cause mis-identification and thereby much confusion in the scientific literature. As such, detailed phylogenetic analysis and/or orthology analysis are required for annotation of genes involved in gene families. The ATP-binding cassette (ABC) transporter gene superfamily is a large gene family that encodes membrane proteins that transport a diverse set of substrates across membranes, playing important roles in protecting organisms from diverse environment. In this work, we identified a set of 50 ABC transporters in catfish genome. Phylogenetic analysis allowed their identification and annotation into seven subfamilies, including 9 ABCA genes, 12 ABCB genes, 12 ABCC genes, 5 ABCD genes, 2 ABCE genes, 4 ABCF genes and 6 ABCG genes. Most ABC transporters are conserved among vertebrates, though cases of recent gene duplications and gene losses do exist. Gene duplications in catfish were found for ABCA1, ABCB3, ABCB6, ABCC5, ABCD3, ABCE1, ABCF2 and ABCG2. The whole set of catfish ABC transporters provide the essential genomic resources for future biochemical, toxicological and physiological studies of ABC drug efflux transporters. The establishment of orthologies should allow functional inferences with the information from model species, though the function of lineage-specific genes can be distinct because of specific living environment with different selection pressure.

  5. Identification and characterization of calcium transporter gene family in finger millet in relation to grain calcium content.

    Science.gov (United States)

    Singh, Uma M; Metwal, Mamta; Singh, Manoj; Taj, Gohar; Kumar, Anil

    2015-07-15

    Calcium (Ca) is an essential mineral for proper growth and development of plants as well as animals. In plants including cereals, calcium is deposited in seed during its development which is mediated by specialized Ca transporters. Common cereal seeds contain very low amounts of Ca while the finger millet (Eleusine coracana) contains exceptionally high amounts of Ca in seed. In order to understand the role of Ca transporters in grain Ca accumulation, developing seed transcriptome of two finger millet genotypes (GP-1, low Ca and GP-45 high Ca) differing in seed Ca content was sequenced using Illumina paired-end sequencing technology and members of Ca transporter gene family were identified. Out of 109,218 and 120,130 contigs, 86 and 81 contigs encoding Ca transporters were identified in GP-1 and GP-45, respectively. After removal of redundant sequences, a total of 19 sequences were confirmed as Ca transporter genes, which includes 11 Ca(2+) ATPases, 07 Ca(2+)/cation exchangers and 01 Ca(2+) channel. The differential expressions of all genes were analyzed from transcriptome data and it was observed that 9 and 3 genes were highly expressed in GP-45 and GP-1 genotypes respectively. Validation of transcriptome expression data of selected Ca transporter genes was performed on different stages of developing spikes of both genotypes grown under different concentrations of exogenous Ca. In both genotypes, significant correlation was observed between the expression of these genes, especially EcCaX3, and on the amount of Ca accumulated in seed. The positive correlation of seed mass with the amount of Ca concentration was also observed. The efficient Ca transport property and responsiveness of EcCAX3 towards exogenous Ca could be utilized in future biofortification program. Copyright © 2015 Elsevier B.V. All rights reserved.

  6. Cloning, Expression, and Characterization of Sorbitol Transporters from Developing Sour Cherry Fruit and Leaf Sink Tissues1

    Science.gov (United States)

    Gao, Zhifang; Maurousset, Laurence; Lemoine, Remi; Yoo, Sang-Dong; van Nocker, Steven; Loescher, Wayne

    2003-01-01

    The acyclic polyol sorbitol is a primary photosynthetic product and the principal photosynthetic transport substance in many economically important members of the family Rosaceace (e.g. almond [Prunus dulcis (P. Mill.) D.A. Webber], apple [Malus pumila P. Mill.], cherry [Prunus spp.], peach [Prunus persica L. Batsch], and pear [Pyrus communis]). To understand key steps in long-distance transport and particularly partitioning and accumulation of sorbitol in sink tissues, we have cloned two sorbitol transporter genes (PcSOT1 and PcSOT2) from sour cherry (Prunus cerasus) fruit tissues that accumulate large quantities of sorbitol. Sorbitol uptake activities and other characteristics were measured by heterologous expression of PcSOT1 and PcSOT2 in yeast (Saccharomyces cerevisiae). Both genes encode proton-dependent, sorbitol-specific transporters with similar affinities (Km sorbitol of 0.81 mm for PcSOT1 and 0.64 mm for PcSOT2). Analyses of gene expression of these transporters, however, suggest different roles during leaf and fruit development. PcSOT1 is expressed throughout fruit development, but especially when growth and sorbitol accumulation rates are highest. In leaves, PcSOT1 expression is highest in young, expanding tissues, but substantially less in mature leaves. In contrast, PcSOT2 is mainly expressed only early in fruit development and not in leaves. Compositional analyses suggest that transport mediated by PcSOT1 and PcSOT2 plays a major role in sorbitol and dry matter accumulation in sour cherry fruits. Presence of these transporters and the high fruit sorbitol concentrations suggest that there is an apoplastic step during phloem unloading and accumulation in these sink tissues. Expression of PcSOT1 in young leaves before completion of the transition from sink to source is further evidence for a role in determining sink activity. PMID:12692316

  7. School Uniform Policies in Public Schools

    Science.gov (United States)

    Brunsma, David L.

    2006-01-01

    The movement for school uniforms in public schools continues to grow despite the author's research indicating little if any impact on student behavior, achievement, and self-esteem. The author examines the distribution of uniform policies by region and demographics, the impact of these policies on perceptions of school climate and safety, and…

  8. School Uniform Policies: Students' Views of Effectiveness.

    Science.gov (United States)

    McCarthy, Teresa M.; Moreno, Josephine

    2001-01-01

    Focus-group interviews of New York City middle-school students about their perceptions of the effectiveness of the school-uniform policy. Finds that students' perceptions of the effects of school-uniform policy on school culture varied considerably with those intended by the principal. (Contains 40 references.) (PKP)

  9. School Uniforms and Discourses on Childhood.

    Science.gov (United States)

    Bodine, Ann

    2003-01-01

    This ethnographic study examined the introduction of school uniforms in the public schools of one California city. Findings indicated that the uniform issue intersected with issues such as student safety and violence, family stress, egalitarianism, competitive dressing, and a power struggle over shaping the childhood environment. It was concluded…

  10. Student Dress Codes and Uniforms. Research Brief

    Science.gov (United States)

    Johnston, Howard

    2009-01-01

    According to an Education Commission of the States "Policy Report", research on the effects of dress code and school uniform policies is inconclusive and mixed. Some researchers find positive effects; others claim no effects or only perceived effects. While no state has legislatively mandated the wearing of school uniforms, 28 states and…

  11. School Dress Codes and Uniform Policies.

    Science.gov (United States)

    Anderson, Wendell

    2002-01-01

    Opinions abound on what students should wear to class. Some see student dress as a safety issue; others see it as a student-rights issue. The issue of dress codes and uniform policies has been tackled in the classroom, the boardroom, and the courtroom. This Policy Report examines the whole fabric of the debate on dress codes and uniform policies…

  12. A School Uniform Program That Works.

    Science.gov (United States)

    Loesch, Paul C.

    1995-01-01

    According to advocates, school uniforms reduce gang influence, decrease families' clothing expenditures, and help mitigate potentially divisive cultural and economic differences. Aiming to improve school climate, a California elementary school adopted uniforms as a source of pride and affiliation. This article describes the development of the…

  13. Devaney's chaos on uniform limit maps

    International Nuclear Information System (INIS)

    Yan Kesong; Zeng Fanping; Zhang Gengrong

    2011-01-01

    Highlights: → The transitivity may not been inherited even if the sequence functions mixing. → The sensitivity may not been inherited even if the iterates of sequence have some uniform convergence. → Some equivalence conditions for the transitivity and sensitivity for uniform limit function are given. → A non-transitive sequence may converge uniformly to a transitive map. - Abstract: Let (X, d) be a compact metric space and f n : X → X a sequence of continuous maps such that (f n ) converges uniformly to a map f. The purpose of this paper is to study the Devaney's chaos on the uniform limit f. On the one hand, we show that f is not necessarily transitive even if all f n mixing, and the sensitive dependence on initial conditions may not been inherited to f even if the iterates of the sequence have some uniform convergence, which correct two wrong claims in . On the other hand, we give some equivalence conditions for the uniform limit f to be transitive and to have sensitive dependence on initial conditions. Moreover, we present an example to show that a non-transitive sequence may converge uniformly to a transitive map.

  14. Growth functions for some uniformly amenable groups

    Directory of Open Access Journals (Sweden)

    Dronka Janusz

    2017-04-01

    Full Text Available We present a simple constructive proof of the fact that every abelian discrete group is uniformly amenable. We improve the growth function obtained earlier and find the optimal growth function in a particular case. We also compute a growth function for some non-abelian uniformly amenable group.

  15. On Uniform Exponential Trichotomy in Banach Spaces

    Directory of Open Access Journals (Sweden)

    Kovacs Monteola Ilona

    2014-06-01

    Full Text Available In this paper we consider three concepts of uniform exponential trichotomy on the half-line in the general framework of evolution operators in Banach spaces. We obtain a systematic classification of uniform exponential trichotomy concepts and the connections between them.

  16. Controlling of density uniformity of polyacrylate foams

    International Nuclear Information System (INIS)

    Shan Wenwen; Yuan Baohe; Wang Yanhong; Xu Jiayun; Zhang Lin

    2010-01-01

    The density non-uniformity existing in most low-density foams will affect performance of the foams. The trimethylolpropane trimethacrylate (TMPTA) foam targets were prepared and controlling methods of the foams, density uniformity were explored together with its forming mechanism. It has been found that the UV-light with high intensity can improve the distribution uniformity of the free radicals induced by UV photons in the solvents, thus improve the density uniformity of the foams. In addition, container wall would influence the concentration distribution of the solution, which affects the density uniformity of the foams. Thus, the UV-light with high intensity was chosen together with polytetrafluoroethylene molds instead of glass molds to prepare the foams with the density non-uniformity less than 10%. β-ray detection technology was used to measure the density uniformity of the TMPTA foams with the density in the range of 10 to 100 mg · cm -3 , and the results show that the lower the foam density is, the worse the density uniformity is. (authors)

  17. A Uniform Syntax and Discourse Structure

    DEFF Research Database (Denmark)

    Hardt, Daniel

    2013-01-01

    I present arguments in favor of the Uniformity Hypothesis: the hypothesis that discourse can extend syntax dependencies without conflicting with them. I consider arguments that Uniformity is violated in certain cases involving quotation, and I argue that the cases presented in the literature...

  18. Characterization of materials for a reactive transport model validation experiment: Interim report on the caisson experiment. Yucca Mountain Site Characterization Project

    International Nuclear Information System (INIS)

    Siegel, M.D.; Cheng, W.C.; Ward, D.B.; Bryan, C.R.

    1995-08-01

    Models used in performance assessment and site characterization activities related to nuclear waste disposal rely on simplified representations of solute/rock interactions, hydrologic flow field and the material properties of the rock layers surrounding the repository. A crucial element in the design of these models is the validity of these simplifying assumptions. An intermediate-scale experiment is being carried out at the Experimental Engineered Test Facility at Los Alamos Laboratory by the Los Alamos and Sandia National Laboratories to develop a strategy to validate key geochemical and hydrological assumptions in performance assessment models used by the Yucca Mountain Site Characterization Project

  19. Characterization of materials for a reactive transport model validation experiment: Interim report on the caisson experiment. Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Siegel, M.D.; Cheng, W.C. [Sandia National Labs., Albuquerque, NM (United States); Ward, D.B.; Bryan, C.R. [Univ. of New Mexico, Albuquerque, NM (United States). Dept. of Earth and Planetary Sciences

    1995-08-01

    Models used in performance assessment and site characterization activities related to nuclear waste disposal rely on simplified representations of solute/rock interactions, hydrologic flow field and the material properties of the rock layers surrounding the repository. A crucial element in the design of these models is the validity of these simplifying assumptions. An intermediate-scale experiment is being carried out at the Experimental Engineered Test Facility at Los Alamos Laboratory by the Los Alamos and Sandia National Laboratories to develop a strategy to validate key geochemical and hydrological assumptions in performance assessment models used by the Yucca Mountain Site Characterization Project.

  20. Characterization of active ion transport across primary rabbit corneal epithelial cell layers (RCrECL) cultured at an air-interface.

    Science.gov (United States)

    Chang-Lin, Joan-En; Kim, Kwang-Jin; Lee, Vincent H L

    2005-06-01

    Previously, we reported the development of a primary culture model of tight rabbit corneal epithelial cell layers (RCrECL) characterizing bioelectric parameters, morphology, cytokeratin, and passive permeability. In the present study, we specifically evaluated the active ion transport processes of RCrECL cultured from either pigmented or albino rabbits. Primary cultured RCrECL were grown at an air-interface on Clear-Snapwells precoated with collagen/fibronectin/laminin and mounted in a modified Ussing-type chamber for the evaluation of their active ion transport processes under short-circuited conditions. Contribution of active Na(+) and Cl(-) transport to overall short-circuit current (I(sc)) was evaluated by removing Na(+) and Cl(-), respectively, from bathing fluids of RCrECL and measurements of net fluxes of Na(+) and Cl(-) using (22)Na and (36)Cl, respectively. Amiloride and benzamil were used to determine the role of apical Na(+)-channel activities to net Na(+) fluxes. N-phenylanthranilic acid (NPAA), ouabain, BaCl(2) and bumetanide were used to determine the role of basolateral Na,K-ATPase, apical Cl(-)-channel, and basolateral K(+)-channel and Na(+)(K(+))2Cl(-)-cotransporter activities, respectively, in active ion transport across RCrECL. I(sc) of RCrECL derived from pigmented rabbits was comprised of 64+/-2% and 44+/-5% for active Na(+) and Cl(-) transport, respectively, consistent with net Na(+) absorption and Cl(-) secretion of 0.062+/-0.006 and 0.046+/-0.008 muEq/cm(2)/hr estimated from radionuclide fluxes. Apical amiloride and benzamil inhibited I(sc) by up to approximately 50% with an IC(50) of 1 and 0.1 microm, respectively, consistent with participation of apical epithelial Na(+)-channels to net Na(+) absorption across RCrECL cultured from pigmented rabbits. Addition of ouabain to the basolateral, NPAA to the apical, BaCl(2) to the basolateral and bumetanide to basolateral fluid decreased I(sc) by 86+/-1.5%, 53+/-3%, 18+/-1.8% and 13+/-1.9% in RCr

  1. Expression, purification and functional characterization of human equilibrative nucleoside transporter subtype-1 (hENT1) protein from Sf9 insect cells.

    Science.gov (United States)

    Rehan, Shahid; Jaakola, Veli-Pekka

    2015-10-01

    Human equilibrative nucleoside transporter-1 (hENT1) is the major plasma membrane transporter involved in transportation of natural nucleosides as well as nucleoside analog drugs, used in anti-cancer and anti-viral therapies. Despite extensive biochemical and pharmacological studies, little is known about the structure-function relationship of this protein. The major obstacles to purification include a low endogenous expression level, the lack of an efficient expression and purification protocol, and the hydrophobic nature of the protein. Here, we report protein expression, purification and functional characterization of hENT1 from Sf9 insect cells. hENT1 expressed by Sf9 cells is functionally active as demonstrated by saturation binding with a Kd of 1.2±0.2nM and Bmax of 110±5pmol/mg for [(3)H]nitrobenzylmercaptopurine ribonucleoside ([(3)H]NBMPR). We also demonstrate purification of hENT1 using FLAG antibody affinity resin in lauryl maltose neopentyl glycol detergent with a Kd of 4.3±0.7nM. The yield of hENT1 from Sf9 cells was ∼0.5mg active transporter per liter of culture. The purified protein is functionally active, stable, homogenous and appropriate for further biophysical and structural studies. Copyright © 2015 Elsevier Inc. All rights reserved.

  2. Determination of S-methyl-L-methionine (SMM) from Brassicaceae Family Vegetables and Characterization of the Intestinal Transport of SMM by Caco-2 Cells.

    Science.gov (United States)

    Song, Ji-Hoon; Lee, Hae-Rim; Shim, Soon-Mi

    2017-01-01

    The objectives of the current study were to determine S-methyl-L-methionine (SMM) from various Brassicaceae family vegetables by using validated analytical method and to characterize the intestinal transport mechanism of SMM by the Caco-2 cells. The SMM is well known to provide therapeutic activity in peptic ulcers. The amount of SMM from various Brassicaceae family vegetables ranged from 89.08 ± 1.68 μg/g to 535.98 ± 4.85 μg/g of dry weight by using validated ultra-performance liquid chromatography-electrospray ionization-mass spectrometry method. For elucidating intestinal transport mechanism, the cells were incubated with or without transport inhibitors, energy source, or a metabolic inhibitor. Phloridzin and verapamil as inhibitors of sodium glucose transport protein (SGLT1) and P-glycoprotein, respectively, were not responsible for cellular uptake of SMM. Glucose and sodium azide were not affected by the cellular accumulation of SMM. The efflux ratio of SMM was 0.26, implying that it is not effluxed through Caco-2 cells. The apparent coefficient permeability (P app ) of SMM was 4.69 × 10 -5 cm/s, indicating that it will show good oral absorption in in vivo. © 2016 Institute of Food Technologists®.

  3. Predictions of tracer transport in interwell tracer tests at the C-Hole complex. Yucca Mountain site characterization project report milestone 4077

    International Nuclear Information System (INIS)

    Reimus, P.W.

    1996-09-01

    This report presents predictions of tracer transport in interwell tracer tests that are to be conducted at the C-Hole complex at the Nevada Test Site on behalf of the Yucca Mountain Site Characterization Project. The predictions are used to make specific recommendations about the manner in which the tracer test should be conducted to best satisfy the needs of the Project. The objective of he tracer tests is to study flow and species transport under saturated conditions in the fractured tuffs near Yucca Mountain, Nevada, the site of a potential high-level nuclear waste repository. The potential repository will be located in the unsaturated zone within Yucca Mountain. The saturated zone beneath and around the mountain represents the final barrier to transport to the accessible environment that radionuclides will encounter if they breach the engineered barriers within the repository and the barriers to flow and transport provided by the unsaturated zone. Background information on the C-Holes is provided in Section 1.1, and the planned tracer testing program is discussed in Section 1.2

  4. Development and optimization of radiographic and tomographic methods for characterization of water transport processes in PEM fuel cell materials

    International Nuclear Information System (INIS)

    Markoetter, Henning

    2013-01-01

    Water transport in polymer electrolyte membrane fuel cells (PEMFC) was non-destructively studied during operation with synchrotron X-ray radiography and tomography. The focus was set on the influence of the three-dimensional morphology of the cell materials on the water distribution and transport. Water management is still one of the mayor issues in PEMFC research. If the fuel cell is too dry, the proton conductivity (of the membrane) decreases leading to a performance loss and, in the worst case, to an irreversible damage of the membrane. On the other hand, the presence of water hinders the gas supply and causes a decrease in the cell performance. For this reason, effective water transport is a prerequisite for successful fuel cell operation. In this work the three-dimensional water transport through the gas diffusion layer (GDL) and its correlated with the 3D morphology of the cell materials has been revealed for the first time. It was shown that water is transported preferably through only a few larger pores which form transport paths of low resistance. This effect is pronounced because of the hydrophobic properties of the employed materials. In addition, water transport was found to be bidirectional, i. e. at appropriate locations a back and forth transport between GDL and flow field channels was observed. Furthermore, liquid water in the GDL was found to agglomerate preferably at the ribs of the flow field. This can be explained by condensation due to a temperature gradient in the cell and by the position, which is sheltered from the gas flow. Larger water accumulations in the gas supply channels were mainly attached to the channel wall opposing the GDL. The gas flow can bypass these agglomerations allowing a continuous gas supply. Moreover, it was shown that randomly distributed cracks in the micro porous layers (MPL) play an important role for the agglomeration of liquid water as they form preferred low resistance transport paths. In this work also

  5. Identification and Characterization of RibN, a Novel Family of Riboflavin Transporters from Rhizobium leguminosarum and Other Proteobacteria

    Science.gov (United States)

    García Angulo, Víctor A.; Bonomi, Hernán R.; Posadas, Diana M.; Serer, María I.; Torres, Alfredo G.; Zorreguieta, Ángeles

    2013-01-01

    Rhizobia are symbiotic bacteria able to invade and colonize the roots of legume plants, inducing the formation of nodules, where bacteria reduce atmospheric nitrogen (N2) to ammonia (NH3). Riboflavin availability influences the capacity of rhizobia to survive in the rhizosphere and to colonize roots. In this study, we identified the RL1692 gene of Rhizobium leguminosarum downstream of a flavin mononucleotide (FMN) riboswitch. RL1692 encodes a putative transmembrane permease with two EamA domains. The presence of an FMN riboswitch regulating a transmembrane protein is usually observed in riboflavin transporters, suggesting that RL1692 may be involved in riboflavin uptake. The product of RL1692, which we named RibN, is conserved in members of the alpha-, beta-, and gammaproteobacteria and shares no significant identity with any riboflavin transporter previously identified. In this work, we show that RibN is localized in the membrane cellular fraction and its expression is downregulated by riboflavin. By heterologous expression in a Brucella abortus mutant auxotrophic for riboflavin, we demonstrate that RibN possesses flavin transport activity. Similarly, we also demonstrate that RibN orthologues from Ochrobactrum anthropi and Vibrio cholerae (which lacks the FMN riboswitch) are able to transport riboflavin. An R. leguminosarum ribN null mutant exhibited lower nodule occupancy levels in pea plants during symbiosis assays. Thus, we propose that RibN and its homologues belong to a novel family of riboflavin transporters. This work provides the first experimental description of riboflavin transporters in Gram-negative bacteria. PMID:23935051

  6. Immuno-detection of OCTN1 (SLC22A4) in HeLa cells and characterization of transport function.

    Science.gov (United States)

    Pochini, Lorena; Scalise, Mariafrancesca; Indiveri, Cesare

    2015-11-01

    OCTN1 was immuno-detected in the cervical cancer cell HeLa, in which the complete pattern of acetylcholine metabolizing enzymes is expressed. Comparison of immuno-staining intensity of HeLa OCTN1 with the purified recombinant human OCTN1 allowed measuring the specific OCTN1 concentration in the HeLa cell extract and, hence calculating the HeLa OCTN1 specific transport activity that was about 10 nmol×min(-1)×mg protein(-1), measured as uptake of [(3)H]acetylcholine in proteoliposomes reconstituted with HeLa extract. This value was very similar to the specific activity of the recombinant protein. Acetylcholine transport was suppressed by incubation of the protein or proteoliposomes with the anti-OCTN1 antibody and was strongly inhibited by PLP and MTSEA, known inhibitors of OCTN1. The absence of ATP in the internal side of proteoliposomes strongly impaired transport function of both the HeLa and, as expected, the recombinant OCTN1. HeLa OCTN1 was inhibited by spermine, NaCl (Na(+)), TEA, γ-butyrobetaine, choline, acetylcarnitine and ipratropium but not by neostigmine. Besides acetylcholine, choline was taken up by HeLa OCTN1 proteoliposomes. The transporter catalyzed also acetylcholine and choline efflux which, differently from uptake, was not inhibited by MTSEA. Time course of [(3)H]acetylcholine uptake in intact HeLa cells was measured. As in proteoliposomes, acetylcholine transport in intact cells was inhibited by TEA and NaCl. Efflux of [(3)H]acetylcholine occurred in intact cells, as well. The experimental data concur in demonstrating a role of OCTN1 in transporting acetylcholine and choline in HeLa cells. Copyright © 2015 Elsevier B.V. All rights reserved.

  7. Synthesis, Characterization and Transport Properties of Novel Ion-exchange Nanocomposite Membrane Containing In-situ Formed ZnO Nanoparticles

    Directory of Open Access Journals (Sweden)

    F. Heidary

    2015-10-01

    Full Text Available A  new  type  of  cation-exchange  nanocomposite  membranes  was prepared  by  in-situ  formation  of  ZnO  nanoparticles  in  a  blend containing  sulfonated  poly  (2,6-dimethyl-1,4-phenylene  oxide  and sulfonated polyvinylchloride  via  a  simple  one-step  chemical method.  As-synthesized  nanocomposite  membranes were characterized  using  Fourier  transform  infrared  spectroscopy, scanning  electron  microscopy  and X-ray  diffraction.  The  SEM images  showed  that  ZnO  nanoparticles  were  uniformly  dispersed throughout the polymeric matrices. The effect of additive loading on physicochemical and electrochemical properties of prepared cation-exchange  nanocomposite  membranes  was  studied.  Various characterizations revealed that  the  incorporation  of  different amounts  of  ZnO  nanoparticles  into  the  basic  membrane  structure had a significant influence on the membrane performance and could improve the electrochemical properties.

