WorldWideScience

Sample records for transionospheric vhf signals

  1. Relation of decorrelated transionospheric GPS signal fluctuations from two stations in the northern anomaly crest region with equatorial ionospheric dynamics

    Science.gov (United States)

    Paul, K. S.; Paul, A.

    2017-05-01

    The ionosphere around the northern crest of the equatorial ionization anomaly (EIA) and beyond exhibits rapid temporal as well as spatial development of ionization density irregularities during postsunset hours. A GPS campaign was conducted during September 2012 and April 2013 from the Institute of Radio Physics and Electronics, Calcutta (22.58°N, 88.38°E geographic; magnetic dip: 32°N), and North Bengal University (NBU), Siliguri (26.72°N, 88.39°E geographic, magnetic dip: 39.49°N) in India in order to assess and quantify differences, if any, in the nature of carrier to noise ratio (C/N0) fluctuations observed on the same satellite link around the same time interval from these stations. Significant decorrelation of the received signals was found when tracking the same satellite vehicle (SV) link from these stations during periods of scintillations. Low values of correlation coefficient of C/N0 at L1 frequency recorded on the same SV link at these two stations were found to correspond with high irregularity characteristic velocities. North-south spatial displacement rates of the impact of ionospheric irregularities were calculated based on coordinated GPS observations which followed an increasing trend with irregularity characteristic velocities measured at VHF. Values of characteristic velocities in excess of 36 m/s were also found to result in large receiver position deviations 3.5-4.0 m during periods of scintillations. Information related to time lag associated with occurrence of scintillations on the same SV link observed from two stations could be useful for improving performance of transionospheric satellite-based position determination techniques.

  2. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer. This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal suppression.

  3. VHF signal power suppression in stratiform and convective precipitation

    Directory of Open Access Journals (Sweden)

    A. J. McDonald

    2006-03-01

    Full Text Available Previous studies have indicated that VHF clear-air radar return strengths are reduced during periods of precipitation. This study aims to examine whether the type of precipitation, stratiform and convective precipitation types are identified, has any impact on the relationships previously observed and to examine the possible mechanisms which produce this phenomenon. This study uses a combination of UHF and VHF wind-profiler data to define periods associated with stratiform and convective precipitation. This identification is achieved using an algorithm which examines the range squared corrected signal to noise ratio of the UHF returns for a bright band signature for stratiform precipitation. Regions associated with convective rainfall have been defined by identifying regions of enhanced range corrected signal to noise ratio that do not display a bright band structure and that are relatively uniform until a region above the melting layer.

    This study uses a total of 68 days, which incorporated significant periods of surface rainfall, between 31 August 2000 and 28 February 2002 inclusive from Aberystwyth (52.4° N, 4.1° W. Examination suggests that both precipitation types produce similar magnitude reductions in VHF signal power on average. However, the frequency of occurrence of statistically significant reductions in VHF signal power are very different. In the altitude range 2-4 km stratiform precipitation is related to VHF signal suppression approximately 50% of the time while in convective precipitation suppression is observed only 27% of the time. This statistical result suggests that evaporation, which occurs more often in stratiform precipitation, is important in reducing the small-scale irregularities in humidity and thereby the radio refractive index. A detailed case study presented also suggests that evaporation reducing small-scale irregularities in humidity may contribute to the observed VHF signal

  4. Effects of transionospheric signal decorrelation on Global Navigation Satellite Systems (GNSS) performance studied from irregularity dynamics around the northern crest of the EIA

    Science.gov (United States)

    Das, T.; Roy, B.; Paul, A.

    2014-10-01

    Transionospheric satellite navigation links operate primarily at L band and are frequently subject to severe degradation of performances arising out of ionospheric irregularities. Various characteristic features of equatorial ionospheric irregularity bubbles like the drift velocity, characteristic velocity, decorrelation time, and decorrelation distance can be determined using spaced aerial measurements at VHF. These parameters measured at VHF from a station Calcutta situated near the northern crest of the Equatorial Ionization Anomaly (EIA) in the geophysically sensitive Indian longitude sector have been correlated with L band scintillation indices and GPS position accuracy parameters for identifying possible proxies to L band scintillations. Good correspondences have been observed between decorrelation times and distances at VHF with GPS S4 and Position Dilution of Precision during periods of GPS scintillations (S4 > 0.3) for February-April 2011, August-October 2011, and February-April 2012. A functional relation has been developed between irregularity drift velocity measured at VHF and S4 at L band during February-April 2011, and validation of measured S4 and predicted values performed during August-October 2011 and February-April 2012. Significant improvement in L band scintillation prediction and consequent navigational accuracy will result using such relations derived from VHF irregularity measurements which are much simpler and inexpensive.

  5. Transionospheric propagation predictions

    Science.gov (United States)

    Klobucher, J. A.; Basu, S.; Basu, S.; Bernhardt, P. A.; Davies, K.; Donatelli, D. E.; Fremouw, E. J.; Goodman, J. M.; Hartmann, G. K.; Leitinger, R.

    1979-01-01

    The current status and future prospects of the capability to make transionospheric propagation predictions are addressed, highlighting the effects of the ionized media, which dominate for frequencies below 1 to 3 GHz, depending upon the state of the ionosphere and the elevation angle through the Earth-space path. The primary concerns are the predictions of time delay of signal modulation (group path delay) and of radio wave scintillation. Progress in these areas is strongly tied to knowledge of variable structures in the ionosphere ranging from the large scale (thousands of kilometers in horizontal extent) to the fine scale (kilometer size). Ionospheric variability and the relative importance of various mechanisms responsible for the time histories observed in total electron content (TEC), proportional to signal group delay, and in irregularity formation are discussed in terms of capability to make both short and long term predictions. The data base upon which predictions are made is examined for its adequacy, and the prospects for prediction improvements by more theoretical studies as well as by increasing the available statistical data base are examined.

  6. Transionospheric radiosounding (Review)

    Science.gov (United States)

    Danilkin, N. P.

    2017-09-01

    The transionospheric radiosounding (TIS) method has naturally brought together the two most precise methods for scanning and monitoring the ionosphere (ionospheric radiosounding by airborne and ground ionosondes) into a single system. The subsequent development of TIS equipment has led to a qualitative change in the structure and operation of the ionospheric observatory, which greatly broadened the diagnostic capabilities of the ionospheric monitoring and expanded the ionospheric region monitored by the ground station. In fact, it can be said that a closed radiosounding system has been developed. It uses three branches of ionospheric multifrequency ray (or radio wave) fans to monitor the inner and outer ionosphere and to control both of these regions via transillumination of the ionosphere at the boundary of its radio transparency. The advantage of such a system is the full use of the entire range of radiated radio waves, each part of which is responsible for certain components of the diagnostic circuit. The paper presents the results of scientific studies obtained based on TIS data, which have led to the appearance of new and, to some extent, unexpected and previously unknown phenomena and effects. Special attention is paid to the modern stage of development of the TIS concept, which has good prospects for continuous monitoring of the polar ionosphere. It is questioned whether it is expedient to replace the term sounding with the term transillumination. It is noted that TIS was and remains the most precise method of ionosphere diagnostics.

  7. Transionospheric synthetic aperture imaging

    CERN Document Server

    Gilman, Mikhail; Tsynkov, Semyon

    2017-01-01

    This landmark monograph presents the most recent mathematical developments in the analysis of ionospheric distortions of SAR images and offers innovative new strategies for their mitigation. As a prerequisite to addressing these topics, the book also discusses the radar ambiguity theory as it applies to synthetic aperture imaging and the propagation of radio waves through the ionospheric plasma, including the anisotropic and turbulent cases. In addition, it covers a host of related subjects, such as the mathematical modeling of extended radar targets (as opposed to point-wise targets) and the scattering of radio waves off those targets, as well as the theoretical analysis of the start-stop approximation, which is used routinely in SAR signal processing but often without proper justification. The mathematics in this volume is clean and rigorous – no assumptions are hidden or ambiguously stated. The resulting work is truly interdisciplinary, providing both a comprehensive and thorough exposition of the field,...

  8. A modern trans-ionospheric propagation sensing system

    Science.gov (United States)

    Bishop, G. J.; Klobuchar, J. A.; Ronn, A. E.; Bedard, M. G.

    1989-09-01

    One of the most important potential problems with modern military systems which utilize spacecraft is the effect of the ionosphere on the radio signals which pass to and from the spacecraft. Such systems include active communications and navigation satellites as well as both ground-based and potential space-based ranging systems. The major effects the ionosphere can have on such systems are the additional time delay the electrons in the earth's ionosphere add to the free space path delay, the short term rate of change of this additional delay, amplitude scintillation or fading effects the signal encounters due to irregularities in the ionosphere, and Faraday rotation of linearly polarized radio waves transmitted through the ionosphere. While some of these effects were studied adequate models of these effects on military systems still do not exist. A modern trans-ionospheric sensing system, called TISS, is being procured which will consist of a number of stations located throughout the world, making real time measurements of the time delay of the ionosphere, and its rate of change, as well as amplitude scintillation, along several different viewing directions from each station. These trans-ionospheric measurements will be used to allow models, which currently provide only monthly propagation parameters. The real-time specifications of these parameters can then be used as decision aids in both the tactical and the strategic military environments. The TISS will include first order artificial intelligence design to aid in gathering the most appropriate sets of available real-time trans-ionospheric propagation data, and will communicate these data sets to the Air Weather Service Forecasting Center where they will be tailored to specific military customers.

  9. Utilizing Yagi antennas in Lightning Mapping Array to detect low-power VHF signals

    Science.gov (United States)

    Tilles, J.; Thomas, R. J.; Edens, H. E.; Krehbiel, P. R.; Rison, W.

    2013-12-01

    The New Mexico Tech VHF Lightning Mapping Array (LMA) being operated at Langmuir Laboratory in central New Mexico is comprised of 22 time-of-arrival stations spanning an area approximately 60 km north-south and 45 km east-west. Nine stations are at high altitude (3.1-3.3 km GPS) over a 3 x 4 km area around the mountain-top Laboratory, and 13 are on the surrounding plains and the Rio Grande valley, at altitudes between 1.4 and 2.2 km. Each station utilizes a vertical half-wave dipole antenna having about 2 dBi gain at horizontal incidence and providing omnidirectional azimuthal coverage. In 2012, four additional stations utilizing higher gain (11 dBi) Yagi antennas were co-located at four of the surrounding sites within 10-15 km of the laboratory, each pointed over the laboratory area. The purpose was to test if directional antennas would improve detection of low-power sources in the laboratory vicinity, such as those associated with positive breakdown or weak precursor events. The test involved comparing the number and quality of radiation sources obtained by processing data from two sets of stations: first for a 17-station network in which all stations were omnidirectional, and then for the same network with Yagi-based measurements substituted in place of the omni measurements at the four co-located stations. For radiation events located in both datasets, the indicated source power values from Yagi stations were typically 5-10 dB greater than their omnidirectional counterpart for sources over or near the laboratory, consistent with the 9 dB difference in on-axis gain values. The difference decreased through zero and to negative values with increasing distance from the laboratory, confirming that it was due to the directionality of the Yagi antennas. It was expected that a network having Yagi antennas at all outlying stations would improve the network's detection of lower power sources in its central region. Rather, preliminary results show that there is no

  10. Faraday polarization fluctuations of satellite beacon signals

    Science.gov (United States)

    Lee, M. C.; Klobuchar, J. A.

    1988-01-01

    The anisotropic effects of random density irregularities in causing Faraday polarization fluctuations of VHF radio signals are examined, taking both rod-like and sheet-like irregularities into consideration. It is found that the variance of Faraday polarization fluctuations depends on the ratio of perpendicular to parallel correlation lengths. The anisotropic effect of rod-like ionospheric irregularities are shown to be most appreciable for longitudinal propagation. The anisotropic effect of sheet-like ionospheric irregularities, however, is not strongly dependent on the radio propagation angle. During transionospheric propagation at large angles with respect to the geomagnetic field, sheet-like irregularities may cause greater Faraday polarization fluctuations than rod-like irregularities.

  11. On preventing the destructive influence of the ionosphere on the resolution of a microwave trans-ionospheric radar system during remote Earth probing

    International Nuclear Information System (INIS)

    Shtejnshleger, V.B.; Dzenkevich, A.V.; Manakov, V.Yu.; Misezhnikov, G.S.

    1998-01-01

    The results presented testify to the efficiency of the proposed two-dimensional adaptive compensation of dispersion and fluctuation ionospheric distortions of signals from space radar station with synthesized equipment (RSE) of USW range waves. This creates a prerequisite for remote probing of the Earth using trans-ionospheric RSE of USW range wave, possessing an increased capability of penetrating through the plant mantle and upper layer of the Earth surface [ru

  12. VHF Scintillation in an Artificially Heated Ionosphere

    Science.gov (United States)

    Suszcynsky, D. M.; Layne, J.; Light, M. E.; Pigue, M. J.; Rivera, L.

    2017-12-01

    As part of an ongoing project to characterize very-high-frequency (VHF) radio wave propagation through structured ionospheres, Los Alamos National Laboratory has been conducting a set of experiments to measure the scintillation effects of VHF transmissions under a variety of ionospheric conditions. Previous work (see 2015 Fall AGU poster by D. Suszcynsky et al.) measured the S4 index and ionospheric coherence bandwidth in the 32 - 44 MHz frequency range under naturally scintillated conditions in the equatorial region at Kwajalein Atoll during three separate campaigns centered on the 2014 and 2015 equinoxes. In this paper, we will present preliminary results from the February and September, 2017 High Altitude Auroral Research Project (HAARP) Experimental Campaigns where we are attempting to make these measurements under more controlled conditions using the HAARP ionospheric heater in a twisted-beam mode. Two types of measurements are made by transmitting VHF signals through the heated ionospheric volume to the Radio Frequency Propagation (RFProp) satellite experiment. The S4 scintillation index is determined by measuring the power fluctuations of a 135-MHz continuous wave signal and the ionospheric coherence bandwidth is simultaneously determined by measuring the delay spread of a frequency-modulated continuous wave (FMCW) signal in the 130 - 140 MHz frequency range. Additionally, a spatial Fourier transform of the CW time series is used to calculate the irregularity spectral density function. Finally, the temporal evolution of the time series is used to characterize spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities. All results are compared to theory and scaled for comparison to the 32 - 44 MHz Kwajalein measurements.

  13. Modelling and observation of transionospheric propagation results from ISIS II in preparation for ePOP

    Directory of Open Access Journals (Sweden)

    R. G. Gillies

    2007-02-01

    Full Text Available The enhanced Polar Outflow Probe (ePOP is scheduled to be launched as part of the Cascade Demonstrator Small-Sat and Ionospheric Polar Explorer (CASSIOPE satellite in early 2008. A Radio Receiver Instrument (RRI on ePOP will receive HF transmissions from various ground-based transmitters. In preparation for the ePOP mission, data from a similar transionospheric experiment performed by the International Satellites for Ionospheric Studies (ISIS II satellite has been studied. Prominent features in the received 9.303-MHz signal were periodic Faraday fading of signal intensity at rates up to 13 Hz and a time of arrival delay between the O- and X-modes of up to 0.8 ms. Both features occurred when the satellite was above or south of the Ottawa transmitter. Ionospheric models for ray tracing were constructed using both International Reference Ionosphere (IRI profiles and local peak electron density values from ISIS ionograms. Values for fade rate and differential mode delay were computed and compared to the values observed in the ISIS II data. The computed values showed very good agreement to the observed values of both received signal parameters when the topside sounding foF2 values were used to scale IRI profiles, but not when strictly modelled IRI profiles were used. It was determined that the primary modifier of the received signal parameters was the foF2 density and not the shape of the profile. This dependence was due to refraction, at the 9.303-MHz signal frequency, causing the rays to travel larger distances near the peak density where essentially all the mode splitting occurred. This study should assist in interpretation of ePOP RRI data when they are available.

  14. Dihydroazulene/Vinylheptafulvene (DHA/VHF)

    DEFF Research Database (Denmark)

    Vlasceanu, Alexandru

    A theoretical and experimental investigation of conformational modifications on the thermodynamic, optical, and switching properties of dihydroazulene/vinylheptafulvene (DHA/VHF) photoswitches, in the context of molecular solar thermal (MOST) systems, is described herein. The optical properties...... of monomeric DHA/VHF systems are found to be strongly dependent on structural changes which can be tuned via steric modifications. This correlation is then used to infer structural features of more complex, macrocyclic DHA/VHF systems based on their optical properties. The introduction of macrocyclic ring...... strain is furthermore found to significantly influence the switching behavior of DHA/VHF moieties compared to non-cyclized systems. The thermal ring closure of macrocyclic VHF-VHF systems is found to occur in a stepwise manner, enabling the release of the energy on both a fast and slow timescale...

  15. Ionospheric Coherence Bandwidth Measurements in the Lower VHF Frequency Range

    Science.gov (United States)

    Suszcynsky, D. M.; Light, M. E.; Pigue, M. J.

    2015-12-01

    The United States Department of Energy's Radio Frequency Propagation (RFProp) experiment consists of a satellite-based radio receiver suite to study various aspects of trans-ionospheric signal propagation and detection in four frequency bands, 2 - 55 MHz, 125 - 175 MHz, 365 - 415 MHz and 820 - 1100 MHz. In this paper, we present simultaneous ionospheric coherence bandwidth and S4 scintillation index measurements in the 32 - 44 MHz frequency range collected during the ESCINT equatorial scintillation experiment. 40-MHz continuous wave (CW) and 32 - 44 MHz swept frequency signals were transmitted simultaneously to the RFProp receiver suite from the Reagan Test Site at Kwajalein Atoll in the Marshall Islands (8.7° N, 167.7° E) in three separate campaigns during the 2014 and 2015 equinoxes. Results show coherence bandwidths as small as ~ 1 kHz for strong scintillation (S4 > 0.7) and indicate a high degree of ionospheric variability and irregularity on 10-m spatial scales. Spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities are also observed and are dominant at low elevation angles. The results are compared to previous measurements and available scaling laws.

  16. CMOS VHF transconductance-C lowpass filter

    NARCIS (Netherlands)

    Nauta, Bram

    1990-01-01

    Experimental results of a VHF CMOS transconductance-C lowpass filter are described. The filter is built with transconductors as published earlier. The cutoff frequency can be tuned from 22 to 98 MHz and the measured filter response is very close to the ideal response

  17. Bias-Voltage Stabilizer for HVHF Amplifiers in VHF Pulse-Echo Measurement Systems.

    Science.gov (United States)

    Choi, Hojong; Park, Chulwoo; Kim, Jungsuk; Jung, Hayong

    2017-10-23

    The impact of high-voltage-high-frequency (HVHF) amplifiers on echo-signal quality is greater with very-high-frequency (VHF, ≥100 MHz) ultrasound transducers than with low-frequency (LF, ≤15 MHz) ultrasound transducers. Hence, the bias voltage of an HVHF amplifier must be stabilized to ensure stable echo-signal amplitudes. We propose a bias-voltage stabilizer circuit to maintain stable DC voltages over a wide input range, thus reducing the harmonic-distortion components of the echo signals in VHF pulse-echo measurement systems. To confirm the feasibility of the bias-voltage stabilizer, we measured and compared the deviations in the gain of the HVHF amplifier with and without a bias-voltage stabilizer. Between -13 and 26 dBm, the measured gain deviations of a HVHF amplifier with a bias-voltage stabilizer are less than that of an amplifier without a bias-voltage stabilizer. In order to confirm the feasibility of the bias-voltage stabilizer, we compared the pulse-echo responses of the amplifiers, which are typically used for the evaluation of transducers or electronic components used in pulse-echo measurement systems. From the responses, we observed that the amplitudes of the echo signals of a VHF transducer triggered by the HVHF amplifier with a bias-voltage stabilizer were higher than those of the transducer triggered by the HVHF amplifier alone. The second, third, and fourth harmonic-distortion components of the HVHF amplifier with the bias-voltage stabilizer were also lower than those of the HVHF amplifier alone. Hence, the proposed scheme is a promising method for stabilizing the bias voltage of an HVHF amplifier, and improving the echo-signal quality of VHF transducers.

  18. Environmental/Noise Effects on VHF/UHF UWB SAR

    National Research Council Canada - National Science Library

    Ralston, James

    1998-01-01

    This paper presents a straightforward approach to estimating the impact of natural environmental noise on an overall system noise temperature for very high frequency/ultrahigh frequency synthetic aperture radar (VHF/UHF SAR...

  19. Dicty_cDB: VHF145 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available VH (Link to library) VHF145 (Link to dictyBase) - - - Contig-U15430-1 VHF145E (Link...) Clone ID VHF145 (Link to dictyBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15430-1 Ori...ology vs DNA Score E Sequences producing significant alignments: (bits) Value N AC116984 |AC116984.2 Dictyos... theta DNA for complete sequence of nucleomorph chromosome 2. 48 2e-07 2 ES451909 | PREDICTED: similar to PI...al 16.0 %: nuclear 8.0 %: vacuolar 8.0 %: endoplasmic reticulum 4.0 %: cytoskeletal >> prediction for VHF145

  20. TH-AB-209-09: Quantitative Imaging of Electrical Conductivity by VHF-Induced Thermoacoustics

    Energy Technology Data Exchange (ETDEWEB)

    Patch, S; Hull, D [Avero Diagnostics, Irving, TX (United States); See, W [Medical College of Wisconsin, Milwaukee, WI (United States); Hanson, G [UW-Milwaukee, Milwaukee, WI (United States)

    2016-06-15

    Purpose: To demonstrate that very high frequency (VHF) induced thermoacoustics has the potential to provide quantitative images of electrical conductivity in Siemens/meter, much as shear wave elastography provides tissue stiffness in kPa. Quantitatively imaging a large organ requires exciting thermoacoustic pulses throughout the volume and broadband detection of those pulses because tomographic image reconstruction preserves frequency content. Applying the half-wavelength limit to a 200-micron inclusion inside a 7.5 cm diameter organ requires measurement sensitivity to frequencies ranging from 4 MHz down to 10 kHz, respectively. VHF irradiation provides superior depth penetration over near infrared used in photoacoustics. Additionally, VHF signal production is proportional to electrical conductivity, and prostate cancer is known to suppress electrical conductivity of prostatic fluid. Methods: A dual-transducer system utilizing a P4-1 array connected to a Verasonics V1 system augmented by a lower frequency focused single element transducer was developed. Simultaneous acquisition of VHF-induced thermoacoustic pulses by both transducers enabled comparison of transducer performance. Data from the clinical array generated a stack of 96-images with separation of 0.3 mm, whereas the single element transducer imaged only in a single plane. In-plane resolution and quantitative accuracy were measured at isocenter. Results: The array provided volumetric imaging capability with superior resolution whereas the single element transducer provided superior quantitative accuracy. Combining axial images from both transducers preserved resolution of the P4-1 array and improved image contrast. Neither transducer was sensitive to frequencies below 50 kHz, resulting in a DC offset and low-frequency shading over fields of view exceeding 15 mm. Fresh human prostates were imaged ex vivo and volumetric reconstructions reveal structures rarely seen in diagnostic images. Conclusion

  1. Comparison Study of Lightning observations from VHF interferometer and Geostationary Lightning Mapper

    Science.gov (United States)

    Kudo, A.; Stock, M.; Ushio, T.

    2017-12-01

    We compared the optical observation from Geostationary Lightning Mapper (GLM) which is mounted on the geostationary meteorological satellite GOES-16 launched last year, and the radio observations from the ground-based VHF broad band interferometer. GLM detects 777.4 nm wavelength infrared optical signals from thunderstorm cells which are illuminated by the heated path during lightning discharge, and was developed mainly for the purpose of increasing the lead time for warning of severe weather and clarifying the discharge mechanism. Its detection has 2 ms frame rate, and 8 km square of space resolution at nadir. The VHF broad band interferometer is able to capture the electromagnetic waves from 20 MHz to 75 MHz and estimate the direction of arrival of the radiation sources using the interferometry technique. This system also has capability of observing the fast discharge process which cannot be captured by other systems, so it is expected to able to make detailed comparison. The recording duration of the system is 1 second. We installed the VHF broad band interferometer which consists of three VHF antenna and one fast antenna at Huntsville, Alabama from April 22nd to May 15th and in this total observation period, 720 triggers of data were observed by the interferometer. For comparison, we adopted the data from April 27th , April 30th. Most April 27th data has GLM "event" detection which is coincident time period. In time-elevation plot comparison, we found GLM detection timing was well coincide with interferometer during K-changes or return strokes and few detection during breakdown process. On the other hand, no GLM detection near the site for all data in April 30th and we are triyng to figure out the reason. We would like to thank University of Alabama Huntsville, New Mexico Institute of Mining and Technology, and RAIRAN Pte. Ltd for the help during the campaign.

  2. Discharge Characteristic of VHF-DC Superimposed Magnetron Sputtering System

    Science.gov (United States)

    Toyoda, Hirotaka; Fukuoka, Yushi; Fukui, Takashi; Takada, Noriharu; Sasai, Kensuke

    2014-10-01

    Magnetron plasmas are one of the most important tools for sputter deposition of thin films. However, energetic particles from the sputtered target such as backscattered rare gas atoms or oxygen negative ions from oxide targets sometimes induce physical and chemical damages as well as surface roughening to the deposited film surface during the sputtering processes. To suppress kinetic energy of such particles, superposition of RF or VHF power to the DC power has been investigated. In this study, influence of the VHF power superposition on the DC target voltage, which is important factor to determine kinetic energy of high energy particles, is investigated. In the study, 40 MHz VHF power was superimposed to an ITO target and decrease in the target DC voltage was measured as well as deposited film deposition properties such as deposition rate or electrical conductivity. From systematic measurement of the target voltage, it was revealed that the target voltage can be determined by a very simple parameter, i.e., a ratio of VHF power to the total input power (DC and VHF powers) in spite of the DC discharge current. Part of this work was supported by ASTEP, JST.

  3. Partial Discharge Spectral Characterization in HF, VHF and UHF Bands Using Particle Swarm Optimization.

    Science.gov (United States)

    Robles, Guillermo; Fresno, José Manuel; Martínez-Tarifa, Juan Manuel; Ardila-Rey, Jorge Alfredo; Parrado-Hernández, Emilio

    2018-03-01

    The measurement of partial discharge (PD) signals in the radio frequency (RF) range has gained popularity among utilities and specialized monitoring companies in recent years. Unfortunately, in most of the occasions the data are hidden by noise and coupled interferences that hinder their interpretation and renders them useless especially in acquisition systems in the ultra high frequency (UHF) band where the signals of interest are weak. This paper is focused on a method that uses a selective spectral signal characterization to feature each signal, type of partial discharge or interferences/noise, with the power contained in the most representative frequency bands. The technique can be considered as a dimensionality reduction problem where all the energy information contained in the frequency components is condensed in a reduced number of UHF or high frequency (HF) and very high frequency (VHF) bands. In general, dimensionality reduction methods make the interpretation of results a difficult task because the inherent physical nature of the signal is lost in the process. The proposed selective spectral characterization is a preprocessing tool that facilitates further main processing. The starting point is a clustering of signals that could form the core of a PD monitoring system. Therefore, the dimensionality reduction technique should discover the best frequency bands to enhance the affinity between signals in the same cluster and the differences between signals in different clusters. This is done maximizing the minimum Mahalanobis distance between clusters using particle swarm optimization (PSO). The tool is tested with three sets of experimental signals to demonstrate its capabilities in separating noise and PDs with low signal-to-noise ratio and separating different types of partial discharges measured in the UHF and HF/VHF bands.

  4. Using the SLAC VHF and UHF radio systems

    International Nuclear Information System (INIS)

    Struven, W.

    1987-02-01

    The use of the SLAC VHF and UHF Radio Systems and the Tunnel Antenna Systems as they are presently configured is described. The original radio system was built in 1966 and has grown in scope over the years. The Tunnel Antenna Systems were developed for, and first installed in, the PEP ring, and later added to other tunnels and redesigned to cover the UHF range, as well as VHF. The UHF radio system was designed and built for SLC use, and was first used in the SLC Arcs. The three radio systems will be described and the capabilities of each system will be defined

  5. From VHF to UHF CMOS-MEMS Monolithically Integrated Resonators

    DEFF Research Database (Denmark)

    Teva, Jordi; Berini, Abadal Gabriel; Uranga, A.

    2008-01-01

    This paper presents the design, fabrication and characterization of microresonators exhibiting resonance frequencies in the VHF and UHF bands, fabricated using the available layers of the standard and commercial CMOS technology, AMS-0.35mum. The resonators are released in a post-CMOS process cons...

  6. Combined VLF and VHF lightning observations of Hurricane Rita landfall

    Science.gov (United States)

    Henderson, B. G.; Suszcynsky, D. M.; Wiens, K. C.; Hamlin, T.; Jeffery, C. A.; Orville, R. E.

    2009-12-01

    Hurricane Rita displayed abundant lightning in its northern eyewall as it made landfall at 0740 UTC 24 Sep 2005 near the Texas/Louisiana border. For this work, we combined VHF and VLF lightning data from Hurricane Rita, along with radar observations from Gulf Coast WSR-88D stations, for the purpose of demonstrating the combined utility of these two spectral regions for hurricane lightning monitoring. Lightning is a direct consequence of the electrification and breakdown processes that take place during the convective stages of thunderstorm development. As Rita approached the Gulf coast, the VHF lightning emissions were distinctly periodic with a period of 1.5 to 2 hours, which is consistent with the rotational period of hurricanes. VLF lightning emissions, measured by LASA and NLDN, were present in some of these VHF bursts but not all of them. At landfall, there was a significant increase in lightning emissions, accompanied by a significant convective surge observed in radar. Furthermore, VLF and VHF lightning source heights clearly increase as a function of time. The evolution of the IC/CG ratio is consistent with that seen in thunderstorms, showing a dominance of IC activity during storm development, followed by an increase in CG activity at the storm’s peak. The periodic VHF lightning events are correlated with increases in convective growth (quantified by the volume of radar echo >40 dB) above 7 km altitude. VLF can discriminate between lightning types, and in the LASA data, Rita landfall lightning activity was dominated by Narrow Bi-polar Events (NBEs)—high-energy, high-altitude, compact intra-cloud discharges. The opportunity to locate NBE lightning sources in altitude may be particularly useful in quantifying the vertical extent (strength) of the convective development and in possibly deducing vertical charge distributions.

  7. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication.

    Science.gov (United States)

    Joseph, Wout; Goeminne, Francis; Verloock, Leen; Vermeeren, Günter; Martens, Luc

    2012-09-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric-field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m(-1) for occupational exposure and from 0.007 to 8.0 V m(-1) for general public exposure. The average fields equal 5.2 V m(-1) for workers, and 0.7 V m(-1) for general public.

  8. In situ occupational and general public exposure to VHF/UHF transmission for air traffic communication

    International Nuclear Information System (INIS)

    Joseph, W.; Goeminne, F.; Verloock, L.; Vermeeren, G.; Martens, L.

    2012-01-01

    Occupational and general public exposure due to very high frequency (VHF)/ultra high frequency (UHF) transmission centres for verbal communication for air traffic control is investigated in situ for the first time. These systems are used for communication with aircraft, resulting in different human exposure from that of classical broadcasting. Measurement methods are proposed for the exposure assessment, and a measurement campaign is executed in three transmission centres. By investigating the temporal behaviour of the VHF signals for 6 d, a realistic worst-case duty cycle of 29 % is determined. Periods of high exposures corresponding with high aircraft traffic are from 7 a.m. to 1 p.m. and in the evening. All measured electric field values satisfy the International Commission on Non-ionizing Radiation Protection guidelines. Fields vary from 0.2 to 21.1 V m -1 for occupational exposure and from 0.007 to 8.0 V m -1 for general public exposure. The average fields equal 5.2 V m -1 for workers, and 0.7 V m -1 for general public. (authors)

  9. VHF lightning mapping observations of a triggered lightning flash

    Science.gov (United States)

    Edens, H. E.; Eack, K. B.; Eastvedt, E. M.; Trueblood, J. J.; Winn, W. P.; Krehbiel, P. R.; Aulich, G. D.; Hunyady, S. J.; Murray, W. C.; Rison, W.; Behnke, S. A.; Thomas, R. J.

    2012-10-01

    On 3 August 2010 an extensive lightning flash was triggered over Langmuir Laboratory in New Mexico. The upward positive leader propagated into the storm's midlevel negative charge region, extending over a horizontal area of 13 × 13 km and 7.5 km altitude. The storm had a normal-polarity tripolar charge structure with upper positive charge over midlevel negative charge. Lightning Mapping Array (LMA) observations were used to estimate positive leader velocities along various branches, which were in the range of 1-3 × 104 m s-1, slower than in other studies. The upward positive leader initiated at 3.4 km altitude, but was mapped only above 4.0 km altitude after the onset of retrograde negative breakdown, indicating a change in leader propagation and VHF emissions. The observations suggest that both positive and negative breakdown produce VHF emissions that can be located by time-of-arrival systems, and that not all VHF emissions occurring along positive leader channels are associated with retrograde negative breakdown.

  10. Repotenciación de un sistema de radiocomunicaciones VHF

    Directory of Open Access Journals (Sweden)

    Juan Ortega

    2016-11-01

    Full Text Available Las comunicaciones móviles avanzan a pasos acelerados, como fuente de ayuda para la interrelación entre personas, empresas y proyectos que se enmarcan dentro de los criterios zonales de planificación, el cambio en la matriz productiva del país y el Plan Nacional del Buen Vivir. En tal virtud, el estudio de una repotenciación mediante la aplicación de conocimientos y herramientas enmarcadas dentro de las comunicaciones VHF, es fundamental dentro del mejoramiento en términos de calidad de servicio dentro del área de concesión donde se fundamenta el estudio. El presente artículo realiza un análisis situacional de la red de radiocomunicaciones VHF actual de la Empresa Eléctrica Regional Centro Sur C. A., el área de concesión, localización y coberturas de los repetidores existentes, con el diagnóstico actual de la misma. Además, se desarrolla la propuesta de repotenciación detallando la infraestructura necesaria para su ejecución, la ampliación del área de cobertura, la configuración del software para la gestión e interconexión de los equipos de diferentes zonas.

  11. Characteristics of equatorial ionization anomaly (EIA) in relation to transionospheric satellite links around the northern crest in the Indian longitude sector

    Science.gov (United States)

    Das, A.; Paul, K. S.; Halder, S.; Basu, K.; Paul, A.

    2014-02-01

    The poleward gradient of the equatorial ionization anomaly (EIA) introduces more intense propagation effects on transionospheric satellite links in comparison to the equatorward gradient. Characterization of the poleward gradient was performed during March-April, August-October 2011 and March-April 2012 using GPS total electron content (TEC) recorded from a chain of stations located more or less along the same meridian (88.5° E) at Calcutta, Baharampore, Farakka and Siliguri. The poleward gradients calculated on magnetically quiet days at elevation in excess of 50° at 14:00, 15:00 and 16:00 LT were found to have a strong correlation with GPS S4 observed from Calcutta during post-sunset-to-midnight hours. A threshold value of poleward TEC gradient is calculated above which there is a probability of scintillation at Calcutta with S4 ≥ 0.4.

  12. Characteristics of equatorial ionization anomaly (EIA in relation to transionospheric satellite links around the northern crest in the Indian longitude sector

    Directory of Open Access Journals (Sweden)

    A. Das

    2014-02-01

    Full Text Available The poleward gradient of the equatorial ionization anomaly (EIA introduces more intense propagation effects on transionospheric satellite links in comparison to the equatorward gradient. Characterization of the poleward gradient was performed during March–April, August–October 2011 and March–April 2012 using GPS total electron content (TEC recorded from a chain of stations located more or less along the same meridian (88.5° E at Calcutta, Baharampore, Farakka and Siliguri. The poleward gradients calculated on magnetically quiet days at elevation in excess of 50° at 14:00, 15:00 and 16:00 LT were found to have a strong correlation with GPS S4 observed from Calcutta during post-sunset-to-midnight hours. A threshold value of poleward TEC gradient is calculated above which there is a probability of scintillation at Calcutta with S4 ≥ 0.4.

  13. Use of vhf dielectric measurements for borehole formation analysis

    Energy Technology Data Exchange (ETDEWEB)

    Poley, J.P.; Nooteboom, J.J.; de Waal, P.J.

    1978-01-01

    A study of the dielectric properties of sedimentary rocks at a sufficiently high frequency may provide useful data for the evaluation of borehole wall formations in exploration and production wells. An experimental program carried out between 1960 and 1967 on sandstone and limestone samples lent further support to these expectations. At frequencies above 20 Mc/s both real and imaginary parts of the complex epsilon* = epsilon' - j epsilon'' were measurable. Moreover, at higher frequencies, epsilon' proved to be independent of the salinity of the water filling the pores, and insensitive to the way in which the oil and the water are actually distributed. The value of epsilon'', on the other hand, turned out to be indicative of the prevailing salinity. By combining other logging data (for instance from an electric or porosity log) with a series of such v.h.f. measurements of epsilon' and epsilon'', the oil or water saturation, the effective formation porosity, the pore-filling fluid salinity, and the rock matrix formation factor might be deduced, if the depth of investigation can be made large enough to overcome the invasion effects.

  14. Observations of lightning processes using VHF radio interferometry

    Science.gov (United States)

    Rhodes, C. T.; Shao, X. M.; Krehbiel, P. R.; Thomas, R.