  8. Pharmacological characterization of human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 in a fluorescence-based membrane potential assay

    DEFF Research Database (Denmark)

    Jensen, Anders A.; Bräuner-Osborne, Hans

    2004-01-01

    We have expressed the human excitatory amino acid transporters EAAT1, EAAT2 and EAAT3 stably in HEK293 cells and characterized the transporters pharmacologically in a conventional [(3) H]-d-aspartate uptake assay and in a fluorescence-based membrane potential assay, the FLIPR Membrane Potential...... (FMP) assay. The K(m) and K(i) values obtained for 12 standard EAAT ligands at EAAT1, EAAT2 and EAAT3 in the FMP assay correlated well with the K(i) values obtained in the [(3) H]-d-aspartate assay (r(2) values of 0.92, 0.92, and 0.95, respectively). Furthermore, the pharmacological characteristics...

  9. Characterization of temperature-dependent carrier transport in disordered indium-tin-oxide/poly (3,4-ethylenedioxythiophene):poly(styrenesulfonate)/polyfluorene/Ca/Al polymer structures

    International Nuclear Information System (INIS)

    Jiang, Joe-Air; Wang, Jen-Cheng; Fang, Chia-Hui; Wu, Ya-Fen; Teng, Jen-Wei; Chen, Yu-Ting; Fan, Ping-Lin; Nee, Tzer-En

    2011-01-01

    The temperature-dependent electrical characteristics of polyfluorene-based polymer structures over a temperature range from 200 to 300 K are systematically investigated in this study. Initially, using the definitions of the Berthelot-type model, it is found that the sample exhibits a higher Berthelot-type temperature T B with high driving voltage, indicating that carrier transport in a disordered system manifests Berthelot-type behaviors. The ideal current density-voltage curve for the polymer structures given the carrier transmit mechanism is further elucidated by taking into account the ohmic conduction, trap charge limited current, and Mott and Gurney model of space charge limited current. The proposed procedure is simple and can be used to characterize the material with reasonable accuracy. We also study the density of the traps H t , and the characteristic energy of the distribution E t to better understand the carrier-transport process in organic materials and structures.

  10. In situ characterization of the film coverage and the charge transport in the alkylated-organic thin film transistor

    Science.gov (United States)

    Watanabe, Takeshi; Koganezawa, Tomoyuki; Kikuchi, Mamoru; Muraoka, Hiroki; Ogawa, Satoshi; Yoshimoto, Noriyuki; Hirosawa, Ichiro

    2018-03-01

    We propose an in situ experimental method of investigating the correlations of the film coverage of the organic semiconductor layers and charge transport properties of organic thin film transistors during vacuum deposition. The coverage of each monolayer was estimated using the intensity of off-specular diffuse scattering and diffraction. Experimental data were obtained from the in situ measurements of two-dimensional grazing incidence X-ray scattering and charge transport. The source-drain current increased over the film coverage of the first monolayer (= 0.48). This is in agreement with the critical percolation coverage, indicating that the conductivities of the first and second monolayers are different.

  11. Characterization of the ZAT1p zinc transporter from Arabidopsis thaliana in microbial model organisms and reconstituted proteoliposomes.

    Science.gov (United States)

    Bloss, Tanja; Clemens, Stephan; Nies, Dietrich H

    2002-03-01

    The ZAT1p zinc transporter from Arabidopsis thaliana (L.) Heynh. is a member of the cation diffusion facilitator (CDF) protein family. When heterologously expressed in Escherichia coli, ZAT1p bound zinc in a metal blot. Binding of zinc occurred mainly to the hydrophilic amino acid region from H182 to H232. A ZAT1p/ZAT1p*Delta(M1-I25) protein mixture was purified and reconstituted into proteoliposomes. Uptake of zinc into the proteoliposomes did not require a proton gradient across the liposomal membrane. ZAT1p did not transport cobalt, and transported cadmium at only 1% of the zinc transport rate. ZAT1p functioned as an uptake system for 65Zn2+ in two strains of the Gram-negative bacterium Ralstonia metallidurans, which were different in their content of zinc-efflux systems. The ZAT1 gene did not rescue increased zinc sensitivity of a Delta ZRC1single-mutant strain or of a Delta ZRC1 Delta COT1 double-mutant strain of Saccharomyces cerevisiae, but ZAT1 complemented this phenotype in a Delta SpZRC1 mutant strain of Schizosaccharomyces pombe.

  12. Topology mapping to characterize cyanobacterial bicarbonate transporters: BicA (SulP/SLC26 family) and SbtA.

    Science.gov (United States)

    Price, G Dean; Howitt, Susan M

    2014-09-01

    This mini-review addresses advances in understanding the transmembrane topologies of two unrelated, single-subunit bicarbonate transporters from cyanobacteria, namely BicA and SbtA. BicA is a Na(+)-dependent bicarbonate transporter that belongs to the SulP/SLC26 family that is widespread in both eukaryotes and prokaryotes. Topology mapping of BicA via the phoA/lacZ fusion reporter method identified 12 transmembrane helices with an unresolved hydrophobic region just beyond helix 8. Re-interpreting this data in the light of a recent topology study on rat prestin leads to a consensus topology of 14 transmembrane domains with a 7+7 inverted repeat structure. SbtA is also a Na(+)-dependent bicarbonate transporter, but of considerably higher affinity (Km 2-5 μM versus >100 μM for BicA). Whilst SbtA is widespread in cyanobacteria and a few bacteria, it appears to be absent from eukaryotes. Topology mapping of SbtA via the phoA/lacZ fusion reporter method identified 10 transmembrane helices. The topology consists of a 5+5 inverted repeat, with the two repeats separated by a large intracellular loop. The unusual location of the N and C-termini outside the cell raises the possibility that SbtA forms a novel fold, not so far identified by structural and topological studies on transport proteins.

  13. Yucca Mountain transportation routes: Preliminary characterization and risk analysis; Volume 2, Figures [and] Volume 3, Technical Appendices

    Energy Technology Data Exchange (ETDEWEB)

    Souleyrette, R.R. II; Sathisan, S.K.; di Bartolo, R. [Nevada Univ., Las Vegas, NV (United States). Transportation Research Center

    1991-05-31

    This report presents appendices related to the preliminary assessment and risk analysis for high-level radioactive waste transportation routes to the proposed Yucca Mountain Project repository. Information includes data on population density, traffic volume, ecologically sensitive areas, and accident history.

  14. Transport pathways in the malaria-infected erythrocyte: characterization and their use as potential targets for chemotherapy

    Directory of Open Access Journals (Sweden)

    Hagai Ginsburg

    1994-01-01

    Full Text Available The intraerythrocytic malarial parasite is involved in an extremely intensive anabolic activity while it resides in its metabolically quiescent host cell. The necessary fast uptake of nutrients and the discharge of waste product, are guaranteed by parasite-induced alterations of the constitutive transporters of the host cell and the production of new parallel pathways. The membrane of the host cell thus becomes permeable to phospholipids, purine bases and nucleosides, small non-electrolytes, anions and cations. When the new pathways are quantitatively unimportant, classical inhibitors of native transporters can be used to inhibit parasite growth. Several compounds were found to effectively inhibit the new pathways and consequently, parasite growth. The pathways have also been used to introduce cytotoxic agents. The parasitophorous membrane consists of channels which are highly permeable to small solutes and display no ion selectivity. Transport of some cations and anions across the parasite membrane is rapid and insensitive to classical inhibitors, and in some cases it is mediated by specific antiporters which respond to their respective inhibitors. Macromolecules have been shown to reach the parasitophorous space through a duct contiguous with the host cell membrane, and subsequently to be endocytosed at the parasite membrane. The simultaneous presence of the parasitophorous membrane channels and the duct, however, is incompatible with experimental evidences. No specific inhibitors were found as yet that would efficiently inhibit transport through the channels or the duct.

  15. Genome-Wide Characterization and Expression Profiling of Sugar Transporter Family in the Whitefly, Bemisia tabaci (Gennadius (Hemiptera: Aleyrodidae

    Directory of Open Access Journals (Sweden)

    Zezhong Yang

    2017-05-01

    Full Text Available Sugar transporters (STs play pivotal roles in the growth, development, and stress responses of phloem-sucking insects, such as the whitefly, Bemisia tabaci. In this study, 137 sugar transporters (STs were identified based on analysis of the genome and transcriptome of B. tabaci MEAM1. B. tabaci MEAM1 encodes a larger number of STs than other selected insects. Phylogenetic and molecular evolution analysis showed that the 137 STs formed three expanded clades and that the genes in Sternorrhyncha expanded clades had accelerated rates of evolution. B. tabaci sugar transporters (BTSTs were divided into three groups based on their expression profiles across developmental stages; however, no host-specific BTST was found in B. tabaci fed on different host plants. Feeding of B. tabaci adults with feeding diet containing dsRNA significantly reduced the transcript level of the target genes in B. tabaci and mortality was significantly improved in B. tabaci fed on dsRNA compared to the control, which indicates the sugar transporters may be used as potential RNAi targets for B. tabaci bio-control. These results provide a foundation for further studies of STs in B. tabaci.

  16. Universal method for effusive-flow characterization target ion source/vapor transport systems for radioactive ion beam generation (abstract)

    International Nuclear Information System (INIS)

    Alton, G.D.; Bilheux, J.-C.; Liu, Y.; Cole, J. A.; Williams, C.

    2004-01-01

    Worldwide interest in the use of accelerated radioactive ion beams (RIBs) for exploring reactions important in understanding the structure of the nucleus and nuclear astrophysical phenomena has motivated the construction of facilities dedicated to their production and acceleration. Many facilities utilize the isotope-separator-on-line (ISOL) method in which species of interest are generated within a solid or liquid target matrix. Experimentally useful RIBs are often difficult to generate by this technique because of the times required for diffusion from the interior of the target material, and to effusively transport the species of interest to the ion source following diffusion release in relation to its lifetime. Therefore, these delay times must be minimized. We have developed an experimental method that can be used to determine effusive-flow times of arbitrary geometry target/vapor transport systems. The technique utilizes a fast valve to measure effusive-flow times as short as 0.1 ms for any chemically active or inactive species through any target system, independent of size, geometry and materials of construction. In this report, we provide a theoretical basis for effusive flow through arbitrary geometry vapor transport systems, describe a universal experimental apparatus for measuring effusive-flow times, and provide time spectra for noble gases through prototype RIB target/vapor-transport systems

  17. Used Nuclear Fuel Loading and Structural Performance Under Normal Conditions of Transport- Demonstration of Approach and Results on Used Fuel Performance Characterization

    Energy Technology Data Exchange (ETDEWEB)

    Adkins, Harold [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Geelhood, Ken [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Koeppel, Brian [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Coleman, Justin [Idaho National Lab. (INL), Idaho Falls, ID (United States); Bignell, John [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Flores, Gregg [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Wang, Jy-An [Oak Ridge National Lab. (ORNL), Oak Ridge, TN (United States); Sanborn, Scott [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Spears, Robert [Idaho National Lab. (INL), Idaho Falls, ID (United States); Klymyshyn, Nick [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)

    2013-09-30

    This document addresses Oak Ridge National Laboratory milestone M2FT-13OR0822015 Demonstration of Approach and Results on Used Nuclear Fuel Performance Characterization. This report provides results of the initial demonstration of the modeling capability developed to perform preliminary deterministic evaluations of moderate-to-high burnup used nuclear fuel (UNF) mechanical performance under normal conditions of storage (NCS) and normal conditions of transport (NCT) conditions. This report also provides results from the sensitivity studies that have been performed. Finally, discussion on the long-term goals and objectives of this initiative are provided.

  18. Aespoe HRL - Geoscientific evaluation 1997/4. Results from pre-investigation and detailed site characterization. Comparison of predictions and observations. Hydrogeology, groundwater chemistry and transport of solutes

    Energy Technology Data Exchange (ETDEWEB)

    Rhen, I; Gustafson, Gunnar [VBB Viak AB, Goeteborg (Sweden); Wikberg, P [Swedish Nuclear Fuel and Waste Management Co., Stockholm (Sweden)

    1997-06-01

    The pre-investigations for the Aespoe Hard Rock Laboratory were started in 1986 and involved extensive field measurements, aimed at characterizing the rock formations with regard to geology, hydrogeology, hydrochemistry and rock mechanics. Prior to the excavation in 1990 predictions were made for the excavation phase concerning: geology, ground water flow and chemistry, transport of solutes and mechanical stability. This report presents a comparison between these predictions and the observations made during the excavation. Also, investigation methods for the 700-2874 m sections of the tunnel are evaluated. 157 refs, 190 figs, 37 tabs.

  19. Aespoe HRL - Geoscientific evaluation 1997/4. Results from pre-investigation and detailed site characterization. Comparison of predictions and observations. Hydrogeology, groundwater chemistry and transport of solutes

    International Nuclear Information System (INIS)

    Rhen, I.; Gustafson, Gunnar; Wikberg, P.

    1997-06-01

    The pre-investigations for the Aespoe Hard Rock Laboratory were started in 1986 and involved extensive field measurements, aimed at characterizing the rock formations with regard to geology, hydrogeology, hydrochemistry and rock mechanics. Prior to the excavation in 1990 predictions were made for the excavation phase concerning: geology, ground water flow and chemistry, transport of solutes and mechanical stability. This report presents a comparison between these predictions and the observations made during the excavation. Also, investigation methods for the 700-2874 m sections of the tunnel are evaluated

  20. In vitro characterization of cadmium transport along the gastro-intestinal tract of freshwater rainbow trout (Oncorhynchus mykiss)

    Energy Technology Data Exchange (ETDEWEB)

    Klinck, Joel S., E-mail: klinckjs@mcmaster.ca [Department of Biology, McMaster University, Hamilton, Ontario, L8S 4K1 (Canada); Wood, Chris M. [Department of Biology, McMaster University, Hamilton, Ontario, L8S 4K1 (Canada)

    2011-03-15

    An in vitro gut sac technique was used to examine the mechanism(s) of cadmium (Cd) uptake along the gastro-intestinal tract (GIT) of rainbow trout (Oncorhynchus mykiss). The spatial distribution of Cd between three compartments (mucus-binding, mucosal epithelium, and transport into blood space) was determined using a modified Cortland saline containing 50 {mu}M Cd (as CdCl{sub 2}) labeled with {sup 109}Cd radiotracer. Taking into account total surface areas, the order of relative importance for total Cd uptake rate was: posterior intestine > anterior intestine > stomach > mid intestine. Cd transport was not inhibited by experimentally reducing fluid transport rates by manipulation of osmotic gradients using mannitol, but was sensitive to internal luminal pressure changes, suggesting a mechanosensitive pathway. Q{sub 10} values (1, 11, and 19 {sup o}C) indicated a facilitated transport of Cd in the anterior- and mid-intestine. The effects of 10 mM Ca on the kinetics of Cd uptake suggest the presence of a common uptake pathway for Cd and Ca in the stomach, anterior-, and mid-intestine. Further evidence of a shared route of entry was found using three Ca channel blockers, lanthanum, verapamil, and nifedipine: both voltage-insensitive and voltage-sensitive Ca channels appear to be present in either some, or all portions of the GIT. Elevated Fe (500 {mu}M), Mg (50 mM), and Zn (500 {mu}M) showed varying degrees of inhibition of Cd transport depending on the compartment and segment of the GIT. Overall it appears that there are multiple sites, and mechanisms, of Cd uptake along the GIT of rainbow trout.

  1. In vitro characterization of cadmium transport along the gastro-intestinal tract of freshwater rainbow trout (Oncorhynchus mykiss)

    International Nuclear Information System (INIS)

    Klinck, Joel S.; Wood, Chris M.

    2011-01-01

    An in vitro gut sac technique was used to examine the mechanism(s) of cadmium (Cd) uptake along the gastro-intestinal tract (GIT) of rainbow trout (Oncorhynchus mykiss). The spatial distribution of Cd between three compartments (mucus-binding, mucosal epithelium, and transport into blood space) was determined using a modified Cortland saline containing 50 μM Cd (as CdCl 2 ) labeled with 109 Cd radiotracer. Taking into account total surface areas, the order of relative importance for total Cd uptake rate was: posterior intestine > anterior intestine > stomach > mid intestine. Cd transport was not inhibited by experimentally reducing fluid transport rates by manipulation of osmotic gradients using mannitol, but was sensitive to internal luminal pressure changes, suggesting a mechanosensitive pathway. Q 10 values (1, 11, and 19 o C) indicated a facilitated transport of Cd in the anterior- and mid-intestine. The effects of 10 mM Ca on the kinetics of Cd uptake suggest the presence of a common uptake pathway for Cd and Ca in the stomach, anterior-, and mid-intestine. Further evidence of a shared route of entry was found using three Ca channel blockers, lanthanum, verapamil, and nifedipine: both voltage-insensitive and voltage-sensitive Ca channels appear to be present in either some, or all portions of the GIT. Elevated Fe (500 μM), Mg (50 mM), and Zn (500 μM) showed varying degrees of inhibition of Cd transport depending on the compartment and segment of the GIT. Overall it appears that there are multiple sites, and mechanisms, of Cd uptake along the GIT of rainbow trout.

  2. Characterizing, for packaging and transport, large objects contaminated by radioactive material having a limited A2 value

    International Nuclear Information System (INIS)

    Pope, R.B.; Shappert, L.B.; Michelhaugh, R.D.; Cash, J.M.; Best, R.E.

    1998-02-01

    The International Atomic Energy Agency (IAEA) Regulations for the safe packaging and transportation of radioactive materials follow a graded approach to the requirements for both packaging and controls during transport. The concept is that, the lower the risk posed to the people and the environment by the contents, (1) the less demanding are the packaging requirements and (2) the smaller in number are the controls imposed on the transport of the material. There are likely to be a great number of situations arising in coming years when large objects, contaminated with radioactive material having unlimited A 2 values will result from various decommissioning and decontamination (D and D) activities and will then require shipment from the D and D site to a disposal site. Such situations may arise relatively frequently during the cleanup of operations involving mining, milling, feedstock, and uranium enrichment processing facilities. Because these objects are contaminated with materials having an unlimited A 2 value they present a low radiological risk to worker and public safety and to the environment during transport. However, when these radioactive materials reside on the surfaces of equipment and other large objects, where the equipment and objects themselves are not radioactive, the radioactive materials appear as surface contamination and, if the contaminated object is categorized as a surface contaminated object, it would need to be packaged for shipment according to the requirements of the Regulations for SCO. Despite this categorization, alternatives may be available which will allow these contaminants, when considered by themselves for packaging and transport, to be categorized as either (1) a limited quantity of radioactive material to be shipped in an excepted package or (2) low specific activity (LSA) materials to be shipped in an IP-1 package or possibly even shipped unpackaged. These options are discussed in this paper

  3. On Uniform Weak König's Lemma

    DEFF Research Database (Denmark)

    Kohlenbach, Ulrich

    2002-01-01

    The so-called weak Konig's lemma WKL asserts the existence of an infinite path b in any infinite binary tree (given by a representing function f). Based on this principle one can formulate subsystems of higher-order arithmetic which allow to carry out very substantial parts of classical mathematics...... which-relative to PRA -implies the schema of 10-induction). In this setting one can consider also a uniform version UWKL of WKL which asserts the existence of a functional which selects uniformly in a given infinite binary tree f an infinite path f of that tree. This uniform version of WKL...

  4. Characterization of an AtCCX5 gene from Arabidopsis thaliana that involves in high-affinity K+ uptake and Na+ transport in yeast

    International Nuclear Information System (INIS)

    Zhang, Xinxin; Zhang, Min; Takano, Tetsuo; Liu, Shenkui

    2011-01-01

    Highlights: → The AtCCX5 protein coding a putative cation calcium exchanger was characterized. → AtCCX5 expressed in yeast was localized in the plasma membrane and nuclear periphery. → AtCCX5 protein did not show the same transport properties as the CAXs. → AtCCX5 protein involves in mediating high-affinity K + uptake in yeast. → AtCCX5 protein also involves in Na + transport in yeast. -- Abstract: The gene for a putative cation calcium exchanger (CCX) from Arabidopsis thaliana, AtCCX5, was cloned and its function was analyzed in yeast. Green fluorescent protein-tagged AtCCX5 expressed in yeast was localized in the plasma membrane and nuclear periphery. The yeast transformants expressing AtCCX5 were created and their growth in the presence of various cations (K + , Na + , Ca 2+ , Mg 2+ , Fe 2+ , Cu 2+ , Co 2+ , Cd 2+ , Mn 2+ , Ba 2+ , Ni 2+ , Zn 2+ , and Li + ) were analyzed. AtCCX5 expression was found to affect the response to K + and Na + in yeast. The AtCCX5 transformant also showed a little better growth to Zn 2+ . The yeast mutant 9.3 expressing AtCCX5 restored growth of the mutant on medium with low K + (0.5 mM), and also suppressed its Na + sensitivity. Ion uptake experiments showed that AtCCX5 mediated relatively high-affinity K + uptake and was also involved in Na + transport in yeast. Taken together, these findings suggest that the AtCCX5 is a novel transport protein involves in mediating high-affinity K + uptake and Na + transport in yeast.

  5. Characterizing the annual cycle of African dust transport to the Caribbean Basin and South America and its impact on the environment and air quality

    Science.gov (United States)

    Prospero, Joseph M.; Collard, François-Xavier; Molinié, Jack; Jeannot, Alexis

    2014-07-01

    Decades of aerosol measurements on Barbados have yielded a detailed picture of African mineral dust transport to the Caribbean Basin that shows a strong seasonal cycle with a maximum in boreal summer and a minimum in winter. Satellite aerosol products suggest that in spring, there is a comparable transport to northeastern South America. Here we characterize the complete annual cycle of dust transport to the western Atlantic by linking the Barbados record to multiyear records of airborne particulate matter less than 10 µm diameter (PM10) measured in air quality programs at Cayenne (French Guiana) and Guadeloupe. Comparisons of PM10 at these sites with concurrent dust measurements at Barbados demonstrate that high PM10 levels are almost entirely due to dust. Cayenne PM10 peaks in spring in a cycle which is consistent with satellite aerosol optical depth and suggests that the Sahel is the dominant source. The persistent transport of dust during much of the year could impact a wide range of environmental processes over a broad region that extends from the southern United States to the Amazon Basin. Finally, the average 24 h PM10 concentrations at Cayenne and Guadeloupe frequently exceed the World Health Organization air quality guideline. Thus soil dust PM10 could be a significant, but generally unrecognized, health factor at western Atlantic sites and also in other relatively remote regions affected by long-range dust from Africa. Because dust emissions and transport are highly sensitive to climate variability, climate change in coming decades could greatly affect a wide range of biogeochemical processes and human health in this region.

  6. Transport of radioactive materials

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1960-04-15

    The increasing use of radioactive substances, not only in reactor operations but also in medicine, industry and other fields, is making the movement of these materials progressively wider, more frequent and larger in volume. Although regulations for the safe transport of radioactive materials have been in existence for many years, it has now become necessary to modify or supplement the existing provisions on an international basis. It is essential that the regulations should be applied uniformly by all countries. It is also desirable that the basic regulations should be uniform for all modes of transport so as to simplify the procedures to be complied with by shippers and carriers

  7. Novel properties of the wheat aluminum tolerance organic acid transporter (TaALMT1) revealed by electrophysiological characterization in Xenopus Oocytes: functional and structural implications.