    1991-01-01

    A single station, multiple baseline radio interferometer was used to locate the direction of VHF radiation from lightning discharges with microsec time resolution. Radiation source directions and electric field waveforms were analyzed for various types of breakdown events. These include initial breakdown and K type events of in-cloud activity, and the leaders of initial and subsequent strokes to ground and activity during and following return strokes. Radiation during the initial breakdown of a flash and in the early stages of initial leaders to ground is found to be similar. In both instances, the activity consists of localized bursts of radiation that are intense and slow moving. Motion within a given burst is unresolved by the interferometer. Radiation from in-cloud K type events is essentially the same as that from dart leaders; in both cases it is produced at the leading edge of a fast moving streamer that propagates along a well defined, often extensive path. K type events are sometimes terminated by fast field changes that are similar to the return stroke initiated by dart leaders; such K type events are the in-cloud analog of the dart leader return stroke process.

  15. Letter to the Editor: Complete maps of the aspect sensitivity of VHF atmospheric radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-08-01

    Full Text Available Using the MU radar at Shigaraki, Japan (34.85°N, 136.10°E, we measure the power distribution pattern of VHF radar echoes from the mid-troposphere. The large number of radar beam-pointing directions (320 allows the mapping of echo power from 0° to 40° from zenith, and also the dependence on azimuth, which has not been achieved before at VHF wavelengths. The results show how vertical shear of the horizontal wind is associated with a definite skewing of the VHF echo power distribution, for beam angles as far as 30° or more from zenith, so that aspect sensitivity cannot be assumed negligible at any beam-pointing angle that most existing VHF radars are able to use. Consequently, the use of VHF echo power to calculate intensity of atmospheric turbulence, which assumes only isotropic backscatter at large beam zenith angles, will sometimes not be valid.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; instruments and techniques

  16. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    International Nuclear Information System (INIS)

    Van Erk, W; Luijks, G M J F; Hitchcock, W

    2011-01-01

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W -1 drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  17. Why does the lumen maintenance of sodium-scandium metal halide lamps improve by VHF operation?

    Energy Technology Data Exchange (ETDEWEB)

    Van Erk, W [Philips Lighting, Sondervick 47, 5505 NB Veldhoven (Netherlands); Luijks, G M J F [Advanced Development Lighting, Philips Lighting, PO Box 80020, 5600 JM Eindhoven (Netherlands); Hitchcock, W, E-mail: Gerard.luijks@philips.com [Philips Lighting Company, 7265 Route 54, Bath, NY 14810 (United States)

    2011-06-08

    Lifetime experiments show that sodium-scandium metal halide lamps perform better on very high frequency (VHF) drivers than on low frequency (LF) constant wattage autotransformer (CWA) ballasts. The question why, will be addressed with focus on arc tube aspects. It is argued that at high frequency operation sodium loss is less, and that the absence of thermal fluctuations in the electrode tip causes less damage and cracking to this part of the electrode. Sudden lm W{sup -1} drops, observed with CWA-operated lamps, most probably occur when the arc attaches on such a corroded and cracked surface. Thorium is effective as an emitter both in the CWA and the VHF operation mode, despite the absence of cataphoretic transport to the cathode in the VHF case.

  18. 33 CFR 401.51 - Signaling approach to a bridge.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Signaling approach to a bridge... approach to a bridge. (a) Unless a vessel's approach has been recognized by a flashing signal, the master shall signal the vessel's presence to the bridge operator by VHF radio when it comes abreast of any of...

  19. Testing VHF/GPS collar design and safety in the study of free-roaming horses.

    Directory of Open Access Journals (Sweden)

    Gail H Collins

    Full Text Available Effective and safe monitoring techniques are needed by U.S. land managers to understand free-roaming horse behavior and habitat use and to aid in making informed management decisions. Global positioning system (GPS and very high frequency (VHF radio collars can be used to provide high spatial and temporal resolution information for detecting free-roaming horse movement. GPS and VHF collars are a common tool used in wildlife management, but have rarely been used for free-roaming horse research and monitoring in the United States. The purpose of this study was to evaluate the design, safety, and detachment device on GPS/VHF collars used to collect free-roaming horse location and movement data. Between 2009 and 2010, 28 domestic and feral horses were marked with commercial and custom designed VHF/GPS collars. Individual horses were evaluated for damage caused by the collar placement, and following initial observations, collar design was modified to reduce the potential for injury. After collar modifications, which included the addition of collar length adjustments to both sides of the collar allowing for better alignment of collar and neck shapes, adding foam padding to the custom collars to replicate the commercial collar foam padding, and repositioning the detachment device to reduce wear along the jowl, we observed little to no evidence of collar wear on horses. Neither custom-built nor commercial collars caused injury to study horses, however, most of the custom-built collars failed to collect data. During the evaluation of collar detachment devices, we had an 89% success rate of collar devices detaching correctly. This study showed that free-roaming horses can be safely marked with GPS and/or VHF collars with minimal risk of injury, and that these collars can be a useful tool for monitoring horses without creating a risk to horse health and wellness.

  20. A no-tune no-match wideband probe for nuclear quadrupole resonance spectroscopy in the VHF range

    Science.gov (United States)

    Scharfetter, Hermann; Petrovic, Andreas; Eggenhofer, Heidi; Stollberger, Rudolf

    2014-12-01

    Nuclear quadrupole resonance (NQR) spectroscopy is a method for the characterization of chemical compounds containing so-called quadrupolar nuclei. Similar to nuclear magnetic resonance (NMR), the sample under investigation is irradiated with strong radiofrequency (RF) pulses, which stimulate the emission of weak RF signals from the quadrupolar nuclei. The signals are then amplified and Fourier transformed so as to obtain a spectrum. In principle, narrowband NQR spectra can be measured with NMR spectrometers. However, pure NQR signals require the absence of a static magnetic field and several special applications require the characterization of a substance over a large bandwidth, e.g. 50-100% of the central frequency, which is hardly possible with standard NMR equipment. Dedicated zero-field NQR equipment is not widespread and current concepts employ resonating probes which are tuned and matched over a wide range by using mechanical capacitors driven by stepper motors. While providing the highest signal to noise ratio (SNR) such probes are slow in operation and can only be operated from dedicated NMR consoles. We developed a low-cost NQR wideband probe without tuning and matching for applications in the very high frequency (VHF) range below 300 MHz. The probe coil was realized as part of a reactive network which approximates an exponential transmission line. The input reflection coefficient of the two developed prototype probe coils is ≤ 20 dB between 90-145 MHz and 74.5-99.5 MHz, respectively. Two wideband NQR spectra of published test substances were acquired with an SNR of better than 20 dB after sufficient averaging. The measured signals and the SNR correspond very well to the theoretically expected values and demonstrate the feasibility of the method. Because there is no need for tuning and matching, our probes can be operated easily from any available NMR console.

  1. Broadband VHF observations for lightning impulses from a small satellite SOHLA-1 (Maido 1)

    Science.gov (United States)

    Morimoto, T.; Kikuchi, H.; Ushio, T.; Kawasaki, Z.; Hidekazu, H.; Aoki, T.

    2009-12-01

    Lightning Research Group of Osaka University (LRG-OU) has been developing VHF Broadband Digital Interferometer (DITF) to image precise lightning channels and monitor lightning activity widely. The feature of broadband DITF is its ultrawide bandwidth (from 25MHz to 100MHz) and implicit redundancy for estimating VHF source location. LRG-OU considers an application of the broadband DITF to the spaceborne measurement system and joins the SOHLA (Space Oriented Higashi-Osaka Leading Associate) satellite project. The SOHLA satellite project represents a technology transfer program to expand the range of the space development community in Japan. The objective is to get SMEs (Small and Medium sized manufacturing Enterprises) involved in small space projects and new space technologies. Under the cooperative agreement, JAXA (Japan Aerospace Exploration Agency) intends to contribute to socio-economic development by returning its R&D results to society, and SOHLA tries to revitalize the local economy through the commercialization of versatile small satellites. According to the agreement, JAXA provides SOHLA its technical information on small satellites and other technical assistance for the development of the small satellites, SOHLA-1. The prime objective of the SOHLA-1 program is to realize low-cost and short term development of a microsatellite which utilizes the components and bus technologies of JAXA’s MicroLabSat. SOHLA-1 is a spin-stabilized microsatellite of MicroLabSat heritage (about 50 kg). The spin axis is fixed to inertial reference frame. The spin axis (z-axis) lies in the plane containing the solar direction and the normal to the orbital plane. LRG-OU takes responsibility for a science mission of SOHLA-1. To examine the feasibility of the DITF receiving VHF lightning impulses in space, LRG-OU proposes the BMW (Broadband Measurement of Waveform for VHF Lightning Impulses). BMW consists of a single pair of an antenna, a band-pass filter, an amplifier, and an

  2. Some radiation safety aspects of operating medical generators of VHF electromagnetic energy

    International Nuclear Information System (INIS)

    Bosevski, V.; Radev, S.; Donev, Ch.

    1977-01-01

    The state of radiation safety in physiotherapy practice using very-high-frequency diathermy was studied with regard to personnel and patient protection. A specially devised shielding set to protect patients and personnel is offered for adoption, and the necessity is insistently stressed of prohibiting any patient head or gonad exposure. It is pointed out that the protective set developed may also be used at facilities employing other types of VHF electromagnetic energy sources. (author)

  3. Adjuvant VHF therapy in locally recurrent and primary unresectable rectal cancer

    International Nuclear Information System (INIS)

    Trotter, J.M.; Lamb, M.H.; Bayliss, E.J.; Edis, A.J.; Blackwell, J.B.; Shepherd, J.M.; Cassidy, B.

    1996-01-01

    In a prospective randomized study, 434 MHz microwave therapy combined with external beam radiotherapy (VHF+RT) was compared with standard external beam radiotherapy (RT) in controlling locally recurrent or unresectable primary adenocarcinoma of the rectum. Independent assessors documented quality of life scores, performance status, toxicities local response to treatment, and systemic disease progression before treatment and after treatment and every 8 week thereafter. Of 75 patients randomized, 73 were eligible for inclusion in the study. Forty-three of these patients had local pelvic tumour recurrence only and 21 also had distant metastases. In addition, nine patients had primary inoperable carcinomas, two of whom also had metastases. Thirty-seven patients were randomized to RT and 36 to VHF+RT. Th median dose of radiation in the VHF+RT arm was 4275 cGy with a median fraction size of 150 cGy and median duration of therapy of 48.5 days versus 4500 cGy in the RT-only arm with a median fraction size of 180 cGy and median duration of therapy of 38 days. These doses are unlikely to be significantly different in biological effect. No significant difference between the two groups was observed in extent and duration of local control, measures of toxicity or quality of life scores. Additionally, survival and cumulative incidence of pelvic site of first progression did not differ significantly between the groups. It is concluded that VHF microwave therapy in conjunction with radiotherapy produces no therapeutic advantage over conventional radiation therapy alone in the treatment of locally recurrent rectal carcinoma. 35 refs., 8 tabs., 3 figs

  4. Characterization of VHF radar observations associated with equatorial Spread F by narrow-band optical measurements

    Directory of Open Access Journals (Sweden)

    R. Sekar

    2004-09-01

    Full Text Available The VHF radars have been extensively used to investigate the structures and dynamics of equatorial Spread F (ESF irregularities. However, unambiguous identification of the nature of the structures in terms of plasma depletion or enhancement requires another technique, as the return echo measured by VHF radar is proportional to the square of the electron density fluctuations. In order to address this issue, co-ordinated radar backscatter and thermospheric airglow intensity measurements were carried out during March 2003 from the MST radar site at Gadanki. Temporal variations of 630.0-nm and 777.4-nm emission intensities reveal small-scale ("micro" and large-scale ("macro" variations during the period of observation. The micro variations are absent on non-ESF nights while the macro variations are present on both ESF and non-ESF nights. In addition to the well-known anti-correlation between the base height of the F-region and the nocturnal variation of thermospheric airglow intensities, the variation of the base height of the F-layer, on occasion, is found to manifest as a bottomside wave-like structure, as seen by VHF radar on an ESF night. The micro variations in the airglow intensities are associated with large-scale irregular plasma structures and found to be in correspondence with the "plume" structures obtained by VHF radar. In addition to the commonly observed depletions with upward movement, the observation unequivocally reveals the presence of plasma enhancements which move downwards. The observation of enhancement in 777.4-nm airglow intensity, which is characterized as plasma enhancement, provides an experimental verification of the earlier prediction based on numerical modeling studies.

  5. Low VHF Channel Measurements and Simulations in Indoor and Outdoor Scenarios

    Science.gov (United States)

    2015-05-01

    Transactions on. 2002;50(5):591-599. 22. Nerguizian C, Despins C, Affes S, Djadel M. Radio-channel characterization of an underground mine at 2.4 ghz...INTENTIONALLY LEFT BLANK. viii 1. Introduction Reliable wireless communication is of paramount importance for many important civilian and military...report, we study near-ground, wireless channel modeling in the lower VHF band for indoor and indoor/outdoor scenarios, drawing from extensive propagation

  6. A beaded collar for dual micro GPS/VHF transmitter attachment to nutria

    Science.gov (United States)

    Haramis, G.M.; White, T.S.

    2011-01-01

    We report on the development of an approximately 85-g beaded collar for dual micro GPS/VHF transmitter attachment to semi-aquatic nutria (Myocastor coypus). Prototype collars were tested on captive nutria and refined during field trials. Central to the design was novel use of the VHF transmitter antenna as a collar. A circular collar was formed by passing the 44-cm antenna cable through a pre-made hole in the transmitter, leaving an approximately 16-cm upright antenna. GPS units were mounted separately via a hole in the base of each unit. For good satellite contact, GPS units (28 g) were maintained at the nape of the neck by counterbalance of the heavier VHF transmitters (50 g) positioned under the neck. To reduce friction, we lined the collar with alternate-sized plastic and, later, more durable nylon beads. The final collar configuration was worn for approximately 1 month deployments with only minor neck abrasion; one collar was worn successfully for 5 months. Foot entanglement remained the greatest risk of injury from the collar. By fitting collars tightly, we reduced the incidence of foot entanglement to 2 of 33 deployments (6%). Successful GPS tracks were acquired on 29 of 33 deployments (88%).

  7. A signature correlation study of ground target VHF/UHF ISAR imagery

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Kersey, William T.; Waldman, Jerry; Carter, Steve; Nixon, William E.

    2003-09-01

    VV and HH-polarized radar signatures of several ground targets were acquired in the VHF/UHF band (171-342 MHz) by using 1/35th scale models and an indoor radar range operating from 6 to 12 GHz. Data were processed into medianized radar cross sections as well as focused, ISAR imagery. Measurement validation was confirmed by comparing the radar cross section of a test object with a method of moments radar cross section prediction code. The signatures of several vehicles from three vehicle classes (tanks, trunks, and TELs) were measured and a signature cross-correlation study was performed. The VHF/UHF band is currently being exploited for its foliage penetration ability, however, the coarse image resolution which results from the relatively long radar wavelengths suggests a more challenging target recognition problem. One of the study's goals was to determine the amount of unique signature content in VHF/UHF ISAR imagery of military ground vehicles. Open-field signatures are compared with each other as well as with simplified shapes of similar size. Signatures were also acquired on one vehicle in a variety of configurations to determine the impact of monitor target variations on the signature content at these frequencies.

  8. Effect of geomagnetic storms on VHF scintillations observed at low latitude

    Science.gov (United States)

    Singh, S. B.; Patel, Kalpana; Singh, A. K.

    2018-06-01

    A geomagnetic storm affects the dynamics and composition of the ionosphere and also offers an excellent opportunity to study the plasma dynamics. In the present study, we have used the VHF scintillations data recorded at low latitude Indian station Varanasi (Geomag. latitude = 14^{°}55^' }N, long. = 154^{°}E) which is radiated at 250 MHz from geostationary satellite UFO-02 during the period 2011-2012 to investigate the effects of geomagnetic storms on VHF scintillation. Various geomagnetic and solar indices such as Dst index, Kp index, IMF Bz and solar wind velocity (Vx) are used to describe the geomagnetic field variation observed during geomagnetic storm periods. These indices are very helpful to find out the proper investigation and possible interrelation between geomagnetic storms and observed VHF scintillation. The pre-midnight scintillation is sometimes observed when the main phase of geomagnetic storm corresponds to the pre-midnight period. It is observed that for geomagnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time and extends to early morning hours.

  9. Concepts for Near Continuous Reception of VHF (Very High Frequency) Signals Using Meteor Burst Propagation.

    Science.gov (United States)

    1985-07-15

    search of the non-government Master Frequency List was made on the microfiche list at the San Diego field office of the FCC. All frequencies in the...channels assigned. A single frequency often has a number of different users. The government Master Frequency List is maintained at area regional centers and

  10. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, H.Y. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Nanjing University of Posts and Telecommunications, School of Tongda, Nanjing (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Zhuge, L.J. [Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Soochow University, Analysis and Testing Center, Suzhou (China); Wu, X.M. [Soochow University, College of Physics, Optoelectronics and Energy and Collaborative Innovation Center of Suzhou Nano Science and Technology, Suzhou (China); Soochow University, Key Lab of Advanced Optical Manufacturing Technologies of Jiangsu Province and Key Lab of Modern Optical Technologies of Education Ministry of China, Suzhou (China); Chinese Academy of Sciences, State Key Laboratory of Functional Materials for Informatics, Shanghai Institute of Microsystem and Information Technology, Shanghai (China)

    2015-01-23

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO{sub x} are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf{sup 2+} and Hf{sup 4+}. The HfErO films are composed with the structures of HfO{sub 2}, HfO and ErO{sub x}, which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO{sub 2} in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO{sub 2} are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  11. Structure, optical properties and thermal stability of HfErO films deposited by simultaneous RF and VHF magnetron sputtering

    International Nuclear Information System (INIS)

    Zhang, H.Y.; He, H.J.; Zhang, Z.; Jin, C.G.; Yang, Y.; Wang, Y.Y.; Ye, C.; Zhuge, L.J.; Wu, X.M.

    2015-01-01

    HfErO films are deposited on Si substrates by simultaneous radio frequency (RF) and very high frequency (VHF) magnetron sputtering technique. The content of the doped ingredient of Er and the body composition of HfO x are, respectively, controlled through the VHF and RF powers. Low content of Er doping in the HfErO films can be achieved, because the VHF source of 27.12 MHz has higher ion energy and lower ion flux than the RF source resulting in low sputtering rate in the magnetron sputtering system. The structure, optical properties and thermal stability of the HfErO films are investigated in this work. Results show that the doped content of Er is independently controlled by the VHF power. The oxygen vacancies are created by the Er incorporation. The hafnium in the HfErO films forms mixed valence of Hf 2+ and Hf 4+ . The HfErO films are composed with the structures of HfO 2 , HfO and ErO x , which can be optimized through the VHF power. At high VHF power, the Hf-Er-O bonds are formed, which demonstrates that the Er atoms are doped into the lattice of HfO 2 in the HfErO films. The HfErO films have bad thermal stability as the crystallization temperature decreases from 900 to 800 C. After thermal annealing, cubic phase of HfO 2 are stabilized, which is ascribed to the oxygen vacancies creation by the Er incorporation. The optical properties such as the refractive index and the optical band gap of the HfErO films are optimized by the VHF power. (orig.)

  12. Low frequency modulation of transionospheric radio wave amplitude at low-latitudes: possible role of field line oscillations

    Directory of Open Access Journals (Sweden)

    A. K. Sinha

    Full Text Available Ionospheric scintillations of radio waves at low-latitudes are associated with electron density irregularities. These irregularities are field-aligned and can provide excitation energy all along the field line to non-local field-aligned oscillations, such as the local field line oscillations. Eigen-periods of toroidal field line oscillations at low-latitudes, computed by using the dipole magnetic field and ion distributions obtained from the International Reference Ionosphere (IRI for typical nighttime conditions, fall in the range of 20–25 s. When subjected to spectral analysis, signal strength of the radio waves recorded on the 250 MHz beacon at Pondicherry (4.5° N dip, Mumbai (13.4° N dip and Ujjain (18.6° N dip exhibit periodicities in the same range. For the single event for which simultaneous ground magnetic data were available, the geomagnetic field also oscillated at the same periodicity. The systematic presence of a significant peak in the 20–25 s range during periods of strong radio wave scintillations, and its absence otherwise suggests the possibility that field line oscillations are endogenously excited by the irregularities, and the oscillations associated with the excited field line generate the modulation characteristics of the radio waves received on the ground. The frequency of modulation is found to be much lower than the characteristic frequencies that define the main body of scintillations, and they probably correspond to scales that are much larger than the typical Fresnel scale. It is possible that the refractive mechanism associated with larger scale long-lived irregularities could be responsible for the observed phenomenon. Results of a preliminary numerical experiment that uses a sinusoidal phase irregularity in the ionosphere as a refracting media are presented. The results show that phase variations which are large enough to produce a focal plane close to the ground can reproduce features that are not

  13. Low frequency modulation of transionospheric radio wave amplitude at low-latitudes: possible role of field line oscillations

    Directory of Open Access Journals (Sweden)

    A. K. Sinha

    2002-01-01

    Full Text Available Ionospheric scintillations of radio waves at low-latitudes are associated with electron density irregularities. These irregularities are field-aligned and can provide excitation energy all along the field line to non-local field-aligned oscillations, such as the local field line oscillations. Eigen-periods of toroidal field line oscillations at low-latitudes, computed by using the dipole magnetic field and ion distributions obtained from the International Reference Ionosphere (IRI for typical nighttime conditions, fall in the range of 20–25 s. When subjected to spectral analysis, signal strength of the radio waves recorded on the 250 MHz beacon at Pondicherry (4.5° N dip, Mumbai (13.4° N dip and Ujjain (18.6° N dip exhibit periodicities in the same range. For the single event for which simultaneous ground magnetic data were available, the geomagnetic field also oscillated at the same periodicity. The systematic presence of a significant peak in the 20–25 s range during periods of strong radio wave scintillations, and its absence otherwise suggests the possibility that field line oscillations are endogenously excited by the irregularities, and the oscillations associated with the excited field line generate the modulation characteristics of the radio waves received on the ground. The frequency of modulation is found to be much lower than the characteristic frequencies that define the main body of scintillations, and they probably correspond to scales that are much larger than the typical Fresnel scale. It is possible that the refractive mechanism associated with larger scale long-lived irregularities could be responsible for the observed phenomenon. Results of a preliminary numerical experiment that uses a sinusoidal phase irregularity in the ionosphere as a refracting media are presented. The results show that phase variations which are large enough to produce a focal plane close to the ground can reproduce features that are not

  14. Forming and detection of digital watermarks in the System for Automatic Identification of VHF Transmissions

    Directory of Open Access Journals (Sweden)

    О. В. Шишкін

    2013-07-01

    Full Text Available Forming and detection algorithms for digital watermarks are designed for automatic identification of VHF radiotelephone transmissions in the maritime and aeronautical mobile services. An audible insensitivity and interference resistance of embedded digital data are provided by means of OFDM technology jointly with normalized distortions distribution and data packet detection by the hash-function. Experiments were carried out on the base of ship’s radio station RT-2048 Sailor and USB ADC-DAC module of type Е14-140M L-CARD in the off-line processing regime in Matlab medium

  15. VHF and L-band scintillation characteristics over an Indian low latitude station, Waltair (17.7° N, 83.3° E

    Directory of Open Access Journals (Sweden)

    P. V. S. Rama Rao

    2005-10-01

    Full Text Available Characteristics of simultaneous VHF (244 MHz and L-band (1.5 GHz scintillations recorded at a low-latitude station, Waltair (17.7° N, 83.3° E, during the low sunspot activity year of March 2004 to March 2005, suggest that the occurrence of scintillations is mainly due to two types, namely the Plasma Bubble Induced (PBI, which maximizes during the post sunset hours of winter and equinoctial months, and the Bottom Side Sinusoidal (BSS type, which maximizes during the post-midnight hours of the summer solstice months. A detailed study on the spectral characteristics of the scintillations at both the frequencies show that the post-sunset scintillations are strong with fast fading (≈40 fad/min and are multiple in nature in scattering, giving rise to steep spectral slopes, whereas the post-midnight scintillations, which occur mostly on the VHF signal with low fading rate (≈4 fad/min, are of the BSS type, often showing typical Fresnel oscillations with reduced roll off spectral slopes, indicating that the type of irregularity resembles a thin screen structure giving rise to weak scattering. Using the onset times of several similar scintillation patches across the two satellite (FLEETSAT 73° E, INMARSAT 65° E ray paths (sub-ionospheric points are separated by 82 km, the East ward movement of the irregularity patches is found to vary from 150 to 250 m/s during the post sunset hours and decrease slowly during the post midnight hours. Further, the east-west extent of the PBI type of irregularities is found to vary from 100 to 500 km, while that of the BSS type extend up to a few thousand kilometers. Keywords. Ionosphere (Ionospheric irregularities; Auroral ionosphere; Electric fields and currents

  16. Two-dimensional simulations of multi-hollow VHF SiH4/H2 plasma

    Directory of Open Access Journals (Sweden)

    Li-Wen Su

    2018-02-01

    Full Text Available A triode multi-hollow VHF SiH4/H2 plasma (60 MHz was examined at a pressure of 20 Pa by two-dimensional simulations using the fluid model. In this study, we considered the effect of the rate constant of reaction, SiH3 + SiH3→SiH2 + SiH4, on the plasma characteristics. A typical VHF plasma of a high-electron density with a low-electron temperature was obtained between two discharge electrodes. Spatial profiles of SiH3+, SiH2+, SiH3- and SiH3 densities were similar to that of the electron density while the electron temperature had a maximum value near the two discharge electrodes. It was found that the SiH3 radical density did not decrease rapidly near the substrate and the electron temperature was lower than 1 eV, suggesting that the triode multi-hollow plasma source can provide high quality amorphous silicon with a high deposition rate.

  17. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other.

    Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  18. VHF/UHF radar observations of tropical mesoscale convective systems over southern India

    Directory of Open Access Journals (Sweden)

    K. Kishore Kumar

    2005-07-01

    Full Text Available Several campaigns have been carried out to study the convective systems over Gadanki (13.5° N, 79.2° E, a tropical station in India, using VHF and UHF radars. The height-time sections of several convective systems are investigated in detail to study reflectivity, turbulence and vertical velocity structure. Structure and dynamics of the convective systems are the main objectives of these campaigns. The observed systems are classified into single- and multi-cell systems. It has been observed that most of the convective systems at this latitude are multi-cellular in nature. Simultaneous VHF and UHF radar observations are used to classify the observed precipitating systems as convective, intermediary and stratiform regions. Composite height profiles of vertical velocities in these regions were obtained and the same were compared with the profiles obtained at other geographical locations. These composite profiles of vertical velocity in the convective regions have shown their peaks in the mid troposphere, indicating that the maximum latent heat is being released at those heights. These profiles are very important for numerical simulations of the convective systems, which vary significantly from one geographical location to the other. Keywords. Meteorology and atmospheric dynamics (Mesoscale meteorology; Convective processes – Radio science (Remote sensing

  19. VHF/UHF imagery and RCS measurements of ground targets in forested terrain

    Science.gov (United States)

    Gatesman, Andrew J.; Beaudoin, Christopher J.; Giles, Robert H.; Waldman, Jerry; Nixon, William E.

    2002-08-01

    The monostatic VV and HH-polarized radar signatures of several targets and trees have been measured at foliage penetration frequencies (VHF/UHF) by using 1/35th scale models and an indoor radar range operating at X-band. An array of high-fidelity scale model ground vehicles and test objects as well as scaled ground terrain and trees have been fabricated for the study. Radar measurement accuracy has been confirmed by comparing the signature of a test object with a method of moments radar cross section prediction code. In addition to acquiring signatures of targets located on a smooth, dielectric ground plane, data have also been acquired with targets located in simulated wooded terrain that included scaled tree trunks and tree branches. In order to assure the correct backscattering behavior, all dielectric properties of live tree wood and moist soil were scaled properly to match the complex dielectric constant of the full-scale materials. The impact of the surrounding tree clutter on the VHF/UHF radar signatures of ground vehicles was accessed. Data were processed into high-resolution, polar-formatted ISAR imagery and signature comparisons are made between targets in open-field and forested scenarios.

  20. Online calibration of high-frequency partial discharge signals in three-phase belted power cables

    NARCIS (Netherlands)

    Wouters, P.A.A.F.

    2005-01-01

    Partial discharge (PD) magnitudes from classical detection techniques are expressed in terms of apparent charges. Signals from HF/VHF/UHF techniques on substation components are often hard to express in this quantity because of complex signal excitation and propagation channels. A method to

  1. Final environmental assessment for vegetation control at VHF stations, microwave stations, electrical substations, and pole yards

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-10-13

    Southwestern Power Adm. operates very high frequency (VHF) and microwave radio stations, electrical substations, and pole yards for electric power transmission throughout AR, MO, and OK. Vegetation growth at the stations must be suppressed for safety of operation and personnel. Southwestern has been using a combination of mechanical/manual and herbicide control for this purpose; Federally- mandated reductions in staff and budgetary resources require Southwestern to evaluate all potentially efficient methods for vegetation control. Three alternatives were examined: no action, mechanical/manual control, and (proposed) a combination of mechanical/manual and herbicide control. Environmental impacts on air and water quality, wetlands, wildlife, endangered species, archaeological and other resources, farmland, human health, transportation, etc. were evaluated.

  2. Morphology and Structural Characterization of Carbon Nanowalls Grown via VHF-PECVD

    Science.gov (United States)

    Akmal Hasanudin, M.; Wahab, Y.; Ismail, A. K.; Zahid Jamal, Z. A.

    2018-03-01

    A 150 MHz very high frequency plasma enhanced chemical vapor deposition (150 MHz VHF-PECVD) system was utilized to fabricate two-dimensional carbon nanostructure from the mixture of methane and hydrogen. Morphology and structural properties of the grown nanostructure were investigated by FESEM imaging and Raman spectroscopy. Carbon nanowalls (CNW) with dense and wavy-like structure were successfully synthesized. The wavy-like morphology of CNW was found to be more distinct during growth at small electrode spacing and denser with increasing deposition time due to better flux of hydrocarbon radicals to the substrate and higher rate of reaction, respectively. Typical characteristics of CNW were observed from strong D band, narrow bandwidth of G band and single broad peak of 2D band of Raman spectra indicating the presence of disordered nanocrystalline graphite structure with high degree of graphitization.

  3. Graphene-based tunable non-foster circuit for VHF applications

    Energy Technology Data Exchange (ETDEWEB)

    Tian, Jing; Nagarkoti, Deepak Singh; Rajab, Khalid Z.; Hao, Yang, E-mail: y.hao@qmul.ac.uk [School of Electronic Engineering and Computer Science, Queen Mary, University of London, London, E1 4NS (United Kingdom)

    2016-06-15

    This paper presents a negative impedance converter (NIC) based on graphene field effect transistors (GFETs) for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS) topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010)] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS) show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency) using Nyquist stability criterion to ensure there are no oscillation issues.

  4. Development of a High-Brightness VHF Electron Source at LBNL

    International Nuclear Information System (INIS)

    Lidia, Steven M.; Sannibale, Fernando; Staples, John W.; Virostek, Steve P.; Wells, Russell P.

    2007-01-01

    Currently proposed ERL and high average power FEL projects require electron beam sources that can generate ∼1nC bunch charges at high repetition rates. Many proposed sources are based around either high voltage DC or microwave RF guns, each with its particular set of technological limits and system complications. We propose a novel solution that greatly diminishes high voltage breakdown issues while also decreasing peak RF power requirements in a warm copper device, and that has the benefit of mapping the rf oscillation period much more closely to the required beam repetition rate. We present the initial RF and mechanical design for a 750kV electron source and beam injection system utilizing a gun resonant in the VHF band. Beam dynamics simulations demonstrate excellent beam quality preservation and transport

  5. Graphene-based tunable non-foster circuit for VHF applications

    Directory of Open Access Journals (Sweden)

    Jing Tian

    2016-06-01

    Full Text Available This paper presents a negative impedance converter (NIC based on graphene field effect transistors (GFETs for VHF applications. The NIC is designed following Linvill’s open circuit stable (OCS topology. The DC modelling parameters of GFET are extracted from a device measured by Meric et al. [IEEE Electron Devices Meeting, 23.2.1 (2010] Estimated parasitics are also taken into account. Simulation results from Keysight Advanced Design System (ADS show good NIC performance up to 200 MHz and the value of negative capacitance is directly proportional to the capacitive load. In addition, it has been shown that by varying the supply voltage the value of negative capacitance can also be tuned. The NIC stability has been tested up to 2 GHz (10 times the maximum operation frequency using Nyquist stability criterion to ensure there are no oscillation issues.

  6. A VHF Class E DC-DC Converter with Self-Oscillating Gate Driver

    DEFF Research Database (Denmark)

    Andersen, Toke Meyer; Christensen, Søren K.; Knott, Arnold

    2011-01-01

    , is inherently resonant, and switching losses are greatly reduced by ensuring Zero Voltage Switching (ZVS) of the power semiconductor devices. A design method to ensure ZVS operation when combining the inverter, rectifier, and gate driver is provided. Several parasitic effects and their influence on converter......This paper describes the analysis and design of a DC-DC converter topology which is operational at frequencies in the Very High Frequency (VHF) band ranging from 30 MHz − 300 MHz. The presented topology, which consists of a class E inverter, class E rectifier, and self-oscillating gate driver...... operation are discussed, and measurement results of a 100 MHz prototype converter are presented and evaluated. The designed prototype converter verifies the described topology....

  7. A Tower-based Prototype VHF/UHF Radar for Subsurface Sensing: System Description and Data Inversion Results

    Science.gov (United States)

    Moghaddam, Mahta; Pierce, Leland; Tabatabaeenejad, Alireza; Rodriguez, Ernesto

    2005-01-01

    Knowledge of subsurface characteristics such as permittivity variations and layering structure could provide a breakthrough in many terrestrial and planetary science disciplines. For Earth science, knowledge of subsurface and subcanopy soil moisture layers can enable the estimation of vertical flow in the soil column linking surface hydrologic processes with that in the subsurface. For planetary science, determining the existence of subsurface water and ice is regarded as one of the most critical information needs for the study of the origins of the solar system. The subsurface in general can be described as several near-parallel layers with rough interfaces. Each homogenous rough layer can be defined by its average thickness, permittivity, and rms interface roughness assuming a known surface spectral distribution. As the number and depth of layers increase, the number of measurements needed to invert for the layer unknowns also increases, and deeper penetration capability would be required. To nondestructively calculate the characteristics of the rough layers, a multifrequency polarimetric radar backscattering approach can be used. One such system is that we have developed for data prototyping of the Microwave Observatory of Subcanopy and Subsurface (MOSS) mission concept. A tower-mounted radar makes backscattering measurements at VHF, UHF, and L-band frequencies. The radar is a pulsed CW system, which uses the same wideband antenna to transmit and receive the signals at all three frequencies. To focus the beam at various incidence angles within the beamwidth of the antenna, the tower is moved vertically and measurements made at each position. The signals are coherently summed to achieve focusing and image formation in the subsurface. This requires an estimate of wave velocity profiles. To solve the inverse scattering problem for subsurface velocity profile simultaneously with radar focusing, we use an iterative technique based on a forward numerical solution of

  8. Mechanical design and fabrication of the VHF-gun, the Berkeley normal-conducting continuous-wave high-brightness electron source

    Science.gov (United States)

    Wells, R. P.; Ghiorso, W.; Staples, J.; Huang, T. M.; Sannibale, F.; Kramasz, T. D.

    2016-02-01

    A high repetition rate, MHz-class, high-brightness electron source is a key element in future high-repetition-rate x-ray free electron laser-based light sources. The VHF-gun, a novel low frequency radio-frequency gun, is the Lawrence Berkeley National Laboratory (LBNL) response to that need. The gun design is based on a normal conducting, single cell cavity resonating at 186 MHz in the VHF band and capable of continuous wave operation while still delivering the high accelerating fields at the cathode required for the high brightness performance. The VHF-gun was fabricated and successfully commissioned in the framework of the Advanced Photo-injector EXperiment, an injector built at LBNL to demonstrate the capability of the gun to deliver the required beam quality. The basis for the selection of the VHF-gun technology, novel design features, and fabrication techniques are described.

  9. First Joint Observations of Radio Aurora by the VHF and HF Radars of the ISTP SB RAS

    Science.gov (United States)

    Berngardt, O. I.; Lebedev, V. P.; Kutelev, K. A.; Kushnarev, D. S.; Grkovich, K. V.

    2018-01-01

    Two modern radars for diagnosis of the ionosphere by the radio-wave backscattering method, namely, the Irkutsk incoherent scatter radar at VHF (IISR, 154-162 MHz) and the Ekaterinburg coherent radar at HF (EKB, 8-20 MHz) are operated at the Institute of Solar-Terrestrial Physics, Siberian Branch of the Russian Academy of Sciences (ISTP SB RAS). The paper analyzes the results of joint observations of strong scattering (radio aurora) on June 8, 2015. To determine the geographical position of the radio aurora, we developed original methods that take into account both the features of the radio-wave propagation and the features of the radar antenna systems. It is shown that there are areas where the spatial position of the HF and VHF radio aurora can coincide. This permits using the radars as a single complex for diagnosis of the characteristics of small-scale high-latitude irregularities in the ionospheric E and F layers. A comparative analysis of the characteristics and temporal dynamics of the radio-aurora region in the HF and VHF ranges is performed. Using the DMSP satellite data, it has been shown that the radio aurora dynamics during this experiment with the EKB radar can be related with the spatial dynamics of the localized area with high electric field, which moves from high to equatorial latitudes. It is found that due to the broader field of view, radio aurora at the HF radar was stably observed 6-12 min earlier than at the VHF radar. This permits using the EKB radar data for prediction of the radio-aurora detection by the IISR radar.