    Science.gov (United States)

    Piñeros, Miguel A; Cançado, Geraldo M A; Kochian, Leon V

    2008-08-01

    Many plant species avoid the phytotoxic effects of aluminum (Al) by exuding dicarboxylic and tricarboxylic acids that chelate and immobilize Al(3+) at the root surface, thus preventing it from entering root cells. Several novel genes that encode membrane transporters from the ALMT and MATE families recently were cloned and implicated in mediating the organic acid transport underlying this Al tolerance response. Given our limited understanding of the functional properties of ALMTs, in this study a detailed characterization of the transport properties of TaALMT1 (formerly named ALMT1) from wheat (Triticum aestivum) expressed in Xenopus laevis oocytes was conducted. The electrophysiological findings are as follows. Although the activity of TaALMT1 is highly dependent on the presence of extracellular Al(3+) (K(m1/2) of approximately 5 microm Al(3+) activity), TaALMT1 is functionally active and can mediate ion transport in the absence of extracellular Al(3+). The lack of change in the reversal potential (E(rev)) upon exposure to Al(3+) suggests that the "enhancement" of TaALMT1 malate transport by Al is not due to alteration in the transporter's selectivity properties but is solely due to increases in its anion permeability. The consistent shift in the direction of the E(rev) as the intracellular malate activity increases indicates that TaALMT1 is selective for the transport of malate over other anions. The estimated permeability ratio between malate and chloride varied between 1 and 30. However, the complex behavior of the E(rev) as the extracellular Cl(-) activity was varied indicates that this estimate can only be used as a general guide to understanding the relative affinity of TaALMT1 for malate, representing only an approximation of those expected under physiologically relevant ionic conditions. TaALMT1 can also mediate a large anion influx (i.e. outward currents). TaALMT1 is permeable not only to malate but also to other physiologically relevant anions such as Cl

  8. Novel Properties of the Wheat Aluminum Tolerance Organic Acid Transporter (TaALMT1) Revealed by Electrophysiological Characterization in Xenopus Oocytes: Functional and Structural Implications1[OA

    Science.gov (United States)

    Piñeros, Miguel A.; Cançado, Geraldo M.A.; Kochian, Leon V.

    2008-01-01

    Many plant species avoid the phytotoxic effects of aluminum (Al) by exuding dicarboxylic and tricarboxylic acids that chelate and immobilize Al3+ at the root surface, thus preventing it from entering root cells. Several novel genes that encode membrane transporters from the ALMT and MATE families recently were cloned and implicated in mediating the organic acid transport underlying this Al tolerance response. Given our limited understanding of the functional properties of ALMTs, in this study a detailed characterization of the transport properties of TaALMT1 (formerly named ALMT1) from wheat (Triticum aestivum) expressed in Xenopus laevis oocytes was conducted. The electrophysiological findings are as follows. Although the activity of TaALMT1 is highly dependent on the presence of extracellular Al3+ (Km1/2 of approximately 5 μm Al3+ activity), TaALMT1 is functionally active and can mediate ion transport in the absence of extracellular Al3+. The lack of change in the reversal potential (Erev) upon exposure to Al3+ suggests that the “enhancement” of TaALMT1 malate transport by Al is not due to alteration in the transporter's selectivity properties but is solely due to increases in its anion permeability. The consistent shift in the direction of the Erev as the intracellular malate activity increases indicates that TaALMT1 is selective for the transport of malate over other anions. The estimated permeability ratio between malate and chloride varied between 1 and 30. However, the complex behavior of the Erev as the extracellular Cl− activity was varied indicates that this estimate can only be used as a general guide to understanding the relative affinity of TaALMT1 for malate, representing only an approximation of those expected under physiologically relevant ionic conditions. TaALMT1 can also mediate a large anion influx (i.e. outward currents). TaALMT1 is permeable not only to malate but also to other physiologically relevant anions such as Cl−, NO3−, and

  9. Uniform Facility Data Set US (UFDS-1997)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Uniform Facility Data Set (UFDS), formerly the National Drug and Alcohol Treatment Unit Survey or NDATUS, was designed to measure the scope and use of drug abuse...

  10. Uniform Facility Data Set US (UFDS-1998)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Uniform Facility Data Set (UFDS) was designed to measure the scope and use of drug abuse treatment services in the United States. The survey collects information...

  11. Nonimaging solar concentrator with uniform irradiance

    Science.gov (United States)

    Winston, Roland; O'Gallagher, Joseph J.; Gee, Randy C.

    2004-09-01

    We report results of a study our group has undertaken under NREL/DOE auspices to design a solar concentrator with uniform irradiance on a planar target. This attribute is especially important for photovoltaic concentrators.

  12. Uniforms, status and professional boundaries in hospital.

    Science.gov (United States)

    Timmons, Stephen; East, Linda

    2011-11-01

    Despite their comparative neglect analytically, uniforms play a key role in the delineation of occupational boundaries and the formation of professional identity in healthcare. This paper analyses a change to the system of uniforms in one UK hospital, where management have required all professions (with the exception of doctors) to wear the same 'corporate' uniform. Focus groups were conducted with the professionals and patients. We analyse this initiative as a kind of McDonaldisation, seeking to create a new 'corporate' worker whose allegiance is principally to the organisation, rather than a profession. Our findings show how important uniforms are to their wearers, both in terms of the defence of professional boundaries and status, as well as the construction of professional identity. © 2011 The Authors. Sociology of Health & Illness © 2011 Foundation for the Sociology of Health & Illness/Blackwell Publishing Ltd.

  13. Uniform Reserve Training and Retirement Category Administration

    National Research Council Canada - National Science Library

    Kohner, D

    1997-01-01

    This Instruction implement policy as provided in DoD Directive 1215.6, assigns responsibilities and prescribes procedures that pertain to the designation and use of uniform Reserve component (RC) categories (RCCs...

  14. Tolerancing a lens for LED uniform illumination

    Science.gov (United States)

    Ryu, Jieun; Sasian, Jose

    2017-08-01

    A method to evaluate tolerance sensitivities for lenses used to produce uniform illumination is presented. Closed form surfaces are used to define optical surfaces and relative illumination is calculated from light etendue considerations.

  15. Identification, evolution and functional characterization of two Zn CDF-family transporters of the ectomycorrhizal fungus Suillus luteus.

    Science.gov (United States)

    Ruytinx, Joske; Coninx, Laura; Nguyen, Hoai; Smisdom, Nick; Morin, Emmanuelle; Kohler, Annegret; Cuypers, Ann; Colpaert, Jan V

    2017-08-01

    Two genes, SlZnT1 and SlZnT2, encoding Cation Diffusion Facilitator (CDF) family transporters were isolated from Suillus luteus mycelium by genome walking. Both gene models are very similar and phylogenetic analysis indicates that they are most likely the result of a recent gene duplication event. Comparative sequence analysis of the deduced proteins predicts them to be Zn transporters. This function was confirmed by functional analysis in yeast for SlZnT1. SlZnT1 was able to restore growth of the highly Zn sensitive yeast mutant Δzrc1 and localized to the vacuolar membrane. Transformation of Δzrc1 yeast cells with SlZnT1 resulted in an increased accumulation of Zn compared to empty vector transformed Δzrc1 yeast cells and equals Zn accumulation in wild type yeast cells. We were not able to express functional SlZnT2 in yeast. In S. luteus, both SlZnT genes are constitutively expressed whatever the external Zn concentrations. A labile Zn pool was detected in the vacuoles of S. luteus free-living mycelium. Therefore we conclude that SlZnT1 is indispensable for maintenance of Zn homeostasis by transporting excess Zn into the vacuole. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

  16. Structural Characterization of Heme Environmental Mutants of CgHmuT that Shuttles Heme Molecules to Heme Transporters

    Directory of Open Access Journals (Sweden)

    Norifumi Muraki

    2016-05-01

    Full Text Available Corynebacteria contain a heme uptake system encoded in hmuTUV genes, in which HmuT protein acts as a heme binding protein to transport heme to the cognate transporter HmuUV. The crystal structure of HmuT from Corynebacterium glutamicum (CgHmuT reveals that heme is accommodated in the central cleft with His141 and Tyr240 as the axial ligands and that Tyr240 forms a hydrogen bond with Arg242. In this work, the crystal structures of H141A, Y240A, and R242A mutants were determined to understand the role of these residues for the heme binding of CgHmuT. Overall and heme environmental structures of these mutants were similar to those of the wild type, suggesting that there is little conformational change in the heme-binding cleft during heme transport reaction with binding and the dissociation of heme. A loss of one axial ligand or the hydrogen bonding interaction with Tyr240 resulted in an increase in the redox potential of the heme for CgHmuT to be reduced by dithionite, though the wild type was not reduced under physiological conditions. These results suggest that the heme environmental structure stabilizes the ferric heme binding in CgHmuT, which will be responsible for efficient heme uptake under aerobic conditions where Corynebacteria grow.

  17. Uniform emergency codes: will they improve safety?

    Science.gov (United States)

    2005-01-01

    There are pros and cons to uniform code systems, according to emergency medicine experts. Uniformity can be a benefit when ED nurses and other staff work at several facilities. It's critical that your staff understand not only what the codes stand for, but what they must do when codes are called. If your state institutes a new system, be sure to hold regular drills to familiarize your ED staff.

  18. Quasiparticles in non-uniformly magnetized plasma

    International Nuclear Information System (INIS)

    Sosenko, P.P.

    1994-01-01

    A quasiparticle concept is generalized for the case of non-uniformly magnetized plasma. Exact and reduced continuity equations for the microscopic density in the quasiparticle phase space are derived, and the nature of quasiparticles is analyzed. The theory is developed for the general case of relativistic particles in electromagnetic fields, besides non-uniform but stationary magnetic fields. Effects of non-stationary magnetic fields are briefly investigated also. 26 refs

  19. Characterization in Helicobacter pylori of a Nickel Transporter Essential for Colonization That Was Acquired during Evolution by Gastric Helicobacter Species

    Science.gov (United States)

    Turlin, Evelyne; Mancuso, Francesco; Michel, Valérie; Richaud, Pierre; Veyrier, Frédéric J.; De Reuse, Hilde; Vinella, Daniel

    2016-01-01

    Metal acquisition is crucial for all cells and for the virulence of many bacterial pathogens. In particular, nickel is a virulence determinant for the human gastric pathogen Helicobacter pylori as it is the cofactor of two enzymes essential for in vivo colonization, urease and a [NiFe] hydrogenase. To import nickel despite its scarcity in the human body, H. pylori requires efficient uptake mechanisms that are only partially defined. Indeed, alternative ways of nickel entry were predicted to exist in addition to the well-described NixA permease. Using a genetic screen, we identified an ABC transporter, that we designated NiuBDE, as a novel H. pylori nickel transport system. Unmarked mutants carrying deletions of nixA, niuD and/or niuB, were constructed and used to measure (i) tolerance to toxic nickel exposure, (ii) intracellular nickel content by ICP-OES, (iii) transport of radioactive nickel and (iv) expression of a reporter gene controlled by nickel concentration. We demonstrated that NiuBDE and NixA function separately and are the sole nickel transporters in H. pylori. NiuBDE, but not NixA, also transports cobalt and bismuth, a metal currently used in H. pylori eradication therapy. Both NiuBDE and NixA participate in nickel-dependent urease activation at pH 5 and survival under acidic conditions mimicking those encountered in the stomach. However, only NiuBDE is able to carry out this activity at neutral pH and is essential for colonization of the mouse stomach. Phylogenomic analyses indicated that both nixA and niuBDE genes have been acquired via horizontal gene transfer by the last common ancestor of the gastric Helicobacter species. Our work highlights the importance of this evolutionary event for the emergence of Helicobacter gastric species that are adapted to the hostile environment of the stomach where the capacity of Helicobacter to import nickel and thereby activate urease needs to be optimized. PMID:27923069

  20. Photocathode non-uniformity contribution to the energy resolution of scintillators

    International Nuclear Information System (INIS)

    Mottaghian, M.; Koohi-Fayegh, R.; Ghal-Eh, N.; Etaati, G. R.

    2010-01-01

    This paper introduces the basics of the light transport simulation in scintillators and the wavelength-dependencies in the process. The non-uniformity measurement of the photocathode surface is undertaken, showing that for the photocathode used in this study the quantum efficiency falls to about 4% of its maximum value, especially in areas far from the centre. The wavelength-and position-dependent quantum efficiency is implemented in the Monte Carlo light transport code, showing that, the contribution of the photocathode non-uniformity to the energy resolution is estimated to be around 18%, when all position-and wavelength-dependencies are included. (authors)

  1. Isolation and functional characterization of an ammonium transporter gene, PyAMT1, related to nitrogen assimilation in the marine macroalga Pyropia yezoensis (Rhodophyta).

    Science.gov (United States)

    Kakinuma, Makoto; Nakamoto, Chika; Kishi, Kazuki; Coury, Daniel A; Amano, Hideomi

    2017-07-01

    Ammonium and nitrate are the primary nitrogen sources in natural environments, and are essential for growth and development in photosynthetic eukaryotes. In this study, we report on the isolation and characterization of an ammonium transporter gene (PyAMT1) which performs a key function in nitrogen (N) metabolism of Pyropia yezoensis thalli. The predicted length of PyAMT1 was 483 amino acids (AAs). The AA sequence included 11 putative transmembrane domains and showed approximately 33-44% identity to algal and plant AMT1 AA sequences. Functional complementation in an AMT-defective yeast mutant indicated that PyAMT1 mediated ammonium transport across the plasma membrane. Expression analysis showed that the PyAMT1 mRNA level was strongly induced by N-deficiency, and was more highly suppressed by resupply of inorganic-N than organic-N. These results suggest that PyAMT1 plays important roles in the ammonium transport system, and is highly regulated in response to external/internal N-status. Copyright © 2016 Elsevier Ltd. All rights reserved.

  2. The mathematical description of uniformity and related theorems

    International Nuclear Information System (INIS)

    Luo Chuanwen; Yi Chundi; Wang Gang; Li Longsuo; Wang Chuncheng

    2009-01-01

    Uniform index is a conception that can describe the uniformity of a finite point set in a polyhedron, and is closely related to chaos. In order to study uniform index, the concept of contained uniform index is defined, which is similar to uniform index and has good mathematical properties. In this paper, we prove the convergence of the contained uniform index, and develop the base of proving the convergence of uniform index.

  3. Uniform photoresponse in thermally oxidized Ni and MoS2 heterostructures

    International Nuclear Information System (INIS)

    Luo, Wei; Peng, Gang; Wang, Fei; Miao, Feng; Zhang, Xue-Ao; Qin, Shiqiao

    2017-01-01

    Non-uniform photocurrent is usually generated at the overlapped region of the heterostructures, and its potential applications may be hindered by the spatial uniformity issue of the device photoresponse. Here, nearly a uniform photoresponse at the overlapped region of the thermally oxidized Ni and molybdenum disulphide (MoS 2 ) heterostructures is obtained. Further characterizations reveal that several nanometers Ni is rightly under the NiO x layer formed at the surface of the film in the oxidation process. The heterostructures based on layered MoS 2 /NiO x /Ni with highly conductive bottom Ni show a high uniform photoresponse with an external quantum efficiency (EQE) of 1.4% at 532 nm. Moreover, successful integration of multiple devices suggests a great priority for such a structure for highly integrated uniform photodetectors. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  4. Uniform photoresponse in thermally oxidized Ni and MoS{sub 2} heterostructures

    Energy Technology Data Exchange (ETDEWEB)

    Luo, Wei [College of Science, National University of Defense Technology, Changsha (China); National Laboratory of Solid State Microstructures, School of Physics, Nanjing University (China); Peng, Gang; Wang, Fei [College of Science, National University of Defense Technology, Changsha (China); Miao, Feng [National Laboratory of Solid State Microstructures, School of Physics, Nanjing University (China); Zhang, Xue-Ao; Qin, Shiqiao [College of Science, National University of Defense Technology, Changsha (China); State Key Laboratory of High Performance Computing, National University of Defense Technology, Changsha (China)

    2017-09-15

    Non-uniform photocurrent is usually generated at the overlapped region of the heterostructures, and its potential applications may be hindered by the spatial uniformity issue of the device photoresponse. Here, nearly a uniform photoresponse at the overlapped region of the thermally oxidized Ni and molybdenum disulphide (MoS{sub 2}) heterostructures is obtained. Further characterizations reveal that several nanometers Ni is rightly under the NiO{sub x} layer formed at the surface of the film in the oxidation process. The heterostructures based on layered MoS{sub 2}/NiO{sub x}/Ni with highly conductive bottom Ni show a high uniform photoresponse with an external quantum efficiency (EQE) of 1.4% at 532 nm. Moreover, successful integration of multiple devices suggests a great priority for such a structure for highly integrated uniform photodetectors. (copyright 2017 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)

  5. Impact of Uniform Methods on Interlaboratory Antibody Titration Variability: Antibody Titration and Uniform Methods.

    Science.gov (United States)

    Bachegowda, Lohith S; Cheng, Yan H; Long, Thomas; Shaz, Beth H

    2017-01-01

    -Substantial variability between different antibody titration methods prompted development and introduction of uniform methods in 2008. -To determine whether uniform methods consistently decrease interlaboratory variation in proficiency testing. -Proficiency testing data for antibody titration between 2009 and 2013 were obtained from the College of American Pathologists. Each laboratory was supplied plasma and red cells to determine anti-A and anti-D antibody titers by their standard method: gel or tube by uniform or other methods at different testing phases (immediate spin and/or room temperature [anti-A], and/or anti-human globulin [AHG: anti-A and anti-D]) with different additives. Interlaboratory variations were compared by analyzing the distribution of titer results by method and phase. -A median of 574 and 1100 responses were reported for anti-A and anti-D antibody titers, respectively, during a 5-year period. The 3 most frequent (median) methods performed for anti-A antibody were uniform tube room temperature (147.5; range, 119-159), uniform tube AHG (143.5; range, 134-150), and other tube AHG (97; range, 82-116); for anti-D antibody, the methods were other tube (451; range, 431-465), uniform tube (404; range, 382-462), and uniform gel (137; range, 121-153). Of the larger reported methods, uniform gel AHG phase for anti-A and anti-D antibodies had the most participants with the same result (mode). For anti-A antibody, 0 of 8 (uniform versus other tube room temperature) and 1 of 8 (uniform versus other tube AHG), and for anti-D antibody, 0 of 8 (uniform versus other tube) and 0 of 8 (uniform versus other gel) proficiency tests showed significant titer variability reduction. -Uniform methods harmonize laboratory techniques but rarely reduce interlaboratory titer variance in comparison with other methods.

  6. Characterization of PM2.5 and identification of transported secondary and biomass burning contribution in Seoul, Korea.

    Science.gov (United States)

    Kim, Yumi; Seo, Jihoon; Kim, Jin Young; Lee, Ji Yi; Kim, Hwajin; Kim, Bong Mann

    2018-02-01

    The chemical and seasonal characteristics of fine particulates in Seoul, Korea, were investigated based on 24-h integrated PM 2.5 measurements made over four 1-month periods in each season between October 2012 and September 2013. The four-season average concentration of PM 2.5 was 37 μg m -3 , and the major chemical components were secondary inorganic aerosol (SIA) species of sulfate, nitrate, and ammonium (49%), followed by organic matter (34%). The mass concentration and most of the chemical components of PM 2.5 showed clear seasonal variation, with a winter-high and summer-low pattern. The winter-to-summer sulfate ratio and the winter organic carbon (OC)-to-elemental carbon (EC) ratio were unusually high compared with those in previous studies. Strong correlations of both the sulfate level and the sulfur oxidation ratio with relative humidity, and between water-soluble OC (WSOC) and SIA in winter, suggest the importance of aqueous phase chemistry for secondary aerosols. A strong correlation between non-sea salt sulfate and Na + levels, a high Cl - /Na + ratio, and an unusual positive correlation between the nitrogen oxidation ratio and temperature during the winter indicate the influence of transported secondary emission sources from upwind urban areas and from China across the Yellow Sea. Despite the absence of local forest fires and the regulation of wood burning, a high levoglucosan concentration and its correlations with OC and WSOC indicate that Seoul was affected by biomass burning sources in the winter. The unusually high water-insoluble OC (WIOC)-to-EC ratio in winter implies additional transported combustion sources of WIOC. The strong correlation between WIOC and levoglucosan suggests the likely influence of transported biomass burning sources on the high WIOC/EC ratio during the winter.

  7. Transport Statistics - Transport - UNECE

    Science.gov (United States)

    Sustainable Energy Statistics Trade Transport Themes UNECE and the SDGs Climate Change Gender Ideas 4 Change UNECE Weekly Videos UNECE Transport Areas of Work Transport Statistics Transport Transport Statistics About us Terms of Reference Meetings and Events Meetings Working Party on Transport Statistics (WP.6

  8. Imaging geochemical heterogeneities using inverse reactive transport modeling: An example relevant for characterizing arsenic mobilization and distribution

    DEFF Research Database (Denmark)

    Fakhreddine, Sarah; Lee, Jonghyun; Kitanidis, Peter K.

    2016-01-01

    groundwater parameters. Specifically, we simulate the mobilization of arsenic via kinetic oxidative dissolution of As-bearing pyrite due to dissolved oxygen in the ambient groundwater, which is an important mechanism for arsenic release in groundwater both under natural conditions and engineering applications......The spatial distribution of reactive minerals in the subsurface is often a primary factor controlling the fate and transport of contaminants in groundwater systems. However, direct measurement and estimation of heterogeneously distributed minerals are often costly and difficult to obtain. While...

  9. Downstream lightening and upward heavying, sorting of sediments of uniform grain size but differing in density

    Science.gov (United States)

    Viparelli, E.; Solari, L.; Hill, K. M.

    2014-12-01

    Downstream fining, i.e. the tendency for a gradual decrease in grain size in the downstream direction, has been observed and studied in alluvial rivers and in laboratory flumes. Laboratory experiments and field observations show that the vertical sorting pattern over a small Gilbert delta front is characterized by an upward fining profile, with preferential deposition of coarse particles in the lowermost part of the deposit. The present work is an attempt to answer the following questions. Are there analogous sorting patterns in mixtures of sediment particles having the same grain size but differing density? To investigate this, we performed experiments at the Hydrosystems Laboratory at the University of Illinois at Urbana-Champaign. During the experiments a Gilbert delta formed and migrated downstream allowing for the study of transport and sorting processes on the surface and within the deposit. The experimental results show 1) preferential deposition of heavy particles in the upstream part of the deposit associated with a pattern of "downstream lightening"; and 2) a vertical sorting pattern over the delta front characterized by a pattern of "upward heavying" with preferential deposition of light particles in the lowermost part of the deposit. The observed downstream lightening is analogous of the downstream fining with preferential deposition of heavy (coarse) particles in the upstream part of the deposit. The observed upward heavying was unexpected because, considering the particle mass alone, the heavy (coarse) particles should have been preferentially deposited in the lowermost part of the deposit. Further, the application of classical fractional bedload transport relations suggests that in the case of mixtures of particles of uniform size and different densities equal mobility is not approached. We hypothesize that granular physics mechanisms traditionally associated with sheared granular flows may be responsible for the observed upward heavying and for the

  10. Characterizing transport current defects in 1-cm-wide YBa[sub 2]Cu[sub 3]O[sub 7-delta] coated conductors.

    Energy Technology Data Exchange (ETDEWEB)

    Brown, G. W. (Geoffrey W.); Hawley, M. E. (Marilyn E.); Peterson, E. J. (Eric J.); Coulter, J. Y. (James Y.); Dowden, P. C. (Paul C.); Arendt, P. N. (Paul N.); Foltyn, S. R. (Stephen R.); Mueller, F. M. (Fred M.)

    2001-01-01

    We have used a low temperature magnetic imaging system to determine current pathways in 5 cm long 'good' and 'bad' regions of a 1-cm-wide YBa2Cu3O7-{delta} coated conductor. The good and bad regions were identified with 4 point probe measurements taken at 1 cm intervals along the tape length. The current density map from the good region showed the expected edge peaked structure, similar to that seen in previous work on high quality test samples grown on single crystal substrates. The structure was also consistent with theoretical understanding of thin film superconductors where demagnetizing effects are strong. The maps from the bad region showed that the current was primarily confined to the right half of the sample. The left half carried only a small current that reached saturation quickly. Effectively halving the sample width quantitatively explains the critical current measured in that section. Spatially resolved xray analysis with 1 mm resolution was used to further characterize the bad section and suggested an abnormally large amount of a-axis YBCO present. This may be the result of non-uniform heating leading to a low deposition temperature in that area.

  11. Evaluate and characterize mechanisms controlling transport, fate and effects of army smokes in an aerosol wind tunnel: Transport, transformations, fate and terrestrial ecological effects of fog oil obscurant smokes: Final report

    Energy Technology Data Exchange (ETDEWEB)

    Cataldo, D.A.; Van Voris, P.; Ligotke, M.W.; Fellows, R.J.; McVeety, B.D.; Li, Shu-mei W.; Bolton, H. Jr.; Fredrickson, J.K.