  10. Meteor head echo altitude distributions and the height cutoff effect studied with the EISCAT HPLA UHF and VHF radars

    Directory of Open Access Journals (Sweden)

    A. Westman

    2004-04-01

    Full Text Available Meteor head echo altitude distributions have been derived from data collected with the EISCAT VHF (224MHz and UHF (930MHz high-power, large-aperture (HPLA radars. At the high-altitude end, the distributions cut off abruptly in a manner reminiscent of the trail echo height ceiling effect observed with classical meteor radars. The target dimensions are shown to be much smaller than both the VHF and the UHF probing wavelengths, but the cutoff heights for the two systems are still clearly different, the VHF cutoff being located several km above the UHF one. A single-collision meteor-atmosphere interaction model is used to demonstrate that meteors in the (1.3–7.2µg mass range will ionise such that critical electron density at 224MHz is first reached at or around the VHF cutoff altitude and critical density at 930MHz will be reached at the UHF cutoff altitude. The observed seasonal variation in the cutoff altitudes is shown to be a function of the seasonal variation of atmospheric density with altitude. Assuming that the electron density required for detection is in the order of the critical density, the abrupt altitude cutoffs can be explained as a consequence of the micrometeoroid joint size-speed distribution dropping off so fast at the large-mass, high-velocity end that above a certain altitude the number of detectable events becomes vanishingly small. Conversely, meteors at the low-mass end of the distribution will be gradually retarded such that the ionisation they generate never reaches critical density. These particles will remain unobservable.Key words. Radio science (instruments and techniques – Interplatery physics (interplanetary dust – General or miscellaneous (new fields

  11. Broadband VHF Interferometer Observations of an Energetic In-cloud Pulse (EIP)

    Science.gov (United States)

    Tilles, J.; Krehbiel, P. R.; Stanley, M. A.; Rison, W.; Lyu, F.; Cummer, S.; Liu, N.; Dwyer, J. R.; Brown, R. G.; Wilson, J. G.

    2017-12-01

    Energetic in-cloud pulses (EIPs) are a little-known in-cloud subprocess of lightning. While they may be best identified by their large peak current (>200 kA) [Lyu et al., Geophys. Res. Lett., 42, 2015], they differ from narrow bipolar events (NBEs) - another type of in-cloud, high peak-current process - in that the sferic of an EIP lasts an order of magnitude longer ( ˜100 us) than that of a typical NBE ( ˜10 us). To further differentiate them from NBEs, EIPs are generally embedded within other electrical activity, whereas NBEs are known to primarily occur in isolation or as a lightning-initiating event [Smith et al., J. Geophys. Res., 104, D4, 4189-4212, 1999; Rison et al., Nat. Commun., 7, 10721, 2016]. Moreover, EIPs may have an intrinsic connection with the production of terrestrial gamma ray flashes (TGFs) [Cummer et al., Geophys. Res. Lett., 41, 8586-8593, 2014].Here we present coincident broadband VHF interferometer (INTF) observations and electric and magnetic field waveforms of an EIP with an associated NLDN peak current of 247 kA. The EIP occurs nearly 4 ms into a normal-polarity intracloud flash as part of the upward extension of the negative-polarity lightning leader. For this reason, we suspect that EIPs are a more energetic version of initial breakdown pulses (IBPs), which accompany the development of negative stepped leaders [e.g. Marshall et al., J. Geophys. Res. Atmos., 119, 445-460, 2014]. In addition, we show similarities with NBE-producing fast breakdown [Rison et al., 2016; Tilles et al., AE12A-03, AGU Fall Meeting, 2016], in that the breakdown accompanying the EIP propagates over a similar vertical extent ( ˜0.5-1 km) and with similar propagation speed ( ˜3×107 m/s). The INTF was developed by New Mexico Tech and has been deployed at Kennedy Space Center since July 2016. It employed three 100-m baselines in 2016, has a bandwidth of 14-88 MHz and samples at 180 MS/s with 16-bit resolution. A synchronously digitized fast antenna (FA), with

  12. Disturbances in VHF/UHF telemetry links as a possible effect of the 2003 Hokkaido Tokachi-oki earthquake

    Directory of Open Access Journals (Sweden)

    H. Nagamoto

    2008-08-01

    Full Text Available The data on radio telemetry links (for water information at VHF/UHF in Hokkaido are used to investigate the rate of disturbances on radio links (or connection failure and its association with a huge earthquake, Tokachi-oki earthquake on 26 September 2003. Especially, the telemetry links at the Tokachi region closest to the earthquake epicenter, showed a significant increase in disturbances on radio links two weeks to a few days before the earthquake on the basis of analysis during a long interval from 1 June 2002 to 3 November 2007 (over 5 years. We suggest that these severe disturbances in VHF/UHF telemetry links are attributed to the generation of seismogenic VHF/UHF radio noises (emissions. Based on this idea, we have estimated that the intensity of these seismogenic emissions is on the order of 10–19 dB μV/m. Finally, the present result was compared with other physical parameters already obtained for this earthquake.

  13. Seasonal temperature variation around the mesopause inferred from a VHF meteor radar at King Sejong Station (62S, 59W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Lee, Changsup; Jee, Gun-Hwa

    A VHF meteor radar, installed at King Sejong Station in March, 2007, has been detecting echoes from more than 20,000 meteors per day. Meteor echoes are decayed typically within seconds as meteors spread away by atmospheric diffusion. The diffusion coefficients can thus be obtained from decay times of meteor echo signals, providing with information on the atmospheric temperatures and pressures at meteor altitudes from 70 to 100 km. In this study, we present altitude profiles of 15-min averaged diffusion coefficients in each month, which clearly show a minimum at 80 - 85 km. The minimum appears at higher altitude during austral summer than winter, and seems to be near the lower level of two temperature minimum structure around the mesopause seen by TIMED/SABER data at high latitudes. The higher mesopause level (95-100 km) of the SABER data does not appear in our diffusion profiles probably because it is too close the limit of meaningful diffusion coefficients that can be derived from meteor decay detection. In order to understand temperature variation around the mesopause more directly, we will discuss various methods to extract temperature profiles from the diffusion profiles. We will also present monthly averaged OH and O2 airglow temperatures observed at the same site, and compare them with those derived from the meteor radar observation.

  14. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    International Nuclear Information System (INIS)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto

    2015-01-01

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively

  15. Ion upflow and downflow at the topside ionosphere observed by the EISCAT VHF radar

    Directory of Open Access Journals (Sweden)

    M. Endo

    2000-02-01

    Full Text Available We have determined the MLT distribution and KP dependence of the ion upflow and downflow of the thermal bulk oxygen ion population based on a data analysis using the EISCAT VHF radar CP-7 data obtained at Tromsø during the period between 1990 and 1996: (1 both ion upflow and downflow events can be observed at any local time (MLT, irrespective of dayside and nightside, and under any magnetic disturbance level, irrespective of quiet and disturbed levels; (2 these upflow and downflow events are more frequently observed in the nightside than in the dayside; (3 the upflow events are more frequently observed than the downflow events at any local time except midnight and at any KP level and the difference of the occurrence frequencies between the upflow and downflow events is smaller around midnight; and (4 the occurrence frequencies of both the ion upflow and downflow events appear to increase with increasing KP level, while the occurrence frequency of the downflow appears to stop increasing at some KP level.Key words: Ionosphere (particle acceleration; plasma waves and instabilities - Space plasma physics (transport processes

  16. Anisotropy of Doppler spectral parameters in the VHF radar observations at MU and White Sands

    Directory of Open Access Journals (Sweden)

    G. D. Nastrom

    2001-08-01

    Full Text Available Significant differences are found between the mean spectral widths from beams in the meridional plane and in the zonal plane at both the MU and the White Sands VHF radars. The spectral width in the beam directed perpendicular to the prevailing wind is greater than that in the beam parallel to the wind. The magnitudes of the differences in spectral width show a linear relationship with wind speed, with the greatest differences at the greatest wind speeds. The differences in spectral width show a positive correlation with the differences in backscattered power. The anisotropy in backscattered power is well-known and is usually attributed to aspect sensitivity effects. However, the anisotropy in spectral width does not appear to be due to the same mechanism, and while several hypotheses to account for this are considered, including finite range-volume effects, effects from the tilting of isentropic layers, and anisotropic turbulence effects, it is seen that each of these suggestions has its shortcomings.Key words. Meteorology and atmospheric dynamics (turbulence; instruments and techniques

  17. Study of CNT growth using nanocatalyst Ag precursor by HWC-VHF-PECVD

    Energy Technology Data Exchange (ETDEWEB)

    Eliyana, Ajeng; Rosikin, Ahmad; Winata, Toto, E-mail: toto@fi.itb.ac.id [Physics of Electronics Material Research Division, Physics Programme, Faculty of Mathematics and Natural Sciences, Institut Teknologi Bandung, Jl. Ganesha 10, Bandung 40132, West Java (Indonesia)

    2015-04-16

    The study of CNT growth has been done by using silver (Ag) nanocatalyst as a guide precursor on corning glass 7059 substrate. The silver catalyst was prepared by the evaporation method by varying deposition time for 50, 25, and 14 seconds. The silver films were then annealed at temperature of 400°C for 4 hours. From Scanning Electron Microscope (SEM) and Energy Dispersive X-ray Spectroscopy (EDX) results the grain sizes are 65 nm, 57 nm, and 33 nm, and also the atomic compositions are 6,06%, 4,52%, and 3,73% for 14, 25 and 50 seconds samples, respectively. The 33 nm samples were then used for CNT growth by using Hot Wire Cell (HWC) – Very High Frequency (VHF) – Plasma Enhanced Chemical Vapor Deposition (PECVD) at 275 ° C deposition temperature and pressure of 300 mTorr. The rf power was varied from 8 to 20 watts, with deposition time for 60 minutes. The methane (CH4) 99.999% was used as Carbon sources. Hydrogen gas (H2) was used to etch the oxide layer formed during the pre-deposition process. The diameter and length for the CNT are 125 nm and 1.650 to 2.989 nm respectively.

  18. VHF and HF radar measurements of E and R region plasma drifts at the magnetic equator

    International Nuclear Information System (INIS)

    Viswanathan, K.S.; Namboothiri, S.P.; Rao, P.B.

    1992-01-01

    Simultaneous observations of E region horizontal irregularity drifts by VHF backscatter radar and of F region vertical plasma drift by HF Doppler radar conducted during daytime on a few magnetically quiet days at Trivandrum (dip 0.2 degree N) are presented. A comparative study of the two measurements indicates broadly (1) a resemblance in the daytime changes of the E-W component between the electric field and (2) evidence of quasi-periodic electric field variations with periods ranging mostly from 1 to 2 hours. The electric fields derived from HF Doppler radar observations are somewhat lower than those deduced by HVHF radar observations. The correlation coefficient for the variations of the electric fields measured by the two experimental techniques is found to be in the range of about 0.5 to 0.9. The observed difference in the E and F region electric fields at the magnetic equator is discussed in terms of the measurement uncertainties and the limitations involved in deriving E-W electric fields. The observations are suggestive of a latitudinal variation in the E-W component of the electric field in the equatorial ionosphere

  19. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  20. The relationship between VHF radar auroral backscatter amplitude and Doppler velocity: a statistical study

    Directory of Open Access Journals (Sweden)

    B. A. Shand

    1996-08-01

    Full Text Available A statistical investigation of the relationship between VHF radar auroral backscatter intensity and Doppler velocity has been undertaken with data collected from 8 years operation of the Wick site of the Sweden And Britain Radar-auroral Experiment (SABRE. The results indicate three different regimes within the statistical data set; firstly, for Doppler velocities <200 m s–1, the backscatter intensity (measured in decibels remains relatively constant. Secondly, a linear relationship is observed between the backscatter intensity (in decibels and Doppler velocity for velocities between 200 m s–1 and 700 m s–1. At velocities greater than 700 m s–1 the backscatter intensity saturates at a maximum value as the Doppler velocity increases. There are three possible geophysical mechanisms for the saturation in the backscatter intensity at high phase speeds: a saturation in the irregularity turbulence level, a maximisation of the scattering volume, and a modification of the local ambient electron density. There is also a difference in the dependence of the backscatter intensity on Doppler velocity for the flow towards and away from the radar. The results for flow towards the radar exhibit a consistent relationship between backscatter intensity and measured velocities throughout the solar cycle. For flow away from the radar, however, the relationship between backscatter intensity and Doppler velocity varies during the solar cycle. The geometry of the SABRE system ensures that flow towards the radar is predominantly associated with the eastward electrojet, and flow away is associated with the westward electrojet. The difference in the backscatter intensity variation as a function of Doppler velocity is attributed to asymmetries between the eastward and westward electrojets and the geophysical parameters controlling the backscatter amplitude.

  1. Effect of solar and magnetic activity on VHF scintillations near the equatorial anomaly crest

    Directory of Open Access Journals (Sweden)

    R. P. Singh

    2004-09-01

    Full Text Available The VHF amplitude scintillation recorded during the period January 1991 to December 1993 in the declining phase of a solar cycle and April 1998 to December 1999 in the ascending phase of the next solar cycle at Varanasi (geogr. lat.=25.3°, long.=83.0°, dip=37°N have been analyzed to study the behavior of ionospheric irregularities during active solar periods and magnetic storms. It is shown that irregularities occur at arbitrary times and may last for <30min. A rise in solar activity increases scintillations during winter (November-February and near equinoxes (March-April; September-October, whereas it depresses the scintillations during the summer (May-July. In general, the role of magnetic activity is to suppress scintillations in the pre-midnight period and to increase it in the post-midnight period during equinox and winter seasons, whilst during summer months the effect is reversed. The pre-midnight scintillation is sometimes observed when the main phase of Dst corresponds to the pre-midnight period. The annual variation shows suppression of scintillations on disturbed days, both during pre-midnight and post-midnight period, which becomes more effective during years of high solar activity. It is observed that for magnetic storms for which the recovery phase starts post-midnight, the probability of occurrence of irregularities is enhanced during this time. If the magnetic storm occurred during daytime, then the probability of occurrence of scintillations during the night hours is decreased. The penetration of magnetospheric electric fields to the magnetic equator affects the evolution of low-latitude irregularities. A delayed disturbance dynamo electric field also affects the development of irregularities.

  2. Simulation of Controller Pilot Data Link Communications over VHF Digital Link Mode 3

    Science.gov (United States)

    Bretmersky, Steven C.; Murawski, Robert; Nguyen, Thanh C.; Raghavan, Rajesh S.

    2004-01-01

    The Federal Aviation Administration (FAA) has established an operational plan for the future Air Traffic Management (ATM) system, in which the Controller Pilot Data Link Communications (CPDLC) is envisioned to evolve into digital messaging that will take on an ever increasing role in controller to pilot communications, significantly changing the way the National Airspace System (NAS) is operating. According to FAA, CPDLC represents the first phase of the transition from the current analog voice system to an International Civil Aviation Organization (ICAO) compliant system in which digital communication becomes the alternate and perhaps primary method of routine communication. The CPDLC application is an Air Traffic Service (ATS) application in which pilots and controllers exchange messages via an addressed data link. CPDLC includes a set of clearance, information, and request message elements that correspond to existing phraseology employed by current Air Traffic Control (ATC) procedures. These message elements encompass altitude assignments, crossing constraints, lateral deviations, route changes and clearances, speed assignments, radio frequency assignments, and various requests for information. The pilot is provided with the capability to respond to messages, to request clearances and information, to report information, and to declare/rescind an emergency. A 'free text' capability is also provided to exchange information not conforming to defined formats. This paper presents simulated results of the aeronautical telecommunication application Controller Pilot Data Link Communications over VHF Digital Link Mode 3 (VDL Mode 3). The objective of this simulation study was to determine the impact of CPDLC traffic loads, in terms of timely message delivery and capacity of the VDL Mode 3 subnetwork. The traffic model is based on and is used for generating air/ground messages with different priorities. Communication is modeled for the en route domain of the Cleveland

  3. Sistema de adquisición de datos para la medición de parámetros radioeléctricos en antenas lineales en la banda de TV de VHF y UHF System of acquisition of information for measurement of radioelectric parameters in linear antennas in the band of VHF and UHF’s television

    Directory of Open Access Journals (Sweden)

    María del Pilar Celemín

    2007-06-01

    Full Text Available Este proyecto desarrolla un sistema de adquisición y procesamiento de datos para la medición y ajuste de parámetros radioeléctricos de antenas lineales en las bandas de VHF y UHF. Como señal de prueba se utilizan algunas de las señales de televisión que se encuentran en el espectro radioeléctrico, provenientes de los transmisores que radian señales de canales nacionales. El receptor implementado incluye un sintonizador comercial de televisión que toma como muestra la señal portadora de video. Esta señal es amplificada, filtrada, almacenada y acondicionada, para ser leída por el puerto serial de un computador personal y procesada empleando un programa en Visual Basic, con una interfaz gráfica que permite una interacción amigable con el usuario. Desde acá se interactúa con un microcontrolador que controla el mecanismo de posicionamiento de la antena receptora por medio de una estructura electromecánica, que le permite ejecutar movimientos en dos grados de libertad: en azimut y en elevación. Con esto se logra un sistema capaz de determinar automáticamente el apuntamiento óptimo de la antena de acuerdo al máximo nivel de recepción de señal. Así mismo, se determinan parámetros propios de la antena tales como: el patrón de radiación (tanto en el plano horizontal como vertical, la ganancia directiva de la antena, la ganancia en cada uno de los puntos que conforman el plano principal, y otros parámetros de interés para el análisis de las características reales de antenas lineales.This project develops a data acquisition and processing system for measuring and adjusting lineal-antenna radioelectric parameters in VHF and UHF. Television signals are used as test signal. They can be found in radio electric spectrum, as they come from commercial transmitters that broadcast signals of national channels. The achieved receptor includes a television commercial tuner for obtaining video signal. Later, this signal is conditioning to

  4. Radar efficiency and the calculation of decade-long PMSE backscatter cross-section for the Resolute Bay VHF radar

    Directory of Open Access Journals (Sweden)

    N. Swarnalingam

    2009-04-01

    Full Text Available The Resolute Bay VHF radar, located in Nunavut, Canada (75.0° N, 95.0° W and operating at 51.5 MHz, has been used to investigate Polar Mesosphere Summer Echoes (PMSE since 1997. PMSE are a unique form of strong coherent radar echoes, and their understanding has been a challenge to the scientific community since their discovery more than three decades ago. While other high latitude radars have recorded strong levels of PMSE activities, the Resolute Bay radar has observed relatively lower levels of PMSE strengths. In order to derive absolute measurements of PMSE strength at this site, a technique is developed to determine the radar efficiency using cosmic (sky noise variations along with the help of a calibrated noise source. VHF radars are only rarely calibrated, but determination of efficiency is even less common. Here we emphasize the importance of efficiency for determination of cross-section measurements. The significant advantage of this method is that it can be directly applied to any MST radar system anywhere in the world as long as the sky noise variations are known. The radar efficiencies for two on-site radars at Resolute Bay are determined. PMSE backscatter cross-section is estimated, and decade-long PMSE strength variations at this location are investigated. It was noticed that the median of the backscatter cross-section distribution remains relatively unchanged, but over the years a great level of variability occurs in the high power tail of the distribution.

  5. High-Rate Fabrication of a-Si-Based Thin-Film Solar Cells Using Large-Area VHF PECVD Processes

    Energy Technology Data Exchange (ETDEWEB)

    Deng, Xunming [University of Toledo; Fan, Qi Hua

    2011-12-31

    The University of Toledo (UT), working in concert with it’s a-Si-based PV industry partner Xunlight Corporation (Xunlight), has conducted a comprehensive study to develop a large-area (3ft x 3ft) VHF PECVD system for high rate uniform fabrication of silicon absorber layers, and the large-area VHF PECVD processes to achieve high performance a-Si/a-SiGe or a-Si/nc-Si tandem junction solar cells during the period of July 1, 2008 to Dec. 31, 2011, under DOE Award No. DE-FG36-08GO18073. The project had two primary goals: (i) to develop and improve a large area (3 ft × 3 ft) VHF PECVD system for high rate fabrication of > = 8 Å/s a-Si and >= 20 Å/s nc-Si or 4 Å/s a-SiGe absorber layers with high uniformity in film thicknesses and in material structures. (ii) to develop and optimize the large-area VHF PECVD processes to achieve high-performance a-Si/nc-Si or a-Si/a-SiGe tandem-junction solar cells with >= 10% stable efficiency. Our work has met the goals and is summarized in “Accomplishments versus goals and objectives”.

  6. Broadband Ionospheric Scintillation Measurements from Space

    Science.gov (United States)

    Suszcynsky, D. M.; Light, M. E.; Pigue, M. J.

    2014-12-01

    The U.S. Department of Energy's Radio Frequency Propagation (RFProp) experiment consists of a satellite-based radio receiver suite to study various aspects of trans-ionospheric signal propagation and detection in four frequency bands, 2 - 55 MHz, 125 - 175 MHz, 365 - 415 MHz and 825 - 1100 MHz. In this paper, we present an overview of the RFProp on-orbit research and analysis effort with particular focus on an equatorial scintillation experiment called ESCINT. The 3-year ESCINT project is designed to characterize equatorial ionospheric scintillation in the upper HF and lower VHF portions of the radio spectrum (20 - 150 MHz). Both a 40 MHz continuous wave (CW) signal and 30 - 42 MHz swept frequency signal are transmitted to the satellite receiver suite from the Reagan Test Site at Kwajalein Atoll in the Marshall Islands (8.7° N, 167.7° E) in four separate campaigns centered on the 2014 and 2015 equinoxes. Results from the first campaign conducted from April 22 - May 15, 2014 will be presented including (a) coherence bandwidth measurements over a full range of transmission frequencies and scintillation activity levels, (b) spread-Doppler clutter effects arising from preferential ray paths to the satellite due to refraction off of isolated density irregularities, and (c) supporting ray-trace simulations. The broadband nature of the measurements is found to offer unique insight into both the structure of ionospheric irregularities and their impact on HF/VHF trans-ionospheric radio wave propagation.

  7. Three-Dimensional Reconstruction of Cloud-to-Ground Lightning Using High-Speed Video and VHF Broadband Interferometer

    Science.gov (United States)

    Li, Yun; Qiu, Shi; Shi, Lihua; Huang, Zhengyu; Wang, Tao; Duan, Yantao

    2017-12-01

    The time resolved three-dimensional (3-D) spatial reconstruction of lightning channels using high-speed video (HSV) images and VHF broadband interferometer (BITF) data is first presented in this paper. Because VHF and optical radiations in step formation process occur with time separation no more than 1 μs, the observation data of BITF and HSV at two different sites provide the possibility of reconstructing the time resolved 3-D channel of lightning. With the proposed procedures for 3-D reconstruction of leader channels, dart leaders as well as stepped leaders with complex multiple branches can be well reconstructed. The differences between 2-D speeds and 3-D speeds of leader channels are analyzed by comparing the development of leader channels in 2-D and 3-D space. Since return stroke (RS) usually follows the path of previous leader channels, the 3-D speeds of the return strokes are first estimated by combination with the 3-D structure of the preceding leaders and HSV image sequences. For the fourth RS, the ratios of the 3-D to 2-D RS speeds increase with height, and the largest ratio of the 3-D to 2-D return stroke speeds can reach 2.03, which is larger than the result of triggered lightning reported by Idone. Since BITF can detect lightning radiation in a 360° view, correlated BITF and HSV observations increase the 3-D detection probability than dual-station HSV observations, which is helpful to obtain more events and deeper understanding of the lightning process.

  8. Investigation of atmospheric high-energy phenomena onboard International Space Station: microsatellite ''Chibis-AI'' and VHF interferometer ''Kite''

    International Nuclear Information System (INIS)

    Dolgonosov, M.; Gotlib, V.; Karedin, V.; Kosov, A.; Nazarov, V.; Zelenyi, L.; Klimov, S.

    2017-01-01

    Space Research Institute of the RAS is gradually developing its own program of the space-born experiments to study high- energy process in the terrestrial atmosphere. Terrestrial Gamma-ray Flashes (TGFS) and Compact Intracloud Discharges (CIDs) are among principal goals of the scientific research of the program. To conduct research is supposed to produce new «instruments»: microsatellite «ChibiS-AI» and VHF interferometer «Kite» aboard International Space Station. Microsatellite ”Chibis-AI” will be constructed on the platform originally designed at the Special Engineering Department of Space Research Institute of the Russian Academy of Sciences in 2011. It's forerunner «Chibis-M» was successfully launched in 2012. Expected date of «Chibis-AI» launch is 2019. The principal idea underlying design of the scientific payload of the microsatellite ”Chibis-AI” is the joint observations of the TGF and CID emissions by different detectors installed onboard: Radio Frequency Analyzer (RFA) and Neutron and Gamma spectrometer (N GS). RFA contained two passbands in the range 15-26 and 26-48 MHZ with a digitization at 96 megasamples/s. NGS is based on LaBr3(Ce3+) crystal with the maximum achievable today spectral resolution and efficiency of gamma rays in the energy range 100 Kev - 10 MeV among scintillation crystals. The microsatellite orbit will be circular with inclination 51° with initial elevation above sea level around 550 km. VHF interferometer «Kite» to be installed in 2019-2020 aboard 188. To implement interferometric scheme 4 antennas will be installed on the 188 surface. The passband of the instrument will be ∼50-100 MHZ. Technical details of both experiments, its current stage and features as well results of the previous experiment «Chibis-M» will be discussed. (author)

  9. Characterization of the Ionospheric Scintillations at High Latitude using GPS Signal

    Science.gov (United States)

    Mezaoui, H.; Hamza, A. M.; Jayachandran, P. T.

    2013-12-01

    Transionospheric radio signals experience both amplitude and phase variations as a result of propagation through a turbulent ionosphere; this phenomenon is known as ionospheric scintillations. As a result of these fluctuations, Global Positioning System (GPS) receivers lose track of signals and consequently induce position and navigational errors. Therefore, there is a need to study these scintillations and their causes in order to not only resolve the navigational problem but in addition develop analytical and numerical radio propagation models. In order to quantify and qualify these scintillations, we analyze the probability distribution functions (PDFs) of L1 GPS signals at 50 Hz sampling rate using the Canadian High arctic Ionospheric Network (CHAIN) measurements. The raw GPS signal is detrended using a wavelet-based technique and the detrended amplitude and phase of the signal are used to construct probability distribution functions (PDFs) of the scintillating signal. The resulting PDFs are non-Gaussian. From the PDF functional fits, the moments are estimated. The results reveal a general non-trivial parabolic relationship between the normalized fourth and third moments for both the phase and amplitude of the signal. The calculated higher-order moments of the amplitude and phase distribution functions will help quantify some of the scintillation characteristics and in the process provide a base for forecasting, i.e. develop a scintillation climatology model. This statistical analysis, including power spectra, along with a numerical simulation will constitute the backbone of a high latitude scintillation model.

  10. Simultaneous radar and spaced receiver VHF scintillation observations of ESF irregularities

    Directory of Open Access Journals (Sweden)

    D. Tiwari

    2006-07-01

    Full Text Available Simultaneous observations of equatorial spread F (ESF irregularities made on 10 nights during March-April 1998 and 1999, using an 18-MHz radar at Trivandrum (77° E, 8.5° N, dip 0.5° N and two spaced receivers recording scintillations on a 251-MHz signal at Tirunelveli (77.8° E, 8.7° N, dip 0.4° N, have been used to study the evolution of Equatorial Spread F (ESF irregularities. Case studies have been carried out on the day-to-day variability in ESF structure and dynamics, as observed by 18-MHz radar, and with spaced receiver measurements of average zonal drift Vo of the 251-MHz radio wave diffraction pattern on the ground, random velocity Vc, which is a measure of random changes in the characteristics of scintillation-producing irregularities, and maximum cross-correlation CI of the spaced receivers signals. Results show that in the initial phase of plasma bubble development, the greater the maximum height of ESF irregularities responsible for the radar backscatter, the greater the decorrelation is of the spaced receiver scintillation signals, indicating greater turbulence. The relationship of the maximum spectral width derived from the radar observations and CI also supports this result.

  11. Simultaneous radar and spaced receiver VHF scintillation observations of ESF irregularities

    Directory of Open Access Journals (Sweden)

    D. Tiwari

    2006-07-01

    Full Text Available Simultaneous observations of equatorial spread F (ESF irregularities made on 10 nights during March-April 1998 and 1999, using an 18-MHz radar at Trivandrum (77° E, 8.5° N, dip 0.5° N and two spaced receivers recording scintillations on a 251-MHz signal at Tirunelveli (77.8° E, 8.7° N, dip 0.4° N, have been used to study the evolution of Equatorial Spread F (ESF irregularities. Case studies have been carried out on the day-to-day variability in ESF structure and dynamics, as observed by 18-MHz radar, and with spaced receiver measurements of average zonal drift Vo of the 251-MHz radio wave diffraction pattern on the ground, random velocity Vc, which is a measure of random changes in the characteristics of scintillation-producing irregularities, and maximum cross-correlation CI of the spaced receivers signals. Results show that in the initial phase of plasma bubble development, the greater the maximum height of ESF irregularities responsible for the radar backscatter, the greater the decorrelation is of the spaced receiver scintillation signals, indicating greater turbulence. The relationship of the maximum spectral width derived from the radar observations and CI also supports this result.

  12. Time and latitudinal distribution of the ionospheric irregularities in Brazil, through the VHF-scintillation and ionogram data analysis

    International Nuclear Information System (INIS)

    Nelson, O.R.

    1984-01-01

    Equatorial ionospheric irregularity distribution morphology, and dynamics, and the dynamics of the ambient ionosphere were investigated. Spread F data from ionograms over Fortaleza (4 0 S; 38 0 O) and Cachoeira Paulista (22,7 0 S; 45 0 O), and simultaneous VHF scintillations of geoestationary satellite beacon received over Natal (5,6 0 S; 33,7 0 O) were used to determine the irregularity local time versus seasonal distribution, over the equatorial and low latitude location, during the solar activity maximum as well as minimum epochs. Concept of flux tube alignment properties of the transequatorial plasma bubbles were used to determine statistical features of the plasma bubble rise velocities. Calculations of plasma bubble rise velocities were then carried out for different solar activity epochs and compared with prereversal enhancement amplitude in the F-layer vertical rise velocities, for the same epochs. Using theoretical considerations on the development of plasma bubble based on flux tube integrated properties, the observed dependence of the plasma bubble rise velocities and the F-region dynamo electric field has been analysed to estimate the average ionizations depletions in the plasma bubble. Possible causes for the lack of correlation often observed between bubble rise velocities and F-Layer velocities also are discussed. (Author) [pt

  13. Calculating the azimuth of mountain waves, using the effect of tilted fine-scale stable layers on VHF radar echoes

    Directory of Open Access Journals (Sweden)

    R. M. Worthington

    1999-02-01

    Full Text Available A simple method is described, based on standard VHF wind-profiler data, where imbalances of echo power between four off-vertical radar beams, caused by mountain waves, can be used to calculate the orientation of the wave pattern. It is shown that the mountain wave azimuth (direction of the horizontal component of the wavevector, is given by the vector [ W (PE - P W ,W (PN - P S ]; PN, PS, PE, PW are radar echo powers, measured in dB, in beams pointed away from vertical by the same angle towards north, south, east and west respectively, and W is the vertical wind velocity. The method is applied to Aberystwyth MST radar data, and the calculated wave vector usually, but not always, points into the low-level wind direction. The mean vertical wind at Aberystwyth, which may also be affected by tilted aspect-sensitive layers, is investigated briefly using the entire radar output 1990-1997. The mean vertical-wind profile is inconsistent with existing theories, but a new mountain-wave interpretation is proposed.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; waves and tides; instruments and techniques.

  14. A meteor head echo analysis algorithm for the lower VHF band

    Directory of Open Access Journals (Sweden)

    J. Kero

    2012-04-01

    Full Text Available We have developed an automated analysis scheme for meteor head echo observations by the 46.5 MHz Middle and Upper atmosphere (MU radar near Shigaraki, Japan (34.85° N, 136.10° E. The analysis procedure computes meteoroid range, velocity and deceleration as functions of time with unprecedented accuracy and precision. This is crucial for estimations of meteoroid mass and orbital parameters as well as investigations of the meteoroid-atmosphere interaction processes. In this paper we present this analysis procedure in detail. The algorithms use a combination of single-pulse-Doppler, time-of-flight and pulse-to-pulse phase correlation measurements to determine the radial velocity to within a few tens of metres per second with 3.12 ms time resolution. Equivalently, the precision improvement is at least a factor of 20 compared to previous single-pulse measurements. Such a precision reveals that the deceleration increases significantly during the intense part of a meteoroid's ablation process in the atmosphere. From each received pulse, the target range is determined to within a few tens of meters, or the order of a few hundredths of the 900 m long range gates. This is achieved by transmitting a 13-bit Barker code oversampled by a factor of two at reception and using a novel range interpolation technique. The meteoroid velocity vector is determined from the estimated radial velocity by carefully taking the location of the meteor target and the angle from its trajectory to the radar beam into account. The latter is determined from target range and bore axis offset. We have identified and solved the signal processing issue giving rise to the peculiar signature in signal to noise ratio plots reported by Galindo et al. (2011, and show how to use the range interpolation technique to differentiate the effect of signal processing from physical processes.

  15. Simultaneous VHF radar backscatter and ionosonde observations of low-latitude E region

    Directory of Open Access Journals (Sweden)

    A. K. Patra

    2005-03-01

    Full Text Available The first results of simultaneous observations made on the low-latitude field-aligned irregularities (FAI using the MST radar located at Gadanki (13.5° N, 79.2° E, dip 12.5° and the Es parameters using an ionosonde at a nearby station Sriharikota (13.7° N, 80.1° E, dip 12.6° are presented. The observations show that while the height of the most intense radar echoes is below the virtual height of Es (h'Es during daytime, it is found to be either below or above during nighttime. The strength of the FAI is better correlated with the top penetration frequency (ftEs and the blanketing frequency (fbEs during the night (r=0.4 in both cases as compared to the day (r=0.35 and -0.04, respectively. Furthermore, the signal strength of FAI is reasonably correlated with (ftEs-fbEs during daytime (r=0.59 while very poorly correlated during nighttime (r=0.18. While the radar observations in general appear to have characteristics close to that of mid-latitudes, the relationship of these with the Es parameters are poorer than that of mid-latitudes. The observations reported here, nevertheless, are quite consistent with the expectations based on the gradient drift instability mechanism.

  16. Tropospheric VHF radiowave propagation measurements in a tropical location in Nigeria

    International Nuclear Information System (INIS)

    Aboaba, O.A.

    2006-04-01

    A major task for the radiocommunication engineer in designing a communication system is to be able to predict the behaviour of the radio signal from the point of transmission to the receiving point. Usually, the radiocommunication engineer would have available propagation data that will enable him to demonstrate that the radiocommunications system will meet both the performance and the availability objectives. The data obtained from a 10-month period of terrestrial over-the-horizon propagation measurements, carried out in southwestern part of Nigeria, have been statistically analyzed in this study. The findings from the analysis show that the measured values of field strength were significantly high during the dry months of November to March, the night time and early morning hours while lower values were obtained during the wet months of April to October. In particular, it is observed that the dry month of March recorded the highest median value of field strength while the wet month of July recorded the lowest. These high values of field strength observed during the dry months are attributed to anomalous propagation effects such as extreme super-refractivity and ducting which are often prevalent in the West African tropical sub-region. (author)

  17. VHF radar observation of atmospheric winds, associated shears and C2n at a tropical location: interdependence and seasonal pattern

    Directory of Open Access Journals (Sweden)

    A. R. Jain

    Full Text Available The turbulence refractivity structure constant (C2n is an important parameter of the atmosphere. VHF radars have been used extensively for the measurements of C2n. Presently, most of such observations are from mid and high latitudes and only very limited observations are available for equatorial and tropical latitudes. Indian MST radar is an excellent tool for making high-resolution measurements of atmospheric winds, associated shears and turbulence refractivity structure constant (C2n. This radar is located at Gadanki (13.45° N, 79.18° E, a tropical station in India. The objective of this paper is to bring out the height structure of C2n for different seasons using the long series of data (September 1995 – August 1999 from Indian MST radar. An attempt is also made to understand such changes in the height structure of C2n in relation to background atmospheric parameters such as horizontal winds and associated shears. The height structure of C2n, during the summer monsoon and post-monsoon season, shows specific height features that are found to be related to Tropical Easterly Jet (TEJ winds. It is important to examine the nature of the radar back-scatterers and also to understand the causative mechanism of such scatterers. Aspect sensitivity of the received radar echo is examined for this purpose. It is observed that radar back-scatterers at the upper tropospheric and lower stratospheric heights are more anisotropic, with horizontal correlation length of 10–20 m, as compared to those observed at lower and middle tropospheric heights.Key words. Meteorology and atmospheric dynamics (climatology; tropical meteorology; turbulence

  18. Spatial variability of the aspect sensitivity of VHF radar echoes in the troposphere and lower stratosphere during jet stream passages

    Directory of Open Access Journals (Sweden)

    J. G. Yoe

    Full Text Available The aspect sensitivity of SOUSY-VHF-radar oblique-beam echoes from the troposphere and lower stratosphere has been examined for a number of jet stream passages during the years 1990 - 1992. When the core of the jet is overhead or nearly so, vertical profiles of the aspect sensitivity display two notable features. First, the distinction between mainly isotropic and strongly aspect-sensitive echoes in the troposphere and the lower stratosphere, respectively, often reported for measurements made during calm conditions, does not necessarily prevail in the vicinity of the jet stream. Second, echoes obtained at altitudes near the height of the horizontal wind maximum are found to be more aspect sensitive for beams directed parallel to the horizontal flow or nearly so, than for other beam directions. It is demonstrated that time-averaged horizontal wind speeds estimated from the radar data, taking into account the reduced effective oblique-beam zenith angle resulting from aspect sensitivity, may exceed uncorrected wind speeds by as much as 10 m s-1 in these circumstances. Implications for wind profiling and for describing the backscattering process are discussed. Doppler spectral widths examined for one jet stream passage are found to be narrower in a beam aligned with the horizontal wind at heights near the wind speed maximum than corresponding widths measured in a beam projected at right angles to the jet. The narrowest spectra thus coincide with the most aspect-sensitive echoes, consistent with the hypothesis that such returns result from specular backscattering processes.

  19. Morphological study of the field-aligned E-layer irregularities observed by the Gadanki VHF radar

    Directory of Open Access Journals (Sweden)

    C. J. Pan

    2004-11-01

    Full Text Available We report on the field-aligned irregularities observed in the low-latitude sporadic E-layer (Es with the Gadanki (13.5° N, 79.2° E; geomagnetic latitude 6.3° N VHF radar. The radar was operated intermittently for 15 days during the summer months in 1998 and 1999, for both daytime and nighttime observation. The total observation periods are 161h for the nighttime and 68h for the daytime. The observations were used to study the percentage of occurrence of the E-region echoes for both daytime and nighttime. The statistical characteristics of the mean radial velocity and spectral width are presented for three cases based on the echo occurrence characteristics and the altitude of observations (from 90 to 140km ranges, namely, the lower E-region daytime (90-110km, the lower E-region nighttime (90-105km and the upper E-region nighttime (105-140km echoes. The results are compared with that of Piura, a low-latitude station located at about the same geomagnetic latitude, but to the south of the equator. By comparing the behaviors of the lower E-region radar echoes of the summer months between Gadanki and Piura, we find that the lower altitude echoes below about 100km are rarely reported in Piura but commonly seen in Gadanki. Features of the nighttime echoes observed by these two radars are quite similar but daytime FAI echoes are again seldom detected by Piura.

  20. Simultaneous VHF radar backscatter and ionosonde observations of low-latitude E region

    Directory of Open Access Journals (Sweden)

    A. K. Patra

    2005-03-01

    Full Text Available The first results of simultaneous observations made on the low-latitude field-aligned irregularities (FAI using the MST radar located at Gadanki (13.5° N, 79.2° E, dip 12.5° and the Es parameters using an ionosonde at a nearby station Sriharikota (13.7° N, 80.1° E, dip 12.6° are presented. The observations show that while the height of the most intense radar echoes is below the virtual height of Es (h'Es during daytime, it is found to be either below or above during nighttime. The strength of the FAI is better correlated with the top penetration frequency (ftEs and the blanketing frequency (fbEs during the night (r=0.4 in both cases as compared to the day (r=0.35 and -0.04, respectively. Furthermore, the signal strength of FAI is reasonably correlated with (ftEs-fbEs during daytime (r=0.59 while very poorly correlated during nighttime (r=0.18. While the radar observations in general appear to have characteristics close to that of mid-latitudes, the relationship of these with the Es parameters are poorer than that of mid-latitudes. The observations reported here, nevertheless, are quite consistent with the expectations based on the gradient drift instability mechanism.

  1. Microcrystalline thin-film solar cell deposition on moving substrates using a linear VHF-PECVD reactor and a cross-flow geometry

    International Nuclear Information System (INIS)

    Flikweert, A J; Zimmermann, T; Merdzhanova, T; Weigand, D; Appenzeller, W; Gordijn, A

    2012-01-01

    A concept for high-rate plasma deposition (PECVD) of hydrogenated microcrystalline silicon on moving substrates (dynamic deposition) is developed and evaluated. The chamber allows for substrates up to a size of 40 × 40 cm 2 . The deposition plasma is sustained between linear VHF electrodes (60 MHz) and a moving substrate. Due to the gas flow geometry and the high degree of source gas depletion, from the carrier's point of view the silane concentration varies when passing the electrodes. This is known to lead to different growth conditions which can induce transitions from microcrystalline to amorphous growth. The effect of different silane concentrations is simulated at a standard RF showerhead electrode by intentionally varying the silane concentration during deposition in static mode. This variation may decrease the layer quality of microcrystalline silicon, due to a shift of the crystallinity away from the optimum. However, adapting the input silane concentration, state-of-the-art solar cells are obtained. Microcrystalline cells (ZnO : Al/Ag back contacts) produced by the linear VHF plasma sources show an efficiency of 7.9% and 6.6% for depositions in static and dynamic mode, respectively. (paper)

  2. SISTEMA WEB DE GEOLOCALIZACIÓN Y MONITOREO DE LA TORTUGA PODOCNEMIS LEWYANA EN EL RÍO SINÚ, MEDIANTE EL USO DE ANTENAS VHF Y DISPOSITIVOS GPS

    Directory of Open Access Journals (Sweden)

    Mario Macea Anaya

    2016-03-01

    Full Text Available Este trabajo tiene como finalidad el diseño e implementación de una aplicación para el monitoreo de las Tortugas de Río Podocnemis Lewyana, utilizando las tecnologías GPS (Global Positioning System y VHF (Very High Frequency. La aplicación permite apoyar los procesos de conservación y recuperación de la especie en el Departamento de Córdoba, en las poblaciones de Caño Viejo y Cotocá Arriba del municipio Santa Cruz de Lorica, Colombia. El uso de esa herramienta está dirigido a biólogos y personas de las comunidades rurales dedicadas a conservar dicha especie. En el desarrollo del proyecto se utilizaron 18 Tortugas de Río para su monitoreo. El resultado del trabajo es la aplicación Web Podocnemis-Soft. Su funcionamiento se basa en un dispositivo GPS y VHF, ubicado en una o varias de las tortugas Podocnemis Lewyana; los dispositivos envían los datos de la ubicación de la tortuga hasta un servidor para su procesamiento y posterior visualización de la información.

  3. Low-Profile Multiband and Flush-Mountable Wideband Antennas for HF/VHF and K/Ka Band Applications

    Science.gov (United States)

    Garrido Lopez, David

    This thesis introduces several novel antenna systems with extended performance capabilities achieved by either enabling multiple operation bands or by widening the bandwidth. Proposed theoretical concepts are successfully tested through simulations and experiments with excellent agreement are demonstrated. The designs developed in this thesis research are low-profile or flush mountable, enabling simple platform integration. In the HF/VHF bands, the development of a novel low-profile multiband antenna for vehicular applications is presented. Specifically, an inverted-F antenna is used as a driven element, to operate at the lowest frequency of 27 MHz, whereas two parasitic elements are built as inverted-L monopoles to enable resonances at 49 and 53 MHz. To eliminate the need for an external matching network, an offset feeding technique is used. When the antenna is mounted on a vehicle and bent to follow its profile, a very low-profile is achieved (lambda/44) while good impedance and far-field performance are maintained across all three bands. The developed antenna system is not only electrically smallest among others found in the literature, but it is easily modified for other band selections and tuning of each band can be readily achieved. Vehicular antennas are often used for high power applications, which may cause exposure of nearby individuals to possibly dangerous electromagnetic fields. To assess this hazard, the RF exposure of a vehicle's crew is discussed and an original and fast modeling approach for prediction thereof is demonstrated. The modeling approach is based on eigenmode analysis for acquiring a range of frequencies where the shielding effectiveness of a vehicle cabin is expected to be lower than average. This approach is typically much faster and requires less computational resources as compared to classical full-wave analyses. This analysis also shows that the position of an antenna system is critical and must be considered when high-power RF

  4. Snow measurement Using P-Band Signals of Opportunity Reflectometry

    Science.gov (United States)

    Shah, R.; Yueh, S. H.; Xu, X.; Elder, K.

    2017-12-01

    Snow water storage in land is a critical parameter of the water cycle. In this study, we develop methods for estimating reflectance from bistatic scattering of digital communication Signals of Opportunity (SoOp) across the available microwave spectrum from VHF to Ka band and show results from proof-of-concept experiments at the Fraser Experimental Forest, Colorado to acquire measurements to relate the SoOp phase and reflectivity to a snow-covered soil surface. The forward modeling of this scenario will be presented and multiple sensitivities were conducted. Available SoOp receiver data along with a network of in situ sensor measurements collected since January 2016 will be used to validate theoretical modeling results. In the winter season of 2016 and 2017, we conducted a field experiment using VHF/UHF-band illuminating sources to detect SWE and surface reflectivity. The amplitude of the reflectivity showed sensitivity to the wetness of snow pack and ground reflectivity while the phase showed sensitivity to SWE. This use of this concept can be helpful to measure the snow water storage in land globally.

  5. Silicon Nitride Deposition for Flexible Organic Electronic Devices by VHF (162 MHz)-PECVD Using a Multi-Tile Push-Pull Plasma Source.

    Science.gov (United States)

    Kim, Ki Seok; Kim, Ki Hyun; Ji, You Jin; Park, Jin Woo; Shin, Jae Hee; Ellingboe, Albert Rogers; Yeom, Geun Young

    2017-10-19

    Depositing a barrier film for moisture protection without damage at a low temperature is one of the most important steps for organic-based electronic devices. In this study, the authors investigated depositing thin, high-quality SiN x film on organic-based electronic devices, specifically, very high-frequency (162 MHz) plasma-enhanced chemical vapor deposition (VHF-PECVD) using a multi-tile push-pull plasma source with a gas mixture of NH 3 /SiH 4 at a low temperature of 80 °C. The thin deposited SiN x film exhibited excellent properties in the stoichiometry, chemical bonding, stress, and step coverage. Thin film quality and plasma damage were investigated by the water vapor transmission rate (WVTR) and by electrical characteristics of organic light-emitting diode (OLED) devices deposited with SiN x , respectively. The thin deposited SiN x film exhibited a low WVTR of 4.39 × 10 -4  g (m 2 · day) -1 for a single thin (430 nm thick) film SiN x and the electrical characteristics of OLED devices before and after the thin SiN x film deposition on the devices did not change, which indicated no electrical damage during the deposition of SiN x on the OLED device.

  6. Estimation of mesospheric vertical winds from a VHF meteor radar at King Sejong Station, Antarctica (62.2S, 58.8W)

    Science.gov (United States)

    Kim, Y.; Lee, C.; Kim, J.; Jee, G.

    2013-12-01

    For the first time, vertical winds near the mesopause region were estimated from radial velocities of meteor echoes detected by a VHF meteor radar at King Sejong Station (KSS) in 2011 and 2012. Since the radar usually detects more than a hundred echoes every hour in an altitude bin of 88 - 92 km, much larger than other radars, we were able to fit measured radial velocities of these echoes with a 6 component model that consists of horizontal winds, spatial gradients of horizontal winds and vertical wind. The conventional method of deriving horizontal winds from meteor echoes utilizes a 2 component model, assuming that vertical winds and spatial gradients of horizontal winds are negligible. We analyzed the radar data obtained for 8400 hours in 2012 and 8100 hours in 2011. We found that daily mean values of vertical winds are mostly within +/- 1 m/s, whereas those of zonal winds are a few tens m/s mostly eastward. The daily mean vertical winds sometimes stay positive or negative for more than 20 days, implying that the atmosphere near the mesopause experiences episodically a large scale low and high pressure environments, respectively, like the tropospheric weather system. By conducting Lomb-normalized periodogram analysis, we also found that the vertical winds have diurnal, semidiurnal and terdiurnal tidal components with about equal significance, in contrast to horizontal winds that show a dominant semidiurnal one. We will discuss about uncertainties of the estimated vertical wind and possible reasons of its tidal and daily variations.

  7. Mesospheric Temperatures and Winds measured by a VHF Meteor Radar at King Sejong Station (62.2S, 58.8W), Antarctica

    Science.gov (United States)

    Kim, Yongha; Kim, Jeong-Han; Jee, Geonwha; Lee, Chang-Sup

    2010-05-01

    A VHF radar at King Sejong Station, Antarctica has been measuring meteor echoes since March 2007. Temperatures near the mesopause are derived from meteor decay times with an improved method of selecting meteor echo samples, and compared with airglow temperatures simultaneously observed by a spectral airglow temperature imager (SATI). The temperatures derived from meteor decay times are mostly consistent with the rotational temperatures of SATI OH(6-2) and O2(0-1) emissions from March through October. During southern summer when SATI cannot be operated due to brief night time, the meteor radar observation shows cold mesospheric temperatures, significantly lower than the CIRA86 model. The meteor radar observation also provides wind field information between 80 and 100 km of altitude. The measured meridional winds seem to follow the summer pole to winter pole circulation, and thus are correlated with the measured seasonal temperature change. However, the correlation between meridional winds and temperatures is not found in day by day base, as a previous study reported. Tidal characteristics of both zonal and meridional winds will also be compared with those of other Antarctic stations.

  8. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  9. Spatial and temporal variations of small-scale plasma turbulence parameters in the equatorial electrojet: HF and VHF radar observational results

    Directory of Open Access Journals (Sweden)

    G. Manju

    2005-06-01

    Full Text Available The spatial and temporal variations of various parameters associated with plasma wave turbulence in the equatorial electrojet (EEJ at the magnetic equatorial location of Trivandrum (8.5° N, 77° E; dip 0.5° N are studied for the first time, using co-located HF (18MHz and VHF (54.95MHz coherent backscatter radar observations (daytime in the altitude region of 95-110km, mostly on magnetically quiet days. The derived turbulence parameters are the mean electron density irregularity strength (δn/n, anomalous electron collision frequency (νe* and the corrected east-west electron drift velocity (Vey. The validity of the derived parameters is confirmed using radar data at two different frequencies and comparing with in-situ measurements. The behaviour of δn/n in relation to the backscattered power during weak and strong EEJ conditions is also examined to understand the growth and evolution of turbulence in the electrojet.

  10. Signal Words

    Science.gov (United States)

    SIGNAL WORDS TOPIC FACT SHEET NPIC fact sheets are designed to answer questions that are commonly asked by the ... making decisions about pesticide use. What are Signal Words? Signal words are found on pesticide product labels, ...

  11. Investigation of inertia-gravity waves in the upper troposphere/lower stratosphere over Northern Germany observed with collocated VHF/UHF radars

    Directory of Open Access Journals (Sweden)

    A. Serafimovich

    2005-01-01

    Full Text Available A case study to investigate the properties of inertia-gravity waves in the upper troposphere/lower stratosphere has been carried out over Northern Germany during the occurrence of an upper tropospheric jet in connection with a poleward Rossby wave breaking event from 17-19 December 1999. The investigations are based on the evaluation of continuous radar measurements with the OSWIN VHF radar at Kühlungsborn (54.1 N, 11.8 E and the 482 MHz UHF wind profiler at Lindenberg (52.2 N, 14.1 E. Both radars are separated by about 265 km. Based on wavelet transformations of both data sets, the dominant vertical wavelengths of about 2-4 km for fixed times as well as the dominant observed periods of about 11 h and weaker oscillations with periods of  6 h for the altitude range between 5 and 8 km are comparable. Gravity wave parameters have been estimated at both locations separately and by a complex cross-spectral analysis of the data of both radars. The results show the appearance of dominating inertia-gravity waves with characteristic horizontal wavelengths of  300 km moving in the opposite direction than the mean background wind and a secondary less pronounced wave with a horizontal wavelength in the order of about 200 km moving with the wind. Temporal and spatial differences of the observed waves are discussed.

  12. Exploiting LF/MF signals of opportunity for lower ionospheric remote sensing

    Science.gov (United States)

    Higginson-Rollins, Marc A.; Cohen, Morris B.

    2017-08-01

    We introduce a method to diagnose and track the D region ionosphere (60-100 km). This region is important for long-distance terrestrial communication and is impacted by a variety of geophysical phenomena, but it is traditionally very difficult to detect. Modern remote sensing methods used to study the D region are predominately near the very low frequency (VLF, 3-30 kHz) band, with some work also done in the high-frequency and very high frequency bands (HF/VHF, 3-300 MHz). However, the frequency band between VLF and HF has been largely ignored as a diagnostic tool for the ionosphere. In this paper, we evaluate the use of 300 kHz radio reflections as a diagnostic tool for characterizing the D region of the ionosphere. We present radio receiver data, analyze diurnal trends in the signal from these transmitters, and identify ionospheric disturbances impacting LF/MF propagation. We find that 300 kHz remote sensing may allow a unique method for D region diagnostics compared to both the VLF and HF/VHF frequency bands, due to a more direct ionospheric reflection coefficient calculation method with high temporal resolution without the use of forward modeling.

  13. ATP signals

    DEFF Research Database (Denmark)

    Novak, Ivana

    2016-01-01

    The Department of Biology at the University of Copenhagen explains the function of ATP signalling in the pancreas......The Department of Biology at the University of Copenhagen explains the function of ATP signalling in the pancreas...

  14. Ionospheric plasma by VHF waves

    Indian Academy of Sciences (India)

    The amplitude scintillations of very high frequency electromagnetic wave ... Scintillations at low latitude are known to occur in discrete patches [5,6] and are part .... weakly ionized plasma with a density gradient and a relative drift of ions and ...

  15. Signaling aggression.

    Science.gov (United States)

    van Staaden, Moira J; Searcy, William A; Hanlon, Roger T

    2011-01-01

    From psychological and sociological standpoints, aggression is regarded as intentional behavior aimed at inflicting pain and manifested by hostility and attacking behaviors. In contrast, biologists define aggression as behavior associated with attack or escalation toward attack, omitting any stipulation about intentions and goals. Certain animal signals are strongly associated with escalation toward attack and have the same function as physical attack in intimidating opponents and winning contests, and ethologists therefore consider them an integral part of aggressive behavior. Aggressive signals have been molded by evolution to make them ever more effective in mediating interactions between the contestants. Early theoretical analyses of aggressive signaling suggested that signals could never be honest about fighting ability or aggressive intentions because weak individuals would exaggerate such signals whenever they were effective in influencing the behavior of opponents. More recent game theory models, however, demonstrate that given the right costs and constraints, aggressive signals are both reliable about strength and intentions and effective in influencing contest outcomes. Here, we review the role of signaling in lieu of physical violence, considering threat displays from an ethological perspective as an adaptive outcome of evolutionary selection pressures. Fighting prowess is conveyed by performance signals whose production is constrained by physical ability and thus limited to just some individuals, whereas aggressive intent is encoded in strategic signals that all signalers are able to produce. We illustrate recent advances in the study of aggressive signaling with case studies of charismatic taxa that employ a range of sensory modalities, viz. visual and chemical signaling in cephalopod behavior, and indicators of aggressive intent in the territorial calls of songbirds. Copyright © 2011 Elsevier Inc. All rights reserved.

  16. Signal detection

    International Nuclear Information System (INIS)

    Tholomier, M.

    1985-01-01

    In a scanning electron microscope, whatever is the measured signal, the same set is found: incident beam, sample, signal detection, signal amplification. The resulting signal is used to control the spot luminosity with the observer cathodoscope. This is synchronized with the beam scanning on the sample; on the cathodoscope, the image in secondary electrons, backscattered electrons,... of the sample surface is reconstituted. The best compromise must be found between a register time low enough to remove eventual variations (under the incident beam) of the nature of the observed phenomenon, and a good spatial resolution of the image and a signal-to-noise ratio high enough. The noise is one of the basic limitations of the scanning electron microscope performance. The whose measurement line must be optimized to reduce it [fr

  17. Navigation Signal Disturbances by Multipath Propagation - Scaled Measurements with a Universal Channel Sounder Architecture

    Science.gov (United States)

    Geise, Robert; Neubauer, Bjoern; Zimmer, Georg

    2015-11-01

    The performance of navigation systems is always reduced by unwanted multipath propagation. This is especially of practical importance for airborne navigation systems like the instrument landing system (ILS) or the VHF omni directional radio range (VOR). Nevertheless, the quantitative analysis of corresponding, potentially harmful multipath propagation disturbances is very difficult due to the large parameter space. Experimentally difficulties arise due to very expensive, real scale measurement campaigns and numerical simulation techniques still have shortcomings which are briefly discussed. In this contribution a new universal approach is introduced on how to measure very flexibly multipath propagation effects for arbitrary navigation systems using a channel sounder architecture in a scaled measurement environment. Two relevant scenarios of multipath propagation and the impact on navigation signals are presented. The first describes disturbances of the ILS due to large taxiing aircraft. The other example shows the influence of rotating wind turbines on the VOR.

  18. Signal Processing

    International Nuclear Information System (INIS)

    Anon.

    1992-01-01

    Signal processing techniques, extensively used nowadays to maximize the performance of audio and video equipment, have been a key part in the design of hardware and software for high energy physics detectors since pioneering applications in the UA1 experiment at CERN in 1979

  19. Integrin Signalling

    OpenAIRE

    Schelfaut, Roselien

    2005-01-01

    Integrins are receptors presented on most cells. By binding ligand they can generate signalling pathways inside the cell. Those pathways are a linkage to proteins in the cytosol. It is known that tumor cells can survive and proliferate in the absence of a solid support while normal cells need to be bound to ligand. To understand why tumour cells act that way, we first have to know how ligand-binding to integrins affect the cell. This research field includes studies on activation of proteins b...

  20. Enlaces de datos En VHF (VDL dentro del contexto CNS/ATM para la prestación de los servicios de tránsito aéreo en Colombia

    Directory of Open Access Journals (Sweden)

    Édgar Leonardo Gómez Gómez

    2012-09-01

    Full Text Available En este artículo se analiza el protocolo de comunicaciones por enlaces de datos en VHF (VDL, el cual, junto con técnicas de posicionamiento satelital, es uno de los pilares fundamentales dentro del concepto CNS/ATM planteado por la Organización de Aviación Civil Internacional (OACI, el cual busca la implantación de nuevas tecnologías para la prestación de los servicios de tránsito aéreo en las áreas de comunicaciones, navegación y vigilancia de aeronaves a nivel mundial. Se presenta el tipo de sistemas usados actualmente por la Unidad Administrativa Especial de Aeronáutica Civil (UAEAC para la prestación de estos servicios en Colombia, y se hace un comparativo para establecer las ventajas que tiene la implantación de las nuevas tecnologías planteadas en el concepto CNS/ATM, teniendo en cuenta las condiciones particulares de terreno y de flujo de tránsito aéreo que presenta Colombia. Además, se presentan los proyectos de implementación de subredes basadas en enlaces de datos VDL más relevantes a nivel mundial, los cuales permiten obtener resultados de pruebas de funcionamiento, como un paso fundamental hacia la consolidación a nivel mundial de este tipo de tecnología.

  1. Ionospheric modification induced by high-power HF transmitters: a potential for extended range VHF--UHF communications and plasma physics research

    International Nuclear Information System (INIS)

    Utlaut, W.F.

    1975-01-01

    When the ionized upper atmosphere of the earth is illuminated by high-power HF radio waves at appropriate frequencies, the temperature of electrons in the ionosphere can be raised substantially. In addition, radio waves with sufficient energy cause parametric instabilities that generate a spectrum of intense plasma waves. Observations of these phenomena have produced new understanding of plasma processes. One consequence of heating and plasma wave generation is that irregularities are formed in the electron distribution which are aligned with the earth's magnetic field. Because of this, a scatterer of large radar cross section is produced, which scatters HF through UHF communication signals over long distance paths, that would not otherwise be normally possible by ionospheric means. Results of radio, radar, communication, and photometric experiments that explored the characteristics of the volume of ionosphere which has been intentionally modified, temporarily, above facilities near Boulder (Platteville), Colo., and at Arecibo, Puerto Rico are summarized

  2. Geophysical analysis of coherent satellite scintillation data

    Science.gov (United States)

    Fremouw, E. J.; Lansinger, J. M.; Miller, D. A.

    1981-11-01

    In May of 1976, Air Force Satellite P76-5 was launched with the Defense Nuclear Agency's Wideband beacon, DNA-002, as its sole payload. Several researchers have employed the resulting data in studies of ionospheric structure and its effect on transionospheric radio communications. In the present work, recordings of amplitude and phase scintillation imposed on Wideband's VHF and UHF signals by the ionosphere have been used to study medium-scale structures in the auroral-zone F layer. Results include quantitative identification of a very close relationship between scintillation and solar/geomagnetic activity, together with lack of a seasonal variation in scintillation activity in the Alaskan sector. A surprisingly high correlation (90%) was found between monthly means of phase-scintillation index, on the one hand, and sunspot number and 10-cm solar radio flux, on the other. The high-latitude scintillation boundary was found to be very similar to the soft-electron precipitation boundary, including similarity in expansion rates with increasing magnetic activity. Interestingly, it is systematically shifted poleward of the precipitation boundary on the day side of the earth and equatorward on the night side. Taken together, the results of this research disclose a rather direct relationship between scintillation and soft-electron precipitation, with plasma convection likely playing an important role in generation of the scintillation-producing irregularities.

  3. Basic digital signal processing

    CERN Document Server

    Lockhart, Gordon B

    1985-01-01

    Basic Digital Signal Processing describes the principles of digital signal processing and experiments with BASIC programs involving the fast Fourier theorem (FFT). The book reviews the fundamentals of the BASIC program, continuous and discrete time signals including analog signals, Fourier analysis, discrete Fourier transform, signal energy, power. The text also explains digital signal processing involving digital filters, linear time-variant systems, discrete time unit impulse, discrete-time convolution, and the alternative structure for second order infinite impulse response (IIR) sections.

  4. Global 21 cm Signal Extraction from Foreground and Instrumental Effects. I. Pattern Recognition Framework for Separation Using Training Sets

    Science.gov (United States)

    Tauscher, Keith; Rapetti, David; Burns, Jack O.; Switzer, Eric

    2018-02-01

    The sky-averaged (global) highly redshifted 21 cm spectrum from neutral hydrogen is expected to appear in the VHF range of ∼20–200 MHz and its spectral shape and strength are determined by the heating properties of the first stars and black holes, by the nature and duration of reionization, and by the presence or absence of exotic physics. Measurements of the global signal would therefore provide us with a wealth of astrophysical and cosmological knowledge. However, the signal has not yet been detected because it must be seen through strong foregrounds weighted by a large beam, instrumental calibration errors, and ionospheric, ground, and radio-frequency-interference effects, which we collectively refer to as “systematics.” Here, we present a signal extraction method for global signal experiments which uses Singular Value Decomposition of “training sets” to produce systematics basis functions specifically suited to each observation. Instead of requiring precise absolute knowledge of the systematics, our method effectively requires precise knowledge of how the systematics can vary. After calculating eigenmodes for the signal and systematics, we perform a weighted least square fit of the corresponding coefficients and select the number of modes to include by minimizing an information criterion. We compare the performance of the signal extraction when minimizing various information criteria and find that minimizing the Deviance Information Criterion most consistently yields unbiased fits. The methods used here are built into our widely applicable, publicly available Python package, pylinex, which analytically calculates constraints on signals and systematics from given data, errors, and training sets.

  5. Retroactive signaling in short signaling pathways.

    Directory of Open Access Journals (Sweden)

    Jacques-Alexandre Sepulchre

    Full Text Available In biochemical signaling pathways without explicit feedback connections, the core signal transduction is usually described as a one-way communication, going from upstream to downstream in a feedforward chain or network of covalent modification cycles. In this paper we explore the possibility of a new type of signaling called retroactive signaling, offered by the recently demonstrated property of retroactivity in signaling cascades. The possibility of retroactive signaling is analysed in the simplest case of the stationary states of a bicyclic cascade of signaling cycles. In this case, we work out the conditions for which variables of the upstream cycle are affected by a change of the total amount of protein in the downstream cycle, or by a variation of the phosphatase deactivating the same protein. Particularly, we predict the characteristic ranges of the downstream protein, or of the downstream phosphatase, for which a retroactive effect can be observed on the upstream cycle variables. Next, we extend the possibility of retroactive signaling in short but nonlinear signaling pathways involving a few covalent modification cycles.

  6. 47 CFR 80.911 - VHF transmitter.

    Science.gov (United States)

    2010-10-01

    ... resistance when operated with a primary supply voltage of 13.6 volts DC. (d) When an individual demonstration... paragraph must be met as follows: (1) Measurements of primary supply voltage and transmitter output power must be made with the equipment drawing energy only from ship's battery; (2) The primary supply voltage...

  7. A Reliable File Group Sending Method Based on Low-bandwidth VHF Radio%一种超短波电台低带宽下文件可靠群发方法

    Institute of Scientific and Technical Information of China (English)

    杨紫薇; 丁敬海; 张士军

    2016-01-01

    在现代连队指挥系统内,普遍采用无线超短波电台传输文件作为通信方式。传统的发送方式是发送方不断检测接收节点的应答帧来判断是否需要续传文件,但在文件群发过程中,发送方频繁查询接收方是否成功接收会严重占用带宽,造成网络瘫痪,从而导致文件传输成功率低下。然而作为连队指挥系统的可靠性要求之一,在超短波电台传输带宽较低(4800 KBps)的情况下,指挥车对作战单元群发文件的成功率决不能低于90%。为了解决这一难题,提出了一种新的文件可靠群发方法,该方法对发送方设计通信首帧,将文件分割编序封装并按周期顺序发送,同时各个接收节点对文件进行CRC校验,索引漏帧并主动发起补传要求。通过这种通信方法,连队通信网络内,指挥车可以一次将10 KB的文件发送至10个作战单元,经过测试,数据通信成功率保持在90%以上。%In company’ s modern command system,files transmission by wireless FM radio is a universal communication method. The traditional sending method is that the sender determines whether to resume files or not by detecting response frame continuously from the receiver. But during the file group sending process,if the sender checks the file transfer result from the receiver frequently,then bandwidth may be consumed seriously and network paralysis even arises,thus the low success rate of file transfer will be caused. As one of the reliability requirements of company command system,the success rate of file group transfer must reach more than 90% by low bandwidth VHF radio (4 800 Kbps). In order to solve this problem,a reliable file group sending method is proposed in this paper,in which a kind of head frame is designed for the sender. The files are divided into several frames,a sequence number is assigned to each frame,and then each file frame is sent in order. Meanwhile, the receivers

  8. Signal sciences workshop proceedings

    Energy Technology Data Exchange (ETDEWEB)

    Candy, J.V.

    1997-05-01

    This meeting is aimed primarily at signal processing and controls. The technical program for the 1997 Workshop includes a variety of efforts in the Signal Sciences with applications in the Microtechnology Area a new program at LLNL and a future area of application for both Signal/Image Sciences. Special sessions organized by various individuals in Seismic and Optical Signal Processing as well as Micro-Impulse Radar Processing highlight the program, while the speakers at the Signal Processing Applications session discuss various applications of signal processing/control to real world problems. For the more theoretical, a session on Signal Processing Algorithms was organized as well as for the more pragmatic, featuring a session on Real-Time Signal Processing.

  9. Signal sciences workshop. Proceedings

    International Nuclear Information System (INIS)

    Candy, J.V.

    1997-01-01

    This meeting is aimed primarily at signal processing and controls. The technical program for the 1997 Workshop includes a variety of efforts in the Signal Sciences with applications in the Microtechnology Area a new program at LLNL and a future area of application for both Signal/Image Sciences. Special sessions organized by various individuals in Seismic and Optical Signal Processing as well as Micro-Impulse Radar Processing highlight the program, while the speakers at the Signal Processing Applications session discuss various applications of signal processing/control to real world problems. For the more theoretical, a session on Signal Processing Algorithms was organized as well as for the more pragmatic, featuring a session on Real-Time Signal Processing

  10. ECG signal processing

    NARCIS (Netherlands)

    2009-01-01

    A system extracts an ECG signal from a composite signal (308) representing an electric measurement of a living subject. Identification means (304) identify a plurality of temporal segments (309) of the composite signal corresponding to a plurality of predetermined segments (202,204,206) of an ECG

  11. Optimal Signal Quality Index for Photoplethysmogram Signals

    Directory of Open Access Journals (Sweden)

    Mohamed Elgendi

    2016-09-01

    Full Text Available A photoplethysmogram (PPG is a noninvasive circulatory signal related to the pulsatile volume of blood in tissue and is typically collected by pulse oximeters. PPG signals collected via mobile devices are prone to artifacts that negatively impact measurement accuracy, which can lead to a significant number of misleading diagnoses. Given the rapidly increased use of mobile devices to collect PPG signals, developing an optimal signal quality index (SQI is essential to classify the signal quality from these devices. Eight SQIs were developed and tested based on: perfusion, kurtosis, skewness, relative power, non-stationarity, zero crossing, entropy, and the matching of systolic wave detectors. Two independent annotators annotated all PPG data (106 recordings, 60 s each and a third expert conducted the adjudication of differences. The independent annotators labeled each PPG signal with one of the following labels: excellent, acceptable or unfit for diagnosis. All indices were compared using Mahalanobis distance, linear discriminant analysis, quadratic discriminant analysis, and support vector machine with leave-one-out cross-validation. The skewness index outperformed the other seven indices in differentiating between excellent PPG and acceptable, acceptable combined with unfit, and unfit recordings, with overall F 1 scores of 86.0%, 87.2%, and 79.1%, respectively.

  12. Optimal Signal Quality Index for Photoplethysmogram Signals.

    Science.gov (United States)

    Elgendi, Mohamed

    2016-09-22

    A photoplethysmogram (PPG) is a noninvasive circulatory signal related to the pulsatile volume of blood in tissue and is typically collected by pulse oximeters. PPG signals collected via mobile devices are prone to artifacts that negatively impact measurement accuracy, which can lead to a significant number of misleading diagnoses. Given the rapidly increased use of mobile devices to collect PPG signals, developing an optimal signal quality index (SQI) is essential to classify the signal quality from these devices. Eight SQIs were developed and tested based on: perfusion, kurtosis, skewness, relative power, non-stationarity, zero crossing, entropy, and the matching of systolic wave detectors. Two independent annotators annotated all PPG data (106 recordings, 60 s each) and a third expert conducted the adjudication of differences. The independent annotators labeled each PPG signal with one of the following labels: excellent, acceptable or unfit for diagnosis. All indices were compared using Mahalanobis distance, linear discriminant analysis, quadratic discriminant analysis, and support vector machine with leave-one-out cross-validation. The skewness index outperformed the other seven indices in differentiating between excellent PPG and acceptable, acceptable combined with unfit, and unfit recordings, with overall F 1 scores of 86.0%, 87.2%, and 79.1%, respectively.

  13. Second-hand signals

    DEFF Research Database (Denmark)

    Bergenholtz, Carsten

    2014-01-01

    Studies of signaling theory have traditionally focused on the dyadic link between the sender and receiver of the signal. Within a science‐based perspective this framing has led scholars to investigate how patents and publications of firms function as signals. I explore another important type...... used by various agents in their search for and assessment of products and firms. I conclude by arguing how this second‐hand nature of signals goes beyond a simple dyadic focus on senders and receivers of signals, and thus elucidates the more complex interrelations of the various types of agents...

  14. Method of signal analysis

    International Nuclear Information System (INIS)

    Berthomier, Charles

    1975-01-01

    A method capable of handling the amplitude and the frequency time laws of a certain kind of geophysical signals is described here. This method is based upon the analytical signal idea of Gabor and Ville, which is constructed either in the time domain by adding an imaginary part to the real signal (in-quadrature signal), or in the frequency domain by suppressing negative frequency components. The instantaneous frequency of the initial signal is then defined as the time derivative of the phase of the analytical signal, and his amplitude, or envelope, as the modulus of this complex signal. The method is applied to three types of magnetospheric signals: chorus, whistlers and pearls. The results obtained by analog and numerical calculations are compared to results obtained by classical systems using filters, i.e. based upon a different definition of the concept of frequency. The precision with which the frequency-time laws are determined leads then to the examination of the principle of the method and to a definition of instantaneous power density spectrum attached to the signal, and to the first consequences of this definition. In this way, a two-dimensional representation of the signal is introduced which is less deformed by the analysis system properties than the usual representation, and which moreover has the advantage of being obtainable practically in real time [fr

  15. Measurand transient signal suppressor

    Science.gov (United States)

    Bozeman, Richard J., Jr. (Inventor)

    1994-01-01

    A transient signal suppressor for use in a controls system which is adapted to respond to a change in a physical parameter whenever it crosses a predetermined threshold value in a selected direction of increasing or decreasing values with respect to the threshold value and is sustained for a selected discrete time interval is presented. The suppressor includes a sensor transducer for sensing the physical parameter and generating an electrical input signal whenever the sensed physical parameter crosses the threshold level in the selected direction. A manually operated switch is provided for adapting the suppressor to produce an output drive signal whenever the physical parameter crosses the threshold value in the selected direction of increasing or decreasing values. A time delay circuit is selectively adjustable for suppressing the transducer input signal for a preselected one of a plurality of available discrete suppression time and producing an output signal only if the input signal is sustained for a time greater than the selected suppression time. An electronic gate is coupled to receive the transducer input signal and the timer output signal and produce an output drive signal for energizing a control relay whenever the transducer input is a non-transient signal which is sustained beyond the selected time interval.