    1989-01-01

    The terrestrial transport, chemical fate, and ecological effects of fog oil (FO) smoke obscurants were evaluated under controlled wind tunnel conditions. The primary objectives of this research program are to characterize and assess the impacts of smoke and obscurants on: (1) natural vegetation characteristic of US Army training sites in the United States; (2) physical and chemical properties of soils representative of these training sites; and (3) soil microbiological and invertebrate communities. Impacts and dose/responses were evaluated based on an exposure scenario, including exposure duration, exposure rate, and sequential cumulative dosing. Key to understanding the environmental impacts of fog oil smoke/obscurants is establishing the importance of environmental parameters, such as relative humidity and wind speed on airborne aerosol characteristics and deposition to receptor surfaces. Direct and indirect biotic effects were evaluated using five plant species and three soil types. 29 refs., 35 figs., 32 tabs.

  12. Molecular cloning and characterization of a gene encoding the proline transporter protein in common bean(Phaseolus vulgaris L.)

    Institute of Scientific and Technical Information of China (English)

    Jibao; Chen; Jing; Wu; Yunfeng; Lu; Yuannan; Cao; Hui; Zeng; Zhaoyuan; Zhang; Lanfen; Wang; Shumin; Wang

    2016-01-01

    As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter(Pro T) plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a c DNA sequence for Pro T from common bean(Phaseolus vulgaris L.) and designated the gene Pv Pro T. The deduced amino acid sequence of Pv Pro T showed high similarity to Bet/Pro T proteins from other leguminous plants, and the highest similarity was observed with mothbean(Vigna aconitifolia L.) Vu Pro T.Relative quantification of the m RNA level of Pv Pro T using real-time PCR analysis showed that the Pv Pro T transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20%(w/w) PEG-6000 treatment,drought-resistant plants expressed a higher level of Pv Pro T transcripts than droughtsensitive plants. Although heterologous expression of Pv Pro T in the Escherichia coli mutant mkh13 showed that Pv Pro T exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that Pv Pro T plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.

  13. Transdermal delivery of flurbiprofen from surfactant-based vesicles: particle characterization and the effect of water on in vitro transport.

    Science.gov (United States)

    Uchino, Tomonobu; Matsumoto, Yuiko; Murata, Akiko; Oka, Toshihiko; Miyazaki, Yasunori; Kagawa, Yoshiyuki

    2014-04-10

    Flurbiprofen loaded rigid and elastic vesicles comprising the bilayer-forming surfactant sucrose-ester laurate were prepared by the film rehydration and extrusion method. The charge-inducing agent sodium dodecyl sulfate, and the micelle-forming surfactants, sorbitan monolaurate, polyethylene glycol monolaurate, and polysorbate 20, were used to enhance elasticity. Vesicle formulations were evaluated for size, zeta potential, (1)H and (19)F nuclear magnetic resonance (NMR) spectra, and in vitro skin permeation across Yucatan micropig (YMP) skin. Vesicle formulations were stable for 2 weeks and their mean sizes were 95-135 nm. NMR spectroscopy showed that flurbiprofen molecular mobility was restricted by interaction with vesicle components because of entrapment in vesicle bilayers. Moreover, sorbitan monolaurate-containing vesicles strongly retained flurbiprofen molecules. After non-occlusive application to YMP skin, flurbiprofen transport from all vesicle formulations was superior to that of flurbiprofen alone and remarkably decreased after water vaporization. Polarization microscopy and small-angle X-ray diffraction analysis showed that the vesicle formulation was transferred to liquid crystalline state. Suppression of vesicle transition to the liquid crystalline state was observed with applications of both large quantities and diluted samples. The presence of water in the formulations was associated with maintenance of the vesicle structure and greater flurbiprofen transport across YMP skin. Copyright © 2014 Elsevier B.V. All rights reserved.

  14. Transcriptome Characterization of the Chinese Fir (Cunninghamia lanceolata (Lamb. Hook. and Expression Analysis of Candidate Phosphate Transporter Genes

    Directory of Open Access Journals (Sweden)

    Ming Li

    2017-11-01

    Full Text Available Chinese fir (Cunninghamia lanceolata (Lamb. Hook. is the most important afforestation tree species in China because of its excellent timber quality and high yield. However, the limited availability of phosphorus in forest soils is widespread and has become an important factor in the declining productivity of Chinese fir plantations. Here we used the Illumina HiSeq™ 2000 DNA sequencing platform to sequence root, stem, and leaf transcriptomes of one-year old Chinese fir clones with phosphorus treatment. Approximately 236,529,278 clean reads were obtained and generated 35.47 G of sequencing data. These reads were assembled into 413,806 unigenes with a mean length of 520 bp. In total, 109,596 unigenes were annotated in the NR (NCBI non-redundant database, 727,287 genes were assigned for GO (Gene Ontology terms, information for 92,001 classified unigenes was assigned to 26 KOG (Karyotic Orthologous Groups categories, and 57,042 unigenes were significantly matched with 132 KEGG (Kyoto Encyclopedia of Genes and Genomes predicted pathways. In total, 49 unigenes were identified as exhibiting inorganic phosphate transporter activity, and 14 positive genes’ expression patterns in different phosphorus deficiency treatments were analyzed by qRT-PCR to explore their putative functions. This study provides a basic foundation for functional genomic studies of the phosphate transporter in Chinese fir, and also presents an extensive annotated sequence resource for molecular research.

  15. Molecular cloning and characterization of a gene encoding the proline transporter protein in common bean (Phaseolus vulgaris L.

    Directory of Open Access Journals (Sweden)

    Jibao Chen

    2016-10-01

    Full Text Available As a typical compatible solute, proline is accumulated in plants under environmental stresses. Proline transporter (ProT plays an important role in proline distribution between plant organs. Using a candidate gene approach, we cloned a cDNA sequence for ProT from common bean (Phaseolus vulgaris L. and designated the gene PvProT. The deduced amino acid sequence of PvProT showed high similarity to Bet/ProT proteins from other leguminous plants, and the highest similarity was observed with mothbean (Vigna aconitifolia L. VuProT. Relative quantification of the mRNA level of PvProT using real-time PCR analysis showed that the PvProT transcript level was higher in leaves than in stems and roots of common bean plants subjected to drought and salt stress. Under 20% (w/w PEG-6000 treatment, drought-resistant plants expressed a higher level of PvProT transcripts than drought-sensitive plants. Although heterologous expression of PvProT in the Escherichia coli mutant mkh13 showed that PvProT exhibited uptake activities for proline and betaine, no betaine content was detected in the common bean. These findings suggest that PvProT plays an important role in the transportation of proline in common bean plants exposed to drought and salt stress.

  16. Characterizing the influence of anthropogenic emissions and transport variability on sulfate aerosol concentrations at Mauna Loa Observatory

    Science.gov (United States)

    Potter, Lauren E.

    Sulfate aerosol in the atmosphere has substantial impacts on human health and environmental quality. Most notably, atmospheric sulfate has the potential to modify the earth's climate system through both direct and indirect radiative forcing mechanisms (Meehl et al., 2007). Emissions of sulfur dioxide, the primary precursor of sulfate aerosol, are now globally dominated by anthropogenic sources as a result of widespread fossil fuel combustion. Economic development in Asian countries since 1990 has contributed considerably to atmospheric sulfur loading, particularly China, which currently emits approximately 1/3 of global anthropogenic SO2 (Klimont et al., 2013). Observational and modeling studies have confirmed that anthropogenic pollutants from Asian sources can be transported long distances with important implications for future air quality and global climate change. Located in the remote Pacific Ocean (19.54°N, 155.58°W) at an elevation of 3.4 kilometers above sea level, Mauna Loa Observatory (MLO) is an ideal measurement site for ground-based, free tropospheric observations and is well situated to experience influence from springtime Asian outflow. This study makes use of a 14-year data set of aerosol ionic composition, obtained at MLO by the University of Hawaii at Manoa. Daily filter samples of total aerosol concentrations were made during nighttime downslope (free-tropospheric) transport conditions, from 1995 to 2008, and were analyzed for aerosol-phase concentrations of the following species: nitrate (NO3-), sulfate (SO42-), methanesulfonate (MSA), chloride (Cl-), oxalate, sodium (Na+), ammonium (NH 4+), potassium (K+), magnesium (Mg 2+), and calcium (Ca2+). An understanding of the factors controlling seasonal and interannual variations in aerosol speciation and concentrations at this site is complicated by the relatively short lifetimes of aerosols, compared with greenhouse gases which have also been sampled over long time periods at MLO. Aerosol filter

  17. 7 CFR 1005.61 - Computation of uniform prices.

    Science.gov (United States)

    2010-01-01

    ... month, the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and...) and (a)(2) of this section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

  18. 7 CFR 1006.61 - Computation of uniform prices.

    Science.gov (United States)

    2010-01-01

    ..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

  19. 7 CFR 1131.61 - Computation of uniform prices.

    Science.gov (United States)

    2010-01-01

    ..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

  20. 7 CFR 1007.61 - Computation of uniform prices.

    Science.gov (United States)

    2010-01-01

    ..., the market administrator shall compute a uniform butterfat price, a uniform skim milk price, and a... section. (b) Uniform skim milk price. The uniform skim milk price per hundredweight, rounded to the... paragraph (a) of this section times 3.5 pounds of butterfat; and (2) Multiply the uniform skim milk price...

  1. IDEAL STRUCTURE OF UNIFORM ROE ALGEBRAS OVER SIMPLE CORES

    Institute of Scientific and Technical Information of China (English)

    CHEN XIAOMAN; WANG QIN

    2004-01-01

    This paper characterizes ideal structure of the uniform Roe algebra B* (X) over sinple cores X. A necessary and sufficient condition for a principal ideal of B*(X) to be spatial is given and an example of non-spatial ideal of B* (X) is constructed. By establishing an one-one correspondence between the ideals of B* (X) and the ω-filters on X, the maximal ideals of B* (X) are completely described by the corona of the Stone-Cech compactification of X.

  2. Molecular cloning, characterization and expression analysis of two members of the Pht1 family of phosphate transporters in Glycine max.

    Directory of Open Access Journals (Sweden)

    Zhaoyun Wu

    Full Text Available BACKGROUND: Phosphorus is one of the macronutrients essential for plant growth and development. The acquisition and translocation of phosphate are pivotal processes of plant growth. In a large number of plants, phosphate uptake by roots and translocation within the plant are presumed to occur via a phosphate/proton cotransport mechanism. PRINCIPAL FINDINGS: We cloned two cDNAs from soybean (Glycine max, GmPT1 and GmPT2, which show homology to the phosphate/proton cotransporter PHO84 from the budding yeast Saccharomyces cerevisiae. The amino acid sequence of the products predicted from GmPT1 and GmPT2 share 61% and 63% identity, respectively, with the PHO84 in amino acid sequence. The deduced structure of the encoded proteins revealed 12 membrane-spanning domains with a central hydrophilic region. The molecular mass values are ∼58.7 kDa for GmPT1 and ∼58.6 kDa for GmPT2. Transiently expressed GFP-protein fusions provide direct evidence that the two Pi transporters are located in the plasma membrane. Uptake of radioactive orthophosphate by the yeast mutant MB192 showed that GmPT1 and GmPT2 are dependent on pH and uptake is reduced by the addition of uncouplers of oxidative phosphorylation. The K(m for phosphate uptake by GmPT1 and GmPT2 is 6.65 mM and 6.63 mM, respectively. A quantitative real time RT-PCR assay indicated that these two genes are expressed in the roots and shoots of seedlings whether they are phosphate-deficient or not. Deficiency of phosphorus caused a slight change of the expression levels of GmPT1 and GmPT2. CONCLUSIONS: The results of our experiments show that the two phosphate transporters have low affinity and the corresponding genes are constitutively expressed. Thereby, the two phosphate transporters can perform translocation of phosphate within the plant.

  3. Magneto-transport characterization of e-beam-induced damage in GaAs-AlGaAs heterostructures

    International Nuclear Information System (INIS)

    Fink, T.; Smith, D.D.; Braddock, W.D.

    1989-01-01

    This paper reports the effect of electron irradiation as a function of energy on the 2D EG transport properties of high electron mobility transistor (HEMT) structures at liquid helium temperature measured. High mobility HEMT structures were molecular beam epitaxy (MBE) grown with a 2D EG channel approximately 850 angstrom below the surface. A Cambridge EBMF 10.5 was used for electron irradiation with electron energies between 2.5 and 20 keV. The HEMT structures were fabricated into Hall bar geometry. Damage is assessed by changes in the 2D EG concentrations, as determined from Shubnikov-de Haas (SdH) oscillations in a magnetic field from 0 to 8.5 Telsa, and changes in the zero field Hall mobilities

  4. Design and characterization of the DC acceleration and transport system required for the FOM 1 MW free electron maser experiment

    Energy Technology Data Exchange (ETDEWEB)

    Caplan, M. [Lawrence Livermore National Lab., CA (United States); Urbanus, W.H.; Geer, C. van der [FOM-Institut voor Plasma Fysica, Nieuwegein (Netherlands)] [and others

    1995-12-31

    A Free Electron Maser (FEM) has been constructed and is soon to be tested at the FOM Institute (Rijnhuizen) Netherlands with the goal of producing 1 MW long pulse to CW microwave output in the range 130 GHz to 250 GHz. The design uses a DC beam system in a depressed collector configuration in order to make the overall wall plug efficiency 50%. The high voltage ({approximately} 2 MeV) power supply provides only the body interception current ({approximately} 30 mA) while the 12 amp beam current is supplied by the 100-200 keV collector supplies. Some of the design features to ensure low interception current, which is critical to long pulse (CW) operation are: (1) DC beam in-line transport and acceleration system, (2) emittance conserving solenoid focusing system, (3) halo suppression techniques at cathode edge, and (4) very low beam fill factor (<20%). A relativistic version of the Herman Optical theory developed for microwave tubes is used to determine current distribution functions everywhere along the beam from the electron gun, through the DC accelerator and transport system to the wiggler. This theory takes into account thermals far out on the gaussian tail which translates into beam current far outside the ideal beam edge. This theory is applied to the FOM beam line design to predict a series of beam envelope contours containing various percentages of total beam current up to 99.9%. Predictions of body interception current due to finite emittance (effective temperature) are presented and compared with measured experimental results.

  5. Glyceryl monooleyl ether-based liquid crystalline nanoparticles as a transdermal delivery system of flurbiprofen: characterization and in vitro transport.

    Science.gov (United States)

    Uchino, Tomonobu; Murata, Akiko; Miyazaki, Yasunori; Oka, Toshihiko; Kagawa, Yoshiyuki

    2015-01-01

    Liquid crystalline nanoparticles (LCNs) were prepared using glyceryl monooleyl ether (GME) by the modified film rehydration method. Hydrogenated lecithin (HL), 1,3-butylene glycol (1,3-BG), and Poloxamer 407 were used as additives. The prepared LCN formulations were evaluated based on particle size, small-angle X-ray diffraction (SAXS) analysis, (1)H- and (19)F-NMR spectra, and in vitro skin permeation across Yucatan micropig skin. The composition (weight percent) of the LCN formulations were GME-HL-1,3-BG (4 : 1 : 15), 4% GME-based LCN and GME-HL-1,3-BG (8 : 1 : 15), 8% GME-based LCN and their mean particle sizes were 130-175 nm. Flurbiprofen 5 and 10 mg was loaded into 4% GME-based LCN and 8% GME-based LCN systems, respectively. The results of SAXS and NMR suggested that both flurbiprofen-loaded formulations consist of particles with reverse type hexagonal phase (formation of hexosome) and flurbiprofen molecules were localized in the lipid domain through interaction of flurbiprofen with the lipid components. Flurbiprofen transport from the LCN systems across the Yucatan micropig skin was increased compared to flurbiprofen in citric buffer (pH=3.0). The 8% GME-based LCN systems was superior to the 4% GME-based LCN for flurbiprofen transport. Since the internal hexagonal phase in the 8% GME-based LCN systems had a higher degree of order compared to the 4% GME-based LCN in SAXS patterns, the 8% GME-based LCN system had a larger surface area, which might influence flurbiprofen permeation. These results indicated that the GME-based LCN system is effective in improving the skin permeation of flurbiprofen across the skin.

  6. Ultrasonic transducer design for uniform insonation

    International Nuclear Information System (INIS)

    Harrison, G.H.; Balcer-Kubiczek, E.K.; McCulloch, D.

    1984-01-01

    Techniques used in transducer development for acoustical imaging have been evaluated for the purpose of producing broad, uniform ultrasonic fields from planar radiators. Such fields should be useful in hyperthermia, physical therapy, and ultrasonic bioeffects studies. Fourier inversion of the circ function yielded a source velocity distribution proportional to (P/r) exp ((-ik/2Z) (2Z/sup 2/+r/sup 2/)) J/sub 1/(krP/Z), where r is the radial source coordinate, k is the wave number, and P is the desired radius of uniform insonation at a depth Z in water. This source distribution can be truncated without significantly degrading the solution. A simpler solution consists of exponentially shading the edge of an otherwise uniformly excited disk transducer. This approach was successfully approximated experimentally

  7. Fuel Aging in Storage and Transportation (FAST): Accelerated Characterization and Performance Assessment of the Used Nuclear Fuel Storage System

    International Nuclear Information System (INIS)

    McDeavitt, Sean

    2016-01-01

    This Integrated Research Project (IRP) was established to characterize key limiting phenomena related to the performance of used nuclear fuel (UNF) storage systems. This was an applied engineering project with a specific application in view (i.e., UNF dry storage). The completed tasks made use of a mixture of basic science and engineering methods. The overall objective was to create, or enable the creation of, predictive tools in the form of observation methods, phenomenological models, and databases that will enable the design, installation, and licensing of dry UNF storage systems that will be capable of containing UNF for extended period of time.

  8. Fuel Aging in Storage and Transportation (FAST): Accelerated Characterization and Performance Assessment of the Used Nuclear Fuel Storage System

    Energy Technology Data Exchange (ETDEWEB)

    McDeavitt, Sean [Texas A & M Univ., College Station, TX (United States). Dept. of Nuclear Engineering

    2016-08-02

    This Integrated Research Project (IRP) was established to characterize key limiting phenomena related to the performance of used nuclear fuel (UNF) storage systems. This was an applied engineering project with a specific application in view (i.e., UNF dry storage). The completed tasks made use of a mixture of basic science and engineering methods. The overall objective was to create, or enable the creation of, predictive tools in the form of observation methods, phenomenological models, and databases that will enable the design, installation, and licensing of dry UNF storage systems that will be capable of containing UNF for extended period of time.

  9. Uniform color space is not homogeneous

    Science.gov (United States)

    Kuehni, Rolf G.

    2002-06-01

    Historical data of chroma scaling and hue scaling are compared and evidence is shown that we do not have a reliable basis in either case. Several data sets indicate explicitly or implicitly that the number of constant sized hue differences between unique hues as well as in the quadrants of the a*, b* diagram differs making what is commonly regarded as uniform color space inhomogeneous. This problem is also shown to affect the OSA-UCS space. A Euclidean uniform psychological or psychophysical color space appears to be impossible.

  10. On Uniformly finitely extensible Banach spaces

    OpenAIRE

    Castillo, Jesús M. F.; Ferenczi, Valentin; Moreno, Yolanda

    2013-01-01

    We continue the study of Uniformly Finitely Extensible Banach spaces (in short, UFO) initiated in Moreno-Plichko, \\emph{On automorphic Banach spaces}, Israel J. Math. 169 (2009) 29--45 and Castillo-Plichko, \\emph{Banach spaces in various positions.} J. Funct. Anal. 259 (2010) 2098-2138. We show that they have the Uniform Approximation Property of Pe\\l czy\\'nski and Rosenthal and are compactly extensible. We will also consider their connection with the automorphic space problem of Lindenstraus...

  11. Uniform topology on EQ-algebras

    Directory of Open Access Journals (Sweden)

    Yang Jiang

    2017-04-01

    Full Text Available In this paper, we use filters of an EQ-algebra E to induce a uniform structure (E, , and then the part induce a uniform topology in E. We prove that the pair (E, is a topological EQ-algebra, and some properties of (E, are investigated. In particular, we show that (E, is a first-countable, zero-dimensional, disconnected and completely regular space. Finally, by using convergence of nets, the convergence of topological EQ-algebras is obtained.

  12. Characterization of the occupational exposure and air transported particles using the techniques of PIXE 252Cf PMDS and alpha spectrometry

    International Nuclear Information System (INIS)

    Carneiro, Luana Gomes

    2008-01-01

    The risk for human health due to exposure to aerosols depends on the intake pattern, the mass concentration and the speciation of the elements present in airborne particles. In this work PDMS (Plasma Desorption Mass Spectrometry) was used as complementary technique to the PIXE (Particle Induced X ray Emission) technique to characterize aerosols samples collected in the environment. The PIXE technique allows the identification of the elements present in the sample and to determine their mass concentrations. The mass spectrometry (PDMS) was used to identify the speciation of these elements present in the samples. The aerosol samples were collected using a six stage cascade impactor in three sites. The Mass Median Aerodynamic Diameter (MMAD) measured indicated that the airborne particulate were in the fine fraction of the aerosols. The theoretical uranium concentration in urine samples using ICRP lung model parameters suggest that the elemental mass concentration in respirable fraction of aerosol and the chemical speciation are important factors to determine the uranium concentration in urine and that the determination of specific solubility parameters for each compound is the most important factor to calculate the uranium concentration in urine. PIXE allows to identify and quantify the elements heavier than Na (Z=11) while PDMS allows to identify the organic and inorganic compounds present in the samples. As these techniques are used as complementary techniques they provide important information about the aerosols characterization. (author)

  13. [{sup 11}C]d-threo-Methylphenidate, a new radiotracer for the dopamine transporter. Characterization in baboon and human brain

    Energy Technology Data Exchange (ETDEWEB)

    Ding, Y.S.; Volkow, N.D.; Fowler, J.S. [Brookhaven National Laboratory, Upton, NY (United States)] [and others

    1995-05-01

    dl-threo Methylphenidate (MP, Ritalin) is a psychostimulant drug which binds to the dopamine transporter (DAT). We evaluated [{sup 11}C]d-threo-methylphenidate ([{sup 11}C]d-MP), the more active enantiomer, as a radiotracer for the DAT in baboons and human brain. Stereoselectivity, saturability and pharmacological specificity and reproducibility were examined. Stereoselectivity was examined in baboons by comparing [{sup 11C}]d-MP,[{sup 11}C]l-MP and [{sup 11}C]dl-MP. Unlabeled MP was used to assess the reversibility and saturability of the binding. GBR 12909,{beta}-(4-iodophenyl)tropane-2-carboxylic acid methyl ester ({beta}-CIT), tomoxetine and citalopram were used to assess the specificity of the binding. The ratios between the radioactivity in the striatum to that in cerebellum (ST/CB) were 3.3,2.2 and 1.1 for [{sup 11}C]d-MP,[{sup 11}C]dl-MP and [{sup 11}C]l-MP respectively. Most of the striatal binding of [{sup 11}C]d-threo-MP was displaced by injection of nonradioactive MP demonstrating reversibility. Pretreatment with MP (0.5 mg/kg), GBR12909 (1.5 mg/kg) or {beta}-CIT (0.3 mg/kg) reduced ST/CB by about 60% and the ratios of distribution volumes at the steady-state for the triatum to cerebellum (DV{sub st/}DV{sub cb}) by about 50%. Pretreatment with tomoxetine (3.0 mg/kg) or citalopram (2.0 mg/kg), inhibitors of the norepinephrine and serotonin transporter, had no effect. Studies of [{sup 11}C]d-MP in the human brain showed highest uptake in basal ganglia with a half clearance time of about 60 minutes. Repeated studies in 6 normal human subjects showed differences in DV{sub st/}DV{sub cb} between -7% and 8%. MP pretreatment decreased BG but no cortical or cerebellar binding and reduced Bmax/Kd by 91%.

  14. Contamination of public transports by Staphylococcus aureus and its carriage by biomedical students: point-prevalence, related risk factors and molecular characterization of methicillin-resistant strains.