  16. Wnt signaling in cancer

    Science.gov (United States)

    Zhan, T; Rindtorff, N; Boutros, M

    2017-01-01

    Wnt signaling is one of the key cascades regulating development and stemness, and has also been tightly associated with cancer. The role of Wnt signaling in carcinogenesis has most prominently been described for colorectal cancer, but aberrant Wnt signaling is observed in many more cancer entities. Here, we review current insights into novel components of Wnt pathways and describe their impact on cancer development. Furthermore, we highlight expanding functions of Wnt signaling for both solid and liquid tumors. We also describe current findings how Wnt signaling affects maintenance of cancer stem cells, metastasis and immune control. Finally, we provide an overview of current strategies to antagonize Wnt signaling in cancer and challenges that are associated with such approaches. PMID:27617575

  17. Cooperative ethylene receptor signaling

    OpenAIRE

    Liu, Qian; Wen, Chi-Kuang

    2012-01-01

    The gaseous plant hormone ethylene is perceived by a family of five ethylene receptor members in the dicotyledonous model plant Arabidopsis. Genetic and biochemical studies suggest that the ethylene response is suppressed by ethylene receptor complexes, but the biochemical nature of the receptor signal is unknown. Without appropriate biochemical measures to trace the ethylene receptor signal and quantify the signal strength, the biological significance of the modulation of ethylene responses ...

  18. Traffic signal synchronization.

    Science.gov (United States)

    Huang, Ding-wei; Huang, Wei-neng

    2003-05-01

    The benefits of traffic signal synchronization are examined within the cellular automata approach. The microsimulations of traffic flow are obtained with different settings of signal period T and time delay delta. Both numerical results and analytical approximations are presented. For undersaturated traffic, the green-light wave solutions can be realized. For saturated traffic, the correlation among the traffic signals has no effect on the throughput. For oversaturated traffic, the benefits of synchronization are manifest only when stochastic noise is suppressed.

  19. Digital signal processing the Tevatron BPM signals

    International Nuclear Information System (INIS)

    Cancelo, G.; James, E.; Wolbers, S.

    2005-01-01

    The Beam Position Monitor (TeV BPM) readout system at Fermilab's Tevatron has been updated and is currently being commissioned. The new BPMs use new analog and digital hardware to achieve better beam position measurement resolution. The new system reads signals from both ends of the existing directional stripline pickups to provide simultaneous proton and antiproton measurements. The signals provided by the two ends of the BPM pickups are processed by analog band-pass filters and sampled by 14-bit ADCs at 74.3MHz. A crucial part of this work has been the design of digital filters that process the signal. This paper describes the digital processing and estimation techniques used to optimize the beam position measurement. The BPM electronics must operate in narrow-band and wide-band modes to enable measurements of closed-orbit and turn-by-turn positions. The filtering and timing conditions of the signals are tuned accordingly for the operational modes. The analysis and the optimized result for each mode are presented

  20. Nichtkontinuierliche (zeitdiskrete) Signale

    Science.gov (United States)

    Plaßmann, Wilfried

    Zeitdiskrete Signale werden häufig aus zeitkontinuierlichen Signalen durch Abtastung erzeugt. Dass beide Signale gleichwertig sind, zeigt das Abtasttheorem (Kap. 116) von Shannon, sofern die Bedingung nach (116.2), f_{ab}≈(2{,}2 {\\ldots} 4)\\cdot fg) eingehalten wird. Digitale Signale haben Vorteile: Einfache Speicherung, Weiterverarbeitung in Rechnern, wenig störanfällige Übertragung. Für die Bearbeitung dieser Signale dienen die im Kapitel dargestellten Hilfsmittel: Diskrete Fouriertransformation; Schnelle Fouriertransformation; z-Transformation: Darstellung, Sätze zur z-Transformation, Korrespondenzen zu Zeitfunktionen, Beispiele.

  1. Biomedical signals and systems

    CERN Document Server

    Tranquillo, Joseph V

    2013-01-01

    Biomedical Signals and Systems is meant to accompany a one-semester undergraduate signals and systems course. It may also serve as a quick-start for graduate students or faculty interested in how signals and systems techniques can be applied to living systems. The biological nature of the examples allows for systems thinking to be applied to electrical, mechanical, fluid, chemical, thermal and even optical systems. Each chapter focuses on a topic from classic signals and systems theory: System block diagrams, mathematical models, transforms, stability, feedback, system response, control, time

  2. Radiation signal processing system

    International Nuclear Information System (INIS)

    Bennett, M.; Knoll, G.; Strange, D.

    1980-01-01

    An improved signal processing system for radiation imaging apparatus comprises: a radiation transducer producing transducer signals proportional to apparent spatial coordinates of detected radiation events; means for storing true spatial coordinates corresponding to a plurality of predetermined apparent spatial coordinates relative to selected detected radiation events said means for storing responsive to said transducer signal and producing an output signal representative of said true spatial coordinates; and means for interpolating the true spatial coordinates of the detected radiation events located intermediate the stored true spatial coordinates, said means for interpolating communicating with said means for storing

  3. Digital signal processing

    CERN Document Server

    O'Shea, Peter; Hussain, Zahir M

    2011-01-01

    In three parts, this book contributes to the advancement of engineering education and that serves as a general reference on digital signal processing. Part I presents the basics of analog and digital signals and systems in the time and frequency domain. It covers the core topics: convolution, transforms, filters, and random signal analysis. It also treats important applications including signal detection in noise, radar range estimation for airborne targets, binary communication systems, channel estimation, banking and financial applications, and audio effects production. Part II considers sel

  4. Drought Signaling in Plants

    Indian Academy of Sciences (India)

    depending upon the source and nature of signaling: (i) hormone signal, (ii) .... plants to regulate the rate of transpiration through minor structural .... cell has to keep spending energy (in the form of A TP) to maintain a .... enzymes and proteins in the regulation of cellular metabolism can be determined by either inactivating.

  5. Ubiquitination in apoptosis signaling

    NARCIS (Netherlands)

    van de Kooij, L.W.

    2014-01-01

    The work described in this thesis focuses on ubiquitination and protein degradation, with an emphasis on how these processes regulate apoptosis signaling. More specifically, our aims were: 1. To increase the understanding of ubiquitin-mediated regulation of apoptosis signaling. 2. To identify the E3

  6. Multiresolution signal decomposition schemes

    NARCIS (Netherlands)

    J. Goutsias (John); H.J.A.M. Heijmans (Henk)

    1998-01-01

    textabstract[PNA-R9810] Interest in multiresolution techniques for signal processing and analysis is increasing steadily. An important instance of such a technique is the so-called pyramid decomposition scheme. This report proposes a general axiomatic pyramid decomposition scheme for signal analysis

  7. SignalR blueprints

    CERN Document Server

    Ingebrigtsen, Einar

    2015-01-01

    This book is designed for software developers, primarily those with knowledge of C#, .NET, and JavaScript. Good knowledge and understanding of SignalR is assumed to allow efficient programming of core elements and applications in SignalR.

  8. Optimal fault signal estimation

    NARCIS (Netherlands)

    Stoorvogel, Antonie Arij; Niemann, H.H.; Saberi, A.; Sannuti, P.

    2002-01-01

    We consider here both fault identification and fault signal estimation. Regarding fault identification, we seek either exact or almost fault identification. On the other hand, regarding fault signal estimation, we seek either $H_2$ optimal, $H_2$ suboptimal or Hinfinity suboptimal estimation. By

  9. Signal sampling circuit

    NARCIS (Netherlands)

    Louwsma, S.M.; Vertregt, Maarten

    2011-01-01

    A sampling circuit for sampling a signal is disclosed. The sampling circuit comprises a plurality of sampling channels adapted to sample the signal in time-multiplexed fashion, each sampling channel comprising a respective track-and-hold circuit connected to a respective analogue to digital

  10. Signal sampling circuit

    NARCIS (Netherlands)

    Louwsma, S.M.; Vertregt, Maarten

    2010-01-01

    A sampling circuit for sampling a signal is disclosed. The sampling circuit comprises a plurality of sampling channels adapted to sample the signal in time-multiplexed fashion, each sampling channel comprising a respective track-and-hold circuit connected to a respective analogue to digital

  11. Bioelectric Signal Measuring System

    Science.gov (United States)

    Guadarrama-Santana, A.; Pólo-Parada, L.; García-Valenzuela, A.

    2015-01-01

    We describe a low noise measuring system based on interdigitated electrodes for sensing bioelectrical signals. The system registers differential voltage measurements in order of microvolts. The base noise during measurements was in nanovolts and thus, the sensing signals presented a very good signal to noise ratio. An excitation voltage of 1Vrms with 10 KHz frequency was applied to an interdigitated capacitive sensor without a material under test and to a mirror device simultaneously. The output signals of both devices was then subtracted in order to obtain an initial reference value near cero volts and reduce parasitic capacitances due to the electronics, wiring and system hardware as well. The response of the measuring system was characterized by monitoring temporal bioelectrical signals in real time of biological materials such as embryo chicken heart cells and bovine suprarenal gland cells.

  12. Acoustic Signals and Systems

    DEFF Research Database (Denmark)

    2008-01-01

    The Handbook of Signal Processing in Acoustics will compile the techniques and applications of signal processing as they are used in the many varied areas of Acoustics. The Handbook will emphasize the interdisciplinary nature of signal processing in acoustics. Each Section of the Handbook...... will present topics on signal processing which are important in a specific area of acoustics. These will be of interest to specialists in these areas because they will be presented from their technical perspective, rather than a generic engineering approach to signal processing. Non-specialists, or specialists...... from different areas, will find the self-contained chapters accessible and will be interested in the similarities and differences between the approaches and techniques used in different areas of acoustics....

  13. Molecular and Cellular Signaling

    CERN Document Server

    Beckerman, Martin

    2005-01-01

    A small number of signaling pathways, no more than a dozen or so, form a control layer that is responsible for all signaling in and between cells of the human body. The signaling proteins belonging to the control layer determine what kinds of cells are made during development and how they function during adult life. Malfunctions in the proteins belonging to the control layer are responsible for a host of human diseases ranging from neurological disorders to cancers. Most drugs target components in the control layer, and difficulties in drug design are intimately related to the architecture of the control layer. Molecular and Cellular Signaling provides an introduction to molecular and cellular signaling in biological systems with an emphasis on the underlying physical principles. The text is aimed at upper-level undergraduates, graduate students and individuals in medicine and pharmacology interested in broadening their understanding of how cells regulate and coordinate their core activities and how diseases ...

  14. Adaptive signal processor

    Energy Technology Data Exchange (ETDEWEB)

    Walz, H.V.

    1980-07-01

    An experimental, general purpose adaptive signal processor system has been developed, utilizing a quantized (clipped) version of the Widrow-Hoff least-mean-square adaptive algorithm developed by Moschner. The system accommodates 64 adaptive weight channels with 8-bit resolution for each weight. Internal weight update arithmetic is performed with 16-bit resolution, and the system error signal is measured with 12-bit resolution. An adapt cycle of adjusting all 64 weight channels is accomplished in 8 ..mu..sec. Hardware of the signal processor utilizes primarily Schottky-TTL type integrated circuits. A prototype system with 24 weight channels has been constructed and tested. This report presents details of the system design and describes basic experiments performed with the prototype signal processor. Finally some system configurations and applications for this adaptive signal processor are discussed.

  15. Adaptive signal processor

    International Nuclear Information System (INIS)

    Walz, H.V.

    1980-07-01

    An experimental, general purpose adaptive signal processor system has been developed, utilizing a quantized (clipped) version of the Widrow-Hoff least-mean-square adaptive algorithm developed by Moschner. The system accommodates 64 adaptive weight channels with 8-bit resolution for each weight. Internal weight update arithmetic is performed with 16-bit resolution, and the system error signal is measured with 12-bit resolution. An adapt cycle of adjusting all 64 weight channels is accomplished in 8 μsec. Hardware of the signal processor utilizes primarily Schottky-TTL type integrated circuits. A prototype system with 24 weight channels has been constructed and tested. This report presents details of the system design and describes basic experiments performed with the prototype signal processor. Finally some system configurations and applications for this adaptive signal processor are discussed

  16. Zinc Signals and Immunity.

    Science.gov (United States)

    Maywald, Martina; Wessels, Inga; Rink, Lothar

    2017-10-24

    Zinc homeostasis is crucial for an adequate function of the immune system. Zinc deficiency as well as zinc excess result in severe disturbances in immune cell numbers and activities, which can result in increased susceptibility to infections and development of especially inflammatory diseases. This review focuses on the role of zinc in regulating intracellular signaling pathways in innate as well as adaptive immune cells. Main underlying molecular mechanisms and targets affected by altered zinc homeostasis, including kinases, caspases, phosphatases, and phosphodiesterases, will be highlighted in this article. In addition, the interplay of zinc homeostasis and the redox metabolism in affecting intracellular signaling will be emphasized. Key signaling pathways will be described in detail for the different cell types of the immune system. In this, effects of fast zinc flux, taking place within a few seconds to minutes will be distinguish from slower types of zinc signals, also designated as "zinc waves", and late homeostatic zinc signals regarding prolonged changes in intracellular zinc.

  17. Orexin/Hypocretin Signaling.

    Science.gov (United States)

    Kukkonen, Jyrki P

    Orexin/hypocretin peptide (orexin-A and orexin-B) signaling is believed to take place via the two G-protein-coupled receptors (GPCRs), named OX 1 and OX 2 orexin receptors, as described in the previous chapters. Signaling of orexin peptides has been investigated in diverse endogenously orexin receptor-expressing cells - mainly neurons but also other types of cells - and in recombinant cells expressing the receptors in a heterologous manner. Findings in the different systems are partially convergent but also indicate cellular background-specific signaling. The general picture suggests an inherently high degree of diversity in orexin receptor signaling.In the current chapter, I present orexin signaling on the cellular and molecular levels. Discussion of the connection to (potential) physiological orexin responses is only brief since these are in focus of other chapters in this book. The same goes for the post-synaptic signaling mechanisms, which are dealt with in Burdakov: Postsynaptic actions of orexin. The current chapter is organized according to the tissue type, starting from the central nervous system. Finally, receptor signaling pathways are discussed across tissues, cell types, and even species.

  18. Signal flow analysis

    CERN Document Server

    Abrahams, J R; Hiller, N

    1965-01-01

    Signal Flow Analysis provides information pertinent to the fundamental aspects of signal flow analysis. This book discusses the basic theory of signal flow graphs and shows their relation to the usual algebraic equations.Organized into seven chapters, this book begins with an overview of properties of a flow graph. This text then demonstrates how flow graphs can be applied to a wide range of electrical circuits that do not involve amplification. Other chapters deal with the parameters as well as circuit applications of transistors. This book discusses as well the variety of circuits using ther

  19. Underwater Acoustic Signal Processing

    National Research Council Canada - National Science Library

    Culver, Richard L; Sibul, Leon H; Bradley, David L

    2007-01-01

    .... The research is directed toward passive sonar detection and classification, continuous wave (CW) and broadband signals, shallow water operation, both platform-mounted and distributed systems, and frequencies below 1 kHz...

  20. Signals and systems

    CERN Document Server

    Rao, K Deergha

    2018-01-01

    This textbook covers the fundamental theories of signals and systems analysis, while incorporating recent developments from integrated circuits technology into its examples. Starting with basic definitions in signal theory, the text explains the properties of continuous-time and discrete-time systems and their representation by differential equations and state space. From those tools, explanations for the processes of Fourier analysis, the Laplace transform, and the z-Transform provide new ways of experimenting with different kinds of time systems. The text also covers the separate classes of analog filters and their uses in signal processing applications. Intended for undergraduate electrical engineering students, chapter sections include exercise for review and practice for the systems concepts of each chapter. Along with exercises, the text includes MATLAB-based examples to allow readers to experiment with signals and systems code on their own. An online repository of the MATLAB code from this textbook can...

  1. Topological signal processing

    CERN Document Server

    Robinson, Michael

    2014-01-01

    Signal processing is the discipline of extracting information from collections of measurements. To be effective, the measurements must be organized and then filtered, detected, or transformed to expose the desired information.  Distortions caused by uncertainty, noise, and clutter degrade the performance of practical signal processing systems. In aggressively uncertain situations, the full truth about an underlying signal cannot be known.  This book develops the theory and practice of signal processing systems for these situations that extract useful, qualitative information using the mathematics of topology -- the study of spaces under continuous transformations.  Since the collection of continuous transformations is large and varied, tools which are topologically-motivated are automatically insensitive to substantial distortion. The target audience comprises practitioners as well as researchers, but the book may also be beneficial for graduate students.

  2. Acoustic MIMO signal processing

    CERN Document Server

    Huang, Yiteng; Chen, Jingdong

    2006-01-01

    A timely and important book addressing a variety of acoustic signal processing problems under multiple-input multiple-output (MIMO) scenarios. It uniquely investigates these problems within a unified framework offering a novel and penetrating analysis.

  3. Ultrahigh bandwidth signal processing

    DEFF Research Database (Denmark)

    Oxenløwe, Leif Katsuo

    2016-01-01

    Optical time lenses have proven to be very versatile for advanced optical signal processing. Based on a controlled interplay between dispersion and phase-modulation by e.g. four-wave mixing, the processing is phase-preserving, an hence useful for all types of data signals including coherent multi......-level modulation founats. This has enabled processing of phase-modulated spectrally efficient data signals, such as orthogonal frequency division multiplexed (OFDM) signa In that case, a spectral telescope system was used, using two time lenses with different focal lengths (chirp rates), yielding a spectral...... regeneratio These operations require a broad bandwidth nonlinear platform, and novel photonic integrated nonlinear platform like aluminum gallium arsenide nano-waveguides used for 1.28 Tbaud optical signal processing will be described....

  4. Traffic Signal Cycle Lengths

    Data.gov (United States)

    Town of Chapel Hill, North Carolina — Traffic signal location list for the town of Chapel Hill. This data set includes light cycle information as well as as intersection information.The Town of Chapel...

  5. Foundations of signal processing

    CERN Document Server

    Vetterli, Martin; Goyal, Vivek K

    2014-01-01

    This comprehensive and engaging textbook introduces the basic principles and techniques of signal processing, from the fundamental ideas of signals and systems theory to real-world applications. Students are introduced to the powerful foundations of modern signal processing, including the basic geometry of Hilbert space, the mathematics of Fourier transforms, and essentials of sampling, interpolation, approximation and compression. The authors discuss real-world issues and hurdles to using these tools, and ways of adapting them to overcome problems of finiteness and localisation, the limitations of uncertainty and computational costs. Standard engineering notation is used throughout, making mathematical examples easy for students to follow, understand and apply. It includes over 150 homework problems and over 180 worked examples, specifically designed to test and expand students' understanding of the fundamentals of signal processing, and is accompanied by extensive online materials designed to aid learning, ...

  6. Source of seismic signals

    Energy Technology Data Exchange (ETDEWEB)

    Frankovskii, B.A.; Khor' yakov, K.A.

    1980-08-30

    Patented is a source of seismic signals consisting of a shock generator with a basic low-voltage and auxillary high-voltage stator coils, a capacitive transformer and control switches. To increase the amplitude of signal excitation a condensor battery and auxillary commutator are introduced into the device, which are connected in parallel and serially into the circuit of the main low-voltage stator coil.

  7. Redox signaling in plants.

    Science.gov (United States)

    Foyer, Christine H; Noctor, Graham

    2013-06-01

    Our aim is to deliver an authoritative and challenging perspective of current concepts in plant redox signaling, focusing particularly on the complex interface between the redox and hormone-signaling pathways that allow precise control of plant growth and defense in response to metabolic triggers and environmental constraints and cues. Plants produce significant amounts of singlet oxygen and other reactive oxygen species (ROS) as a result of photosynthetic electron transport and metabolism. Such pathways contribute to the compartment-specific redox-regulated signaling systems in plant cells that convey information to the nucleus to regulate gene expression. Like the chloroplasts and mitochondria, the apoplast-cell wall compartment makes a significant contribution to the redox signaling network, but unlike these organelles, the apoplast has a low antioxidant-buffering capacity. The respective roles of ROS, low-molecular antioxidants, redox-active proteins, and antioxidant enzymes are considered in relation to the functions of plant hormones such as salicylic acid, jasmonic acid, and auxin, in the composite control of plant growth and defense. Regulation of redox gradients between key compartments in plant cells such as those across the plasma membrane facilitates flexible and multiple faceted opportunities for redox signaling that spans the intracellular and extracellular environments. In conclusion, plants are recognized as masters of the art of redox regulation that use oxidants and antioxidants as flexible integrators of signals from metabolism and the environment.

  8. Transient-Switch-Signal Suppressor

    Science.gov (United States)

    Bozeman, Richard J., Jr.

    1995-01-01

    Circuit delays transmission of switch-opening or switch-closing signal until after preset suppression time. Used to prevent transmission of undesired momentary switch signal. Basic mode of operation simple. Beginning of switch signal initiates timing sequence. If switch signal persists after preset suppression time, circuit transmits switch signal to external circuitry. If switch signal no longer present after suppression time, switch signal deemed transient, and circuit does not pass signal on to external circuitry, as though no transient switch signal. Suppression time preset at value large enough to allow for damping of underlying pressure wave or other mechanical transient.

  9. Digital Signal Processing applied to Physical Signals

    CERN Document Server

    Alberto, Diego; Musa, L

    2011-01-01

    It is well known that many of the scientific and technological discoveries of the XXI century will depend on the capability of processing and understanding a huge quantity of data. With the advent of the digital era, a fully digital and automated treatment can be designed and performed. From data mining to data compression, from signal elaboration to noise reduction, a processing is essential to manage and enhance features of interest after every data acquisition (DAQ) session. In the near future, science will go towards interdisciplinary research. In this work there will be given an example of the application of signal processing to different fields of Physics from nuclear particle detectors to biomedical examinations. In Chapter 1 a brief description of the collaborations that allowed this thesis is given, together with a list of the publications co-produced by the author in these three years. The most important notations, definitions and acronyms used in the work are also provided. In Chapter 2, the last r...

  10. Cellular signalling properties in microcircuits

    DEFF Research Database (Denmark)

    Toledo-Rodriguez, Maria; El Manira, Abdeljabbar; Wallén, Peter

    2005-01-01

    Molecules and cells are the signalling elements in microcircuits. Recent studies have uncovered bewildering diversity in postsynaptic signalling properties in all areas of the vertebrate nervous system. Major effort is now being invested in establishing the specialized signalling properties...

  11. VLSI signal processing technology

    CERN Document Server

    Swartzlander, Earl

    1994-01-01

    This book is the first in a set of forthcoming books focussed on state-of-the-art development in the VLSI Signal Processing area. It is a response to the tremendous research activities taking place in that field. These activities have been driven by two factors: the dramatic increase in demand for high speed signal processing, especially in consumer elec­ tronics, and the evolving microelectronic technologies. The available technology has always been one of the main factors in determining al­ gorithms, architectures, and design strategies to be followed. With every new technology, signal processing systems go through many changes in concepts, design methods, and implementation. The goal of this book is to introduce the reader to the main features of VLSI Signal Processing and the ongoing developments in this area. The focus of this book is on: • Current developments in Digital Signal Processing (DSP) pro­ cessors and architectures - several examples and case studies of existing DSP chips are discussed in...

  12. Signal integrity characterization techniques

    CERN Document Server

    Bogatin, Eric

    2009-01-01

    "Signal Integrity Characterization Techniques" addresses the gap between traditional digital and microwave curricula all while focusing on a practical and intuitive understanding of signal integrity effects within the data transmission channel. High-speed interconnects such as connectors, PCBs, cables, IC packages, and backplanes are critical elements of differential channels that must be designed using today's most powerful analysis and characterization tools.Both measurements and simulation must be done on the device under test, and both activities must yield data that correlates with each other. Most of this book focuses on real-world applications of signal integrity measurements - from backplane for design challenges to error correction techniques to jitter measurement technologies. The authors' approach wisely addresses some of these new high-speed technologies, and it also provides valuable insight into its future direction and will teach the reader valuable lessons on the industry.

  13. Quantum signaling game

    International Nuclear Information System (INIS)

    Frackiewicz, Piotr

    2014-01-01

    We present a quantum approach to a signaling game; a special kind of extensive game of incomplete information. Our model is based on quantum schemes for games in strategic form where players perform unitary operators on their own qubits of some fixed initial state and the payoff function is given by a measurement on the resulting final state. We show that the quantum game induced by our scheme coincides with a signaling game as a special case and outputs nonclassical results in general. As an example, we consider a quantum extension of the signaling game in which the chance move is a three-parameter unitary operator whereas the players' actions are equivalent to classical ones. In this case, we study the game in terms of Nash equilibria and refine the pure Nash equilibria adapting to the quantum game the notion of a weak perfect Bayesian equilibrium. (paper)

  14. PKD signaling and pancreatitis

    Science.gov (United States)

    Yuan, Jingzhen; Pandol, Stephen J.

    2016-01-01

    Background Acute pancreatitis is a serious medical disorder with no current therapies directed to the molecular pathogenesis of the disorder. Inflammation, inappropriate intracellular activation of digestive enzymes, and parenchymal acinar cell death by necrosis are the critical pathophysiologic processes of acute pancreatitis. Thus, it is necessary to elucidate the key molecular signals that mediate these pathobiologic processes and develop new therapeutic strategies to attenuate the appropriate signaling pathways in order to improve outcomes for this disease. A novel serine/threonine protein kinase D (PKD) family has emerged as key participants in signal transduction, and this family is increasingly being implicated in the regulation of multiple cellular functions and diseases. Methods This review summarizes recent findings of our group and others regarding the signaling pathway and the biological roles of the PKD family in pancreatic acinar cells. In particular, we highlight our studies of the functions of PKD in several key pathobiologic processes associated with acute pancreatitis in experimental models. Results Our findings reveal that PKD signaling is required for NF-κB activation/inflammation, intracellular zymogen activation, and acinar cell necrosis in rodent experimental pancreatitis. Novel small-molecule PKD inhibitors attenuate the severity of pancreatitis in both in vitro and in vivo experimental models. Further, this review emphasizes our latest advances in the therapeutic application of PKD inhibitors to experimental pancreatitis after the initiation of pancreatitis. Conclusions These novel findings suggest that PKD signaling is a necessary modulator in key initiating pathobiologic processes of pancreatitis, and that it constitutes a novel therapeutic target for treatments of this disorder. PMID:26879861

  15. Signal processing in microdosimetry

    International Nuclear Information System (INIS)

    Arbel, A.

    1984-01-01

    Signals occurring in microdosimetric measurements cover a dynamic range of 100 dB at a counting rate which normally stays below 10 4 but could increase significantly in case of an accident. The need for high resolution at low energies, non-linear signal processing to accommodate the specified dynamic range, easy calibration and thermal stability are conflicting requirements which pose formidable design problems. These problems are reviewed, and a practical approach to their solution is given employing a single processing channel. (author)

  16. Understanding signal integrity

    CERN Document Server

    Thierauf, Stephen C

    2010-01-01

    This unique book provides you with practical guidance on understanding and interpreting signal integrity (SI) performance to help you with your challenging circuit board design projects. You find high-level discussions of important SI concepts presented in a clear and easily accessible format, including question and answer sections and bulleted lists.This valuable resource features rules of thumb and simple equations to help you make estimates of critical signal integrity parameters without using circuit simulators of CAD (computer-aided design). The book is supported with over 120 illustratio

  17. Electronic signal conditioning

    CERN Document Server

    NEWBY, BRUCE

    1994-01-01

    At technician level, brief references to signal conditioning crop up in a fragmented way in various textbooks, but there has been no single textbook, until now!More advanced texts do exist but they are more mathematical and presuppose a higher level of understanding of electronics and statistics. Electronic Signal Conditioning is designed for HNC/D students and City & Guilds Electronics Servicing 2240 Parts 2 & 3. It will also be useful for BTEC National, Advanced GNVQ, A-level electronics and introductory courses at degree level.

  18. TOR signalling in plants.

    Science.gov (United States)

    Rexin, Daniel; Meyer, Christian; Robaglia, Christophe; Veit, Bruce

    2015-08-15

    Although the eukaryotic TOR (target of rapamycin) kinase signalling pathway has emerged as a key player for integrating nutrient-, energy- and stress-related cues with growth and metabolic outputs, relatively little is known of how this ancient regulatory mechanism has been adapted in higher plants. Drawing comparisons with the substantial knowledge base around TOR kinase signalling in fungal and animal systems, functional aspects of this pathway in plants are reviewed. Both conserved and divergent elements are discussed in relation to unique aspects associated with an autotrophic mode of nutrition and adaptive strategies for multicellular development exhibited by plants. © 2015 Authors; published by Portland Press Limited.

  19. Genomic signal processing

    CERN Document Server

    Shmulevich, Ilya

    2007-01-01

    Genomic signal processing (GSP) can be defined as the analysis, processing, and use of genomic signals to gain biological knowledge, and the translation of that knowledge into systems-based applications that can be used to diagnose and treat genetic diseases. Situated at the crossroads of engineering, biology, mathematics, statistics, and computer science, GSP requires the development of both nonlinear dynamical models that adequately represent genomic regulation, and diagnostic and therapeutic tools based on these models. This book facilitates these developments by providing rigorous mathema

  20. Television picture signal processing

    NARCIS (Netherlands)

    1998-01-01

    Field or frame memories are often used in television receivers for video signal processing functions, such as noise reduction and/or flicker reduction. Television receivers also have graphic features such as teletext, menu-driven control systems, multilingual subtitling, an electronic TV-Guide, etc.

  1. Signals: Applying Academic Analytics

    Science.gov (United States)

    Arnold, Kimberly E.

    2010-01-01

    Academic analytics helps address the public's desire for institutional accountability with regard to student success, given the widespread concern over the cost of higher education and the difficult economic and budgetary conditions prevailing worldwide. Purdue University's Signals project applies the principles of analytics widely used in…

  2. Communication Signals in Lizards.

    Science.gov (United States)

    Carpenter, Charles C.

    1983-01-01

    Discusses mechanisms and functional intent of visual communication signals in iguanid/agamid lizards. Demonstrated that lizards communicate with each other by using pushups and head nods and that each species does this in its own way, conveying different types of information. (JN)

  3. Modeling binaural signal detection

    NARCIS (Netherlands)

    Breebaart, D.J.

    2001-01-01

    With the advent of multimedia technology and powerful signal processing systems, audio processing and reproduction has gained renewed interest. Examples of products that have been developed are audio coding algorithms to efficiently store and transmit music and speech, or audio reproduction systems

  4. Quantum cloning and signaling

    International Nuclear Information System (INIS)

    Simon, C.; Weihs, G.; Zeilinger, A.

    1999-01-01

    We discuss the close connections between cloning of quantum states and superluminal signaling. We present an optimal universal cloning machine based on stimulated emission recently proposed by the authors. As an instructive example, we show how a scheme for superluminal communication based on this cloning machine fails. (Authors)

  5. "Utilizing" signal detection theory.

    Science.gov (United States)

    Lynn, Spencer K; Barrett, Lisa Feldman

    2014-09-01

    What do inferring what a person is thinking or feeling, judging a defendant's guilt, and navigating a dimly lit room have in common? They involve perceptual uncertainty (e.g., a scowling face might indicate anger or concentration, for which different responses are appropriate) and behavioral risk (e.g., a cost to making the wrong response). Signal detection theory describes these types of decisions. In this tutorial, we show how incorporating the economic concept of utility allows signal detection theory to serve as a model of optimal decision making, going beyond its common use as an analytic method. This utility approach to signal detection theory clarifies otherwise enigmatic influences of perceptual uncertainty on measures of decision-making performance (accuracy and optimality) and on behavior (an inverse relationship between bias magnitude and sensitivity optimizes utility). A "utilized" signal detection theory offers the possibility of expanding the phenomena that can be understood within a decision-making framework. © The Author(s) 2014.

  6. Critical nodes in signalling pathways

    DEFF Research Database (Denmark)

    Taniguchi, Cullen M; Emanuelli, Brice; Kahn, C Ronald

    2006-01-01

    Physiologically important cell-signalling networks are complex, and contain several points of regulation, signal divergence and crosstalk with other signalling cascades. Here, we use the concept of 'critical nodes' to define the important junctions in these pathways and illustrate their unique role...... using insulin signalling as a model system....

  7. Sinusoidal Representation of Acoustic Signals

    Science.gov (United States)

    Honda, Masaaki

    Sinusoidal representation of acoustic signals has been an important tool in speech and music processing like signal analysis, synthesis and time scale or pitch modifications. It can be applicable to arbitrary signals, which is an important advantage over other signal representations like physical modeling of acoustic signals. In sinusoidal representation, acoustic signals are composed as sums of sinusoid (sine wave) with different amplitudes, frequencies and phases, which is based on the timedependent short-time Fourier transform (STFT). This article describes the principles of acoustic signal analysis/synthesis based on a sinusoid representation with focus on sine waves with rapidly varying frequency.

  8. The newest digital signal processing

    International Nuclear Information System (INIS)

    Lee, Chae Uk

    2002-08-01

    This book deal with the newest digital signal processing, which contains introduction on conception of digital signal processing, constitution and purpose, signal and system such as signal, continuos signal, discrete signal and discrete system, I/O expression on impress response, convolution, mutual connection of system and frequency character,z transform of definition, range, application of z transform and relationship with laplace transform, Discrete fourier, Fast fourier transform on IDFT algorithm and FFT application, foundation of digital filter of notion, expression, types, frequency characteristic of digital filter and design order of filter, Design order of filter, Design of FIR digital filter, Design of IIR digital filter, Adaptive signal processing, Audio signal processing, video signal processing and application of digital signal processing.

  9. Variable reflectivity signal mirrors and signal response measurements

    International Nuclear Information System (INIS)

    Vine, Glenn de; Shaddock, Daniel A; McClelland, David E

    2002-01-01

    Future gravitational wave detectors will include some form of signal mirror in order to alter the signal response of the device. We introduce interferometer configurations which utilize a variable reflectivity signal mirror allowing a tunable peak frequency and variable signal bandwidth. A detector configured with a Fabry-Perot cavity as the signal mirror is compared theoretically with one using a Michelson interferometer for a signal mirror. A system for the measurement of the interferometer signal responses is introduced. This technique is applied to a power-recycled Michelson interferometer with resonant sideband extraction. We present broadband measurements of the benchtop prototype's signal response for a range of signal cavity detunings. This technique is also applicable to most other gravitational wave detector configurations

  10. Variable reflectivity signal mirrors and signal response measurements

    CERN Document Server

    Vine, G D; McClelland, D E

    2002-01-01

    Future gravitational wave detectors will include some form of signal mirror in order to alter the signal response of the device. We introduce interferometer configurations which utilize a variable reflectivity signal mirror allowing a tunable peak frequency and variable signal bandwidth. A detector configured with a Fabry-Perot cavity as the signal mirror is compared theoretically with one using a Michelson interferometer for a signal mirror. A system for the measurement of the interferometer signal responses is introduced. This technique is applied to a power-recycled Michelson interferometer with resonant sideband extraction. We present broadband measurements of the benchtop prototype's signal response for a range of signal cavity detunings. This technique is also applicable to most other gravitational wave detector configurations.

  11. Lymphocyte signaling: beyond knockouts.

    Science.gov (United States)

    Saveliev, Alexander; Tybulewicz, Victor L J

    2009-04-01

    The analysis of lymphocyte signaling was greatly enhanced by the advent of gene targeting, which allows the selective inactivation of a single gene. Although this gene 'knockout' approach is often informative, in many cases, the phenotype resulting from gene ablation might not provide a complete picture of the function of the corresponding protein. If a protein has multiple functions within a single or several signaling pathways, or stabilizes other proteins in a complex, the phenotypic consequences of a gene knockout may manifest as a combination of several different perturbations. In these cases, gene targeting to 'knock in' subtle point mutations might provide more accurate insight into protein function. However, to be informative, such mutations must be carefully based on structural and biophysical data.

  12. Sphingosine signaling and atherogenesis

    DEFF Research Database (Denmark)

    Xu, Cang-bao; Hansen-Schwartz, Jacob; Edvinsson, Lars

    2004-01-01

    Sphingosine-1-phosphate (S1P) has diverse biological functions acting inside cells as a second messenger to regulate cell proliferation and survival, and extracellularly, as a ligand for a group of G protein-coupled receptors (GPCRs) named the endothelial differentiation gene (EDG) family. Five...... closely related GPCRs of EDG family (EDG1, EDG3, EDG5, EDG6, and EDG8) have recently been identified as high-affinity S1P receptors. These receptors are coupled via Gi, Gq, G12/13, and Rho. The signaling pathways are linked to vascular cell migration, proliferation, apoptosis, intracellular Ca2......+ mobilization, and expression of adhesion molecules. The formation of an atherosclerotic lesion occurs through activation of cellular events that include monocyte adhesion to the endothelium and vascular smooth muscle cell (VSMC) migration and proliferation. Thus, S1P signaling may play an important role...

  13. NMR signal transducer

    International Nuclear Information System (INIS)

    Kucheryaev, A.G.; Oliferchuk, N.L.

    1975-01-01

    A signal transducer of nuclear magnetic resonance for simultaneously measuring frequency and intensitivity of two various isotope signals, which are in one specimen is described. The transducer represents radiofrequency circuit with two resonance frequences, which is common for two autodyne generators. To decrease measuring time and to increase recording diagram stability the radiofrequency circuit has LC netork, in the inductivity of which investigated specimen is located; a circuit variable capacity is connected in parallel with one of the autodyne generators. Besides the radiofrequency circuit has an inductance coil in series with a standard specimen inside as well as a variable capacitor connected in parallel with the second autodyne generator. An amplitude of oscillation of each resonance frequency is controlled and adjusted separately. The transducer described can be used for the measurement of a nuclei concentration, isotope concentration and for the spin determination

  14. Biomedical signal analysis

    CERN Document Server

    Rangayyan, Rangaraj M

    2015-01-01

    The book will help assist a reader in the development of techniques for analysis of biomedical signals and computer aided diagnoses with a pedagogical examination of basic and advanced topics accompanied by over 350 figures and illustrations. Wide range of filtering techniques presented to address various applications. 800 mathematical expressions and equations. Practical questions, problems and laboratory exercises. Includes fractals and chaos theory with biomedical applications.