    Science.gov (United States)

    Mendes, Â; Martins da Costa, P; Rego, D; Beça, N; Alves, C; Moreira, T; Conceição, T; Aires-de-Sousa, M

    2015-08-01

    To analyse the contamination of public transports by Staphylococcus aureus and assess its carriage by biomedical students, focussing on the point-prevalence, related risk factors and molecular characterization of methicillin-resistant strains. Cross-sectional survey. Methicillin-resistant S. aureus (MRSA) and methicillin-sensitive S. aureus (MSSA) isolated from handrails of buses (n = 112) and trains (n = 79) circulating in Porto and from nasal swabs of local university students (n = 475) were quantified, characterized by molecular typing methods and related to possible risk factors. The MRSA prevalence in buses (16.1%) was not significantly different from trains (8.9%). There was also no identifiable association between the counts of MSSA and MRSA in buses and trains and the number of travellers in each sampling day, specific routes (including those passing by main hospitals) or other risk factors. Of the students, 37.1% carried S. aureus, and having a part-time job or smoking were found to be risk factors for carriage. EMRSA-15 (ST22-SCCmecIVh) was the prevalent MRSA clonal lineage, found not only in the buses (n = 14) and trains (n = 2) but also in the single MRSA-carrier among the students. The characteristics of the community-associated Southwest Pacific MRSA clone were found in a single ST30-IVa isolate, which may suggest a recent SCCmec acquisition by an MSSA background in the community. The spread of EMRSA-15, a common hospital-associated lineage, among different public transports and as a nasal coloniser is of concern and warrants adequate public health control measures. Copyright © 2015 The Royal Society for Public Health. Published by Elsevier Ltd. All rights reserved.

  15. Threshold switching uniformity in In2Se3 nanowire-based phase change memory

    International Nuclear Information System (INIS)

    Chen Jian; Du Gang; Liu Xiao-Yan

    2015-01-01

    The uniformity of threshold voltage and threshold current in the In 2 Se 3 nanowire-based phase change memory (PCM) devices is investigated. Based on the trap-limited transport model, amorphous layer thickness, trap density, and trap depth are considered to clarify their influences upon the threshold voltage and threshold current through simulations. (paper)

  16. Nonlinear generation of zonal flows by ion-acoustic waves in a uniform magnetoplasma

    International Nuclear Information System (INIS)

    Shukla, Nitin; Shukla, P.K.

    2010-01-01

    It is shown that large-scale zonal flows (ZFs) can be excited by Reynolds stress of nonlinearly interacting random phase ion-acoustic waves (EIAWs) in a uniform magnetoplasma. Since ZFs are associated with poloidal sheared flows, they can tear apart short scale EIAW turbulence eddies, and hence contribute to the reduction of the cross-field turbulent transport in a magnetized plasma.

  17. Chemical characterization of long-range transport biomass burning emissions to the Himalayas: insights from high-resolution aerosol mass spectrometry

    Science.gov (United States)

    Zhang, Xinghua; Xu, Jianzhong; Kang, Shichang; Liu, Yanmei; Zhang, Qi

    2018-04-01

    An intensive field measurement was conducted at a remote, background, high-altitude site (Qomolangma Station, QOMS, 4276 m a.s.l.) in the northern Himalayas, using an Aerodyne high-resolution time-of-flight aerosol mass spectrometer (HR-ToF-AMS) along with other collocated instruments. The field measurement was performed from 12 April to 12 May 2016 to chemically characterize the high time-resolved submicron particulate matter (PM1) and obtain the dynamic processes (emissions, transport, and chemical evolution) of biomass burning (BB), frequently transported from South Asia to the Himalayas during pre-monsoon season. Overall, the average (±1σ) PM1 mass concentration was 4.44 (±4.54) µg m-3 for the entire study, which is comparable with those observed at other remote sites worldwide. Organic aerosol (OA) was the dominant PM1 species (accounting for 54.3 % of total PM1 on average) followed by black carbon (BC) (25.0 %), sulfate (9.3 %), ammonium (5.8 %), nitrate (5.1 %), and chloride (0.4 %). The average size distributions of PM1 species all peaked at an overlapping accumulation mode (˜ 500 nm), suggesting that aerosol particles were internally well-mixed and aged during long-range transport. Positive matrix factorization (PMF) analysis on the high-resolution organic mass spectra identified three distinct OA factors, including a BB-related OA (BBOA, 43.7 %), a nitrogen-containing OA (NOA, 13.9 %) and a more-oxidized oxygenated OA (MO-OOA, 42.4 %). Two polluted episodes with enhanced PM1 mass loadings and elevated BBOA contributions from the west and southwest of QOMS during the study were observed. A typical BB plume was investigated in detail to illustrate the chemical evolution of aerosol characteristics under distinct air mass origins, meteorological conditions, and atmospheric oxidation processes.

  18. Characterization of a Novel 99mTc-Carbonyl Complex as a Functional Probe of MDR1 P-Glycoprotein Transport Activity

    Directory of Open Access Journals (Sweden)

    Mary Dyszlewski

    2002-01-01

    Full Text Available Multidrug resistance (MDR mediated by overexpression of MDR1 P-glycoprotein (Pgp is one of the best characterized barriers to chemotherapy in cancer patients. Furthermore, the protective function of Pgp-mediated efflux of xenobiotics in various organs has a profound effect on the bioavailability of drugs in general. Thus, there is an expanding requirement to noninvasively interrogate Pgp transport activity in vivo. We herein report the Pgp recognition properties of a novel 99mTc(I-tricarbonyl complex, [99mTc(CO3(MIBI3] + (Tc-CO-MIBI. Tc-CO-MIBI showed 60-fold higher accumulation in drug-sensitive KB 3–1 cells compared to colchicine-selected drug-resistant KB 8-5 cells. In KB 8-5 cells, tracer enhancement was observed with the potent MDR modulator LY335979 (EC50 = 62 nM. Similar behavior was observed using drug-sensitive MCF-7 breast adenocarcinoma cells and MCF-7/MDR1 stable transfectants, confirming that Tc-CO-MIBI is specifically excluded by overexpression of MDR1 Pgp. By comparison, net accumulation in control H69 lung tumor cells was 9-fold higher than in MDR-associated protein (MRP1-expressing H69AR cells, indicating only modest transport by MRP1. Biodistribution analysis following tail vein injection of Tc-CO-MIBI showed delayed liver clearance as well as enhanced brain uptake and retention in mdr1a/1b(−/− gene deleted mice versus wild-type mice, directly demonstrating that Tc-CO-MIBI is a functional probe of Pgp transport activity in vivo.

  19. Characterization of stormwater at selected South Carolina Department of Transportation maintenance yards and section shed facilities in Ballentine, Conway, and North Charleston, South Carolina, 2010-12

    Science.gov (United States)

    Journey, Celeste A.; Conlon, Kevin J.

    2014-01-01

    Increased impervious surfaces (driveways, parking lots, and buildings) and human activities (residential, industrial, and commercial) have been linked to substantial changes in both the quality and quantity of stormwater on a watershed scale (Brabec and others, 2002; Pitt and Maestre, 2005). Small-scale storage and equipment repair facilities increase impervious surfaces that prevent infiltration of stormwater, and these facilities accommodate activities that can introduce trace metals, organic compounds, and other contaminants to the facility’s grounds. Thus, these small facilities may contribute pollutants to the environment during storm events (U.S. Environmental Protection Agency, 1992). The South Carolina Department of Transportation (SCDOT) operates section shed and maintenance yard facilities throughout the State. Prior to this investigation, the SCDOT had no data to define the quality of stormwater leaving these facilities. To provide these data, the U.S. Geological Survey (USGS), in cooperation with the SCDOT, conducted an investigation to identify and quantify constituents that are transported in stormwater from two maintenance yards and a section shed in three different areas of South Carolina. The two maintenance yards, in North Charleston and Conway, S.C., were selected because they represent facilities where equipment and road maintenance materials are stored and complete equipment repair operations are conducted. The section shed, in Ballentine, S.C., was selected because it is a facility that stores equipment and road maintenance material. Characterization of the constituents that were transported in stormwater from these representative SCDOT maintenance facilities may be used by the SCDOT in the development of stormwater management plans for similar section shed and maintenance yard facilities throughout the State to improve stormwater quality.

  20. Use of a watershed model to characterize the fate and transport of fluometuron, a soil-applied cotton herbicide, in surface water

    Science.gov (United States)

    Coupe, R.H.

    2007-01-01

    The Soil and Water Assessment Tool (SWAT) was used to characterize the fate and transport of fluometuron (a herbicide used on cotton) in the Bogue Phalia Basin in northwestern Mississippi, USA. SWAT is a basin-scale watershed model, able to simulate hydrological, chemical, and sediment transport processes. After adjustments to a few parameters (specifically the SURLAG variable, the runoff curve number, Manning's N for overland flow, soil available water capacity, and the base-flow alpha factor) the SWAT model fit the observed streamflow well (the Coefficient of Efficiency and R2 were greater than 60). The results from comparing observed fluometuron concentrations with simulated concentrations were reasonable. The simulated concentrations (which were daily averages) followed the pattern of observed concentrations (instantaneous values) closely, but could be off in magnitude at times. Further calibration might have improved the fit, but given the uncertainties in the input data, it was not clear that any improvement would be due to a better understanding of the input variables. ?? 2007 Taylor & Francis.

  1. Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio).

    Science.gov (United States)

    Liu, Xiang; Li, Shangqi; Peng, Wenzhu; Feng, Shuaisheng; Feng, Jianxin; Mahboob, Shahid; Al-Ghanim, Khalid A; Xu, Peng

    2016-01-01

    The ATP-binding cassette (ABC) gene family is considered to be one of the largest gene families in all forms of prokaryotic and eukaryotic life. Although the ABC transporter genes have been annotated in some species, detailed information about the ABC superfamily and the evolutionary characterization of ABC genes in common carp (Cyprinus carpio) are still unclear. In this research, we identified 61 ABC transporter genes in the common carp genome. Phylogenetic analysis revealed that they could be classified into seven subfamilies, namely 11 ABCAs, six ABCBs, 19 ABCCs, eight ABCDs, two ABCEs, four ABCFs, and 11 ABCGs. Comparative analysis of the ABC genes in seven vertebrate species including common carp, showed that at least 10 common carp genes were retained from the third round of whole genome duplication, while 12 duplicated ABC genes may have come from the fourth round of whole genome duplication. Gene losses were also observed for 14 ABC genes. Expression profiles of the 61 ABC genes in six common carp tissues (brain, heart, spleen, kidney, intestine, and gill) revealed extensive functional divergence among the ABC genes. Different copies of some genes had tissue-specific expression patterns, which may indicate some gene function specialization. This study provides essential genomic resources for future studies in common carp.

  2. Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC) Transporter Genes in Common Carp (Cyprinus carpio)

    Science.gov (United States)

    Peng, Wenzhu; Feng, Shuaisheng; Feng, Jianxin; Mahboob, Shahid; Al-Ghanim, Khalid A.

    2016-01-01

    The ATP-binding cassette (ABC) gene family is considered to be one of the largest gene families in all forms of prokaryotic and eukaryotic life. Although the ABC transporter genes have been annotated in some species, detailed information about the ABC superfamily and the evolutionary characterization of ABC genes in common carp (Cyprinus carpio) are still unclear. In this research, we identified 61 ABC transporter genes in the common carp genome. Phylogenetic analysis revealed that they could be classified into seven subfamilies, namely 11 ABCAs, six ABCBs, 19 ABCCs, eight ABCDs, two ABCEs, four ABCFs, and 11 ABCGs. Comparative analysis of the ABC genes in seven vertebrate species including common carp, showed that at least 10 common carp genes were retained from the third round of whole genome duplication, while 12 duplicated ABC genes may have come from the fourth round of whole genome duplication. Gene losses were also observed for 14 ABC genes. Expression profiles of the 61 ABC genes in six common carp tissues (brain, heart, spleen, kidney, intestine, and gill) revealed extensive functional divergence among the ABC genes. Different copies of some genes had tissue-specific expression patterns, which may indicate some gene function specialization. This study provides essential genomic resources for future studies in common carp. PMID:27058731

  3. Genome-Wide Identification, Characterization and Phylogenetic Analysis of ATP-Binding Cassette (ABC Transporter Genes in Common Carp (Cyprinus carpio.

    Directory of Open Access Journals (Sweden)

    Xiang Liu

    Full Text Available The ATP-binding cassette (ABC gene family is considered to be one of the largest gene families in all forms of prokaryotic and eukaryotic life. Although the ABC transporter genes have been annotated in some species, detailed information about the ABC superfamily and the evolutionary characterization of ABC genes in common carp (Cyprinus carpio are still unclear. In this research, we identified 61 ABC transporter genes in the common carp genome. Phylogenetic analysis revealed that they could be classified into seven subfamilies, namely 11 ABCAs, six ABCBs, 19 ABCCs, eight ABCDs, two ABCEs, four ABCFs, and 11 ABCGs. Comparative analysis of the ABC genes in seven vertebrate species including common carp, showed that at least 10 common carp genes were retained from the third round of whole genome duplication, while 12 duplicated ABC genes may have come from the fourth round of whole genome duplication. Gene losses were also observed for 14 ABC genes. Expression profiles of the 61 ABC genes in six common carp tissues (brain, heart, spleen, kidney, intestine, and gill revealed extensive functional divergence among the ABC genes. Different copies of some genes had tissue-specific expression patterns, which may indicate some gene function specialization. This study provides essential genomic resources for future studies in common carp.

  4. Progress report on colloid-facilitated transport at Yucca Mountain: Yucca Mountain site characterization program milestone 3383

    International Nuclear Information System (INIS)

    Triay, I.R.; Degueldre, C.; Wistrom, A.O.; Cotter, C.R.; Lemons, W.W.

    1996-06-01

    To assess colloid-facilitated radionuclide transport in groundwaters at the potential nuclear waste repository at Yucca Mountain, it is very important to understand the generation and stability of colloids, including naturally occurring colloids. To this end, we measured the colloid concentration in waters from Well J-13, which is on the order of 106 particles per milliliter (for particle sizes larger than 100 manometers). At this low particle loading, the sorption of radionuclides to colloids would have to be extremely high before the colloids could carry a significant amount of radionuclides from the repository to the accessible environment. We also performed aggregation experiments to evaluate the stability of silica (particle diameter: 85 nm) and clay colloids (particle diameter: 140 nm) as a function of ionic strength in a carbonate-rich synthetic groundwater. When the concentration of electrolyte is increased to induce aggregation, the aggregation is irreversible and the rate of aggregation increases with increasing electrolyte strength. We used autocorrelation photon spectroscopy to estimate the rate of particle aggregation for both types of colloids. By relating the measured aggregation rate to the Smoluchowski rate expression, we determined the stability ratio, W. Aggregation of silica particles and kaolinite clay particles decreased dramatically for an electrolyte concentration, C NaCl , below 300 mM and 200 mM, respectively

  5. Characterization of carrier transport properties in strained crystalline Si wall-like structures in the quasi-quantum regime

    Energy Technology Data Exchange (ETDEWEB)

    Mayberry, C. S.; Huang, Danhong, E-mail: danhong.huang@us.af.mil; Kouhestani, C. [Air Force Research Laboratory, Space Vehicles Directorate, Kirtland Air Force Base, New Mexico 87117 (United States); Balakrishnan, G. [Department of Electrical and Computer Engineering, University of New Mexico, Albuquerque, New Mexico 87106 (United States); Islam, N. [Department of Electrical and Computer Engineering, University of Missouri-Columbia, Columbia, Missouri 65211 (United States); Brueck, S. R. J. [Department of Electrical and Computer Engineering, University of New Mexico, Albuquerque, New Mexico 87106 (United States); Department of Physics and Astronomy, University of New Mexico, Albuquerque, New Mexico 87106 (United States); Sharma, A. K. [Air Force Research Laboratory, Space Vehicles Directorate, Kirtland Air Force Base, New Mexico 87117 (United States); Department of Electrical and Computer Engineering, University of New Mexico, Albuquerque, New Mexico 87106 (United States)

    2015-10-07

    We report the transport characteristics of both electrons and holes through narrow constricted crystalline Si “wall-like” long-channels that were surrounded by a thermally grown SiO{sub 2} layer. The strained buffering depth inside the Si region (due to Si/SiO{sub 2} interfacial lattice mismatch) is where scattering is seen to enhance some modes of the carrier-lattice interaction, while suppressing others, thereby changing the relative value of the effective masses of both electrons and holes, as compared to bulk Si. In the narrowest wall devices, a considerable increase in conductivity was observed as a result of higher carrier mobilities due to lateral constriction and strain. The strain effects, which include the reversal splitting of light- and heavy-hole bands as well as the decrease of conduction-band effective mass by reduced Si bandgap energy, are formulated in our microscopic model for explaining the experimentally observed enhancements in both conduction- and valence-band mobilities with reduced Si wall thickness. Also, the enhancements of the valence-band and conduction-band mobilities are found to be associated with different aspects of theoretical model.

  6. Identification and characterization of a novel Cut family cDNA that encodes human copper transporter protein CutC

    International Nuclear Information System (INIS)

    Li Jixi; Ji Chaoneng; Chen Jinzhong; Yang Zhenxing; Wang Yijing; Fei, Xiangwei; Zheng Mei; Gu Xing; Wen Ge; Xie Yi; Mao Yumin

    2005-01-01

    Copper is an essential heavy metal trace element that plays important roles in cell physiology. The Cut family was associated with the copper homeostasis and involved in several important metabolisms, such as uptake, storage, delivery, and efflux of copper. In this study, a novel Cut family cDNA was isolated from the human fetal brain library, which encodes a 273 amino acid protein with a molecular mass of about 29.3 kDa and a calculated pI of 8.17. It was named hCutC (human copper transporter protein CutC). The ORF of hCutC gene was cloned into pQE30 vector and expressed in Escherichia coli M15. The secreted hCutC protein was purified to a homogenicity of 95% by using the Ni-NTA affinity chromatography. RT-PCR analysis showed that the hCutC gene expressed extensively in human tissues. Subcellular location analysis of hCutC-EGFP fusion protein revealed that hCutC was distributed to cytoplasm of COS-7 cells, and both cytoplasm and nucleus of AD293 cells. The results suggest that hCutC may be one shuttle protein and play important roles in intracellular copper trafficking

  7. Characterizing the Asian Tropopause Aerosol Layer (ATAL) Using Satellite Observations, Balloon Measurements and a Chemical Transport Model

    Science.gov (United States)

    Fairlie, T. D.; Vernier, J.-P.; Liu, H.; Deshler, T.; Natarajan, M.; Bedka, K.; Wegner, T.; Baker, N.; Gadhavi, H.; Ratnam, M. V.; hide

    2016-01-01

    Satellite observations and numerical modeling studies have demonstrated that the Asian Summer Monsoon (ASM) provide a conduit for gas-phase pollutants in south Asia to reach the lower stratosphere. Now, observations from the CALIPSO satellite have revealed the Asian Tropopause Aerosol Layer (ATAL), a summertime accumulation of aerosols in the upper troposphere and lower stratosphere (UTLS), associated with the ASM anticyclone. The ATAL has potential implications for regional cloud properties, climate, and chemical processes in the UTLS. Here, we show in situ measurements from balloon-borne instruments, aircraft, and satellite observations, together with trajectory and chemical transport model (CTM) simulations to explore the origin, composition, physical, and optical properties of aerosols in the ATAL. In particular, we show balloon-data from our BATAL-2015 field campaign to India and Saudi Arabia in summer 2015, which includes in situ backscatter measurements from COBALD instruments, and the first observations of size and volatility of aerosols in the ATAL layer using optical particle counters (OPCs). Back trajectory calculations initialized from CALIPSO observations point to deep convection over North India as a principal source of ATAL aerosols. Available aircraft observations suggest significant sulfur and carbonaceous components to the ATAL, which is supported by simulations using the GEOS-Chem CTM. Source elimination studies conducted with the GEOS-Chem indicate that ATAL aerosols originate primary from south Asian sources, in contrast with some earlier studies.

  8. Caracterização do microclima dos diferentes layouts de caixas no transporte de ovos férteis Characterization of microclimate in different layout of boxes during transport of fertile eggs

    Directory of Open Access Journals (Sweden)

    Aérica C. Nazareno

    2013-03-01

    Full Text Available Quando as condições microclimáticas e de transporte são combinadas inadequadamente, os componentes dos ovos férteis podem ser danificados. Objetivou-se, com este trabalho, caracterizar e analisar a dependência espacial dos perfis microclimáticos no transporte de ovos férteis em diferentes layouts de caixas. A pesquisa foi conduzida na empresa integradora avícola, em Mogi Mirim, SP, por meio do acompanhamento de cinco carregamentos. Utilizou-se um caminhão climatizado do tipo baú, com capacidade para 592 caixas de ovos e se avaliaram dois layouts da carga (caixas superiores e inferiores de 9 pilhas com seis caixas de ovos férteis. Um microprocessador foi instalado dentro das caixas de ovos, totalizando 18 microprocessadores. As variáveis meteorológicas analisadas foram: temperatura (ºC umidade relativa (% e entalpia específica (kJ kg-1 ar seco. O delineamento experimental adotado foi o inteiramente casualizado com parcelas subdividas e realizada a análise geoestatística (krigagem ordinária. No layout das caixas superiores foram registrados valores elevados de temperatura e baixos valores de umidade relativa e entalpia específica. As regiões de piores condições microclimáticas nos dois layouts se situaram nas partes central e traseira do caminhão, durante o transporte dos ovos férteis.The fertile egg components may be damaged when the microclimatic conditions and transportation characteristics are combined inadequately. Thus, the aim of this study was to characterize and to assess the spatial dependence of microclimatic profiles during transport of fertile eggs with different layout of boxes. A trial was conducted in a commercial poultry industry in Mogi Mirim in the State of São Paulo, Brazil, through monitoring five loads of hatching eggs. An air conditioned truck was used, with maximum capacity of 592 egg boxes. Two layout of boxes were assessed in the present study. One data logger was installed inside the egg boxes

  9. MODERATOR ELEMENTS FOR UNIFORM POWER NUCLEAR REACTOR

    Science.gov (United States)

    Balent, R.

    1963-03-12

    This patent describes a method of obtaining a flatter flux and more uniform power generation across the core of a nuclear reactor. The method comprises using moderator elements having differing moderating strength. The elements have an increasing amount of the better moderating material as a function of radial and/or axial distance from the reactor core center. (AEC)

  10. Coded aperture imaging with uniformly redundant arrays

    International Nuclear Information System (INIS)

    Fenimore, E.E.; Cannon, T.M.

    1980-01-01

    A system is described which uses uniformly redundant arrays to image non-focusable radiation. The array is used in conjunction with a balanced correlation technique to provide a system with no artifacts so that virtually limitless signal-to-noise ratio is obtained with high transmission characteristics. The array is mosaicked to reduce required detector size over conventional array detectors. 15 claims

  11. School Uniform Revisited: Procedure, Pressure and Equality

    Science.gov (United States)

    Carney, Damian; Sinclair, Adele

    2006-01-01

    The House of Lords' decision in "R. (on the application of Begum) v. The Headteacher and Governors of Denbigh High School" considered whether a particular school uniform policy infringed a student's right to manifest her religion under Article 9. This paper analyses the content of this decision, and explores how schools should approach…

  12. School Uniforms in Urban Public High Schools

    Science.gov (United States)

    Draa, Virginia Ann Bendel

    2005-01-01

    The purpose of this study was to determine whether or not the implementation of a mandatory uniform policy in urban public high schools improved school performance measures at the building level for rates of attendance, graduation, academic proficiency, and student conduct as measured by rates of suspensions and expulsions. Sixty-four secondary…

  13. Mandatory School Uniforms and Freedom of Expression

    Science.gov (United States)

    Vopat, Mark C.

    2010-01-01

    On 10 December 2007 the Akron City School Board--following the precedent set by many school systems across the United States and the world--instituted a policy of mandatory school uniforms for all students in grades K-8. The measure was met with mixed reviews. While many parents supported the measure, a small group of parents from a selective,…

  14. Dynamic Uniform Scaling for Multiobjective Genetic Algorithms

    DEFF Research Database (Denmark)

    Pedersen, Gerulf; Goldberg, David E.

    2004-01-01

    Before Multiobjective Evolutionary Algorithms (MOEAs) can be used as a widespread tool for solving arbitrary real world problems there are some salient issues which require further investigation. One of these issues is how a uniform distribution of solutions along the Pareto non-dominated front c...