  15. Calcium signaling in liver.

    Science.gov (United States)

    Gaspers, Lawrence D; Thomas, Andrew P

    2005-01-01

    In hepatocytes, hormones linked to the formation of the second messenger inositol 1,4,5-trisphosphate (InsP3) evoke transient increases or spikes in cytosolic free calcium ([Ca2+]i), that increase in frequency with the agonist concentration. These oscillatory Ca2+ signals are thought to transmit the information encoded in the extracellular stimulus to down-stream Ca2+-sensitive metabolic processes. We have utilized both confocal and wide field fluorescence microscopy techniques to study the InsP3-dependent signaling pathway at the cellular and subcellular levels in the intact perfused liver. Typically InsP3-dependent [Ca2+]i spikes manifest as Ca2+ waves that propagate throughout the entire cytoplasm and nucleus, and in the intact liver these [Ca2+]i increases are conveyed through gap junctions to encompass entire lobular units. The translobular movement of Ca2+ provides a means to coordinate the function of metabolic zones of the lobule and thus, liver function. In this article, we describe the characteristics of agonist-evoked [Ca2+]i signals in the liver and discuss possible mechanisms to explain the propagation of intercellular Ca2+ waves in the intact organ.

  16. Biomedical signal and image processing

    CERN Document Server

    Najarian, Kayvan

    2012-01-01

    INTRODUCTION TO DIGITAL SIGNAL AND IMAGE PROCESSINGSignals and Biomedical Signal ProcessingIntroduction and OverviewWhat is a ""Signal""?Analog, Discrete, and Digital SignalsProcessing and Transformation of SignalsSignal Processing for Feature ExtractionSome Characteristics of Digital ImagesSummaryProblemsFourier TransformIntroduction and OverviewOne-Dimensional Continuous Fourier TransformSampling and NYQUIST RateOne-Dimensional Discrete Fourier TransformTwo-Dimensional Discrete Fourier TransformFilter DesignSummaryProblemsImage Filtering, Enhancement, and RestorationIntroduction and Overview

  17. Signal multiplexing scheme for LINAC

    International Nuclear Information System (INIS)

    Sujo, C.I.; Mohan, Shyam; Joshi, Gopal; Singh, S.K.; Karande, Jitendra

    2004-01-01

    For the proper operation of the LINAC some signals, RF (radio frequency) as well as LF (low frequency) have to be available at the Master Control Station (MCS). These signals are needed to control, calibrate and characterize the RF fields in the resonators. This can be achieved by proper multiplexing of various signals locally and then routing the selected signals to the MCS. A multiplexing scheme has been designed and implemented, which will allow the signals from the selected cavity to the MCS. High isolation between channels and low insertion loss for a given signal are important issues while selecting the multiplexing scheme. (author)

  18. Pathophysiology of Glucocorticoid Signaling.

    Science.gov (United States)

    Vitellius, Géraldine; Trabado, Séverine; Bouligand, Jérôme; Delemer, Brigitte; Lombès, Marc

    2018-06-01

    Glucocorticoids (GC), such as cortisol or dexamethasone, control various physiological functions, notably those involved in development, metabolism, inflammatory processes and stress, and exert most of their effects upon binding to the glucocorticoid receptor (GR, encoded by NR3C1 gene). GC signaling follows several consecutive steps leading to target gene transactivation, including ligand binding, nuclear translocation of ligand-activated GR complexes, DNA binding, coactivator interaction and recruitment of functional transcriptional machinery. Any step may be impaired and may account for altered GC signaling. Partial or generalized glucocorticoid resistance syndrome may result in a reduced level of functional GR, a decreased hormone affinity and binding, a defect in nuclear GR translocation, a decrease or lack of DNA binding and/or post-transcriptional GR modifications. To date, 26 loss-of-function NR3C1 mutations have been reported in the context of hypertension, hirsutism, adrenal hyperplasia or metabolic disorders. These clinical signs are generally associated with biological features including hypercortisolism without negative regulatory feedback loop on the hypothalamic-pituitary-adrenal axis. Patients had often low plasma aldosterone and renin levels despite hypertension. Only one GR gain-of-function mutation has been described associating Cushing's syndrome phenotype with normal urinary-free cortisol. Some GR polymorphisms (ER22/23EK, GR-9β) have been linked to glucocorticoid resistance and a healthier metabolic profile whereas some others seemed to be associated with GC hypersensitivity (N363S, BclI), increasing cardiovascular risk (diabetes type 2, visceral obesity). This review focuses on the earlier findings on the pathophysiology of GR signaling and presents criteria facilitating identification of novel NR3C1 mutations in selected patients. Copyright © 2018 Elsevier Masson SAS. All rights reserved.

  19. Purinergic Signalling: Therapeutic Developments

    Directory of Open Access Journals (Sweden)

    Geoffrey Burnstock

    2017-09-01

    Full Text Available Purinergic signalling, i.e., the role of nucleotides as extracellular signalling molecules, was proposed in 1972. However, this concept was not well accepted until the early 1990’s when receptor subtypes for purines and pyrimidines were cloned and characterised, which includes four subtypes of the P1 (adenosine receptor, seven subtypes of P2X ion channel receptors and 8 subtypes of the P2Y G protein-coupled receptor. Early studies were largely concerned with the physiology, pharmacology and biochemistry of purinergic signalling. More recently, the focus has been on the pathophysiology and therapeutic potential. There was early recognition of the use of P1 receptor agonists for the treatment of supraventricular tachycardia and A2A receptor antagonists are promising for the treatment of Parkinson’s disease. Clopidogrel, a P2Y12 antagonist, is widely used for the treatment of thrombosis and stroke, blocking P2Y12 receptor-mediated platelet aggregation. Diquafosol, a long acting P2Y2 receptor agonist, is being used for the treatment of dry eye. P2X3 receptor antagonists have been developed that are orally bioavailable and stable in vivo and are currently in clinical trials for the treatment of chronic cough, bladder incontinence, visceral pain and hypertension. Antagonists to P2X7 receptors are being investigated for the treatment of inflammatory disorders, including neurodegenerative diseases. Other investigations are in progress for the use of purinergic agents for the treatment of osteoporosis, myocardial infarction, irritable bowel syndrome, epilepsy, atherosclerosis, depression, autism, diabetes, and cancer.

  20. Phonocardiography Signal Processing

    CERN Document Server

    Abbas, Abbas K

    2009-01-01

    The auscultation method is an important diagnostic indicator for hemodynamic anomalies. Heart sound classification and analysis play an important role in the auscultative diagnosis. The term phonocardiography refers to the tracing technique of heart sounds and the recording of cardiac acoustics vibration by means of a microphone-transducer. Therefore, understanding the nature and source of this signal is important to give us a tendency for developing a competent tool for further analysis and processing, in order to enhance and optimize cardiac clinical diagnostic approach. This book gives the

  1. Nichtperiodische zeitkontinuierliche Signale

    Science.gov (United States)

    Plaßmann, Wilfried

    Nichtperiodische Signale haben eine große Bedeutung für die Nachrichten- und Datenübertragung, weil Information nur in nichtdeterministischen Signalen enthalten ist (Teil "Nachrichtentechnik", Abschn. 92.4.1). Aber auch für die Energie- und Regelungstechnik sind sie von Interesse, weil sie entweder Ein- und Ausschaltvorgänge erfassen oder den Übergang von einem momentan stationären Zustand in einen neuen darstellen (Kurzschluss im Energieversorgungsnetz, Auftreten einer Störgröße im Regelsystem). Die Fourier- und die Laplacetransformation können bei nichtperiodischen zeitkontinuierlichen Signalen eingesetzt werden.

  2. Generation of earthquake signals

    International Nuclear Information System (INIS)

    Kjell, G.

    1994-01-01

    Seismic verification can be performed either as a full scale test on a shaker table or as numerical calculations. In both cases it is necessary to have an earthquake acceleration time history. This report describes generation of such time histories by filtering white noise. Analogue and digital filtering methods are compared. Different methods of predicting the response spectrum of a white noise signal filtered by a band-pass filter are discussed. Prediction of both the average response level and the statistical variation around this level are considered. Examples with both the IEEE 301 standard response spectrum and a ground spectrum suggested for Swedish nuclear power stations are included in the report

  3. Multiscale Signal Analysis and Modeling

    CERN Document Server

    Zayed, Ahmed

    2013-01-01

    Multiscale Signal Analysis and Modeling presents recent advances in multiscale analysis and modeling using wavelets and other systems. This book also presents applications in digital signal processing using sampling theory and techniques from various function spaces, filter design, feature extraction and classification, signal and image representation/transmission, coding, nonparametric statistical signal processing, and statistical learning theory. This book also: Discusses recently developed signal modeling techniques, such as the multiscale method for complex time series modeling, multiscale positive density estimations, Bayesian Shrinkage Strategies, and algorithms for data adaptive statistics Introduces new sampling algorithms for multidimensional signal processing Provides comprehensive coverage of wavelets with presentations on waveform design and modeling, wavelet analysis of ECG signals and wavelet filters Reviews features extraction and classification algorithms for multiscale signal and image proce...

  4. A Serpentine Way to Signaling

    Indian Academy of Sciences (India)

    IAS Admin

    the cell. The receptor transfers the signal to intracellular proteins ... and molecular mechanisms of GPCR signaling and how this discovery impacts ..... stabilize GPCR–G-protein interaction and resolve dynamics of ... elucidation stages. Kobilka.

  5. Biological signals classification and analysis

    CERN Document Server

    Kiasaleh, Kamran

    2015-01-01

    This authored monograph presents key aspects of signal processing analysis in the biomedical arena. Unlike wireless communication systems, biological entities produce signals with underlying nonlinear, chaotic nature that elude classification using the standard signal processing techniques, which have been developed over the past several decades for dealing primarily with standard communication systems. This book separates what is random from that which appears to be random, and yet is truly deterministic with random appearance. At its core, this work gives the reader a perspective on biomedical signals and the means to classify and process such signals. In particular, a review of random processes along with means to assess the behavior of random signals is also provided. The book also includes a general discussion of biological signals in order to demonstrate the inefficacy of the well-known techniques to correctly extract meaningful information from such signals. Finally, a thorough discussion of recently ...

  6. Two-dimensional signal analysis

    CERN Document Server

    Garello, René

    2010-01-01

    This title sets out to show that 2-D signal analysis has its own role to play alongside signal processing and image processing.Concentrating its coverage on those 2-D signals coming from physical sensors (such as radars and sonars), the discussion explores a 2-D spectral approach but develops the modeling of 2-D signals and proposes several data-oriented analysis techniques for dealing with them. Coverage is also given to potential future developments in this area.

  7. Wireless data signal transmission system

    DEFF Research Database (Denmark)

    2014-01-01

    The present invention relates to a method for providing a radio frequency signal for transmission, a system for providing a radio frequency signal for transmission and a method for wireless data transmission between a transmitter and a receiver.......The present invention relates to a method for providing a radio frequency signal for transmission, a system for providing a radio frequency signal for transmission and a method for wireless data transmission between a transmitter and a receiver....

  8. Astrocytes in endocannabinoid signalling.

    Science.gov (United States)

    Navarrete, Marta; Díez, Adolfo; Araque, Alfonso

    2014-10-19

    Astrocytes are emerging as integral functional components of synapses, responding to synaptically released neurotransmitters and regulating synaptic transmission and plasticity. Thus, they functionally interact with neurons establishing tripartite synapses: a functional concept that refers to the existence of communication between astrocytes and neurons and its crucial role in synaptic function. Here, we discuss recent evidence showing that astrocytes are involved in the endocannabinoid (ECB) system, responding to exogenous cannabinoids as well as ECBs through activation of type 1 cannabinoid receptors, which increase intracellular calcium and stimulate the release of glutamate that modulates synaptic transmission and plasticity. We also discuss the consequences of ECB signalling in tripartite synapses on the astrocyte-mediated regulation of synaptic function, which reveal novel properties of synaptic regulation by ECBs, such as the spatially controlled dual effect on synaptic strength and the lateral potentiation of synaptic efficacy. Finally, we discuss the potential implications of ECB signalling for astrocytes in brain pathology and animal behaviour. © 2014 The Author(s) Published by the Royal Society. All rights reserved.

  9. Salicylic acid signaling inhibits apoplastic reactive oxygen species signaling.

    Science.gov (United States)

    Xu, Enjun; Brosché, Mikael

    2014-06-04

    Reactive oxygen species (ROS) are used by plants as signaling molecules during stress and development. Given the amount of possible challenges a plant face from their environment, plants need to activate and prioritize between potentially conflicting defense signaling pathways. Until recently, most studies on signal interactions have focused on phytohormone interaction, such as the antagonistic relationship between salicylic acid (SA)-jasmonic acid and cytokinin-auxin. In this study, we report an antagonistic interaction between SA signaling and apoplastic ROS signaling. Treatment with ozone (O3) leads to a ROS burst in the apoplast and induces extensive changes in gene expression and elevation of defense hormones. However, Arabidopsis thaliana dnd1 (defense no death1) exhibited an attenuated response to O3. In addition, the dnd1 mutant displayed constitutive expression of defense genes and spontaneous cell death. To determine the exact process which blocks the apoplastic ROS signaling, double and triple mutants involved in various signaling pathway were generated in dnd1 background. Simultaneous elimination of SA-dependent and SA-independent signaling components from dnd1 restored its responsiveness to O3. Conversely, pre-treatment of plants with SA or using mutants that constitutively activate SA signaling led to an attenuation of changes in gene expression elicited by O3. Based upon these findings, we conclude that plants are able to prioritize the response between ROS and SA via an antagonistic action of SA and SA signaling on apoplastic ROS signaling.

  10. Signals and systems for dummies

    CERN Document Server

    Wickert, Mark

    2013-01-01

    Getting mixed signals in your signals and systems course? The concepts covered in a typical signals and systems course are often considered by engineering students to be some of the most difficult to master. Thankfully, Signals & Systems For Dummies is your intuitive guide to this tricky course, walking you step-by-step through some of the more complex theories and mathematical formulas in a way that is easy to understand. From Laplace Transforms to Fourier Analyses, Signals & Systems For Dummies explains in plain English the difficult concepts that can trip you up

  11. Detection of signals in noise

    CERN Document Server

    Whalen, Anthony D; Declaris, Nicholas

    1971-01-01

    Detection of Signals in Noise serves as an introduction to the principles and applications of the statistical theory of signal detection. The book discusses probability and random processes; narrowband signals, their complex representation, and their properties described with the aid of the Hilbert transform; and Gaussian-derived processes. The text also describes the application of hypothesis testing for the detection of signals and the fundamentals required for statistical detection of signals in noise. Problem exercises, references, and a supplementary bibliography are included after each c

  12. Multimodal signal variation in space and time : how important is matching a signal with its signaler?

    OpenAIRE

    Taylor, Ryan C.; Klein, Barrett; Stein, Joey; Ryan, Michael J.

    2011-01-01

    Multimodal signals (acoustic+visual) are known to be used by many anuran amphibians during courtship displays. The relative degree to which each signal component influences female mate choice, however, remains poorly understood. In this study we used a robotic frog with an inflating vocal sac and acoustic playbacks to document responses of female túngara frogs to unimodal signal components (acoustic and visual). We then tested female responses to a synchronous multimodal signal. Finally, we t...

  13. Purinergic signalling and diabetes

    DEFF Research Database (Denmark)

    Burnstock, Geoffrey; Novak, Ivana

    2013-01-01

    , and common and divergent roles of receptors for nucleotides and nucleosides in different organ systems will be given. This integrated picture will aid our understanding of the challenges of the potential and currently used drugs targeted to specific organ/cells or disorders associated with diabetes.......The pancreas is an organ with a central role in nutrient breakdown, nutrient sensing and release of hormones regulating whole body nutrient homeostasis. In diabetes mellitus, the balance is broken-cells can be starving in the midst of plenty. There are indications that the incidence of diabetes...... type 1 and 2, and possibly pancreatogenic diabetes, is rising globally. Events leading to insulin secretion and action are complex, but there is emerging evidence that intracellular nucleotides and nucleotides are not only important as intracellular energy molecules but also as extracellular signalling...

  14. Machine intelligence and signal processing

    CERN Document Server

    Vatsa, Mayank; Majumdar, Angshul; Kumar, Ajay

    2016-01-01

    This book comprises chapters on key problems in machine learning and signal processing arenas. The contents of the book are a result of a 2014 Workshop on Machine Intelligence and Signal Processing held at the Indraprastha Institute of Information Technology. Traditionally, signal processing and machine learning were considered to be separate areas of research. However in recent times the two communities are getting closer. In a very abstract fashion, signal processing is the study of operator design. The contributions of signal processing had been to device operators for restoration, compression, etc. Applied Mathematicians were more interested in operator analysis. Nowadays signal processing research is gravitating towards operator learning – instead of designing operators based on heuristics (for example wavelets), the trend is to learn these operators (for example dictionary learning). And thus, the gap between signal processing and machine learning is fast converging. The 2014 Workshop on Machine Intel...

  15. Concept and design of a UAS-based platform for measurements of RF signal-in-space

    Science.gov (United States)

    Schrader, Thorsten; Bredemeyer, Jochen; Mihalachi, Marius; Rohde, Jan; Kleine-Ostmann, Thomas

    2016-09-01

    Field strength or signal-in-space (SIS) measurements have been performed by using manned helicopters, aircrafts or from ground level using extendable masts. With the availability of unmanned aerial systems (UAS) such as multicopters a new versatile platform for SIS measurements is deployable. Larger types show up to eight individually driven electric motors and controllers (therefore called octocopter). They provide the ability to fly along predefined traces, to hover at waypoints and to initiate other actions when those have been reached. They provide self-levelling and stabilisation and moreover, they may gear at a point of interest regardless of their actual position, e.g. during their flight around a tower. Their payload mainly depends on the platform size and allows integration of complex measurement equipment. Upgrading their navigation capabilities including state-of-the-art global navigation satellite system (GNSS) and ground station transmitter (real-time kinematic - RTK) enables precise localisation of the UAS. For operation in electromagnetic harsh environments a shielding can be considered and integrated into the concept. This paper describes concept and design of an octocopter and its instrumentation, along with applications in recent projects, in which we measure and validate terrestrial navigation systems applied in air traffic and the weather forecast services. Among those are instrumentation landing systems (ILS), VHF omnidirectional radio ranges (VOR), airport traffic and weather radars as well as military surveillance radars, and UHF wind profilers. Especially to investigate the possible interaction of VORs and radars with single wind turbines (WT) or wind power plants has become a major request of economy, military and politics. Here, UAS can be deployed to deliver measurement data investigating this interaction. Once developed and setup to a certain extent, UAS are easy and cost-efficient to operate. Nonetheless, due to their compact size, UAS

  16. Wavelet analysis for nonstationary signals

    International Nuclear Information System (INIS)

    Penha, Rosani Maria Libardi da

    1999-01-01

    Mechanical vibration signals play an important role in anomalies identification resulting of equipment malfunctioning. Traditionally, Fourier spectral analysis is used where the signals are assumed to be stationary. However, occasional transient impulses and start-up process are examples of nonstationary signals that can be found in mechanical vibrations. These signals can provide important information about the equipment condition, as early fault detection. The Fourier analysis can not adequately be applied to nonstationary signals because the results provide data about the frequency composition averaged over the duration of the signal. In this work, two methods for nonstationary signal analysis are used: Short Time Fourier Transform (STFT) and wavelet transform. The STFT is a method of adapting Fourier spectral analysis for nonstationary application to time-frequency domain. To have a unique resolution throughout the entire time-frequency domain is its main limitation. The wavelet transform is a new analysis technique suitable to nonstationary signals, which handles the STFT drawbacks, providing multi-resolution frequency analysis and time localization in a unique time-scale graphic. The multiple frequency resolutions are obtained by scaling (dilatation/compression) the wavelet function. A comparison of the conventional Fourier transform, STFT and wavelet transform is made applying these techniques to: simulated signals, arrangement rotor rig vibration signal and rotate machine vibration signal Hanning window was used to STFT analysis. Daubechies and harmonic wavelets were used to continuos, discrete and multi-resolution wavelet analysis. The results show the Fourier analysis was not able to detect changes in the signal frequencies or discontinuities. The STFT analysis detected the changes in the signal frequencies, but with time-frequency resolution problems. The wavelet continuos and discrete transform demonstrated to be a high efficient tool to detect

  17. Seismic signals hard clipping overcoming

    Science.gov (United States)

    Olszowa, Paula; Sokolowski, Jakub

    2018-01-01

    In signal processing the clipping is understand as the phenomenon of limiting the signal beyond certain threshold. It is often related to overloading of a sensor. Two particular types of clipping are being recognized: soft and hard. Beyond the limiting value soft clipping reduces the signal real gain while the hard clipping stiffly sets the signal values at the limit. In both cases certain amount of signal information is lost. Obviously if one possess the model which describes the considered signal and the threshold value (which might be slightly more difficult to obtain in the soft clipping case), the attempt of restoring the signal can be made. Commonly it is assumed that the seismic signals take form of an impulse response of some specific system. This may lead to belief that the sine wave may be the most appropriate to fit in the clipping period. However, this should be tested. In this paper the possibility of overcoming the hard clipping in seismic signals originating from a geoseismic station belonging to an underground mine is considered. A set of raw signals will be hard-clipped manually and then couple different functions will be fitted and compared in terms of least squares. The results will be then analysed.

  18. Pleiotrophin Signaling Through PTNR in Breast Cancer

    National Research Council Canada - National Science Library

    Powers, Ciaron

    2001-01-01

    ... of intracellular signaling cascades. The pleiotrophin signaling pathway is known to be important in angiogenesis and breast cancer growth, but the exact mechanisms of pleiotrophin signaling remain undefined...

  19. Digitally programmable signal generator

    International Nuclear Information System (INIS)

    Priatko, G.J.; Kaskey, J.A.

    1988-01-01

    A digitally programmable signal generator (DPSG) includes a first memory from which data is written into a second memory formed of n banks. Each bank includes four memories and a multiplexer, the banks being read once during each time frame, the read-out bits being multiplexed and fed out serially in synchronism with a plurality of clock pulses occuring during a time frame. The resulting serial bit streams may be fed in parallel to a digital-to-analog converter. The DPSG can be used in applications such as Atomic Vapor Laser Isotope Separation (AVLIS) to create an optimal match between the process laser's spectral profile and that of the vaporized material, optical telecommunications, non-optical telecommunication in the microwave and radio spectrum, radar, electronic countermeasures, high speed computer interconnects, local area networks, high definition video transport and the multiplexing of large quantities of slow digital memory into high speed data streams. This invention extends the operation of DPSGs into the GHz range. (author)

  20. Volcanic signals in oceans

    KAUST Repository

    Stenchikov, Georgiy L.

    2009-08-22

    Sulfate aerosols resulting from strong volcanic explosions last for 2–3 years in the lower stratosphere. Therefore it was traditionally believed that volcanic impacts produce mainly short-term, transient climate perturbations. However, the ocean integrates volcanic radiative cooling and responds over a wide range of time scales. The associated processes, especially ocean heat uptake, play a key role in ongoing climate change. However, they are not well constrained by observations, and attempts to simulate them in current climate models used for climate predictions yield a range of uncertainty. Volcanic impacts on the ocean provide an independent means of assessing these processes. This study focuses on quantification of the seasonal to multidecadal time scale response of the ocean to explosive volcanism. It employs the coupled climate model CM2.1, developed recently at the National Oceanic and Atmospheric Administration\\'s Geophysical Fluid Dynamics Laboratory, to simulate the response to the 1991 Pinatubo and the 1815 Tambora eruptions, which were the largest in the 20th and 19th centuries, respectively. The simulated climate perturbations compare well with available observations for the Pinatubo period. The stronger Tambora forcing produces responses with higher signal-to-noise ratio. Volcanic cooling tends to strengthen the Atlantic meridional overturning circulation. Sea ice extent appears to be sensitive to volcanic forcing, especially during the warm season. Because of the extremely long relaxation time of ocean subsurface temperature and sea level, the perturbations caused by the Tambora eruption could have lasted well into the 20th century.

  1. Multimodal signalling in estrildid finches

    DEFF Research Database (Denmark)

    Gomes, A. C. R.; Funghi, C.; Soma, M.

    2017-01-01

    Sexual traits (e.g. visual ornaments, acoustic signals, courtship behaviour) are often displayed together as multimodal signals. Some hypotheses predict joint evolution of different sexual signals (e.g. to increase the efficiency of communication) or that different signals trade off with each other...... (e.g. due to limited resources). Alternatively, multiple signals may evolve independently for different functions, or to communicate different information (multiple message hypothesis). We evaluated these hypotheses with a comparative study in the family Estrildidae, one of the largest songbird...... compromise, but generally courtship dance also evolved independently from other signals. Instead of correlated evolution, we found that song, dance and colour are each related to different socio-ecological traits. Song complexity evolved together with ecological generalism, song performance with investment...

  2. Fundamentals of statistical signal processing

    CERN Document Server

    Kay, Steven M

    1993-01-01

    A unified presentation of parameter estimation for those involved in the design and implementation of statistical signal processing algorithms. Covers important approaches to obtaining an optimal estimator and analyzing its performance; and includes numerous examples as well as applications to real- world problems. MARKETS: For practicing engineers and scientists who design and analyze signal processing systems, i.e., to extract information from noisy signals — radar engineer, sonar engineer, geophysicist, oceanographer, biomedical engineer, communications engineer, economist, statistician, physicist, etc.

  3. Semi-classical signal analysis

    KAUST Repository

    Laleg-Kirati, Taous-Meriem

    2012-09-30

    This study introduces a new signal analysis method, based on a semi-classical approach. The main idea in this method is to interpret a pulse-shaped signal as a potential of a Schrödinger operator and then to use the discrete spectrum of this operator for the analysis of the signal. We present some numerical examples and the first results obtained with this method on the analysis of arterial blood pressure waveforms. © 2012 Springer-Verlag London Limited.

  4. Signal generation in gas detectors

    International Nuclear Information System (INIS)

    Stillman, A.

    1993-01-01

    This tutorial describes the generation of electrical signals in gas detectors. Ionization of the gas by the passage of charged particles generates these signals. Starting with the Bethe-Bloch equation, the treatment is a general introduction to the production of ion-pairs in gas devices. I continue with the characterization of the ionization as an electrical signal, and calculate the signal current in a simple example. Another example demonstrates the effect of space charge on the design of a detector. The AGS Booster ionization profile monitor is a model for this calculation

  5. Paracrine signaling in a bacterium.

    Science.gov (United States)

    López, Daniel; Vlamakis, Hera; Losick, Richard; Kolter, Roberto

    2009-07-15

    Cellular differentiation is triggered by extracellular signals that cause target cells to adopt a particular fate. Differentiation in bacteria typically involves autocrine signaling in which all cells in the population produce and respond to the same signal. Here we present evidence for paracrine signaling in bacterial populations-some cells produce a signal to which only certain target cells respond. Biofilm formation in Bacillus involves two centrally important signaling molecules, ComX and surfactin. ComX triggers the production of surfactin. In turn, surfactin causes a subpopulation of cells to produce an extracellular matrix. Cells that produced surfactin were themselves unable to respond to it. Likewise, once surfactin-responsive cells commenced matrix production, they no longer responded to ComX and could not become surfactin producers. Insensitivity to ComX was the consequence of the extracellular matrix as mutant cells unable to make matrix responded to both ComX and surfactin. Our results demonstrate that extracellular signaling was unidirectional, with one subpopulation producing a signal and a different subpopulation responding to it. Paracrine signaling in a bacterial population ensures the maintenance, over generations, of particular cell types even in the presence of molecules that would otherwise cause those cells to differentiate into other cell types.

  6. The Evolution of Covert Signaling.

    Science.gov (United States)

    Smaldino, Paul E; Flamson, Thomas J; McElreath, Richard

    2018-03-20

    Human sociality depends upon the benefits of mutual aid and extensive communication. However, diverse norms and preferences complicate mutual aid, and ambiguity in meaning hinders communication. Here we demonstrate that these two problems can work together to enhance cooperation through the strategic use of deliberately ambiguous signals: covert signaling. Covert signaling is the transmission of information that is accurately received by its intended audience but obscured when perceived by others. Such signals may allow coordination and enhanced cooperation while also avoiding the alienation or hostile reactions of individuals with different preferences. Although the empirical literature has identified potential mechanisms of covert signaling, such as encryption in humor, there is to date no formal theory of its dynamics. We introduce a novel mathematical model to assess when a covert signaling strategy will evolve, as well as how receiver attitudes coevolve with covert signals. Covert signaling plausibly serves an important function in facilitating within-group cooperative assortment by allowing individuals to pair up with similar group members when possible and to get along with dissimilar ones when necessary. This mechanism has broad implications for theories of signaling and cooperation, humor, social identity, political psychology, and the evolution of human cultural complexity.

  7. Signal anomaly detection and characterization

    International Nuclear Information System (INIS)

    Morgenstern, V.M.; Upadhyaya, B.R.; Gloeckler, O.

    1988-08-01

    As part of a comprehensive signal validation system, we have developed a signal anomaly detector, without specifically establishing the cause of the anomaly. A signal recorded from process instrumentation is said to have an anomaly, if during steady-state operation, the deviation in the level of the signal, its root-mean-square (RMS) value, or its statistical distribution changes by a preset value. This deviation could be an unacceptable increase or a decrease in the quantity being monitored. An anomaly in a signal may be characterized by wideband or single-frequency noise, bias error, pulse-type error, nonsymmetric behavior, or a change in the signal bandwidth. Various signatures can be easily computed from data samples and compared against specified threshold values. We want to point out that in real processes, pulses can appear with different time widths, and at different rates of change of the signal. Thus, in characterizing an anomaly as a pulse-type, the fastest pulse width is constrained by the signal sampling interval. For example, if a signal is sampled at 100 Hz, we will not be able to detect pulses occurring at kHz rates. Discussion with utility and Combustion Engineering personnel indicated that it is not practical to detect pulses having a narrow time width. 9 refs., 11 figs., 8 tabs

  8. Thermal resonance in signal transmission

    International Nuclear Information System (INIS)

    Reigada, Ramon; Sarmiento, Antonio; Lindenberg, Katja

    2001-01-01

    We use temperature tuning to control signal propagation in simple one-dimensional arrays of masses connected by hard anharmonic springs and with no local potentials. In our numerical model a sustained signal is applied at one site of a chain immersed in a thermal environment and the signal-to-noise ratio is measured at each oscillator. We show that raising the temperature can lead to enhanced signal propagation along the chain, resulting in thermal resonance effects akin to the resonance observed in arrays of bistable systems

  9. Thermal resonance in signal transmission

    Energy Technology Data Exchange (ETDEWEB)

    Reigada, Ramon; Sarmiento, Antonio; Lindenberg, Katja

    2001-06-01

    We use temperature tuning to control signal propagation in simple one-dimensional arrays of masses connected by hard anharmonic springs and with no local potentials. In our numerical model a sustained signal is applied at one site of a chain immersed in a thermal environment and the signal-to-noise ratio is measured at each oscillator. We show that raising the temperature can lead to enhanced signal propagation along the chain, resulting in thermal resonance effects akin to the resonance observed in arrays of bistable systems.

  10. Smoke Signal or Smoke Screen?

    DEFF Research Database (Denmark)

    Vergne, Jean-Philippe; Wernicke, Georg; Brenner, Steffen

    This paper explains the amount of disapproval faced by firms that overpay their CEO by integrating signaling and categorization theories. We argue that, in contexts characterized by intense scrutiny, ambivalent signals sent by firms suspend categorization by stakeholders, leading to further disap...

  11. Signals and systems with MATLAB

    CERN Document Server

    Yang, Won Young; Song, Ik H; Cho, Yong S

    2009-01-01

    Covers some of the theoretical foundations and mathematical derivations that can be used in higher-level related subjects such as signal processing, communication, and control, minimizing the mathematical difficulty and computational burden. This book illustrates the usage of MATLAB and Simulink for signal and system analysis and design.

  12. Signaling equilibria in sensorimotor interactions.

    Science.gov (United States)

    Leibfried, Felix; Grau-Moya, Jordi; Braun, Daniel A

    2015-08-01

    Although complex forms of communication like human language are often assumed to have evolved out of more simple forms of sensorimotor signaling, less attention has been devoted to investigate the latter. Here, we study communicative sensorimotor behavior of humans in a two-person joint motor task where each player controls one dimension of a planar motion. We designed this joint task as a game where one player (the sender) possesses private information about a hidden target the other player (the receiver) wants to know about, and where the sender's actions are costly signals that influence the receiver's control strategy. We developed a game-theoretic model within the framework of signaling games to investigate whether subjects' behavior could be adequately described by the corresponding equilibrium solutions. The model predicts both separating and pooling equilibria, in which signaling does and does not occur respectively. We observed both kinds of equilibria in subjects and found that, in line with model predictions, the propensity of signaling decreased with increasing signaling costs and decreasing uncertainty on the part of the receiver. Our study demonstrates that signaling games, which have previously been applied to economic decision-making and animal communication, provide a framework for human signaling behavior arising during sensorimotor interactions in continuous and dynamic environments. Copyright © 2015 Elsevier B.V. All rights reserved.

  13. Noisy signaling: theory and experiment

    NARCIS (Netherlands)

    de Haan, T.; Offerman, T.; Sloof, R.

    2011-01-01

    We introduce noise in the signaling technology of an otherwise standard wasteful signaling model (Spence, 1973). We theoretically derive the properties of the equilibria under different levels of noise and we experimentally test how behavior changes with noise. We obtain three main insights. First,

  14. Signals in Communication Engineering History

    Science.gov (United States)

    Consonni, Denise; Silva, Magno T. M.

    2010-01-01

    This paper is a study of various electric signals, which have been employed throughout the history of communication engineering in its two main landmarks: the telegraph and the telephone. The signals are presented in their time and frequency domain representations. The historical order has been followed in the presentation: wired systems, spark…

  15. Non-Smad signaling pathways.

    Science.gov (United States)

    Mu, Yabing; Gudey, Shyam Kumar; Landström, Maréne

    2012-01-01

    Transforming growth factor-beta (TGFβ) is a key regulator of cell fate during embryogenesis and has also emerged as a potent driver of the epithelial-mesenchymal transition during tumor progression. TGFβ signals are transduced by transmembrane type I and type II serine/threonine kinase receptors (TβRI and TβRII, respectively). The activated TβR complex phosphorylates Smad2 and Smad3, converting them into transcriptional regulators that complex with Smad4. TGFβ also uses non-Smad signaling pathways such as the p38 and Jun N-terminal kinase (JNK) mitogen-activated protein kinase (MAPK) pathways to convey its signals. Ubiquitin ligase tumor necrosis factor (TNF)-receptor-associated factor 6 (TRAF6) and TGFβ-associated kinase 1 (TAK1) have recently been shown to be crucial for the activation of the p38 and JNK MAPK pathways. Other TGFβ-induced non-Smad signaling pathways include the phosphoinositide 3-kinase-Akt-mTOR pathway, the small GTPases Rho, Rac, and Cdc42, and the Ras-Erk-MAPK pathway. Signals induced by TGFβ are tightly regulated and specified by post-translational modifications of the signaling components, since they dictate the subcellular localization, activity, and duration of the signal. In this review, we discuss recent findings in the field of TGFβ-induced responses by non-Smad signaling pathways.

  16. Signal analysis of ventricular fibrillation

    NARCIS (Netherlands)

    Herbschleb, J.N.; Heethaar, R.M.; Tweel, L.H. van der; Zimmerman, A.N.E.; Meijler, F.L.

    Signal analysis of electro(cardio)grams during ventricular fibrillation (VF) in dogs and human patients indicates more organization and regularity than the official WHO definition suggests. The majority of the signal is characterized by a power spectrum with narrow, equidistant peaks. In a further

  17. Semi-classical signal analysis

    KAUST Repository

    Laleg-Kirati, Taous-Meriem; Cré peau, Emmanuelle; Sorine, Michel

    2012-01-01

    This study introduces a new signal analysis method, based on a semi-classical approach. The main idea in this method is to interpret a pulse-shaped signal as a potential of a Schrödinger operator and then to use the discrete spectrum

  18. Signaling a Change of Heart

    DEFF Research Database (Denmark)

    Schumacher, Gijs

    2011-01-01

    introduced welfare state retrenchment measures. Social Democrats can win votes and join coalitions by shifting rightwards. In contrast, they can pursue policy objectives by shifting leftwards. To communicate these shifts, in other words, ‘changes of heart’, parties send signals to voters and other parties...... after having signalled ‘a change of heart’....

  19. Intracellular signal modulation by nanomaterials.

    Science.gov (United States)

    Hussain, Salik; Garantziotis, Stavros; Rodrigues-Lima, Fernando; Dupret, Jean-Marie; Baeza-Squiban, Armelle; Boland, Sonja

    2014-01-01

    A thorough understanding of the interactions of nanomaterials with biological systems and the resulting activation of signal transduction pathways is essential for the development of safe and consumer friendly nanotechnology. Here we present an overview of signaling pathways induced by nanomaterial exposures and describe the possible correlation of their physicochemical characteristics with biological outcomes. In addition to the hierarchical oxidative stress model and a review of the intrinsic and cell-mediated mechanisms of reactive oxygen species (ROS) generating capacities of nanomaterials, we also discuss other oxidative stress dependent and independent cellular signaling pathways. Induction of the inflammasome, calcium signaling, and endoplasmic reticulum stress are reviewed. Furthermore, the uptake mechanisms can be of crucial importance for the cytotoxicity of nanomaterials and membrane-dependent signaling pathways have also been shown to be responsible for cellular effects of nanomaterials. Epigenetic regulation by nanomaterials, effects of nanoparticle-protein interactions on cell signaling pathways, and the induction of various cell death modalities by nanomaterials are described. We describe the common trigger mechanisms shared by various nanomaterials to induce cell death pathways and describe the interplay of different modalities in orchestrating the final outcome after nanomaterial exposures. A better understanding of signal modulations induced by nanomaterials is not only essential for the synthesis and design of safer nanomaterials but will also help to discover potential nanomedical applications of these materials. Several biomedical applications based on the different signaling pathways induced by nanomaterials are already proposed and will certainly gain a great deal of attraction in the near future.