  15. UMAPRM: Uniformly sampling the medial axis

    KAUST Repository

    Yeh, Hsin-Yi Cindy

    2014-05-01

    © 2014 IEEE. Maintaining clearance, or distance from obstacles, is a vital component of successful motion planning algorithms. Maintaining high clearance often creates safer paths for robots. Contemporary sampling-based planning algorithms That utilize The medial axis, or The set of all points equidistant To Two or more obstacles, produce higher clearance paths. However, They are biased heavily Toward certain portions of The medial axis, sometimes ignoring parts critical To planning, e.g., specific Types of narrow passages. We introduce Uniform Medial Axis Probabilistic RoadMap (UMAPRM), a novel planning variant That generates samples uniformly on The medial axis of The free portion of Cspace. We Theoretically analyze The distribution generated by UMAPRM and show its uniformity. Our results show That UMAPRM\\'s distribution of samples along The medial axis is not only uniform but also preferable To other medial axis samplers in certain planning problems. We demonstrate That UMAPRM has negligible computational overhead over other sampling Techniques and can solve problems The others could not, e.g., a bug Trap. Finally, we demonstrate UMAPRM successfully generates higher clearance paths in The examples.

  16. An analysis of the uniform core experiment

    Energy Technology Data Exchange (ETDEWEB)

    Waterson, R H

    1973-10-15

    This report describes an analysis of the Uniform Core of HITREX using the WIMS E codes, and presents the results of theory/experiment comparisons. The overall picture is one of good agreement for core reaction rate distributions, but theory umderestimating k{sub eff} by about 1.5% {delta}k/k.

  17. Evaluation model development for sprinkler irrigation uniformity ...

    African Journals Online (AJOL)

    use

    Sprinkle and trickle irrigation. The. Blackburn Press, New Jersey, USA. Li JS, Rao MJ (1999). Evaluation method of sprinkler irrigation nonuniformity. Trans. CSAE. 15(4): 78-82. Lin Z, Merkley GP (2011). Relationships between common irrigation application uniformity indicators. Irrig Sci. Online First™, 27 January. 2011.

  18. Uniform semiclassical approximation for absorptive scattering systems

    International Nuclear Information System (INIS)

    Hussein, M.S.; Pato, M.P.

    1987-07-01

    The uniform semiclassical approximation of the elastic scattering amplitude is generalized to absorptive systems. An integral equation is derived which connects the absorption modified amplitude to the absorption free one. Division of the amplitude into a diffractive and refractive components is then made possible. (Author) [pt

  19. Magnetostatics of the uniformly polarized torus

    DEFF Research Database (Denmark)

    Beleggia, Marco; De Graef, Marc; Millev, Yonko

    2009-01-01

    We provide an exhaustive description of the magnetostatics of the uniformly polarized torus and its derivative self-intersecting (spindle) shapes. In the process, two complementary approaches have been implemented, position-space analysis of the Laplace equation with inhomogeneous boundary condit...

  20. Dynamic Uniform Scaling for Multiobjective Genetic Algorithms

    DEFF Research Database (Denmark)

    Pedersen, Gerulf; Goldberg, D.E.

    2004-01-01

    Before Multiobjective Evolutionary Algorithms (MOEAs) can be used as a widespread tool for solving arbitrary real world problems there are some salient issues which require further investigation. One of these issues is how a uniform distribution of solutions along the Pareto non-dominated front can...

  1. Improving rooting uniformity in rose cuttings

    NARCIS (Netherlands)

    Telgen, van H.J.; Eveleens-Clark, B.A.; Garcia Victoria, N.

    2007-01-01

    Studies to improve rooting uniformity of single node stem cuttings for rose are reported. We found that the variation in shoot growth in a young rose crop depended on the variation in root number of the cuttings, which, in turn, was related to the auxin concentration applied to the cutting before

  2. Downsampling Non-Uniformly Sampled Data

    Directory of Open Access Journals (Sweden)

    Fredrik Gustafsson

    2007-10-01

    Full Text Available Decimating a uniformly sampled signal a factor D involves low-pass antialias filtering with normalized cutoff frequency 1/D followed by picking out every Dth sample. Alternatively, decimation can be done in the frequency domain using the fast Fourier transform (FFT algorithm, after zero-padding the signal and truncating the FFT. We outline three approaches to decimate non-uniformly sampled signals, which are all based on interpolation. The interpolation is done in different domains, and the inter-sample behavior does not need to be known. The first one interpolates the signal to a uniformly sampling, after which standard decimation can be applied. The second one interpolates a continuous-time convolution integral, that implements the antialias filter, after which every Dth sample can be picked out. The third frequency domain approach computes an approximate Fourier transform, after which truncation and IFFT give the desired result. Simulations indicate that the second approach is particularly useful. A thorough analysis is therefore performed for this case, using the assumption that the non-uniformly distributed sampling instants are generated by a stochastic process.

  3. Evaluation model development for sprinkler irrigation uniformity ...

    African Journals Online (AJOL)

    A new evaluation method with accompanying software was developed to precisely calculate uniformity from catch-can test data, assuming sprinkler distribution data to be a continuous variable. Two interpolation steps are required to compute unknown water application depths at grid distribution points from radial ...

  4. uniform van die staatspresidentswag - herkoms en tradisie

    African Journals Online (AJOL)

    A blue uniform was inter alia proposed in 1980 but finally rejected by the Prime Minister in 1984. Instructions were issued to put forth new ideas. All the arguments in ..... In 1896 Is die rang van kommandant van die Staatsartlllerie verhoog tot die van lultenant-kolonel. Henning Pretorlus, father and first commandant of the.

  5. Characterization of rainwater chemical composition after a Southeast Asia haze event: insight of transboundary pollutant transport during the northeast monsoon.

    Science.gov (United States)

    Nadzir, Mohd Shahrul Mohd; Lin, Chin Yik; Khan, Md Firoz; Latif, Mohd Talib; Dominick, Doreena; Hamid, Haris Hafizal Abdul; Mohamad, Noorlin; Maulud, Khairul Nizam Abdul; Wahab, Muhammad Ikram Abdul; Kamaludin, Nurul Farahana; Lazim, Mohamad Azwani Shah Mat

    2017-06-01

    Open biomass burning in Peninsula Malaysia, Sumatra, and parts of the Indochinese region is a major source of transboundary haze pollution in the Southeast Asia. To study the influence of haze on rainwater chemistry, a short-term investigation was carried out during the occurrence of a severe haze episode from March to April 2014. Rainwater samples were collected after a prolonged drought and analyzed for heavy metals and major ion concentrations using inductively coupled plasma mass spectroscopy (ICP-MS) and ion chromatography (IC), respectively. The chemical composition and morphology of the solid particulates suspended in rainwater were examined using a scanning electron microscope coupled with energy-dispersive X-ray spectroscopy (SEM-EDS). The dataset was further interpreted using enrichment factors (EF), statistical analysis, and a back trajectory (BT) model to find the possible sources of the particulates and pollutants. The results show a drop in rainwater pH from near neutral (pH 6.54) to acidic (transported from the mainland of Indo-China and the marine region in the South China Sea were responsible for the high pollution event in the study area. These findings can be useful in identifying contributions of pollutants from single or multiple sources in rainwater samples during haze episodes.

  6. Transport and accumulation of PVP-Hypericin in cancer and normal cells characterized by image correlation spectroscopy techniques.

    Science.gov (United States)

    Penjweini, Rozhin; Smisdom, Nick; Deville, Sarah; Ameloot, Marcel

    2014-05-01

    PVP-Hypericin (PVP: polyvinylpyrrolidone) is a potent anti-cancer photosensitizer for photodynamic diagnosis (PDD) and therapy (PDT). However, cellular targets and mechanisms involved in the cancer-selectivity of the photosensitizer are not yet fully understood. This paper gives new insights into the differential transport and localization of PVP-Hypericin in cancer and normal cells which are essential to unravel the mechanisms of action and cancer-selectivity. Temporal (TICS) and spatiotemporal (STICS) image correlation spectroscopy are used for the assessment of PVP-Hypericin diffusion and/or velocity in the case of concerted flow in human cervical epithelial HeLa and human lung carcinoma A549 cells, as well as in human primary dendritic cells (DC) and human peripheral blood mononuclear cells (PBMC). Spatiotemporal image cross-correlation spectroscopy (STICCS) based on organelle specific fluorescent labeling is employed to study the accumulation of the photosensitizer in nucleus, mitochondria, early-endosomes and lysosomes of the cells and to assess the dynamics of co-migrating molecules. Whereas STICS and TICS did not show a remarkable difference between the dynamics of PVP-Hypericin in HeLa, A549 and DC cells, a significantly different diffusion rate of the photosensitizer was measured in PBMC. STICCS detected a stationary accumulation of PVP-Hypericin within the nucleus, mitochondria, early endosomes and lysosomes of HeLa and A549 cells. However, significant flow due to the directed motion of the organelles was detected. In contrast, no accumulation in the nucleus and mitochondria of DC and PBMC could be monitored. Copyright © 2014 Elsevier B.V. All rights reserved.

  7. Characterization of a novel cation transporter ATPase gene (ATP13A4) interrupted by 3q25-q29 inversion in an individual with language delay.

    Science.gov (United States)

    Kwasnicka-Crawford, Dorota A; Carson, Andrew R; Roberts, Wendy; Summers, Anne M; Rehnström, Karola; Järvelä, Irma; Scherer, Stephen W

    2005-08-01

    Specific language impairment (SLI) is defined as failure to acquire normal language skills despite adequate intelligence and environmental stimulation. Although SLI disorders are often heritable, the genetic basis is likely to involve a number of risk factors. This study describes a 7-year-old girl carrying an inherited paracentric inversion of the long arm of chromosome 3 [46XX, inv(3)(q25.32-q29)] having clinically defined expressive and receptive language delay. Fluorescence in situ hybridization (FISH) with locus-specific bacterial artificial chromosome clones (BACs) as probes was used to characterize the inverted chromosome 3. The proximal and distal inversion breakpoint was found to reside between markers D3S3692/D3S1553 and D3S3590/D3S2305, respectively. ATP13A4, a novel gene coding for a cation-transporting P-type ATPase, was found to be disrupted by the distal breakpoint. The ATP13A4 gene was shown to comprise a 3591-bp transcript encompassing 30 exons spanning 152 kb of the genomic DNA. This study discusses the characterization of ATP13A4 and its possible involvement in speech-language disorder.

  8. Uniform Foam Crush Testing for Multi-Mission Earth Entry Vehicle Impact Attenuation

    Science.gov (United States)

    Patterson, Byron W.; Glaab, Louis J.

    2012-01-01

    Multi-Mission Earth Entry Vehicles (MMEEVs) are blunt-body vehicles designed with the purpose of transporting payloads from outer space to the surface of the Earth. To achieve high-reliability and minimum weight, MMEEVs avoid use of limited-reliability systems, such as parachutes and retro-rockets, instead using built-in impact attenuators to absorb energy remaining at impact to meet landing loads requirements. The Multi-Mission Systems Analysis for Planetary Entry (M-SAPE) parametric design tool is used to facilitate the design of MMEEVs and develop the trade space. Testing was conducted to characterize the material properties of several candidate impact foam attenuators to enhance M-SAPE analysis. In the current effort, four different Rohacell foams are tested at three different, uniform, strain rates (approximately 0.17, approximately 100, approximately 13,600%/s). The primary data analysis method uses a global data smoothing technique in the frequency domain to remove noise and system natural frequencies. The results from the data indicate that the filter and smoothing technique are successful in identifying the foam crush event and removing aberrations. The effect of strain rate increases with increasing foam density. The 71-WF-HT foam may support Mars Sample Return requirements. Several recommendations to improve the drop tower test technique are identified.

  9. Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7

    Energy Technology Data Exchange (ETDEWEB)

    McKee, Courtney H.; Onder, Zeynep; Ashok, Aditya; Cardoso, Rebeca; Moroianu, Junona, E-mail: moroianu@bc.edu

    2013-08-15

    We previously discovered that nuclear import of low risk HPV11 E7 is mediated by its zinc-binding domain via a pathway that is independent of karyopherins/importins (Piccioli et al., 2010. Virology 407, 100–109). In this study we mapped and characterized a leucine-rich nuclear export signal (NES), {sub 76}IRQLQDLLL{sub 84}, within the zinc-binding domain that mediates the nuclear export of HPV11 E7 in a CRM1-dependent manner. We also identified a mostly hydrophobic patch {sub 65}VRLVV{sub 69} within the zinc-binding domain that mediates nuclear import of HPV11 E7 via hydrophobic interactions with the FG-repeats domain of Nup62. Substitutions of hydrophobic residues to alanine within the {sub 65}VRLVV{sub 69} sequence disrupt the nuclear localization of 11E7, whereas the R66A mutation has no effect. Overall the data support a model of nuclear entry of HPV11 E7 protein via hydrophobic interactions with FG nucleoporins at the nuclear pore complex. - Highlights: • HPV11 E7 has a leucine-rich nuclear export signal that mediates its nuclear export via CRM1. • HPV11 E7 interacts via its unique cNLS with the FG domain of Nup62. • Identification of a hydrophobic patch essential for nuclear localization of HPV11 E7.

  10. Characterization of the transport signals that mediate the nucleocytoplasmic traffic of low risk HPV11 E7

    International Nuclear Information System (INIS)

    McKee, Courtney H.; Onder, Zeynep; Ashok, Aditya; Cardoso, Rebeca; Moroianu, Junona

    2013-01-01

    We previously discovered that nuclear import of low risk HPV11 E7 is mediated by its zinc-binding domain via a pathway that is independent of karyopherins/importins (Piccioli et al., 2010. Virology 407, 100–109). In this study we mapped and characterized a leucine-rich nuclear export signal (NES), 76 IRQLQDLLL 84 , within the zinc-binding domain that mediates the nuclear export of HPV11 E7 in a CRM1-dependent manner. We also identified a mostly hydrophobic patch 65 VRLVV 69 within the zinc-binding domain that mediates nuclear import of HPV11 E7 via hydrophobic interactions with the FG-repeats domain of Nup62. Substitutions of hydrophobic residues to alanine within the 65 VRLVV 69 sequence disrupt the nuclear localization of 11E7, whereas the R66A mutation has no effect. Overall the data support a model of nuclear entry of HPV11 E7 protein via hydrophobic interactions with FG nucleoporins at the nuclear pore complex. - Highlights: • HPV11 E7 has a leucine-rich nuclear export signal that mediates its nuclear export via CRM1. • HPV11 E7 interacts via its unique cNLS with the FG domain of Nup62. • Identification of a hydrophobic patch essential for nuclear localization of HPV11 E7

  11. Comparative evaluation between montmorillonite clay/LLDPE and potassium hexaniobate/LLDPE nanocomposites: characterization of mechanical and transport properties

    International Nuclear Information System (INIS)

    Komatsu, Daniel; Otaguro, Harumi; Ruvolo Filho, Adhemar C.

    2014-01-01

    Linear low density polyethylene-montmorillonite clay and linear low density polyethylene-organophilic niobate nanocomposites were obtained from dilution of masterbatch with 20% w/w of fillers in the LLDPE matrix by melt intercalation using a twin-screw extruder, obtaining nanocomposites with 1.5% up to 10.0% w/w of filler. In this study mechanical and water vapor and oxygen permeation tests were used to characterize the nanocomposites. In mechanical tests an increase of modulus values and decrease of toughness value by increasing concentration of montmorillonite clay were observed. The behavior of LLDPE-organophilic niobate nanocomposites was similar to LLDPE-montmorillonite clay nanocomposites but softer due to hexaniobate structure. The distribution of the organoclay is more homogeneous than organophilic niobate to concentrations below 10.0% filler using the SEM/FEG. It is possible to see a decrease in the permeability value with increasing concentration of montmorillonite clay for both gases used. In the LLDPE-organophilic niobate nanocomposites a decrease of permeability value occurs followed by an increase of permeability value for both gases used, with increasing concentration of organophilic niobate. Furthermore, it was observed that the polarity of the gas used is an important factor in the diffusion process through the nanocomposite. (author)

  12. Molecular cloning and characterization of the porcine prostaglandin transporter (SLCO2A1: evaluation of its role in F4 mediated neonatal diarrhoea

    Directory of Open Access Journals (Sweden)

    Cox Eric

    2009-10-01

    Full Text Available Abstract Background Because prostaglandins are involved in many (pathophysiological processes, SLCO2A1 was already characterized in several species in an attempt to unravel specific processes/deficiencies. Here, we describe the molecular cloning and characterization of the porcine ortholog in order to evaluate its possible involvement in F4 enterotoxigenic E. coli mediated neonatal diarrhoea, based on a positional candidate gene approach study. Results Porcine SLCO2A1 is organized in 14 exons, containing an open reading frame of 1935 bp, encoding a 12-transmembrane organic anion cell surface transporter of 644 aa. The -388 to -5 upstream region comprises a (CpG48 island containing a number of conserved promoter elements, including a TATA box. A potential alternative promoter region was found in the conserved -973 to -700 upstream region. No consensus polyadenylation signal was discovered in the 3' UTR. Repeat sequences were found in 15% of all the non coding sequences. As expected for a multifunctional protein, a wide tissue distribution was observed. mRNA expression was found in the adrenal gland, bladder, caecum, colon (centripetal coil/centrifugal coil, diaphragm, duodenum, gallbladder, heart, ileum, jejunum, kidney, liver, longissimus dorsi muscle, lung, lymph node, mesenterium, rectum, spleen, stomach, tongue and ureter, but not in the aorta, oesophagus and pancreas. The promoter region and the exons (including the splice sites of SLCO2A1 were resequenced in 5 F4ab/ac receptor positive and 5 F4ab/ac receptor negative pigs. Two silent and 2 missense (both S → L at position 360 and 633 mutations were found, but none was associated with the F4ab/ac receptor phenotype. In addition, no phenotype associated differential mRNA expression or alternative/abberant splicing/polyadenylation was found in the jejunum. Conclusion The molecular cloning and characterization of porcine SLCO2A1 not only contributes to the already existing knowledge about the

  13. Multi-Scale Thermal Heat Tracer Tests for Characterizing Transport Processes and Flow Channelling in Fractured Media: Theory and Field Experiments

    Science.gov (United States)

    de La Bernardie, J.; Klepikova, M.; Bour, O.; Le Borgne, T.; Dentz, M.; Guihéneuf, N.; Gerard, M. F.; Lavenant, N.

    2017-12-01

    The characterization of flow and transport in fractured media is particularly challenging because hydraulic conductivity and transport properties are often strongly dependent on the geometric structure of the fracture surfaces. Here we show how thermal tracer tests may be an excellent complement to conservative solute tracer tests to infer fracture geometry and flow channeling. We performed a series of thermal tracer tests at different scales in a crystalline rock aquifer at the experimental site of Ploemeur (H+ observatory network). The first type of thermal tracer tests are push-pull tracer tests at different scales. The temporal and spatial scaling of heat recovery, measured from thermal breakthrough curves, shows a clear signature of flow channeling. In particular, the late time tailing of heat recovery under channeled flow is shown to diverge from the T(t) α t-1,5 behavior expected for the classical parallel plate model and follow the scaling T(t) α 1/t(logt)2 for a simple channel modeled as a tube. Flow channeling is also manifested on the spatial scaling of heat recovery as flow channeling affects the decay of the thermal breakthrough peak amplitude and the increase of the peak time with scale. The second type of thermal tracer tests are flow-through tracer tests where a pulse of hot water was injected in a fracture isolated by a double straddle packer while pumping at the same flow rate in another fracture at a distance of about 10 meters to create a dipole flow field. Comparison with a solute tracer test performed under the same conditions also present a clear signature of flow channeling. We derive analytical expressions for the retardation and decay of the thermal breakthrough peak amplitude for different fracture geometries and show that the observed differences between thermal and solute breakthrough can be explained only by channelized flow. These results suggest that heat transport is much more sensitive to fracture heterogeneity and flow

  14. Uniform Sampling Table Method and its Applications II--Evaluating the Uniform Sampling by Experiment.

    Science.gov (United States)

    Chen, Yibin; Chen, Jiaxi; Chen, Xuan; Wang, Min; Wang, Wei

    2015-01-01

    A new method of uniform sampling is evaluated in this paper. The items and indexes were adopted to evaluate the rationality of the uniform sampling. The evaluation items included convenience of operation, uniformity of sampling site distribution, and accuracy and precision of measured results. The evaluation indexes included operational complexity, occupation rate of sampling site in a row and column, relative accuracy of pill weight, and relative deviation of pill weight. They were obtained from three kinds of drugs with different shape and size by four kinds of sampling methods. Gray correlation analysis was adopted to make the comprehensive evaluation by comparing it with the standard method. The experimental results showed that the convenience of uniform sampling method was 1 (100%), odds ratio of occupation rate in a row and column was infinity, relative accuracy was 99.50-99.89%, reproducibility RSD was 0.45-0.89%, and weighted incidence degree exceeded the standard method. Hence, the uniform sampling method was easy to operate, and the selected samples were distributed uniformly. The experimental results demonstrated that the uniform sampling method has good accuracy and reproducibility, which can be put into use in drugs analysis.

  15. Rolling Force Prediction in Heavy Plate Rolling Based on Uniform Differential Neural Network

    Directory of Open Access Journals (Sweden)

    Fei Zhang

    2016-01-01

    Full Text Available Accurate prediction of the rolling force is critical to assuring the quality of the final product in steel manufacturing. Exit thickness of plate for each pass is calculated from roll gap, mill spring, and predicted roll force. Ideal pass scheduling is dependent on a precise prediction of the roll force in each pass. This paper will introduce a concept that allows obtaining the material model parameters directly from the rolling process on an industrial scale by the uniform differential neural network. On the basis of the characteristics that the uniform distribution can fully characterize the solution space and enhance the diversity of the population, uniformity research on differential evolution operator is made to get improved crossover with uniform distribution. When its original function is transferred with a transfer function, the uniform differential evolution algorithms can quickly solve complex optimization problems. Neural network structure and weights threshold are optimized by uniform differential evolution algorithm, and a uniform differential neural network is formed to improve rolling force prediction accuracy in process control system.

  16. A Multi-Tracer Approach to Characterize Sources and Transport of Nitrate in Groundwater in Mantled Karst, Northern Florida

    Science.gov (United States)

    Katz, B. G.; Bohlke, J.; Hornsby, D.