  20. Algebraic Methods to Design Signals

    Science.gov (United States)

    2015-08-27

    to date on designing signals using algebraic and combinatorial methods. Mathematical tools from algebraic number theory, representation theory and... combinatorial objects in designing signals for communication purposes. Sequences and arrays with desirable autocorrelation properties have many...multiple access methods in mobile radio communication systems. We continue our mathematical framework based on group algebras, character theory

  1. Hippo signalling directs intestinal fate

    DEFF Research Database (Denmark)

    le Bouteiller, Marie Catherine M; Jensen, Kim Bak

    2015-01-01

    Hippo signalling has been associated with many important tissue functions including the regulation of organ size. In the intestinal epithelium differing functions have been proposed for the effectors of Hippo signalling, YAP and TAZ1. These are now shown to have a dual role in the intestinal...

  2. Signal processing for radiation detectors

    CERN Document Server

    Nakhostin, Mohammad

    2018-01-01

    This book provides a clear understanding of the principles of signal processing of radiation detectors. It puts great emphasis on the characteristics of pulses from various types of detectors and offers a full overview on the basic concepts required to understand detector signal processing systems and pulse processing techniques. Signal Processing for Radiation Detectors covers all of the important aspects of signal processing, including energy spectroscopy, timing measurements, position-sensing, pulse-shape discrimination, and radiation intensity measurement. The book encompasses a wide range of applications so that readers from different disciplines can benefit from all of the information. In addition, this resource: * Describes both analog and digital techniques of signal processing * Presents a complete compilation of digital pulse processing algorithms * Extrapolates content from more than 700 references covering classic papers as well as those of today * Demonstrates concepts with more than 340 origin...

  3. Aberrant Signaling Pathways in Glioma

    International Nuclear Information System (INIS)

    Nakada, Mitsutoshi; Kita, Daisuke; Watanabe, Takuya; Hayashi, Yutaka; Teng, Lei; Pyko, Ilya V.; Hamada, Jun-Ichiro

    2011-01-01

    Glioblastoma multiforme (GBM), a WHO grade IV malignant glioma, is the most common and lethal primary brain tumor in adults; few treatments are available. Median survival rates range from 12–15 months. The biological characteristics of this tumor are exemplified by prominent proliferation, active invasiveness, and rich angiogenesis. This is mainly due to highly deregulated signaling pathways in the tumor. Studies of these signaling pathways have greatly increased our understanding of the biology and clinical behavior of GBM. An integrated view of signal transduction will provide a more useful approach in designing novel therapies for this devastating disease. In this review, we summarize the current understanding of GBM signaling pathways with a focus on potential molecular targets for anti-signaling molecular therapies

  4. Coupled Research in Ocean Acoustics and Signal Processing for the Next Generation of Underwater Acoustic Communication Systems

    Science.gov (United States)

    2016-08-05

    the analysis of data collected during the VHF acoustics test con - ducted in a wave tank at the Scripps Institution of Oceanography in October 2015...a first look at the statistics, the Scintillation Index (traditional narrowband def - inition) was calculated as a function of arrival delay and wind

  5. Quorum Quenching Revisited—From Signal Decays to Signalling Confusion

    Directory of Open Access Journals (Sweden)

    Kok-Gan Chan

    2012-04-01

    Full Text Available In a polymicrobial community, while some bacteria are communicating with neighboring cells (quorum sensing, others are interrupting the communication (quorum quenching, thus creating a constant arms race between intercellular communication. In the past decade, numerous quorum quenching enzymes have been found and initially thought to inactivate the signalling molecules. Though this is widely accepted, the actual roles of these quorum quenching enzymes are now being uncovered. Recent evidence extends the role of quorum quenching to detoxification or metabolism of signalling molecules as food and energy source; this includes “signalling confusion”, a term coined in this paper to refer to the phenomenon of non-destructive modification of signalling molecules. While quorum quenching has been explored as a novel anti-infective therapy targeting, quorum sensing evidence begins to show the development of resistance against quorum quenching.

  6. Alternatives to Pyrotechnic Distress Signals; Additional Signal Evaluation

    Science.gov (United States)

    2017-06-01

    device performance standard that addresses Coast Guard project sponsor and stakeholders needs. 17. Key Words Visual Distress Signal Device (VDSD...devices. The report discussed the concept of “effective intensity,” as used by the International Association of Marine Aids to Navigation and Lighthouse...efficacy of Cyan as a signal color. In order to move forward, the RDC project team met with CG-ENG-4 and other Coast Guard stakeholders (Offices of

  7. Fast digitizing and digital signal processing of detector signals

    International Nuclear Information System (INIS)

    Hannaske, Roland

    2008-01-01

    A fast-digitizer data acquisition system recently installed at the neutron time-of-flight experiment nELBE, which is located at the superconducting electron accelerator ELBE of Forschungszentrum Dresden-Rossendorf, is tested with two different detector types. Preamplifier signals from a high-purity germanium detector are digitized, stored and finally processed. For a precise determination of the energy of the detected radiation, the moving-window deconvolution algorithm is used to compensate the ballistic deficit and different shaping algorithms are applied. The energy resolution is determined in an experiment with γ-rays from a 22 Na source and is compared to the energy resolution achieved with analogously processed signals. On the other hand, signals from the photomultipliers of barium fluoride and plastic scintillation detectors are digitized. These signals have risetimes of a few nanoseconds only. The moment of interaction of the radiation with the detector is determined by methods of digital signal processing. Therefore, different timing algorithms are implemented and tested with data from an experiment at nELBE. The time resolutions achieved with these algorithms are compared to each other as well as to reference values coming from analog signal processing. In addition to these experiments, some properties of the digitizing hardware are measured and a program for the analysis of stored, digitized data is developed. The analysis of the signals shows that the energy resolution achieved with the 10-bit digitizer system used here is not competitive to a 14-bit peak-sensing ADC, although the ballistic deficit can be fully corrected. However, digital methods give better result in sub-ns timing than analog signal processing. (orig.)

  8. Advanced optical signal processing of broadband parallel data signals

    DEFF Research Database (Denmark)

    Oxenløwe, Leif Katsuo; Hu, Hao; Kjøller, Niels-Kristian

    2016-01-01

    Optical signal processing may aid in reducing the number of active components in communication systems with many parallel channels, by e.g. using telescopic time lens arrangements to perform format conversion and allow for WDM regeneration.......Optical signal processing may aid in reducing the number of active components in communication systems with many parallel channels, by e.g. using telescopic time lens arrangements to perform format conversion and allow for WDM regeneration....

  9. ESR signals of irradiated insects

    International Nuclear Information System (INIS)

    Ukai, Mitsuko; Kameya, Hiromi; Imamura, Taro; Miyanoshita, Akihiro; Todoriki, Setsuko; Shimoyama, Yuhei

    2009-01-01

    Analysis of irradiated insects using Electron Spin Resonance (ESR) spectroscopy was reported. The insects were maize weevil, red flour beetle, Indian meal moth and cigarette beetle that are hazardous to crops. The ESR spectra were consisted of a singlet at g=2 and a sextet centered at the similar g-value. The singlet signal is due to an organic free radical. The sextet signal is attributable to the hyperfine interactions from Mn 2+ ions. Upon irradiation, new signals were not detected. The relaxation times, T 1 and T 2 , showed no variations before and after irradiation. (author)

  10. Statistical theory of signal detection

    CERN Document Server

    Helstrom, Carl Wilhelm; Costrell, L; Kandiah, K

    1968-01-01

    Statistical Theory of Signal Detection, Second Edition provides an elementary introduction to the theory of statistical testing of hypotheses that is related to the detection of signals in radar and communications technology. This book presents a comprehensive survey of digital communication systems. Organized into 11 chapters, this edition begins with an overview of the theory of signal detection and the typical detection problem. This text then examines the goals of the detection system, which are defined through an analogy with the testing of statistical hypotheses. Other chapters consider

  11. Subjective Evaluation of Audiovisual Signals

    Directory of Open Access Journals (Sweden)

    F. Fikejz

    2010-01-01

    Full Text Available This paper deals with subjective evaluation of audiovisual signals, with emphasis on the interaction between acoustic and visual quality. The subjective test is realized by a simple rating method. The audiovisual signal used in this test is a combination of images compressed by JPEG compression codec and sound samples compressed by MPEG-1 Layer III. Images and sounds have various contents. It simulates a real situation when the subject listens to compressed music and watches compressed pictures without the access to original, i.e. uncompressed signals.

  12. On Generalized Fractional Differentiator Signals

    Directory of Open Access Journals (Sweden)

    Hamid A. Jalab

    2013-01-01

    Full Text Available By employing the generalized fractional differential operator, we introduce a system of fractional order derivative for a uniformly sampled polynomial signal. The calculation of the bring in signal depends on the additive combination of the weighted bring-in of N cascaded digital differentiators. The weights are imposed in a closed formula containing the Stirling numbers of the first kind. The approach taken in this work is to consider that signal function in terms of Newton series. The convergence of the system to a fractional time differentiator is discussed.

  13. Dicty_cDB: VHF408 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available MTYF9_FA... 33 7.5 CP000568_3082( CP000568 |pid:none) Clostridium thermocellum ATCC 2... 33 9.8 AY698035_1(... AY698035 |pid:none) Desmognathus marmoratus isolate 69... 33 9.8 protein update 2009. 3. 3 PSORT psg: 0.69

  14. Characteristics of ionospheric irregularities causing scintillations at VHF/UHF

    International Nuclear Information System (INIS)

    Vats, H.O.; Deshpande, M.R.; Rastogi, R.G.

    1978-01-01

    Some properties of ionization irregularities using amplitude scintillation records of radio beacons from ATS-6 (phase II) at Ootacamund, India have been investigated. For the estimation of scale-size and strength of the irregularities a simple diffraction model has been used which explains only weak and moderate equatorial scintillation observations. It was found that the scale sizes of day time E-region irregularities are smaller than those in the F-region during night time in addition, irregularities are generated initially at large scale sizes which later break up into smaller scale sizes

  15. Lightning initiation: Strong pulses of VHF radiation accompany preliminary breakdown

    Czech Academy of Sciences Publication Activity Database

    Kolmašová, Ivana; Santolík, Ondřej; Defer, E.; Rison, W.; Coquillat, S.; Pedeboy, S.; Lán, Radek; Uhlíř, Luděk; Lambert, D.; Pinty, J.P.; Prieur, S.; Pont, V.

    2018-01-01

    Roč. 8, č. 1 (2018), č. článku 3650. ISSN 2045-2322 R&D Projects: GA ČR GA17-07027S Grant - others:AV ČR(CZ) AP1401 Program:Akademická prémie - Praemium Academiae Institutional support: RVO:68378289 Keywords : controlled study * article * electromagnetic radiation * magnetic field * waveform * lightning * mapping array * discharges * ionosphere * luminosity * flashes * leaders * system Subject RIV: BL - Plasma and Gas Discharge Physics OBOR OECD: Fluids and plasma physics (including surface physics ) Impact factor: 4.259, year: 2016 https://www.nature.com/articles/s41598-018-21972-z

  16. VHF radar observations of gravity waves at a low latitude

    Directory of Open Access Journals (Sweden)

    G. Dutta

    1999-08-01

    Full Text Available Wind observations made at Gadanki (13.5°N by using Indian MST Radar for few days in September, October, December 1995 and January, 1996 have been analyzed to study gravity wave activity in the troposphere and lower stratosphere. Horizontal wind variances have been computed for gravity waves of period (2-6 h from the power spectral density (PSD spectrum. Exponential curves of the form eZ/H have been fitted by least squares technique to these variance values to obtain height variations of the irregular winds upto the height of about 15 km, where Z is the height in kilometers. The value of H, the scale height, as determined from curve fitting is found to be less than the theoretical value of scale height of neutral atmosphere in this region, implying that the waves are gaining energy during their passage in the troposphere. In other words, it indicates that the sources of gravity waves are present in the troposphere. The energy densities of gravity wave fluctuations have been computed. Polynomial fits to the observed values show that wave energy density increases in the troposphere, its source region, and then decreases in the lower stratosphere.Key words. Meteorology and atmospheric dynamics (middle atmosphere dynamics; turbulence; waves and tides

  17. Dicty_cDB: VHF127 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ce. 72 3e-12 2 EL476245 |EL476245.1 CHUL4181.b1_J14.ab1 CHU(LMS) puzzle sunflower... Helianthus paradoxus cDNA clone CHUL4181, mRNA sequence. 72 3e-12 2 EL513430 |EL513430.1 CHUX465.b1_A21.ab1 CHU(XYZ) puzzle

  18. Dicty_cDB: VHF491 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available ents: (bits) Value BC142916_1( BC142916 |pid:none) Danio rerio hypothetical LOC555303... 97 6e-19 (Q9NZJ4) RecName: Full=Sacsi...n; &AL157766_4( AL157766 |pid:none) 97 9e-19 BC171956_1( BC171956 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 1e-18 BC138482_1( BC138482 |pid:none) Mus musculus sacsi...n, mRNA (cDNA cl... 96 2e-18 (Q9JLC8) RecName: Full=Sacsin; 96 2e-18 CP001577_292( CP001577 |pid:none) Mi

  19. VHF spectrum monitoring using Meraka cognitive radio platform

    CSIR Research Space (South Africa)

    Aderonmu, AI

    2012-11-01

    Full Text Available discuss the Meraka Cognitive Radio Platform (MCRP) developed using the second version of the Universal Serial Radio Peripheral (USRP2) hardware and the GNU Radio software. We also discussed how the spectrum monitoring system is being implemented...

  20. Simply folded band chaos in a VHF microstrip oscillator

    Energy Technology Data Exchange (ETDEWEB)

    Blakely, Jonathan N. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)]. E-mail: jonathan.blakely@us.army.mil; Holder, J. Darryl [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Corron, Ned J. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States); Pethel, Shawn D. [US Army Research, Development, and Engineering Command, AMSRD-AMR-WS-ST, Redstone Arsenal, AL 35898 (United States)

    2005-10-10

    We present experimental observations of a microstrip circuit that produces Roessler-like chaos with center frequency of 175 MHz. A simply folded band chaotic attractor is created through a period doubling route. The circuit provides an experimental realization of a chaotic neutral delay differential equation, a largely unexplored type of nonlinear dynamical system.

  1. Dicty_cDB: VHF631 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available C114006_1( BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 6e-13 AY892312_1( AY892312 |pid:none...ing fra... 74 2e-12 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid

  2. Dicty_cDB: VHF111 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available id:none) Homo sapiens L-pipecolic acid oxid... 76 2e-12 AX882278_1( AX882278 |pid:none) Sequence 17183 from ...Patent EP10746... 76 2e-12 BC114006_1( BC114006 |pid:none) Bos taurus L-pipecolic

  3. 47 CFR 80.873 - VHF radiotelephone transmitter.

    Science.gov (United States)

    2010-10-01

    ...) The transmitter must deliver a carrier power between 8 and 25 watts into a 50 ohm effective resistance... 50 ohms effective resistance over the frequency band specified in § 80.871(d). An individual...

  4. VHF/UHF filters and multicouplers application of air resonators

    CERN Document Server

    Piette, Bernard

    2013-01-01

    This book describes the various devices used in radio communication and broadcasting to achieve high selectivity filtering and coupling. After providing a background in the basics of microwave theory and more detailed material - including a special chapter on precision and errors in measurement - the reader will find detailed descriptions, manufacturing processes, and, for the most useful instances, a number of worked-through formulas, which will allow engineers and technicians to design circuits or components for filtering or coupling applications. Content is covered in this format across a b

  5. VHF NEMS-CMOS piezoresistive resonators for advanced sensing applications

    Science.gov (United States)

    Arcamone, Julien; Dupré, Cécilia; Arndt, Grégory; Colinet, Eric; Hentz, Sébastien; Ollier, Eric; Duraffourg, Laurent

    2014-10-01

    This work reports on top-down nanoelectromechanical resonators, which are among the smallest resonators listed in the literature. To overcome the fact that their electromechanical transduction is intrinsically very challenging due to their very high frequency (100 MHz) and ultimate size (each resonator is a 1.2 μm long, 100 nm wide, 20 nm thick silicon beam with 100 nm long and 30 nm wide piezoresistive lateral nanowire gauges), they have been monolithically integrated with an advanced fully depleted SOI CMOS technology. By advantageously combining the unique benefits of nanomechanics and nanoelectronics, this hybrid NEMS-CMOS device paves the way for novel breakthrough applications, such as NEMS-based mass spectrometry or hybrid NEMS/CMOS logic, which cannot be fully implemented without this association.

  6. Dicty_cDB: VHF289 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available d sequence lvdpasshmlvskikpcmskykflydetadgslqq**tnrlsgftfwitavnrg*yiqam gdwqrklsdy*hstnafgfwvipnniadrgfifdks...siqagkkkrddianinrkasa Translated Amino Acid sequence (All Frames) Frame A: lvdpasshmlvskikpcmskykflydetadgsl

  7. Dicty_cDB: VHF123 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available 03667.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP1...nsertion targeting and chromosome engineering clone MHPP186g09. 50 0.17 1 CR034434 |CR034434.1 Forward stran...d read from insert in 3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 CR023...465 |CR023465.1 Forward strand read from insert in 3'HPRT insertion targeting and chromosome engineering...3'HPRT insertion targeting and chromosome engineering clone MHPP47e19. 50 0.17 1 BX990136 |BX990136.1 Forwar

  8. 76 FR 5521 - Innovation in the Broadcast Television Bands

    Science.gov (United States)

    2011-02-01

    ... broadcasters serving minority, foreign language and niche interests that might have smaller audiences and lower... signals, including those not specifically raised in this NPRM. Improving Reception of VHF TV Service 34... band that can cause interference, and reception of VHF signals requires physically larger antennas that...

  9. Ultrasound imaging using coded signals

    DEFF Research Database (Denmark)

    Misaridis, Athanasios

    Modulated (or coded) excitation signals can potentially improve the quality and increase the frame rate in medical ultrasound scanners. The aim of this dissertation is to investigate systematically the applicability of modulated signals in medical ultrasound imaging and to suggest appropriate...... methods for coded imaging, with the goal of making better anatomic and flow images and three-dimensional images. On the first stage, it investigates techniques for doing high-resolution coded imaging with improved signal-to-noise ratio compared to conventional imaging. Subsequently it investigates how...... coded excitation can be used for increasing the frame rate. The work includes both simulated results using Field II, and experimental results based on measurements on phantoms as well as clinical images. Initially a mathematical foundation of signal modulation is given. Pulse compression based...

  10. Digital storage of repeated signals

    International Nuclear Information System (INIS)

    Prozorov, S.P.

    1984-01-01

    An independent digital storage system designed for repeated signal discrimination from background noises is described. The signal averaging is performed off-line in the real time mode by means of multiple selection of the investigated signal and integration in each point. Digital values are added in a simple summator and the result is recorded the storage device with the volume of 1024X20 bit from where it can be output on an oscillograph, a plotter or transmitted to a compUter for subsequent processing. The described storage is reliable and simple device on one base of which the systems for the nuclear magnetic resonapce signal acquisition in different experiments are developed

  11. Zufällige Signale

    Science.gov (United States)

    Plaßmann, Wilfried

    Die hier betrachteten Signale werden auch als stochastische Signale bezeichnet. Sie sind zufällig, d. h. ihr Augenblickswert ist nicht vorhersagbar. Abb. 118.1 zeigt eine Unterteilung nach den Signaleigenschaften. Über die nichtstationären Signale lässt sich keinerlei Aussage machen, und sie werden hier deshalb auch nicht weiter betrachtet. Für die stationären Signale gilt, dass ihr Momentanwert zwar auch nicht vorhergesagt werden kann, dass sie aber trotzdem gewisse auswertbare Eigenschaften besitzen, die allerdings statistischer Art sind und deshalb nur mit den Gesetzen der Wahrscheinlichkeitstheorie erfasst werden können. Zwar sind - theoretisch - für die Anwendung der Wahrscheinlichkeitstheorie unendlich viele Probenwerte zu nehmen, in der Praxis hat sich aber gezeigt, dass man auch mit einer endlichen Anzahl dem gesuchten Wert schon ausreichend nahe kommen kann.

  12. Signal Incongruence and its Consequences

    DEFF Research Database (Denmark)

    Vergne, Jean-Philippe; Wernicke, Maria Stokholm; Brenner, Steffen

    2018-01-01

    theory on signal incongruence, we find that firms engaged in philanthropy receive more media disapproval when they overcompensate their CEO, but they are also more likely to decrease CEO overcompensation as a response. Our study contributes to the signaling literature by theorizing about signal......We draw on the signaling and infomediary literatures to examine how media evaluations of CEO overcompensation (a negative cue associated with selfishness and greed) are affected by the presence of corporate philanthropy (a positive cue associated with altruism and generosity). In line with our...... incongruence, and to infomediary and corporate governance research by showing that media disapproval can lead to lower executive compensation. We also reconcile two conflicting views on firm prosocial behavior by showing that, in the presence of incongruent cues, philanthropy can simultaneously enhance...

  13. Mathematical Modelling Plant Signalling Networks

    KAUST Repository

    Muraro, D.; Byrne, H.M.; King, J.R.; Bennett, M.J.

    2013-01-01

    methods for modelling gene and signalling networks and their application in plants. We then describe specific models of hormonal perception and cross-talk in plants. This mathematical analysis of sub-cellular molecular mechanisms paves the way for more

  14. Signal transforms in dynamic measurements

    CERN Document Server

    Layer, Edward

    2015-01-01

    This book is devoted to the analysis of measurement signals which requires specific mathematical operations like Convolution, Deconvolution, Laplace, Fourier, Hilbert, Wavelet or Z transform which are all presented in the present book. The different problems refer to the modulation of signals, filtration of disturbance as well as to the orthogonal signals and their use in digital form for the measurement of current, voltage, power and frequency are also widely discussed. All the topics covered in this book are presented in detail and illustrated by means of examples in MathCad and LabVIEW. This book provides a useful source for researchers, scientists and engineers who in their daily work are required to deal with problems of measurement and signal processing and can also be helpful to undergraduate students of electrical engineering.    

  15. Dopamine signaling: target in glioblastoma

    Czech Academy of Sciences Publication Activity Database

    Bartek, Jiří; Hodný, Zdeněk

    2014-01-01

    Roč. 5, č. 5 (2014), 1116-1117 ISSN 1949-2553 Institutional support: RVO:68378050 Keywords : Dopamine signaling * glioblastoma * MAPK Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.359, year: 2014

  16. Pedestrian Friendly Traffic Signal Control.

    Science.gov (United States)

    2016-01-01

    This project continues research aimed at real-time detection and use of pedestrian : traffic flow information to enhance adaptive traffic signal control in urban areas : where pedestrian traffic is substantial and must be given appropriate attention ...

  17. Nuclear Receptor Signaling Atlas (NURSA)

    Data.gov (United States)

    U.S. Department of Health & Human Services — The Nuclear Receptor Signaling Atlas (NURSA) is designed to foster the development of a comprehensive understanding of the structure, function, and role in disease...

  18. Intercellular signalling in Stigmatella aurantiaca.

    Science.gov (United States)

    Plaga, W; Ulrich, S H

    1999-12-01

    The myxobacterium Stigmatella aurantiaca is a prokaryotic model used to study intercellular signalling and the genetic determination of morphogenesis. Signalling factors and genes required for the generation of the elaborate multicellular fruiting body are to be identified. Recently, the structure of stigmolone, which is the pheromone necessary for fruiting body formation, was elucidated, and genes involved in development were characterised. Progress has also been made in the genetic accessibility of S. aurantiaca.

  19. Neurotransmitter signaling in white matter.

    Science.gov (United States)

    Butt, Arthur M; Fern, Robert F; Matute, Carlos

    2014-11-01

    White matter (WM) tracts are bundles of myelinated axons that provide for rapid communication throughout the CNS and integration in grey matter (GM). The main cells in myelinated tracts are oligodendrocytes and astrocytes, with small populations of microglia and oligodendrocyte precursor cells. The prominence of neurotransmitter signaling in WM, which largely exclude neuronal cell bodies, indicates it must have physiological functions other than neuron-to-neuron communication. A surprising aspect is the diversity of neurotransmitter signaling in WM, with evidence for glutamatergic, purinergic (ATP and adenosine), GABAergic, glycinergic, adrenergic, cholinergic, dopaminergic and serotonergic signaling, acting via a wide range of ionotropic and metabotropic receptors. Both axons and glia are potential sources of neurotransmitters and may express the respective receptors. The physiological functions of neurotransmitter signaling in WM are subject to debate, but glutamate and ATP-mediated signaling have been shown to evoke Ca(2+) signals in glia and modulate axonal conduction. Experimental findings support a model of neurotransmitters being released from axons during action potential propagation acting on glial receptors to regulate the homeostatic functions of astrocytes and myelination by oligodendrocytes. Astrocytes also release neurotransmitters, which act on axonal receptors to strengthen action potential propagation, maintaining signaling along potentially long axon tracts. The co-existence of multiple neurotransmitters in WM tracts suggests they may have diverse functions that are important for information processing. Furthermore, the neurotransmitter signaling phenomena described in WM most likely apply to myelinated axons of the cerebral cortex and GM areas, where they are doubtless important for higher cognitive function. © 2014 Wiley Periodicals, Inc.

  20. Sentiment analysis for PTSD signals

    CERN Document Server

    Kagan, Vadim; Sapounas, Demetrios

    2013-01-01

    This book describes a computational framework for real-time detection of psychological signals related to Post-Traumatic Stress Disorder (PTSD) in online text-based posts, including blogs and web forums. Further, it explores how emerging computational techniques such as sentiment mining can be used in real-time to identify posts that contain PTSD-related signals, flag those posts, and bring them to the attention of psychologists, thus providing an automated flag and referral capability.

  1. Aberrant Wnt Signaling in Leukemia

    Directory of Open Access Journals (Sweden)

    Frank J. T. Staal

    2016-08-01

    Full Text Available The Wnt signaling pathway is essential in the development and homeostasis of blood and immune cells, but its exact role is still controversial and is the subject of intense research. The malignant counterpart of normal hematopoietic cells, leukemic (stem cells, have hijacked the Wnt pathway for their self-renewal and proliferation. Here we review the multiple ways dysregulated Wnt signaling can contribute to leukemogenesis, both cell autonomously as well as by changes in the microenvironment.

  2. Wnt signaling in limb organogenesis

    OpenAIRE

    Geetha-Loganathan, Poongodi; Nimmagadda, Suresh; Scaal, Martin

    2008-01-01

    Secreted signaling molecules of the Wnt family have been found to play a central role in controlling embryonic development of a wide range of taxa from Hydra to humans. The most extensively studied Wnt signaling pathway is the canonical Wnt pathway, which controls gene expression by stabilizing β-catenin, and regulates a multitude of developmental processes. More recently, noncanonical Wnt pathways, which are β-catenin-independent, have been found to be important developmental regulators. Und...

  3. Handbook of signal processing systems

    CERN Document Server

    Deprettere, Ed; Leupers, Rainer; Takala, Jarmo

    2013-01-01

    Handbook of Signal Processing Systems is organized in three parts. The first part motivates representative applications that drive and apply state-of-the art methods for design and implementation of signal processing systems; the second part discusses architectures for implementing these applications; the third part focuses on compilers and simulation tools, describes models of computation and their associated design tools and methodologies. This handbook is an essential tool for professionals in many fields and researchers of all levels.

  4. Hedgehog Signaling in Endochondral Ossification

    Directory of Open Access Journals (Sweden)

    Shinsuke Ohba

    2016-06-01

    Full Text Available Hedgehog (Hh signaling plays crucial roles in the patterning and morphogenesis of various organs within the bodies of vertebrates and insects. Endochondral ossification is one of the notable developmental events in which Hh signaling acts as a master regulator. Among three Hh proteins in mammals, Indian hedgehog (Ihh is known to work as a major Hh input that induces biological impact of Hh signaling on the endochondral ossification. Ihh is expressed in prehypertrophic and hypertrophic chondrocytes of developing endochondral bones. Genetic studies so far have demonstrated that the Ihh-mediated activation of Hh signaling synchronizes chondrogenesis and osteogenesis during endochondral ossification by regulating the following processes: (1 chondrocyte differentiation; (2 chondrocyte proliferation; and (3 specification of bone-forming osteoblasts. Ihh not only forms a negative feedback loop with parathyroid hormone-related protein (PTHrP to maintain the growth plate length, but also directly promotes chondrocyte propagation. Ihh input is required for the specification of progenitors into osteoblast precursors. The combinatorial approaches of genome-wide analyses and mouse genetics will facilitate understanding of the regulatory mechanisms underlying the roles of Hh signaling in endochondral ossification, providing genome-level evidence of the potential of Hh signaling for the treatment of skeletal disorders.

  5. Hedgehog Signaling in Endochondral Ossification

    Science.gov (United States)

    Ohba, Shinsuke

    2016-01-01

    Hedgehog (Hh) signaling plays crucial roles in the patterning and morphogenesis of various organs within the bodies of vertebrates and insects. Endochondral ossification is one of the notable developmental events in which Hh signaling acts as a master regulator. Among three Hh proteins in mammals, Indian hedgehog (Ihh) is known to work as a major Hh input that induces biological impact of Hh signaling on the endochondral ossification. Ihh is expressed in prehypertrophic and hypertrophic chondrocytes of developing endochondral bones. Genetic studies so far have demonstrated that the Ihh-mediated activation of Hh signaling synchronizes chondrogenesis and osteogenesis during endochondral ossification by regulating the following processes: (1) chondrocyte differentiation; (2) chondrocyte proliferation; and (3) specification of bone-forming osteoblasts. Ihh not only forms a negative feedback loop with parathyroid hormone-related protein (PTHrP) to maintain the growth plate length, but also directly promotes chondrocyte propagation. Ihh input is required for the specification of progenitors into osteoblast precursors. The combinatorial approaches of genome-wide analyses and mouse genetics will facilitate understanding of the regulatory mechanisms underlying the roles of Hh signaling in endochondral ossification, providing genome-level evidence of the potential of Hh signaling for the treatment of skeletal disorders. PMID:29615586

  6. Metabolites in vertebrate Hedgehog signaling.

    Science.gov (United States)

    Roberg-Larsen, Hanne; Strand, Martin Frank; Krauss, Stefan; Wilson, Steven Ray

    2014-04-11

    The Hedgehog (HH) signaling pathway is critical in embryonic development, stem cell biology, tissue homeostasis, chemoattraction and synapse formation. Irregular HH signaling is associated with a number of disease conditions including congenital disorders and cancer. In particular, deregulation of HH signaling has been linked to skin, brain, lung, colon and pancreatic cancers. Key mediators of the HH signaling pathway are the 12-pass membrane protein Patched (PTC), the 7-pass membrane protein Smoothened (SMO) and the GLI transcription factors. PTC shares homology with the RND family of small-molecule transporters and it has been proposed that it interferes with SMO through metabolites. Although a conclusive picture is lacking, substantial efforts are made to identify and understand natural metabolites/sterols, including cholesterol, vitamin D3, oxysterols and glucocorticoides, that may be affected by, or influence the HH signaling cascade at the level of PTC and SMO. In this review we will elaborate the role of metabolites in HH signaling with a focus on oxysterols, and discuss advancements in modern analytical approaches in the field. Copyright © 2014 Elsevier Inc. All rights reserved.

  7. Bystander signaling via oxidative metabolism.

    Science.gov (United States)

    Sawal, Humaira Aziz; Asghar, Kashif; Bureik, Matthias; Jalal, Nasir

    2017-01-01

    The radiation-induced bystander effect (RIBE) is the initiation of biological end points in cells (bystander cells) that are not directly traversed by an incident-radiation track, but are in close proximity to cells that are receiving the radiation. RIBE has been indicted of causing DNA damage via oxidative stress, besides causing direct damage, inducing tumorigenesis, producing micronuclei, and causing apoptosis. RIBE is regulated by signaling proteins that are either endogenous or secreted by cells as a means of communication between cells, and can activate intracellular or intercellular oxidative metabolism that can further trigger signaling pathways of inflammation. Bystander signals can pass through gap junctions in attached cell lines, while the suspended cell lines transmit these signals via hormones and soluble proteins. This review provides the background information on how reactive oxygen species (ROS) act as bystander signals. Although ROS have a very short half-life and have a nanometer-scale sphere of influence, the wide variety of ROS produced via various sources can exert a cumulative effect, not only in forming DNA adducts but also setting up signaling pathways of inflammation, apoptosis, cell-cycle arrest, aging, and even tumorigenesis. This review outlines the sources of the bystander effect linked to ROS in a cell, and provides methods of investigation for researchers who would like to pursue this field of science.

  8. Insulin Signaling and Heart Failure

    Science.gov (United States)

    Riehle, Christian; Abel, E. Dale

    2016-01-01

    Heart failure is associated with generalized insulin resistance. Moreover, insulin resistant states such as type 2 diabetes and obesity increases the risk of heart failure even after adjusting for traditional risk factors. Insulin resistance or type 2 diabetes alters the systemic and neurohumoral milieu leading to changes in metabolism and signaling pathways in the heart that may contribute to myocardial dysfunction. In addition, changes in insulin signaling within cardiomyocytes develop in the failing heart. The changes range from activation of proximal insulin signaling pathways that may contribute to adverse left ventricular remodeling and mitochondrial dysfunction to repression of distal elements of insulin signaling pathways such as forkhead (FOXO) transcriptional signaling or glucose transport which may also impair cardiac metabolism, structure and function. This article will review the complexities of insulin signaling within the myocardium and ways in which these pathways are altered in heart failure or in conditions associated with generalized insulin resistance. The implications of these changes for therapeutic approaches to treating or preventing heart failure will be discussed. PMID:27034277

  9. SignalPlant: an open signal processing software platform.

    Science.gov (United States)

    Plesinger, F; Jurco, J; Halamek, J; Jurak, P

    2016-07-01

    The growing technical standard of acquisition systems allows the acquisition of large records, often reaching gigabytes or more in size as is the case with whole-day electroencephalograph (EEG) recordings, for example. Although current 64-bit software for signal processing is able to process (e.g. filter, analyze, etc) such data, visual inspection and labeling will probably suffer from rather long latency during the rendering of large portions of recorded signals. For this reason, we have developed SignalPlant-a stand-alone application for signal inspection, labeling and processing. The main motivation was to supply investigators with a tool allowing fast and interactive work with large multichannel records produced by EEG, electrocardiograph and similar devices. The rendering latency was compared with EEGLAB and proves significantly faster when displaying an image from a large number of samples (e.g. 163-times faster for 75  ×  10(6) samples). The presented SignalPlant software is available free and does not depend on any other computation software. Furthermore, it can be extended with plugins by third parties ensuring its adaptability to future research tasks and new data formats.

  10. Bystander signaling via oxidative metabolism

    Directory of Open Access Journals (Sweden)

    Sawal HA

    2017-08-01

    Full Text Available Humaira Aziz Sawal,1 Kashif Asghar,2 Matthias Bureik,3 Nasir Jalal4 1Healthcare Biotechnology Department, Atta-ur-Rahman School of Applied Biosciences, National University of Sciences and Technology, Islamabad, 2Basic Sciences Research, Shaukat Khanum Memorial Cancer Hospital and Research Centre, Lahore, Pakistan; 3Health Science Platform, School of Pharmaceutical Science and Technology, Tianjin University, Tianjin, China; 4Health Science Platform, Department of Molecular and Cellular Pharmacology, Tianjin University, Tianjin, China Abstract: The radiation-induced bystander effect (RIBE is the initiation of biological end points in cells (bystander cells that are not directly traversed by an incident-radiation track, but are in close proximity to cells that are receiving the radiation. RIBE has been indicted of causing DNA damage via oxidative stress, besides causing direct damage, inducing tumorigenesis, producing micronuclei, and causing apoptosis. RIBE is regulated by signaling proteins that are either endogenous or secreted by cells as a means of communication between cells, and can activate intracellular or intercellular oxidative metabolism that can further trigger signaling pathways of inflammation. Bystander signals can pass through gap junctions in attached cell lines, while the suspended cell lines transmit these signals via hormones and soluble proteins. This review provides the background information on how reactive oxygen species (ROS act as bystander signals. Although ROS have a very short half-life and have a nanometer-scale sphere of influence, the wide variety of ROS produced via various sources can exert a cumulative effect, not only in forming DNA adducts but also setting up signaling pathways of inflammation, apoptosis, cell-cycle arrest, aging, and even tumorigenesis. This review outlines the sources of the bystander effect linked to ROS in a cell, and provides methods of investigation for researchers who would like to

  11. Liquid Argon TPC Signal Formation, Signal Processing and Hit Reconstruction

    Energy Technology Data Exchange (ETDEWEB)

    Baller, Bruce [Fermilab

    2017-03-11

    This document describes the early stage of the reconstruction chain that was developed for the ArgoNeuT and MicroBooNE experiments at Fermilab. These experiments study accelerator neutrino interactions that occur in a Liquid Argon Time Projection Chamber. Reconstructing the properties of particles produced in these interactions requires knowledge of the micro-physics processes that affect the creation and transport of ionization electrons to the readout system. A wire signal deconvolution technique was developed to convert wire signals to a standard form for hit reconstruction, to remove artifacts in the electronics chain and to remove coherent noise.