    2001-05-01

    Nitrate is readily transported from agricultural activities at the surface to the Upper Floridan aquifer in northern Florida due to karst features mantled by highly permeable sands and a high recharge rate (50 cm/yr). In Suwannee and Lafayette Counties, nitrate contamination of groundwater is widespread due to the 10-30 kg/ha nitrogen (N) applied annually for the past few decades as synthetic fertilizers (the dominant source of N). Water samples were collected from 12 springs during baseflow conditions (1997-99) and monthly from 14 wells (1998-99). Springwaters were analyzed for various chemical (N species, dissolved gases, CFCs) and isotopic tracers (15N, 3H/3He, 18O, D, 13C). Water from wells was analyzed monthly for N species, and during low-flow and high-flow conditions for 15N, 18O, D, and 13C. As a result of oxic conditions in the aquifer, nitrate was the dominant N species in water samples. Large monthly fluctuations of groundwater nitrate concentrations were observed at most wells. Relatively high nitrate concentrations in groundwater from 7 wells likely resulted from seasonal agricultural practices including fertilizer applications and manure spreading on cropland. Relatively low nitrate concentrations in groundwater from two wells during high-flow conditions were related to mixing with river water. Groundwater samples had N-isotope values (3.8-11.7 per mil) that indicated varying mixtures of inorganic and organic N sources, which corresponded in part to varying proportions of synthetic fertilizers and manure applied to fields. In springwaters from Suwannee County, nitrate trends and N-isotope data (2.7-6.2 per mil) were consistent with a peak in fertilizer N input in the late 1970's and a relatively high overall ratio of artificial fertilizer/manure. In contrast, springwater nitrate trends and N-isotope data (4.5-9.1 per mil) in Lafayette County were consistent with a more monotonic increase in fertilizer N input and relatively low overall ratio of

  17. Characterization of atmospheric bioaerosols along the transport pathway of Asian dust during the Dust-Bioaerosol 2016 Campaign

    Science.gov (United States)

    Tang, Kai; Huang, Zhongwei; Huang, Jianping; Maki, Teruya; Zhang, Shuang; Shimizu, Atsushi; Ma, Xiaojun; Shi, Jinsen; Bi, Jianrong; Zhou, Tian; Wang, Guoyin; Zhang, Lei

    2018-05-01

    Previous studies have shown that bioaerosols are injected into the atmosphere during dust events. These bioaerosols may affect leeward ecosystems, human health, and agricultural productivity and may even induce climate change. However, bioaerosol dynamics have rarely been investigated along the transport pathway of Asian dust, especially in China where dust events affect huge areas and massive numbers of people. Given this situation, the Dust-Bioaerosol (DuBi) Campaign was carried out over northern China, and the effects of dust events on the amount and diversity of bioaerosols were investigated. The results indicate that the number of bacteria showed remarkable increases during the dust events, and the diversity of the bacterial communities also increased significantly, as determined by means of microscopic observations with 4,6-diamidino-2-phenylindole (DAPI) staining and MiSeq sequencing analysis. These results indicate that dust clouds can carry many bacteria of various types into downwind regions and may have potentially important impacts on ecological environments and climate change. The abundances of DAPI-stained bacteria in the dust samples were 1 to 2 orders of magnitude greater than those in the non-dust samples and reached 105-106 particles m-3. Moreover, the concentration ratios of DAPI-stained bacteria to yellow fluorescent particles increased from 5.1 % ± 6.3 % (non-dust samples) to 9.8 % ± 6.3 % (dust samples). A beta diversity analysis of the bacterial communities demonstrated the distinct clustering of separate prokaryotic communities in the dust and non-dust samples. Actinobacteria, Bacteroidetes, and Proteobacteria remained the dominant phyla in all samples. As for Erenhot, the relative abundances of Acidobacteria and Chloroflexi had a remarkable rise in dust events. In contrast, the relative abundances of Acidobacteria and Chloroflexi in non-dust samples of R-DzToUb were greater than those in dust samples. Alphaproteobacteria made the major

  18. Uniformity testing: assessment of a centralized web-based uniformity analysis system.

    Science.gov (United States)

    Klempa, Meaghan C

    2011-06-01

    Uniformity testing is performed daily to ensure adequate camera performance before clinical use. The aim of this study is to assess the reliability of Beth Israel Deaconess Medical Center's locally built, centralized, Web-based uniformity analysis system by examining the differences between manufacturer and Web-based National Electrical Manufacturers Association integral uniformity calculations measured in the useful field of view (FOV) and the central FOV. Manufacturer and Web-based integral uniformity calculations measured in the useful FOV and the central FOV were recorded over a 30-d period for 4 cameras from 3 different manufacturers. These data were then statistically analyzed. The differences between the uniformity calculations were computed, in addition to the means and the SDs of these differences for each head of each camera. There was a correlation between the manufacturer and Web-based integral uniformity calculations in the useful FOV and the central FOV over the 30-d period. The average differences between the manufacturer and Web-based useful FOV calculations ranged from -0.30 to 0.099, with SD ranging from 0.092 to 0.32. For the central FOV calculations, the average differences ranged from -0.163 to 0.055, with SD ranging from 0.074 to 0.24. Most of the uniformity calculations computed by this centralized Web-based uniformity analysis system are comparable to the manufacturers' calculations, suggesting that this system is reasonably reliable and effective. This finding is important because centralized Web-based uniformity analysis systems are advantageous in that they test camera performance in the same manner regardless of the manufacturer.

  19. Development of electrochemical supercapacitors with uniform nanoporous silver network

    International Nuclear Information System (INIS)

    Li, Rui; Liu, Xiongjun; Wang, Hui; Wu, Yuan; Lu, Z.P.

    2015-01-01

    Metal oxides such as manganese dioxide (MnO 2 ) are often used as electrode materials for supercapacitors due to their high specific capacitance. In practice, however, their specific capacitance is much smaller than the theoretical limit due to the low electrical conductivity and serious agglomeration. In the present work, we demonstrate that highly conductive nanoporous silver (NPS) network with uniform continuous nanoporosity and high surface area which was fabricated by dealloying Ag-Mg-Ca metallic glasses can be employed as supports and collectors for MnO 2 capacitors. By plating the MnO 2 nanocrystals into the nanopore structure, the NPS/MnO 2 composite electrode provides fast ionic conduction and excellent electron-proton transport, resulting in an ultrahigh specific capacitance of the plated active MnO 2 (∼1088 F g −1 ), which is close to the theoretical limit. The unique combination of high specific capacitance and long cycle life enhanced by the current composite structure makes the NPS/MnO 2 composite promising for electrochemical supercapacitor as electrode material. In addition, our findings suggest that the uniform NPS network is capable for improving capacitance performance of metal oxides in electrochemical supercapacitors.

  20. Development and characterization of a high yield transportable pulsed neutron source with efficient and compact pulsed power system

    Energy Technology Data Exchange (ETDEWEB)

    Verma, Rishi, E-mail: rishiv9@gmail.com, E-mail: rishiv@barc.gov.in; Mishra, Ekansh; Dhang, Prosenjit; Sagar, Karuna; Meena, Manraj; Shyam, Anurag [Energetics and Electromagnetics Division, Bhabha Atomic Research Centre Autonagar, Vishakapatnam 530012 (India)

    2016-09-15

    The results of characterization experiments carried out on a newly developed dense plasma focus device based intense pulsed neutron source with efficient and compact pulsed power system are reported. Its high current sealed pseudospark switch based low inductance capacitor bank with maximum stored energy of ∼10 kJ is segregated into four modules of ∼2.5 kJ each and it cumulatively delivers peak current in the range of 400 kA–600 kA (corresponding to charging voltage range of 14 kV–18 kV) in a quarter time period of ∼2 μs. The neutron yield performance of this device has been optimized by discretely varying deuterium filling gas pressure in the range of 6 mbar–11 mbar at ∼17 kV/550 kA discharge. At ∼7 kJ/8.5 mbar operation, the average neutron yield has been measured to be in the order of ∼4 × 10{sup 9} neutrons/pulse which is the highest ever reported neutron yield from a plasma focus device with the same stored energy. The average forward to radial anisotropy in neutron yield is found to be ∼2. The entire system is contained on a moveable trolley having dimensions 1.5 m × 1 m × 0.7 m and its operation and control (up to the distance of 25 m) are facilitated through optically isolated handheld remote console. The overall compactness of this system provides minimum proximity to small as well as large samples for irradiation. The major intended application objective of this high neutron yield dense plasma focus device development is to explore the feasibility of active neutron interrogation experiments by utilization of intense pulsed neutron sources.

  1. Detecting Uniform Areas for Vicarious Calibration using Landsat TM Imagery: A Study using the Arabian and Saharan Deserts

    Science.gov (United States)

    Hilbert, Kent; Pagnutti, Mary; Ryan, Robert; Zanoni, Vicki

    2002-01-01

    This paper discusses a method for detecting spatially uniform sites need for radiometric characterization of remote sensing satellites. Such information is critical for scientific research applications of imagery having moderate to high resolutions (African Saharan and Arabian deserts contained extremely uniform sites with respect to spatial characteristics. We developed an algorithm for detecting site uniformity and applied it to orthorectified Landsat Thematic Mapper (TM) imagery over eight uniform regions of interest. The algorithm's results were assessed using both medium-resolution (30-m GSD) Landsat 7 ETM+ and fine-resolution (research shows that Landsat TM products appear highly useful for detecting potential calibration sites for system characterization. In particular, the approach detected spatially uniform regions that frequently occur at multiple scales of observation.

  2. 24 CFR 5.801 - Uniform financial reporting standards.

    Science.gov (United States)

    2010-04-01

    ... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Uniform financial reporting... and Urban Development GENERAL HUD PROGRAM REQUIREMENTS; WAIVERS Uniform Financial Reporting Standards § 5.801 Uniform financial reporting standards. (a) Applicability. This subpart H implements uniform...

  3. Activity uniformity of Ir-192 seeds

    International Nuclear Information System (INIS)

    Ling, C.C.; Gromadzki, Z.C.

    1981-01-01

    A simple device that uses materials and apparatus commonly available in a radiotherapy department has been designed, fabricated and used in routine quality control relative to the activity uniformity of clinical Ir-192 seeds in ribbons. Detailed evaluation indicated that this system is easy to use and can yield relative activity measurements of individual Ir-192 seeds accurate to within 2%. With this device, activity uniformity of commercial Ir-192 seeds from two manufacturers has been assessed. For the seven shipments of Ir-192 seeds studied, the root mean square variations of individual seed strength from the average of each shipment ranged from 3.4 to 7.1%. Variation in seed activity by more than +- 10% from the average is not uncommon

  4. Non-uniform tube representation of proteins

    DEFF Research Database (Denmark)

    Hansen, Mikael Sonne

    Treating the full protein structure is often neither computationally nor physically possible. Instead one is forced to consider various reduced models capturing the properties of interest. Previous work have used tubular neighborhoods of the C-alpha backbone. However, assigning a unique radius...... might not correctly capture volume exclusion - of crucial importance when trying to understand a proteins $3$d-structure. We propose a new reduced model treating the protein as a non-uniform tube with a radius reflecting the positions of atoms. The tube representation is well suited considering X......-ray crystallographic resolution ~ 3Å while a varying radius accounts for the different sizes of side chains. Such a non-uniform tube better capture the protein geometry and has numerous applications in structural/computational biology from the classification of protein structures to sequence-structure prediction....

  5. Casimir energy for a piecewise uniform string

    International Nuclear Information System (INIS)

    Brevik, I.; Nielsen, H.B.

    1989-07-01

    The Casimir energy for the transverse oscillations of a piecewise uniform closed string is calculated. The string consists of two parts I and II, endowed in general with different tensions and mass densities, although adjusted in such a way that the velocity of sound always equals the velocity of light. The dispersion equation is worked out under general conditions, and the frequency spectrum is determined in special cases. When the ratio L II /L I between the string lengths is an integer, it is in principle possible to determine the frequency spectrum through solving algebraic equations of increasingly high degree. The Casimir energy relative to the uniform string is in general found to be negative, although in the special case L I =L II the energy is equal to zero. Delicate points in the regularization procedure are discussed; they point toward an anomaly in the theory. (orig.)

  6. Kinetic theory of nonlinear transport phenomena in complex plasmas

    International Nuclear Information System (INIS)

    Mishra, S. K.; Sodha, M. S.

    2013-01-01

    In contrast to the prevalent use of the phenomenological theory of transport phenomena, a number of transport properties of complex plasmas have been evaluated by using appropriate expressions, available from the kinetic theory, which are based on Boltzmann's transfer equation; in particular, the energy dependence of the electron collision frequency has been taken into account. Following the recent trend, the number and energy balance of all the constituents of the complex plasma and the charge balance on the particles is accounted for; the Ohmic loss has also been included in the energy balance of the electrons. The charging kinetics for the complex plasma comprising of uniformly dispersed dust particles, characterized by (i) uniform size and (ii) the Mathis, Rumpl, and Nordsieck power law of size distribution has been developed. Using appropriate expressions for the transport parameters based on the kinetic theory, the system of equations has been solved to investigate the parametric dependence of the complex plasma transport properties on the applied electric field and other plasma parameters; the results are graphically illustrated.

  7. Uniform analytic approximation of Wigner rotation matrices

    Science.gov (United States)

    Hoffmann, Scott E.

    2018-02-01

    We derive the leading asymptotic approximation, for low angle θ, of the Wigner rotation matrix elements, dm1m2 j(θ ) , uniform in j, m1, and m2. The result is in terms of a Bessel function of integer order. We numerically investigate the error for a variety of cases and find that the approximation can be useful over a significant range of angles. This approximation has application in the partial wave analysis of wavepacket scattering.

  8. Physical optics in a uniform gravitational field

    Science.gov (United States)

    Hacyan, Shahen

    2012-01-01

    The motion of a (quasi-)plane wave in a uniform gravitational field is studied. It is shown that the energy of an elliptically polarized wave does not propagate along a geodesic, but in a direction that is rotated with respect to the gravitational force. The similarity with the walk-off effect in anisotropic crystals or the optical Magnus effect in inhomogeneous media is pointed out.

  9. 78 FR 50359 - Civilian Health and Medical Program of the Uniformed Services (CHAMPUS); TRICARE Uniform Health...

    Science.gov (United States)

    2013-08-19

    ... Organization (HMO) Benefit--Prime Enrollment Fee Exemption for Survivors of Active Duty Deceased Sponsors and... Enrollment Fee Exemption for Survivors of Active Duty Deceased Sponsors and Medically Retired Uniformed Services [[Page 50360

  10. Molecular characterization of free tropospheric aerosol collected at the Pico Mountain Observatory: a case study with a long-range transported biomass burning plume

    Science.gov (United States)

    Dzepina, K.; Mazzoleni, C.; Fialho, P.; China, S.; Zhang, B.; Owen, R. C.; Helmig, D.; Hueber, J.; Kumar, S.; Perlinger, J. A.; Kramer, L. J.; Dziobak, M. P.; Ampadu, M. T.; Olsen, S.; Wuebbles, D. J.; Mazzoleni, L. R.

    2015-05-01

    Free tropospheric aerosol was sampled at the Pico Mountain Observatory located at 2225 m above mean sea level on Pico Island of the Azores archipelago in the North Atlantic. The observatory is located ~ 3900 km east and downwind of North America, which enables studies of free tropospheric air transported over long distances. Aerosol samples collected on filters from June to October 2012 were analyzed to characterize organic carbon, elemental carbon, and inorganic ions. The average ambient concentration of aerosol was 0.9 ± 0.7 μg m-3. On average, organic aerosol components represent the largest mass fraction of the total measured aerosol (60 ± 51%), followed by sulfate (23 ± 28%), nitrate (13 ± 10%), chloride (2 ± 3%), and elemental carbon (2 ± 2%). Water-soluble organic matter (WSOM) extracted from two aerosol samples (9/24 and 9/25) collected consecutively during a pollution event were analyzed using ultrahigh-resolution electrospray ionization Fourier transform ion cyclotron resonance mass spectrometry. Approximately 4000 molecular formulas were assigned to each of the mass spectra in the range of m/z 100-1000. The majority of the assigned molecular formulas had unsaturated structures with CHO and CHNO elemental compositions. FLEXPART retroplume analyses showed the sampled air masses were very aged (average plume age > 12 days). These aged aerosol WSOM compounds had an average O/C ratio of ~ 0.45, which is relatively low compared to O/C ratios of other aged aerosol. The increase in aerosol loading during the measurement period of 9/24 was linked to biomass burning emissions from North America by FLEXPART retroplume analysis and Moderate Resolution Imaging Spectroradiometer (MODIS) fire counts. This was confirmed with biomass burning markers detected in the WSOM and with the morphology and mixing state of particles as determined by scanning electron microscopy. The presence of markers characteristic of aqueous-phase reactions of phenolic species suggests

  11. Uniformity: The key to better inventory management

    International Nuclear Information System (INIS)

    Boshears, G.

    1993-01-01

    The objective of this paper is to show how uniformity in describing parts and materials can be the key ingredient to more effective inventory management. Although most nuclear utilities have some type of computer system for maintenance management as well as materials tracking, few have a system to provide the various users with complete information about parts and material in stock. One of the industry's most perplexing problems is How do you know, and find, the item you need to repair a particular piece of equipment or component? In many instances it is easier to order a new one from the manufacturer rather than try to find it on-site, which can result in inaccurate usage records, over-stocking, frustration, and strain on cash flow. What is needed is a higher degree of uniformity within a station, and a utility, of catalog descriptions for parts and material that will satisfy all users-planners, craftsmen, warehouse personnel, and buyers. The results of attaining this uniformity are improved performance through searchability, duplicate stock avoidance, interchangeability, substitutability, and more accurate bills of material; economic benefits will also be noted

  12. Conceptual, experimental and computational approaches to support performance assessment of hydrology and chemical transport at Yucca Mountain; Yucca Mountain Site Characterization Project

    Energy Technology Data Exchange (ETDEWEB)

    Narasimhan, T.N.; Wang, J.S.Y. [Lawrence Berkeley Lab., CA (United States)

    1992-07-01

    The authors of this report have been participating in the Sandia National Laboratory`s hydrologic performance assessment of the Yucca Mountain, Nevada, since 1983. The scope of this work is restricted to the unsaturated zone at Yucca Mountain and to technical questions about hydrology and chemical transport. The issues defined here are not to be confused with the elaborate hierarchy of issues that forms the framework of the US Department of Energy plans for characterizing the site (DOE, 1989). The overall task of hydrologic performance assessment involves issues related to hydrology, geochemistry, and energy transport in a highly heterogeneous natural geologic system which will be perturbed in a major way by the disposal activity. Therefore, a rational evaluation of the performance assessment issues must be based on an integrated appreciation of the aforesaid interacting processes. Accordingly, a hierarchical approach is taken in this report, proceeding from the statement of the broad features of the site that make it the site for intensive studies and the rationale for disposal strategy, through the statement of the fundamental questions that need to be answered, to the identification of the issues that need resolution. Having identified the questions and issues, the report then outlines the tasks to be undertaken to resolve the issues. The report consists essentially of two parts. The first part deals with the definition of issues summarized above. The second part summarizes the findings of the authors between 1983 and 1989 under the activities of the former Nevada Nuclear Waste Storage Investigations (NNWSI) and the current YMP.

  13. Characterization, Long-Range Transport and Source Identification of Carbonaceous Aerosols during Spring and Autumn Periods at a High Mountain Site in South China

    Directory of Open Access Journals (Sweden)

    Hong-yan Jia

    2016-09-01

    Full Text Available PM10 (particulate matter samples were collected at Mount Lu, a high elevation mountain site in south China (August and September of 2011; and March, April and May of 2012. Eight carbonaceous fractions of particles were analyzed to characterize the possible carbonaceous emission sources. During the sampling events, daily average concentrations of PM10 at Mount Lu were 97.87 μg/m3 and 73.40 μg/m3 in spring and autumn, respectively. The observed mean organic carbon (OC and element carbon (EC concentrations during spring in PM10 were 10.58 μg/m3 and 2.58 μg/m3, respectively, and those in autumn were 6.89 μg/m3 and 2.40 μg/m3, respectively. Secondary organic carbon concentration was 4.77 μg/m3 and 2.93 μg/m3 on average, accounting for 28.0% and 31.0% of the total OC in spring and autumn, respectively. Relationships between carbonaceous species and results of principal component analysis showed that there were multiple sources contributing to the carbonaceous aerosols at the observation site. Through back trajectory analysis, it was found that air masses in autumn were mainly transported from the south of China, and these have the highest OC but lowest EC concentrations. Air masses in spring transported from northwest China bring 7.77 μg/m3 OC and 2.28 μg/m3 EC to the site, with lower levels coming from other sites. These air mass sources were featured by the effective carbon ratio (ECR.

  14. Ballistic charge carrier transmission through graphene multi-barrier structures in uniform magnetic field

    International Nuclear Information System (INIS)

    Zubarev, A; Dragoman, D

    2014-01-01

    We investigate charge carrier transport in graphene multi-barrier structures placed in a uniform magnetic field. The transmission coefficient is found analytically by generalizing the transfer matrix method for the case of graphene regions subjected to a uniform magnetic field. The transmission coefficient through the structure can be modulated by varying the gate voltages, the magnetic field and/or the width of the gated regions. Such a configuration could be used in multiple-valued logic circuits, since it has several output states with discrete and easily selectable transmission/current values. (paper)

  15. Chemical characterization of long-range transport biomass burning emissions to the Himalayas: insights from high-resolution aerosol mass spectrometry

    Directory of Open Access Journals (Sweden)

    X. Zhang

    2018-04-01

    Full Text Available An intensive field measurement was conducted at a remote, background, high-altitude site (Qomolangma Station, QOMS, 4276 m a.s.l. in the northern Himalayas, using an Aerodyne high-resolution time-of-flight aerosol mass spectrometer (HR-ToF-AMS along with other collocated instruments. The field measurement was performed from 12 April to 12 May 2016 to chemically characterize the high time-resolved submicron particulate matter (PM1 and obtain the dynamic processes (emissions, transport, and chemical evolution of biomass burning (BB, frequently transported from South Asia to the Himalayas during pre-monsoon season. Overall, the average (±1σ PM1 mass concentration was 4.44 (±4.54 µg m−3 for the entire study, which is comparable with those observed at other remote sites worldwide. Organic aerosol (OA was the dominant PM1 species (accounting for 54.3 % of total PM1 on average followed by black carbon (BC (25.0 %, sulfate (9.3 %, ammonium (5.8 %, nitrate (5.1 %, and chloride (0.4 %. The average size distributions of PM1 species all peaked at an overlapping accumulation mode (∼ 500 nm, suggesting that aerosol particles were internally well-mixed and aged during long-range transport. Positive matrix factorization (PMF analysis on the high-resolution organic mass spectra identified three distinct OA factors, including a BB-related OA (BBOA, 43.7 %, a nitrogen-containing OA (NOA, 13.9 % and a more-oxidized oxygenated OA (MO-OOA, 42.4 %. Two polluted episodes with enhanced PM1 mass loadings and elevated BBOA contributions from the west and southwest of QOMS during the study were observed. A typical BB plume was investigated in detail to illustrate the chemical evolution of aerosol characteristics under distinct air mass origins, meteorological conditions, and atmospheric oxidation processes.

  16. Transport proteins promoting Escherichia coli pathogenesis

    Science.gov (United States)

    Tang, Fengyi; Saier, Milton H.

    2014-01-01

    Escherichia coli is a genetically diverse species infecting hundreds of millions of people worldwide annually. We examined seven well-characterized E. coli pathogens causing urinary tract infections, gastroenteritis, pyelonephritis and haemorrhagic colitis. Their transport proteins were identified and compared with each other and a non-pathogenic E. coli K12 strain to identify transport proteins related to pathogenesis. Each pathogen possesses a unique set of protein secretion systems for export to the cell surface or for injecting effector proteins into host cells. Pathogens have increased numbers of iron siderophore receptors and ABC iron uptake transporters, but the numbers and types of low-affinity secondary iron carriers were uniform in all strains. The presence of outer membrane iron complex receptors and high-affinity ABC iron uptake systems correlated, suggesting co-evolution. Each pathovar encodes a different set of pore-forming toxins and virulence-related outer membrane proteins lacking in K12. Intracellular pathogens proved to have a characteristically distinctive set of nutrient uptake porters, different from those of extracellular pathogens. The results presented in this report provide information about transport systems relevant to various types of E. coli pathogenesis that can be exploited in future basic and applied studies. PMID:24747185

  17. Transport proteins promoting Escherichia coli pathogenesis.

    Science.gov (United States)

    Tang, Fengyi; Saier, Milton H

    2014-01-01

    Escherichia coli is a genetically diverse species infecting hundreds of millions of people worldwide annually. We examined seven well-characterized E. coli pathogens causing urinary tract infections, gastroenteritis, pyelonephritis and haemorrhagic colitis. Their transport proteins were identified and compared with each other and a non-pathogenic E. coli K12 strain to identify transport proteins related to pathogenesis. Each pathogen possesses a unique set of protein secretion systems for export to the cell surface or for injecting effector proteins into host cells. Pathogens have increased numbers of iron siderophore receptors and ABC iron uptake transporters, but the numbers and types of low-affinity secondary iron carriers were uniform in all strains. The presence of outer membrane iron complex receptors and high-affinity ABC iron uptake systems correlated, suggesting co-evolution. Each pathovar encodes a different set of pore-forming toxins and virulence-related outer membrane proteins lacking in K12. Intracellular pathogens proved to have a characteristically distinctive set of nutrient uptake porters, different from those of extracellular pathogens. The results presented in this report provide information about transport systems relevant to various types of E. coli pathogenesis that can be exploited in future basic and applied studies. Copyright © 2014 Elsevier Ltd. All rights reserved.

  18. Characterization of Organic Thin Film Solar Cells of PCDTBT : PC71BM Prepared by Different Mixing Ratio and Effect of Hole Transport Layer

    Directory of Open Access Journals (Sweden)

    Vijay Srinivasan Murugesan

    2015-01-01

    Full Text Available The organic thin film solar cells (OTFSCs have been successfully fabricated using PCDTBT : PC71BM with different mixing ratios (1 : 1 to 1 : 8 and the influence of hole transport layer thickness (PEDOT : PSS. The active layers with different mixing ratios of PCDTBT : PC71BM have been fabricated using o-dichlorobenzene (o-DCB. The surface morphology of the active layers and PEDOT : PSS layer with different thicknesses were characterized by AFM analysis. Here, we report that the OTFSCs with high performance have been optimized with 1 : 4 ratios of PCDTBT : PC71BM. The power conversion efficiency (PCE = 5.17% of the solar cells was significantly improved by changing thickness of PEDOT : PSS layer. The thickness of the PEDOT : PSS layer was found to be of significant importance; the thickness of the PEDOT : PSS layer at 45 nm (higher spin speed 5000 rpm shows higher short circuit current density (Jsc and lower series resistance (Rs and higher PCE.

  19. Characterization of a lactose-responsive promoter of ATP-binding cassette (ABC) transporter gene from Lactobacillus acidophilus 05-172.

    Science.gov (United States)

    Zeng, Zhu; Zuo, Fanglei; Yu, Rui; Zhang, Bo; Ma, Huiqin; Chen, Shangwu

    2017-09-01

    A novel lactose-responsive promoter of the ATP-binding cassette (ABC) transporter gene Lba1680 of Lactobacillus acidophilus strain 05-172 isolated from a traditionally fermented dairy product koumiss was characterized. In L. acidophilus 05-172, expression of Lba1680 was induced by lactose, with lactose-induced transcription of Lba1680 being 6.1-fold higher than that induced by glucose. This is in contrast to L. acidophilus NCFM, a strain isolated from human feces, in which expression of Lba1680 and Lba1679 is induced by glucose. Both gene expression and enzyme activity assays in L. paracasei transformed with a vector containing the inducible Lba1680 promoter (PLba1680) of strain 05-172 and a heme-dependent catalase gene as reporter confirmed that PLba1680 is specifically induced by lactose. Its regulatory expression could not be repressed by glucose, and was independent of cAMP receptor protein. This lactose-responsive promoter might be used in the expression of functional genes in L. paracasei incorporated into a lactose-rich environment, such as dairy products. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  20. Characterization of victims of aggression and transportation accidents treated at the Forensic Medicine and Dentistry Institute - Campina Grande, Paraíba, Brazil - 2010.

    Science.gov (United States)

    d'Avila, Sergio; Campos, Ana Cristina; Cavalcante, Gigliana Maria Sobral; Silva, Carlos Jose de Paula; da Nóbrega, Lorena Marques; Ferreira, Efigenia Ferreira E

    2015-03-01

    The objective of this cross-sectional census study was to characterize agression and land-based transport accidents in a city in the Northeast of Brazil. Data was analyzed from live victims who were treated at a forensic service (N = 2.379). In the descriptive analysis, the majority of events were represented by aggression (71.6%); which occurred on weekdays (65%), with 35.1% at night. Trauma occurred to the whole body (63.6%) and to soft tissue (74.2%). On the basis of multiple correspondence analysis, two dimensions were formed: the first dimension (internal reliability = 0.654) was formed by the cause of the event, the trauma and the age group and the second dimension (reliability = 0.514), by age group, occupation and civil status. Three groups with distinct profiles were formed for accidents and aggression: young women who suffered aggression, with trauma to the face and soft tissues during the evening and at weekends; adult men who suffered car accidents, in the morning and on work days; and retired elderly widowers, who were run over.

  1. Generalized Landau-Lifshitz-Gilbert equation for uniformly magnetized bodies

    Energy Technology Data Exchange (ETDEWEB)

    Serpico, C. [Dipartimento di Ingegneria Elettrica, Universita di Napoli ' FedericoII' , Via Claudio 21, I-80125 Naples (Italy)], E-mail: serpico@unina.it; Mayergoyz, I.D. [ECE Department and UMIACS, University of Maryland, College Park, MD 20742 (United States); Bertotti, G. [Istituto Nazionale di Ricerca Metrologica (INRiM), I-10135 Turin (Italy); D' Aquino, M. [Dipartimento per le Tecnologie, University of Napoli ' Parthenope' , I-80133 Naples (Italy); Bonin, R. [Istituto Nazionale di Ricerca Metrologica (INRiM), I-10135 Turin (Italy)

    2008-02-01

    We consider generalized Landau-Lifshitz-Gilbert (LLG) deterministic dynamics in uniformly magnetized bodies. The dynamics take place on the unit sphere {sigma}, and are characterized by a vector field v tangential to {sigma}. By using Helmholtz decomposition on {sigma}, it is proven that v is uniquely defined by two potentials {chi} and {psi}. Potential {chi} can be identified with the free energy of the system, while {psi} describes non-conservative interactions of the system with the environment. The presence of {psi} modifies the usual energy balance of LLG dynamics. Instead of purely relaxation dynamics we may have steady injection of energy through non-conservative interactions. The implications of the new form of the energy balance are discussed in detail.

  2. Temperature uniformity in the CERN CLOUD chamber

    Directory of Open Access Journals (Sweden)

    A. Dias

    2017-12-01

    Full Text Available The CLOUD (Cosmics Leaving OUtdoor Droplets experiment at CERN (European Council for Nuclear Research investigates the nucleation and growth of aerosol particles under atmospheric conditions and their activation into cloud droplets. A key feature of the CLOUD experiment is precise control of the experimental parameters. Temperature uniformity and stability in the chamber are important since many of the processes under study are sensitive to temperature and also to contaminants that can be released from the stainless steel walls by upward temperature fluctuations. The air enclosed within the 26 m3 CLOUD chamber is equipped with several arrays (strings of high precision, fast-response thermometers to measure its temperature. Here we present a study of the air temperature uniformity inside the CLOUD chamber under various experimental conditions. Measurements were performed under calibration conditions and run conditions, which are distinguished by the flow rate of fresh air and trace gases entering the chamber at 20 and up to 210 L min−1, respectively. During steady-state calibration runs between −70 and +20 °C, the air temperature uniformity is better than ±0.06 °C in the radial direction and ±0.1 °C in the vertical direction. Larger non-uniformities are present during experimental runs, depending on the temperature control of the make-up air and trace gases (since some trace gases require elevated temperatures until injection into the chamber. The temperature stability is ±0.04 °C over periods of several hours during either calibration or steady-state run conditions. During rapid adiabatic expansions to activate cloud droplets and ice particles, the chamber walls are up to 10 °C warmer than the enclosed air. This results in temperature differences of ±1.5 °C in the vertical direction and ±1 °C in the horizontal direction, while the air returns to its equilibrium temperature with a time constant of about 200 s.

  3. Tomographical properties of uniformly redundant arrays

    International Nuclear Information System (INIS)

    Cannon, T.M.; Fenimore, E.E.

    1978-01-01

    Recent work in coded aperture imaging has shown that the uniformly redundant array (URA) can image distant planar radioactive sources with no artifacts. The performance of two URA apertures when used in a close-up tomographic imaging system is investigated. It is shown that a URA based on m sequences is superior to one based on quadratic residues. The m sequence array not only produces less obnoxious artifacts in tomographic imaging, but is also more resilient to some described detrimental effects of close-up imaging. It is shown that in spite of these close-up effects, tomographic depth resolution increases as the source is moved closer to the detector

  4. SAM revisited: uniform semiclassical approximation with absorption

    International Nuclear Information System (INIS)

    Hussein, M.S.; Pato, M.P.

    1986-01-01

    The uniform semiclassical approximation is modified to take into account strong absorption. The resulting theory, very similar to the one developed by Frahn and Gross is used to discuss heavy-ion elastic scattering at intermediate energies. The theory permits a reasonably unambiguos separation of refractive and diffractive effects. The systems 12 C+ 12 C and 12 C+ 16 O, which seem to exhibit a remnant of a nuclear rainbow at E=20 Mev/N, are analysed with theory which is built directly on a model for the S-matrix. Simple relations between the fit S-matrix and the underlying complex potential are derived. (Author) [pt

  5. Angular momentum conservation for uniformly expanding flows

    International Nuclear Information System (INIS)

    Hayward, Sean A

    2007-01-01

    Angular momentum has recently been defined as a surface integral involving an axial vector and a twist 1-form, which measures the twisting around the spacetime due to a rotating mass. The axial vector is chosen to be a transverse, divergence-free, coordinate vector, which is compatible with any initial choice of axis and integral curves. Then a conservation equation expresses the rate of the change of angular momentum along a uniformly expanding flow as a surface integral of angular momentum densities, with the same form as the standard equation for an axial Killing vector, apart from the inclusion of an effective energy tensor for gravitational radiation

  6. Nonimaging reflectors for efficient uniform illumination.

    Science.gov (United States)

    Gordon, J M; Kashin, P; Rabl, A

    1992-10-01

    Nonimaging reflectors that are an extension of the design principle that was developed for compound parabolic concentrator type devices are proposed for illumination applications. The optical designs presented offer maximal lighting efficiency while they retain sharp angular control of the radiation and highly uniform flux densities on distant target planes. Our results are presented for symmetrical configurations in two dimensions (troughlike reflectors) for flat and for tubular sources. For fields of view of practical interest (half-angle in the 30-60 degrees range), these devices can achieve minimum-tomaximum intensity ratios of 0.7, while they remain compact and incur low reflective losses.

  7. Formation of Uniform Hollow Silica microcapsules

    Science.gov (United States)

    Yan, Huan; Kim, Chanjoong

    2013-03-01

    Microcapsules are small containers with diameters in the range of 0.1 - 100 μm. Mesoporous microcapsules with hollow morphologies possess unique properties such as low-density and high encapsulation capacity, while allowing controlled release by permeating substances with a specific size and chemistry. Our process is a one-step fabrication of monodisperse hollow silica capsules with a hierarchical pore structure and high size uniformity using double emulsion templates obtained by the glass-capillary microfluidic technique to encapsulate various active ingredients. These hollow silica microcapsules can be used as biomedical applications such as drug delivery and controlled release.

  8. A uniform Tauberian theorem in dynamic games

    Science.gov (United States)

    Khlopin, D. V.

    2018-01-01

    Antagonistic dynamic games including games represented in normal form are considered. The asymptotic behaviour of value in these games is investigated as the game horizon tends to infinity (Cesàro mean) and as the discounting parameter tends to zero (Abel mean). The corresponding Abelian-Tauberian theorem is established: it is demonstrated that in both families the game value uniformly converges to the same limit, provided that at least one of the limits exists. Analogues of one-sided Tauberian theorems are obtained. An example shows that the requirements are essential even for control problems. Bibliography: 31 titles.

  9. Uniformly bounded representations of the Lorentz groups

    International Nuclear Information System (INIS)

    Brega, A.O.

    1982-01-01

    For the Lorentz group G = SO/sub e/(n + 1, 1)(ngreater than or equal to 2) the author constructs a family of uniformly bounded representations by means of analytically continuing a certain normalization of the unitary principal series. The method the author uses relies on an analysis of various operators under a Mellin transform and extends earlier work of E.N. Wilson. In a series of papers Kunze and Stein initiated the theory of uniformly bounded representations of semisimple Lie groups; the starting point is the unitary principal series T(sigma,s) obtained in a certain subgroup M of G and a purely imaginary number s. From there Kunze and Stein constructed families of representations R(sigma,s) depending analytically on a parameter s in a domain D of C containing the imaginary axis which are unitarily equilvalent to T(sigma,s) for s contained in the set of imaginary numbers and whose operator norms are uniformly bounded for each s in D. In the case of the Lorentz groups SO/sub e/(n + 1, 1)(ngreater than or equal to2) and the trivial representation 1 of M, E.N. Wilson obtained such a family R(1,s) for the domain D = [s contained in the set of C: absolute value Re(s) Vertical Bar2]. For this domain D and for any representation sigma of M the author provides a family R(sigma,s) of uniformly bounded representations analytically continuing T(sigma,s), thereby generalizing Wilson's work. The author has also investigated certain symmetry properties of the representations R(sigma,s) under the action of the Weyl group. The trivial representation is Weyl group invariant and the family R(1,s) obtained by Wilson satisfies R(1,s) = R(1,-s) reflecting this. Obtained was the analogous result R(sigma,s) = R(sigma,-s) for some well known representations sigma that are Weyl group invariant. This involves the explicit computation of certain constants arising in the Fourier transforms of intertwining operators

  10. Apparatus for uniform pumping of lasing media

    International Nuclear Information System (INIS)

    Condit, W.C.; Eccles, S.F.

    1975-01-01

    Electron beam pumping of gaseous or liquid lasing media is carried out by means of electron pulses generated by an electron accelerator. Between the accelerator and the laser cavity, the electron pulse is subjected to a magnetic field to turn the electron pulse approximately through a quarter orbit, so that in essence the direction of pulse travel is changed from axial to lateral. This procedure then enables pumping of the laser cavity uniformly and simultaneously, or in any desired traveling wave mode, over the entire length of the laser cavity with relatively short, and highly intense, electron pulses. (U.S.)

  11. Assessment of MODIS RSB Detector Uniformity Using Deep Convective Clouds

    Science.gov (United States)

    Chang, Tiejun; Xiong, Xiaoxiong (Jack); Angal, Amit; Mu, Qiaozhen

    2016-01-01

    For satellite sensor, the striping observed in images is typically associated with the relative multiple detector gain difference derived from the calibration. A method using deep convective cloud (DCC) measurements to assess the difference among detectors after calibration is proposed and demonstrated for select reflective solar bands (RSBs) of the Moderate Resolution Imaging Spectroradiometer (MODIS). Each detector of MODIS RSB is calibrated independently using a solar diffuser (SD). Although the SD is expected to accurately characterize detector response, the uncertainties associated with the SD degradation and characterization result in inadequacies in the estimation of each detector's gain. This work takes advantage of the DCC technique to assess detector uniformity and scan mirror side difference for RSB. The detector differences for Terra MODIS Collection 6 are less than 1% for bands 1, 3-5, and 18 and up to 2% for bands 6, 19, and 26. The largest difference is up to 4% for band 7. Most Aqua bands have detector differences less than 0.5% except bands 19 and 26 with up to 1.5%. Normally, large differences occur for edge detectors. The long-term trending shows seasonal oscillations in detector differences for some bands, which are correlated with the instrument temperature. The detector uniformities were evaluated for both unaggregated and aggregated detectors for MODIS band 1 and bands 3-7, and their consistencies are verified. The assessment results were validated by applying a direct correction to reflectance images. These assessments can lead to improvements to the calibration algorithm and therefore a reduction in striping observed in the calibrated imagery.

  12. Charge carrier transport mechanisms in nanocrystalline indium oxide

    International Nuclear Information System (INIS)

    Forsh, E.A.; Marikutsa, A.V.; Martyshov, M.N.; Forsh, P.A.; Rumyantseva, M.N.; Gaskov, A.M.; Kashkarov, P.K.

    2014-01-01

    The charge transport properties of nanocrystalline indium oxide (In 2 O 3 ) are studied. A number of nanostructured In 2 O 3 samples with various nanocrystal sizes are prepared by sol–gel method and characterized using various techniques. The mean nanocrystals size varies from 7–8 nm to 18–20 nm depending on the conditions of their preparation. Structural characterizations of the In 2 O 3 samples are performed by means of transmission electron microscopy and X-ray diffraction. The analysis of dc and ac conductivity in a wide temperature range (T = 50–300 K) shows that at high temperatures charge carrier transport takes place over conduction band and at low temperatures a variable range hopping transport mechanism can be observed. We find out that the temperature of transition from one mechanism to another depends on nanocrystal size: the transition temperature rises when nanocrystals are bigger in size. The average hopping distance between two sites and the activation energy are calculated basing on the analysis of dc conductivity at low temperature. Using random barrier model we show a uniform hopping mechanism taking place in our samples and conclude that nanocrystalline In 2 O 3 can be regarded as a disordered system. - Highlights: • In 2 O 3 samples with various nanocrystal sizes are prepared by sol–gel method. • The mean nanocrystal size varies from 7–8 nm to 18–20 nm. • At high temperatures charge carrier transport takes place over conduction band. • At low temperatures a variable range hopping transport mechanism can be observed. • We show a uniform hopping mechanism taking place in our samples

  13. Arrangements of intermodal transport in the field of conflicting conventions

    NARCIS (Netherlands)

    K.F. Haak (Krijn); M.A.I.H. Hoeks (Marian)

    2004-01-01

    textabstractThe continuing advance of containerization emphasizes the need for a more uniform legal approach to international intermodal transport. With the current lack of a uniform instrument regulating such transport, the next best solution - both in legal theory as well as in practice - seems to

  14. Functional characterization of a recombinant sodium-dependent nucleoside transporter with selectivity for pyrimidine nucleosides (cNT1rat) by transient expression in cultured mammalian cells.

    OpenAIRE

    Fang, X; Parkinson, F E; Mowles, D A; Young, J D; Cass, C E

    1996-01-01

    We have demonstrated that monkey kidney (COS-1) cells have a single type of nucleoside transport process, which, because it was equilibrative, sodium-independent and could be inhibited by nitrobenzylthioinosine (NBMPR), was identified as the 'equilibrative sensitive' or 'es' transporter. Using NBMPR or dilazep to inhibit the endogenous nucleoside transport activity, we have transiently expressed a cDNA that encodes an inhibitor-insensitive, concentrative nucleoside transporter protein (cNT1ra...

  15. A stability criterion for HNFDE with non-uniform delays

    International Nuclear Information System (INIS)

    Liu Xingwen; Zhong Shouming; Zhang Fengli

    2005-01-01

    Stability of functional differential equations (FDE) is an increasingly important problem in both science and engineering. Delays, whether uniform or non-uniform, play an important role in the dynamics of a system. Since non-uniform delay is more general and less focused than uniform delay, this paper concentrates on the stability of high-order neutral functional differential equations (HNFDE) with non-uniform delay, and proposes a sufficient condition for it. This result may be widely helpful, thanks to the frequent emergence of a HNFDE with non-uniform delay in various fields. Its effectiveness is illustrated by some examples

  16. Molecular cloning, functional characterization and expression analysis of a novel monosaccharide transporter gene OsMST6 from rice (Oryza sativa L.)

    NARCIS (Netherlands)

    Wang, Y.; Xiao, Y.; Zhang, Y.; Chai, C.; Wei, G.; Wei, X.; Xu, H.; Wang, M.; Ouwerkerk, P.B.F.; Zhu, Z.

    2008-01-01

    Monosaccharides transporters play important roles in assimilate supply for sink tissue development. In this study, a new monosaccharide transporter gene OsMST6 was identified from rice (Oryza sativa L.). The predicted OsMST6 protein shows typical features of sugar transporters and shares 79.6%

  17. A Structurally Specialized Uniform Wall Layer is Essential for Constructing Wall Ingrowth Papillae in Transfer Cells

    Science.gov (United States)

    Xia, Xue; Zhang, Hui-Ming; Offler, Christina E.; Patrick, John W.

    2017-01-01

    Transfer cells are characterized by wall labyrinths with either a flange or reticulate architecture. A literature survey established that reticulate wall ingrowth papillae ubiquitously arise from a modified component of their wall labyrinth, termed the uniform wall layer; a structure absent from flange transfer cells. This finding sparked an investigation of the deposition characteristics and role of the uniform wall layer using a Vicia faba cotyledon culture system. On transfer of cotyledons to culture, their adaxial epidermal cells spontaneously trans-differentiate to a reticulate architecture comparable to their abaxial epidermal transfer cell counterparts formed in planta. Uniform wall layer construction commenced once adaxial epidermal cell expansion had ceased to overlay the original outer periclinal wall on its inner surface. In contrast to the dense ring-like lattice of cellulose microfibrils in the original primary wall, the uniform wall layer was characterized by a sparsely dispersed array of linear cellulose microfibrils. A re-modeled cortical microtubule array exerted no influence on uniform wall layer formation or on its cellulose microfibril organization. Surprisingly, formation of the uniform wall layer was not dependent upon depositing a cellulose scaffold. In contrast, uniform wall cellulose microfibrils were essential precursors for constructing wall ingrowth papillae. On converging to form wall ingrowth papillae, the cellulose microfibril diameters increased 3-fold. This event correlated with up-regulated differential, and transfer-cell specific, expression of VfCesA3B while transcript levels of other cellulose biosynthetic-related genes linked with primary wall construction were substantially down-regulated. PMID:29259611

  18. Long GRBs sources population non-uniformity

    Science.gov (United States)

    Arkhangelskaja, Irene

    Long GRBs observed in the very wide energy band. It is possible to separate two subsets of GRBs with high energy component (E > 500 MeV) presence. First type events energy spectra in low and high energy intervals are similar (as for GRB 021008) and described by Band, power law or broken power law models look like to usual bursts without emission in tens MeV region. For example, Band spectrum of GRB080916C covering 6 orders of magnitude. Second ones contain new additional high energy spectral component (for example, GRB 050525B and GRB 090902B). Both types of GRBs observed since CGRO mission beginning. The low energy precursors existence are typical for all types bursts. Both types of bursts temporal profiles can be similar in the various energy regions during some events or different in other cases. The absence of hard to soft evolution in low energy band and (or) presence of high energy precursors for some events are the special features of second class of GRBs by the results of preliminary data analysis and this facts gives opportunities to suppose differences between these two GRBs subsets sources. Also the results of long GRB redshifts distribution analysis have shown its shape contradiction to uniform population objects one for our Metagalaxy to both total and various redshifts definition methods GRBs sources samples. These evidences allow making preliminary conclusion about non-uniformity of long GRBs sources population.

  19. Experimental study on the CHF in uniformly and non-uniformly heated vertical annuli

    Energy Technology Data Exchange (ETDEWEB)

    Chun, Se Young; Moon, Sang Ki; Chung, Heung June; Park, Jong Kuk; Kim, Bok Deuk; Youn, Young Jung; Chung, Moon Ki

    2001-09-01

    Up to now, KAERI has performed critical heat flux experiments in water under zero-flow and low-flow conditions using a RCS CHF loop facility with uniformly and non-uniformly heated vertical annulus. Since the existing CHF experiments were mainly performed under low-pressure conditions, we performed the CHF experiment to investigate the pressure effect on the CHF under zero-flow and low-flow conditions for a wide range of system pressures. Also, two vertical annuli with the same geometry have been used to investigate the axial heat flux distributions on the CHF. This report summarizes the experimental results and provides the CHF data that can be used for the development for CHF correlation and a thermal hydraulic analysis code. The CHF data have been collected for system pressures ranging from 0.57 to 15.15 MPa, mass flux 0 and from 200 to 650 kg/m2s, inlet subcooling from 75 to 360 kJ/kg and exit quality from 0.07 to 0.57. At low-flow conditions, the total number of data are 242 and 290 with uniformly heated- and non-uniformly heated test sections, respectively. 41 and 94 CHF data are generated with uniformly heated- and non-uniformly heated test sections, respectively, in zero-flow CHF experiments that are performed by blocking test section bottoms. The CHF experiment result shows that the effects of system pressure, mass flux and inlet subcooling are consistent with conventional understandings and similar to those for round tubes. The behavior of the CHF is relatively complex at low pressures. Also, the effects of axial heat flux profile are large at low-pressure conditions.

  20. Experimental study on the CHF in uniformly and non-uniformly heated vertical annuli

    International Nuclear Information System (INIS)

    Chun, Se Young; Moon, Sang Ki; Chung, Heung June; Park, Jong Kuk; Kim, Bok Deuk; Youn, Young Jung; Chung, Moon Ki

    2001-09-01

    Up to now, KAERI has performed critical heat flux experiments in water under zero-flow and low-flow conditions using a RCS CHF loop facility with uniformly and non-uniformly heated vertical annulus. Since the existing CHF experiments were mainly performed under low-pressure conditions, we performed the CHF experiment to investigate the pressure effect on the CHF under zero-flow and low-flow conditions for a wide range of system pressures. Also, two vertical annuli with the same geometry have been used to investigate the axial heat flux distributions on the CHF. This report summarizes the experimental results and provides the CHF data that can be used for the development for CHF correlation and a thermal hydraulic analysis code. The CHF data have been collected for system pressures ranging from 0.57 to 15.15 MPa, mass flux 0 and from 200 to 650 kg/m2s, inlet subcooling from 75 to 360 kJ/kg and exit quality from 0.07 to 0.57. At low-flow conditions, the total number of data are 242 and 290 with uniformly heated- and non-uniformly heated test sections, respectively. 41 and 94 CHF data are generated with uniformly heated- and non-uniformly heated test sections, respectively, in zero-flow CHF experiments that are performed by blocking test section bottoms. The CHF experiment result shows that the effects of system pressure, mass flux and inlet subcooling are consistent with conventional understandings and similar to those for round tubes. The behavior of the CHF is relatively complex at low pressures. Also, the effects of axial heat flux profile are large at low-pressure conditions