  12. Overlay Spectrum Sharing using Improper Gaussian Signaling

    KAUST Repository

    Amin, Osama; Abediseid, Walid; Alouini, Mohamed-Slim

    2016-01-01

    in overlay cognitive radio system, where the secondary transmitter broadcasts a mixture of two different signals. The first signal is selected from the PGS scheme to match the primary message transmission. On the other hand, the second signal is chosen

  13. 300 Area signal cable study

    International Nuclear Information System (INIS)

    Whattam, J.W.

    1994-01-01

    This report was prepared to discuss the alternatives available for removing the 300 Area overhead signal cable system. This system, installed in 1969, has been used for various monitoring and communication signaling needs throughout the 300 Area. Over the years this cabling system has deteriorated, has been continually reconfigured, and has been poorly documented to the point of nonreliability. The first step was to look at the systems utilizing the overhead signal cable that are still required for operation. Of the ten systems that once operated via the signal cable, only five are still required; the civil defense evacuation alarms, the public address (PA) system, the criticality alarms, the Pacific Northwest Laboratory Facilities Management Control System (FMCS), and the 384 annunciator panel. Of these five, the criticality alarms and the FMCS have been dealt with under other proposals. Therefore, this study focused on the alternatives available for the remaining three systems (evacuation alarms, PA system, and 384 panel) plus the accountability aid phones. Once the systems to be discussed were determined, then three alternatives for providing the signaling pathway were examined for each system: (1) re-wire using underground communication ducts, (2) use the Integrated Voice/Data Telecommunications System (IVDTS) already installed and operated by US West, and (3) use radio control. Each alternative was developed with an estimated cost, advantages, and disadvantages. Finally, a recommendation was provided for the best alternative for each system

  14. Calcium Signaling in Taste Cells

    Science.gov (United States)

    Medler, Kathryn F.

    2014-01-01

    The sense of taste is a common ability shared by all organisms and is used to detect nutrients as well as potentially harmful compounds. Thus taste is critical to survival. Despite its importance, surprisingly little is known about the mechanisms generating and regulating responses to taste stimuli. All taste responses depend on calcium signals to generate appropriate responses which are relayed to the brain. Some taste cells have conventional synapses and rely on calcium influx through voltage-gated calcium channels. Other taste cells lack these synapses and depend on calcium release to formulate an output signal through a hemichannel. Beyond establishing these characteristics, few studies have focused on understanding how these calcium signals are formed. We identified multiple calcium clearance mechanisms that regulate calcium levels in taste cells as well as a calcium influx that contributes to maintaining appropriate calcium homeostasis in these cells. Multiple factors regulate the evoked taste signals with varying roles in different cell populations. Clearly, calcium signaling is a dynamic process in taste cells and is more complex than has previously been appreciated. PMID:25450977

  15. Biomedical signal and image processing.

    Science.gov (United States)

    Cerutti, Sergio; Baselli, Giuseppe; Bianchi, Anna; Caiani, Enrico; Contini, Davide; Cubeddu, Rinaldo; Dercole, Fabio; Rienzo, Luca; Liberati, Diego; Mainardi, Luca; Ravazzani, Paolo; Rinaldi, Sergio; Signorini, Maria; Torricelli, Alessandro

    2011-01-01

    Generally, physiological modeling and biomedical signal processing constitute two important paradigms of biomedical engineering (BME): their fundamental concepts are taught starting from undergraduate studies and are more completely dealt with in the last years of graduate curricula, as well as in Ph.D. courses. Traditionally, these two cultural aspects were separated, with the first one more oriented to physiological issues and how to model them and the second one more dedicated to the development of processing tools or algorithms to enhance useful information from clinical data. A practical consequence was that those who did models did not do signal processing and vice versa. However, in recent years,the need for closer integration between signal processing and modeling of the relevant biological systems emerged very clearly [1], [2]. This is not only true for training purposes(i.e., to properly prepare the new professional members of BME) but also for the development of newly conceived research projects in which the integration between biomedical signal and image processing (BSIP) and modeling plays a crucial role. Just to give simple examples, topics such as brain–computer machine or interfaces,neuroengineering, nonlinear dynamical analysis of the cardiovascular (CV) system,integration of sensory-motor characteristics aimed at the building of advanced prostheses and rehabilitation tools, and wearable devices for vital sign monitoring and others do require an intelligent fusion of modeling and signal processing competences that are certainly peculiar of our discipline of BME.

  16. Signal analysis for failure detection

    International Nuclear Information System (INIS)

    Parpaglione, M.C.; Perez, L.V.; Rubio, D.A.; Czibener, D.; D'Attellis, C.E.; Brudny, P.I.; Ruzzante, J.E.

    1994-01-01

    Several methods for analysis of acoustic emission signals are presented. They are mainly oriented to detection of changes in noisy signals and characterization of higher amplitude discrete pulses or bursts. The aim was to relate changes and events with failure, crack or wear in materials, being the final goal to obtain automatic means of detecting such changes and/or events. Performance evaluation was made using both simulated and laboratory test signals. The methods being presented are the following: 1. Application of the Hopfield Neural Network (NN) model for classifying faults in pipes and detecting wear of a bearing. 2. Application of the Kohonnen and Back Propagation Neural Network model for the same problem. 3. Application of Kalman filtering to determine time occurrence of bursts. 4. Application of a bank of Kalman filters (KF) for failure detection in pipes. 5. Study of amplitude distribution of signals for detecting changes in their shape. 6. Application of the entropy distance to measure differences between signals. (author). 10 refs, 11 figs

  17. Neurotrophin signaling and visceral hypersensitivity.

    Science.gov (United States)

    Qiao, Li-Ya

    2014-06-01

    Neurotrophin family are traditionally recognized for their nerve growth promoting function and are recently identified as crucial factors in regulating neuronal activity in the central and peripheral nervous systems. The family members including nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), and neurotrophin-3 (NT-3) are reported to have distinct roles in the development and maintenance of sensory phenotypes in normal states and in the modulation of sensory activity in disease. This paper highlights receptor tyrosine kinase (Trk) -mediated signal transduction by which neurotrophins regulate neuronal activity in the visceral sensory reflex pathways with emphasis on the distinct roles of NGF and BDNF signaling in physiologic and pathophysiological processes. Viscero-visceral cross-organ sensitization exists widely in human diseases. The role of neurotrophins in mediating neural cross talk and interaction in primary afferent neurons in the dorsal root ganglia (DRG) and neurotrophin signal transduction in the context of cross-organ sensitization are also discussed.

  18. Cytokinin signaling during root development.

    Science.gov (United States)

    Bishopp, Anthony; Help, Hanna; Helariutta, Ykä

    2009-01-01

    The cytokinin class of phytohormones regulates division and differentiation of plant cells. They are perceived and signaled by a phosphorelay mechanism similar to those observed in prokaryotes. Research into the components of phosphorelay had previously been marred by genetic redundancy. However, recent studies have addressed this with the creation of high-order mutants. In addition, several new elements regulating cytokinin signaling have been identified. This has uncovered many roles in diverse developmental and physiological processes. In this review, we look at these processes specifically in the context of root development. We focus on the formation and maintenance of the root apical meristem, primary and secondary vascular development, lateral root emergence and development, and root nodulation. We believe that the root is an ideal organ with which to investigate cytokinin signaling in a wider context.

  19. Neural networks in signal processing

    International Nuclear Information System (INIS)

    Govil, R.

    2000-01-01

    Nuclear Engineering has matured during the last decade. In research and design, control, supervision, maintenance and production, mathematical models and theories are used extensively. In all such applications signal processing is embedded in the process. Artificial Neural Networks (ANN), because of their nonlinear, adaptive nature are well suited to such applications where the classical assumptions of linearity and second order Gaussian noise statistics cannot be made. ANN's can be treated as nonparametric techniques, which can model an underlying process from example data. They can also adopt their model parameters to statistical change with time. Algorithms in the framework of Neural Networks in Signal processing have found new applications potentials in the field of Nuclear Engineering. This paper reviews the fundamentals of Neural Networks in signal processing and their applications in tasks such as recognition/identification and control. The topics covered include dynamic modeling, model based ANN's, statistical learning, eigen structure based processing and generalization structures. (orig.)

  20. Wavelets and multiscale signal processing

    CERN Document Server

    Cohen, Albert

    1995-01-01

    Since their appearance in mid-1980s, wavelets and, more generally, multiscale methods have become powerful tools in mathematical analysis and in applications to numerical analysis and signal processing. This book is based on "Ondelettes et Traitement Numerique du Signal" by Albert Cohen. It has been translated from French by Robert D. Ryan and extensively updated by both Cohen and Ryan. It studies the existing relations between filter banks and wavelet decompositions and shows how these relations can be exploited in the context of digital signal processing. Throughout, the book concentrates on the fundamentals. It begins with a chapter on the concept of multiresolution analysis, which contains complete proofs of the basic results. The description of filter banks that are related to wavelet bases is elaborated in both the orthogonal case (Chapter 2), and in the biorthogonal case (Chapter 4). The regularity of wavelets, how this is related to the properties of the filters and the importance of regularity for t...

  1. Ocean circulation generated magnetic signals

    DEFF Research Database (Denmark)

    Manoj, C.; Kuvshinov, A.; Maus, S.

    2006-01-01

    Conducting ocean water, as it flows through the Earth's magnetic field, generates secondary electric and magnetic fields. An assessment of the ocean-generated magnetic fields and their detectability may be of importance for geomagnetism and oceanography. Motivated by the clear identification...... of ocean tidal signatures in the CHAMP magnetic field data we estimate the ocean magnetic signals of steady flow using a global 3-D EM numerical solution. The required velocity data are from the ECCO ocean circulation experiment and alternatively from the OCCAM model for higher resolution. We assume...... of the magnetic field, as compared to the ECCO simulation. Besides the expected signatures of the global circulation patterns, we find significant seasonal variability of ocean magnetic signals in the Indian and Western Pacific Oceans. Compared to seasonal variation, interannual variations produce weaker signals....

  2. Chansporter complexes in cell signaling.

    Science.gov (United States)

    Abbott, Geoffrey W

    2017-09-01

    Ion channels facilitate diffusion of ions across cell membranes for such diverse purposes as neuronal signaling, muscular contraction, and fluid homeostasis. Solute transporters often utilize ionic gradients to move aqueous solutes up their concentration gradient, also fulfilling a wide variety of tasks. Recently, an increasing number of ion channel-transporter ('chansporter') complexes have been discovered. Chansporter complex formation may overcome what could otherwise be considerable spatial barriers to rapid signal integration and feedback between channels and transporters, the ions and other substrates they transport, and environmental factors to which they must respond. Here, current knowledge in this field is summarized, covering both heterologous expression structure/function findings and potential mechanisms by which chansporter complexes fulfill contrasting roles in cell signaling in vivo. © 2017 Federation of European Biochemical Societies.

  3. The Dynamics of Costly Signaling

    Directory of Open Access Journals (Sweden)

    Elliott O. Wagner

    2013-04-01

    Full Text Available Costly signaling is a mechanism through which the honesty of signals can be secured in equilibrium, even in interactions where communicators have conflicting interests. This paper explores the dynamics of one such signaling game: Spence’s model of education. It is found that separating equilibria are unlikely to emerge under either the replicator or best response dynamics, but that partially communicative mixed equilibria are quite important dynamically. These mixtures are Lyapunov stable in the replicator dynamic and asymptotically stable in the best response dynamic. Moreover, they have large basins of attraction, in fact larger than those of either pooling or separating equilibria. This suggests that these mixtures may play significant, and underappreciated, roles in the explanation of the emergence and stability of information transfer.

  4. Signals, systems, transforms, and digital signal processing with Matlab

    CERN Document Server

    Corinthios, Michael

    2009-01-01

    Continuous-Time and Discrete-Time Signals and SystemsIntroductionContinuous-Time SignalsPeriodic FunctionsUnit Step FunctionGraphical Representation of FunctionsEven and Odd Parts of a FunctionDirac-Delta ImpulseBasic Properties of the Dirac-Delta ImpulseOther Important Properties of the ImpulseContinuous-Time SystemsCausality, StabilityExamples of Electrical Continuous-Time SystemsMechanical SystemsTransfer Function and Frequency ResponseConvolution and CorrelationA Right-Sided and a Left-Sided FunctionConvolution with an Impulse and Its DerivativesAdditional Convolution PropertiesCorrelation FunctionProperties of the Correlation FunctionGraphical InterpretationCorrelation of Periodic FunctionsAverage, Energy and Power of Continuous-Time SignalsDiscrete-Time SignalsPeriodicityDifference EquationsEven/Odd DecompositionAverage Value, Energy and Power SequencesCausality, StabilityProblemsAnswers to Selected ProblemsFourier Series ExpansionTrigonometric Fourier SeriesExponential Fourier SeriesExponential versus ...

  5. Signal transduction by growth factor receptors: signaling in an instant

    DEFF Research Database (Denmark)

    Dengjel, Joern; Akimov, Vyacheslav; Blagoev, Blagoy

    2007-01-01

    Phosphorylation-based signaling events happening within the first minute of receptor stimulation have so far only been analyzed by classical cell biological approaches like live-cell microscopy. The development of a quench flow system with a time resolution of one second coupled to a read...

  6. Conversion of interlaced image signals into progressive scanned image signals.

    NARCIS (Netherlands)

    2008-01-01

    In a method of de-interlacing video data (F), at least three different de-interlacing algorithms (VTF, MED1, CM3) are applied on the video data (F) to obtain at least three de-interlaced signals (DIO-1, DIO-2, DIO-3), no majority of de-interlacing algorithms copying a single spatio-temporally

  7. Signals of Opportunity Navigation Using Wi-Fi Signals

    Science.gov (United States)

    2011-03-24

    Multiplexed Signals of Opportunity. Master’s Thesis, Air Force Institute of Technology, 2007. 33. Wiles, Charles. “Introducing the Gears Geolocation ... API for All Laptop WiFi Users”, October 2008. URL http://googlecode.blogspot.com. 88 REPORT DOCUMENTATION PAGE Form ApprovedOMB No. 0704–0188 The public

  8. Chaotic signals in digital communications

    CERN Document Server

    Eisencraft, Marcio; Suyama, Ricardo

    2013-01-01

    Chaotic Signals in Digital Communications combines fundamental background knowledge with state-of-the-art methods for using chaotic signals and systems in digital communications. The book builds a bridge between theoretical works and practical implementation to help researchers attain consistent performance in realistic environments. It shows the possible shortcomings of the chaos-based communication systems proposed in the literature, particularly when they are subjected to non-ideal conditions. It also presents a toolbox of techniques for researchers working to actually implement such system

  9. Digital signal processing for NDT

    International Nuclear Information System (INIS)

    Georgel, B.

    1994-01-01

    NDT begins to adapt and use the most recent developments of digital signal and image processing. We briefly sum up the main characteristics of NDT situations (particularly noise and inverse problem formulation) and comment on techniques already used or just emerging (SAFT, split spectrum, adaptive learning network, noise reference filtering, stochastic models, neural networks). This survey is focused on ultrasonics, eddy currents and X-ray radiography. The final objective of end users (availability of automatic diagnosis systems) cannot be achieved only by signal processing algorithms. A close cooperation with other techniques such as artificial intelligence has therefore to be implemented. (author). 20 refs

  10. Subgraph detection using graph signals

    KAUST Repository

    Chepuri, Sundeep Prabhakar

    2017-03-06

    In this paper we develop statistical detection theory for graph signals. In particular, given two graphs, namely, a background graph that represents an usual activity and an alternative graph that represents some unusual activity, we are interested in answering the following question: To which of the two graphs does the observed graph signal fit the best? To begin with, we assume both the graphs are known, and derive an optimal Neyman-Pearson detector. Next, we derive a suboptimal detector for the case when the alternative graph is not known. The developed theory is illustrated with numerical experiments.

  11. Signal processing for cognitive radios

    CERN Document Server

    Jayaweera, Sudharman K

    2014-01-01

    This book covers power electronics, in depth, by presenting the basic principles and application details, and it can be used both as a textbook and reference book.  Introduces the specific type of CR that has gained the most research attention in recent years: the CR for Dynamic Spectrum Access (DSA). Provides signal processing solutions to each task by relating the tasks to materials covered in Part II. Specialized chapters then discuss specific signal processing algorithms required for DSA and DSS cognitive radios  

  12. PSpice for digital signal processing

    CERN Document Server

    Tobin, Paul

    2007-01-01

    PSpice for Digital Signal Processing is the last in a series of five books using Cadence Orcad PSpice version 10.5 and introduces a very novel approach to learning digital signal processing (DSP). DSP is traditionally taught using Matlab/Simulink software but has some inherent weaknesses for students particularly at the introductory level. The 'plug in variables and play' nature of these software packages can lure the student into thinking they possess an understanding they don't actually have because these systems produce results quicklywithout revealing what is going on. However, it must be

  13. Signal recovery in imaging photoplethysmography

    International Nuclear Information System (INIS)

    Holton, Benjamin D; Mannapperuma, Kavan; Lesniewski, Peter J; Thomas, John C

    2013-01-01

    Imaging photoplethysmography is an emerging technique for the extraction of biometric information from people using video recordings. The focus is on extracting the cardiac heart rate of the subject by analysing the luminance of the colour video signal and identifying periodic components. Advanced signal processing is needed to recover the information required. In this paper, independent component analysis (ICA), principal component analysis, auto- and cross-correlation are investigated and compared with respect to their effectiveness in extracting the relevant information from video recordings. Results obtained are compared with those recorded by a modern commercial finger pulse oximeter. It is found that ICA produces the most consistent results. (paper)

  14. Queen signaling in social wasps

    DEFF Research Database (Denmark)

    van Zweden, Jelle Stijn; Bonckaert, Wim; Wenseleers, Tom

    2014-01-01

    Social Hymenoptera are characterized by a reproductive division of labor, whereby queens perform most of the reproduction and workers help to raise her offspring. A long-lasting debate is whether queens maintain this reproductive dominance by manipulating their daughter workers into remaining...... sterile (queen control), or if instead queens honestly signal their fertility and workers reproduce according to their own evolutionary incentives (queen signaling). Here, we test these competing hypotheses using data from Vespine wasps. We show that in natural colonies of the Saxon wasp, Dolichovespula...

  15. Subgraph detection using graph signals

    KAUST Repository

    Chepuri, Sundeep Prabhakar; Leus, Geert

    2017-01-01

    In this paper we develop statistical detection theory for graph signals. In particular, given two graphs, namely, a background graph that represents an usual activity and an alternative graph that represents some unusual activity, we are interested in answering the following question: To which of the two graphs does the observed graph signal fit the best? To begin with, we assume both the graphs are known, and derive an optimal Neyman-Pearson detector. Next, we derive a suboptimal detector for the case when the alternative graph is not known. The developed theory is illustrated with numerical experiments.

  16. Signal recovery in imaging photoplethysmography.

    Science.gov (United States)

    Holton, Benjamin D; Mannapperuma, Kavan; Lesniewski, Peter J; Thomas, John C

    2013-11-01

    Imaging photoplethysmography is an emerging technique for the extraction of biometric information from people using video recordings. The focus is on extracting the cardiac heart rate of the subject by analysing the luminance of the colour video signal and identifying periodic components. Advanced signal processing is needed to recover the information required. In this paper, independent component analysis (ICA), principal component analysis, auto- and cross-correlation are investigated and compared with respect to their effectiveness in extracting the relevant information from video recordings. Results obtained are compared with those recorded by a modern commercial finger pulse oximeter. It is found that ICA produces the most consistent results.

  17. DMPD: Signal integration between IFNgamma and TLR signalling pathways in macrophages. [Dynamic Macrophage Pathway CSML Database

    Lifescience Database Archive (English)

    Full Text Available 16920490 Signal integration between IFNgamma and TLR signalling pathways in macroph...tml) (.csml) Show Signal integration between IFNgamma and TLR signalling pathways in macrophages. PubmedID 16920490 Title Signal inte...gration between IFNgamma and TLR signalling pathways in

  18. Maternal health Indicators Signal Optimism

    African Journals Online (AJOL)

    user

    Maternal health Indicators Signal Optimism. Abraham Haileamlak, MD, Professor of Pediatrics and Child Health. Maternal health is a major health priority for international agencies and the Ethiopian. Government. Many low income countries including. Ethiopia, made substantial improvements in maternal health achieving ...

  19. Cholinergic signalling in gut immunity

    NARCIS (Netherlands)

    Dhawan, Shobhit; Cailotto, Cathy; Harthoorn, Lucien F.; de Jonge, Wouter J.

    2012-01-01

    The gut immune system shares many signalling molecules and receptors with the autonomic nervous system. A good example is the vagal neurotransmitter acetylcholine (ACh), for which many immune cell types express cholinergic receptors (AChR). In the last decade the vagal nerve has emerged as an

  20. Multipactor theory for multicarrier signals

    International Nuclear Information System (INIS)

    Anza, S.; Vicente, C.; Gil, J.; Mattes, M.; Raboso, D.; Boria, V. E.; Gimeno, B.

    2011-01-01

    This work presents a new theory of multipactor under multicarrier signals for parallel-plate geometries, assuming a homogeneous electric field and one-dimensional electron motion. It is the generalization of the nonstationary multipactor theory for single-carrier signals [S. Anza et al.,Phys. Plasmas 17, 062110 (2010)]. It is valid for multicarrier signals with an arbitrary number of carriers with different amplitude, arbitrary frequency, and phase conditions and for any material coating. This new theory is able to model the real dynamics of the electrons during the multipactor discharge for both single and double surface interactions. Among other parameters of the discharge, it calculates the evolution in time of the charge growth, electron absorption, and creation rates as well as the instantaneous secondary emission yield and order. An extensive set of numerical tests with particle-in-cell software has been carried out in order to validate the theory under many different conditions. This theoretical development constitutes the first multipactor theory which completely characterizes the multipactor discharge for arbitrary multicarrier signals, setting the first step for further investigations in the field.

  1. Eliminating ambiguity in digital signals

    Science.gov (United States)

    Weber, W. J., III

    1979-01-01

    Multiamplitude minimum shift keying (mamsk) transmission system, method of differential encoding overcomes problem of ambiguity associated with advanced digital-transmission techniques with little or no penalty in transmission rate, error rate, or system complexity. Principle of method states, if signal points are properly encoded and decoded, bits are detected correctly, regardless of phase ambiguities.

  2. Mathematical Modelling Plant Signalling Networks

    KAUST Repository

    Muraro, D.

    2013-01-01

    During the last two decades, molecular genetic studies and the completion of the sequencing of the Arabidopsis thaliana genome have increased knowledge of hormonal regulation in plants. These signal transduction pathways act in concert through gene regulatory and signalling networks whose main components have begun to be elucidated. Our understanding of the resulting cellular processes is hindered by the complex, and sometimes counter-intuitive, dynamics of the networks, which may be interconnected through feedback controls and cross-regulation. Mathematical modelling provides a valuable tool to investigate such dynamics and to perform in silico experiments that may not be easily carried out in a laboratory. In this article, we firstly review general methods for modelling gene and signalling networks and their application in plants. We then describe specific models of hormonal perception and cross-talk in plants. This mathematical analysis of sub-cellular molecular mechanisms paves the way for more comprehensive modelling studies of hormonal transport and signalling in a multi-scale setting. © EDP Sciences, 2013.

  3. [Automated processing of electrophysiologic signals].

    Science.gov (United States)

    Korenevskiĭ, N A; Gubanov, V V

    1995-01-01

    The paper outlines a diagram of a multichannel analyzer of electrophysiological signals while are significantly non-stationary (such as those of electroencephalograms, myograms, etc.), by using a method based on the ranging procedure by the change-over points which may be the points of infection, impaired locality, minima, maxima, discontinuity, etc.

  4. Biophysical Aspects of Transmembrane Signaling

    CERN Document Server

    Damjanovich, Sandor

    2005-01-01

    Transmembrane signaling is one of the most significant cell biological events in the life and death of cells in general and lymphocytes in particular. Until recently biochemists and biophysicists were not accustomed to thinking of these processes from the side of a high number of complex biochemical events and an equally high number of physical changes at molecular and cellular levels at the same time. Both types of researchers were convinced that their findings are the most decisive, having higher importance than the findings of the other scientist population. Both casts were wrong. Life, even at cellular level, has a number of interacting physical and biochemical mechanisms, which finally build up the creation of an "excited" cell that will respond to particular signals from the outer or inner world. This book handles both aspects of the signalling events, and in some cases tries to unify our concepts and help understand the signals that govern the life and death of our cells. Not only the understanding, bu...

  5. EUROmediCAT signal detection

    DEFF Research Database (Denmark)

    Given, Joanne E; Loane, Maria; Luteijn, Johannes Michiel

    2016-01-01

    AIMS: To evaluate congenital anomaly (CA)-medication exposure associations produced by the new EUROmediCAT signal detection system and determine which require further investigation. METHODS: Data from 15 EUROCAT registries (1995-2011) with medication exposures at the chemical substance (5th level...

  6. Syndecans, signaling, and cell adhesion

    DEFF Research Database (Denmark)

    Couchman, J R; Woods, A

    1996-01-01

    structures within the heparan sulfate chains, leaving the roles of chondroitin sulfate chains and extracellular portion of the core proteins to be elucidated. Evidence that syndecans are a class of receptor involved in cell adhesion is mounting, and their small cytoplasmic domains may link...... transmembrane signaling from matrix to cytoskeleton, as proposed for other classes of adhesion receptors....

  7. Tyrosine Phosphorylation in Brassinosteroid Signaling

    Science.gov (United States)

    Brassinosteroids (BRs) regulate plant growth and development through a complex signal transduction pathway involving BRASSINOSTEROID INSENSITIVE 1 (BRI1), which is the BR receptor, and its co-receptor BRI1-ASSOCIATED KINASE 1 (BAK1). Both proteins are classified as Ser/Thr protein kinases. Recently,...

  8. VEGF Signaling in Neurological Disorders

    Directory of Open Access Journals (Sweden)

    Joon W. Shim

    2018-01-01

    Full Text Available Vascular endothelial growth factor (VEGF is a potent growth factor playing diverse roles in vasculogenesis and angiogenesis. In the brain, VEGF mediates angiogenesis, neural migration and neuroprotection. As a permeability factor, excessive VEGF disrupts intracellular barriers, increases leakage of the choroid plexus endothelia, evokes edema, and activates the inflammatory pathway. Recently, we discovered that a heparin binding epidermal growth factor like growth factor (HB-EGF—a class of EGF receptor (EGFR family ligands—contributes to the development of hydrocephalus with subarachnoid hemorrhage through activation of VEGF signaling. The objective of this review is to entail a recent update on causes of death due to neurological disorders involving cerebrovascular and age-related neurological conditions and to understand the mechanism by which angiogenesis-dependent pathological events can be treated with VEGF antagonisms. The Global Burden of Disease study indicates that cancer and cardiovascular disease including ischemic and hemorrhagic stroke are two leading causes of death worldwide. The literature suggests that VEGF signaling in ischemic brains highlights the importance of concentration, timing, and alternate route of modulating VEGF signaling pathway. Molecular targets distinguishing two distinct pathways of VEGF signaling may provide novel therapies for the treatment of neurological disorders and for maintaining lower mortality due to these conditions.

  9. Robust power detector for wideband signals among many single tone signals

    Science.gov (United States)

    Musgrove, Cameron H.; Thompson, Douglas

    2018-03-06

    Various technologies for isolating a signal of interest from signals received contemporaneously by an antenna are described herein. A time period for which a signal of interest is present in a second signal can be identified based upon ratios of values of the second signal to the mean value of the second signal. When the ratio of the value of the second signal at a particular time to the mean of the second signal exceeds a threshold value, the signal of interest is considered to be present in the second signal.

  10. Predicting Secretory Proteins with SignalP

    DEFF Research Database (Denmark)

    Nielsen, Henrik

    2017-01-01

    SignalP is the currently most widely used program for prediction of signal peptides from amino acid sequences. Proteins with signal peptides are targeted to the secretory pathway, but are not necessarily secreted. After a brief introduction to the biology of signal peptides and the history...

  11. Measuring displacement signal with an accelerometer

    International Nuclear Information System (INIS)

    Han, Sang Bo

    2010-01-01

    An effective and simple way to reconstruct displacement signal from a measured acceleration signal is proposed in this paper. To reconstruct displacement signal by means of double-integrating the time domain acceleration signal, the Nyquist frequency of the digital sampling of the acceleration signal should be much higher than the highest frequency component of the signal. On the other hand, to reconstruct displacement signal by taking the inverse Fourier transform, the magnitude of the significant frequency components of the Fourier transform of the acceleration signal should be greater than the 6 dB increment line along the frequency axis. With a predetermined resolution in time and frequency domain, determined by the sampling rate to measure and record the original signal, reconstructing high-frequency signals in the time domain and reconstructing low-frequency signals in the frequency domain will produce biased errors. Furthermore, because of the DC components inevitably included in the sampling process, low-frequency components of the signals are overestimated when displacement signals are reconstructed from the Fourier transform of the acceleration signal. The proposed method utilizes curve-fitting around the significant frequency components of the Fourier transform of the acceleration signal before it is inverse-Fourier transformed. Curve-fitting around the dominant frequency components provides much better results than simply ignoring the insignificant frequency components of the signal

  12. Liquid argon TPC signal formation, signal processing and reconstruction techniques

    Science.gov (United States)

    Baller, B.

    2017-07-01

    This document describes a reconstruction chain that was developed for the ArgoNeuT and MicroBooNE experiments at Fermilab. These experiments study accelerator neutrino interactions that occur in a Liquid Argon Time Projection Chamber. Reconstructing the properties of particles produced in these interactions benefits from the knowledge of the micro-physics processes that affect the creation and transport of ionization electrons to the readout system. A wire signal deconvolution technique was developed to convert wire signals to a standard form for hit reconstruction, to remove artifacts in the electronics chain and to remove coherent noise. A unique clustering algorithm reconstructs line-like trajectories and vertices in two dimensions which are then matched to create of 3D objects. These techniques and algorithms are available to all experiments that use the LArSoft suite of software.

  13. The Fog signaling pathway: Insights into signaling in morphogenesis

    Science.gov (United States)

    Manning, Alyssa J.; Rogers, Stephen L.

    2014-01-01

    Epithelia form the building blocks of many tissue and organ types. Epithelial cells often form a contiguous 2-dimensional sheet that is held together by strong adhesions. The mechanical properties conferred by these adhesions allow the cells to undergo dramatic three-dimensional morphogenetic movements while maintaining cell–cell contacts during embryogenesis and post-embryonic development. The Drosophila Folded gastrulation pathway triggers epithelial cell shape changes that drive gastrulation and tissue folding and is one of the most extensively studied examples of epithelial morphogenesis. This pathway has yielded key insights into the signaling mechanisms and cellular machinery involved in epithelial remodeling. In this review, we discuss principles of morphogenesis and signaling that have been discovered through genetic and cell biological examination of this pathway. We also consider various regulatory mechanisms and the system's relevance to mammalian development. We propose future directions that will continue to broaden our knowledge of morphogenesis across taxa. PMID:25127992

  14. Experiment and practice on signal processing

    International Nuclear Information System (INIS)

    2002-11-01

    The contents of this book contains basic practice of CEM Tool, discrete time signal and experiment and practice of system, experiment and practice of discrete time signal sampling, practice of frequency analysis, experiment of digital filter design, application of digital signal processing, project related voice, basic principle of signal processing, the technique of basic image signal processing, biology astronomy and Robot soccer with apply of image signal processing technique, control video signal and project related image. It also has an introduction of CEM Linker I. O in the end.

  15. Experiment and practice on signal processing

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2002-11-15

    The contents of this book contains basic practice of CEM Tool, discrete time signal and experiment and practice of system, experiment and practice of discrete time signal sampling, practice of frequency analysis, experiment of digital filter design, application of digital signal processing, project related voice, basic principle of signal processing, the technique of basic image signal processing, biology astronomy and Robot soccer with apply of image signal processing technique, control video signal and project related image. It also has an introduction of CEM Linker I. O in the end.

  16. Flanking signal and mature peptide residues influence signal peptide cleavage

    Directory of Open Access Journals (Sweden)

    Ranganathan Shoba

    2008-12-01

    Full Text Available Abstract Background Signal peptides (SPs mediate the targeting of secretory precursor proteins to the correct subcellular compartments in prokaryotes and eukaryotes. Identifying these transient peptides is crucial to the medical, food and beverage and biotechnology industries yet our understanding of these peptides remains limited. This paper examines the most common type of signal peptides cleavable by the endoprotease signal peptidase I (SPase I, and the residues flanking the cleavage sites of three groups of signal peptide sequences, namely (i eukaryotes (Euk (ii Gram-positive (Gram+ bacteria, and (iii Gram-negative (Gram- bacteria. Results In this study, 2352 secretory peptide sequences from a variety of organisms with amino-terminal SPs are extracted from the manually curated SPdb database for analysis based on physicochemical properties such as pI, aliphatic index, GRAVY score, hydrophobicity, net charge and position-specific residue preferences. Our findings show that the three groups share several similarities in general, but they display distinctive features upon examination in terms of their amino acid compositions and frequencies, and various physico-chemical properties. Thus, analysis or prediction of their sequences should be separated and treated as distinct groups. Conclusion We conclude that the peptide segment recognized by SPase I extends to the start of the mature protein to a limited extent, upon our survey of the amino acid residues surrounding the cleavage processing site. These flanking residues possibly influence the cleavage processing and contribute to non-canonical cleavage sites. Our findings are applicable in defining more accurate prediction tools for recognition and identification of cleavage site of SPs.

  17. SignalPlant: an open signal processing software platform

    Czech Academy of Sciences Publication Activity Database

    Plešinger, Filip; Jurčo, Juraj; Halámek, Josef; Jurák, Pavel

    2016-01-01

    Roč. 37, č. 7 (2016), N38-N48 ISSN 0967-3334 R&D Projects: GA ČR GAP103/11/0933; GA MŠk(CZ) LO1212; GA ČR GAP102/12/2034 Institutional support: RVO:68081731 Keywords : data visualization * software * signal processing * ECG * EEG Subject RIV: FS - Medical Facilities ; Equipment Impact factor: 2.058, year: 2016

  18. Signal-to-Signal Ratio Independent Speaker Identification for Co-channel Speech Signals

    DEFF Research Database (Denmark)

    Saeidi, Rahim; Mowlaee, Pejman; Kinnunen, Tomi

    2010-01-01

    In this paper, we consider speaker identification for the co-channel scenario in which speech mixture from speakers is recorded by one microphone only. The goal is to identify both of the speakers from their mixed signal. High recognition accuracies have already been reported when an accurately...

  19. Signal processing for smart cards

    Science.gov (United States)

    Quisquater, Jean-Jacques; Samyde, David

    2003-06-01

    In 1998, Paul Kocher showed that when a smart card computes cryptographic algorithms, for signatures or encryption, its consumption or its radiations leak information. The keys or the secrets hidden in the card can then be recovered using a differential measurement based on the intercorrelation function. A lot of silicon manufacturers use desynchronization countermeasures to defeat power analysis. In this article we detail a new resynchronization technic. This method can be used to facilitate the use of a neural network to do the code recognition. It becomes possible to reverse engineer a software code automatically. Using data and clock separation methods, we show how to optimize the synchronization using signal processing. Then we compare these methods with watermarking methods for 1D and 2D signal. The very last watermarking detection improvements can be applied to signal processing for smart cards with very few modifications. Bayesian processing is one of the best ways to do Differential Power Analysis, and it is possible to extract a PIN code from a smart card in very few samples. So this article shows the need to continue to set up effective countermeasures for cryptographic processors. Although the idea to use advanced signal processing operators has been commonly known for a long time, no publication explains that results can be obtained. The main idea of differential measurement is to use the cross-correlation of two random variables and to repeat consumption measurements on the processor to be analyzed. We use two processors clocked at the same external frequency and computing the same data. The applications of our design are numerous. Two measurements provide the inputs of a central operator. With the most accurate operator we can improve the signal noise ratio, re-synchronize the acquisition clock with the internal one, or remove jitter. The analysis based on consumption or electromagnetic measurements can be improved using our structure. At first sight

  20. ROS signalling - specificity is required

    DEFF Research Database (Denmark)

    Møller, Ian M; Sweetlove, Lee J

    2010-01-01

    Reactive oxygen species (ROS) production increases in plants under stress. ROS can damage cellular components, but they can also act in signal transduction to help the cell counteract the oxidative damage in the stressed compartment. H2O2 might induce a general stress response, but it does not have...... the required specificity to selectively regulate nuclear genes required for dealing with localized stress, e.g. in chloroplasts or mitochondria. Here we argue that peptides deriving from proteolytic breakdown of oxidatively damaged proteins have the requisite specificity to act as secondary ROS messengers...... and regulate source-specific genes and in this way contribute to retrograde ROS signalling during oxidative stress. Likewise, unmodified peptides deriving from the breakdown of redundant proteins could help coordinate organellar and nuclear gene expression...

  1. Cellular semiotics and signal transduction

    DEFF Research Database (Denmark)

    Bruni, Luis Emilio

    2007-01-01

    Semiosis, the processes of production, communication and interpretation of signs - coding and de-coding - takes place within and between organisms. The term "endosemiosis" refers to the processes of interpretation and sign transmission inside an organism (as opposed to "exosemiosis", which refers...... to the processes of sign interpretation and transmission between organisms of the same or different species). In Biosemiotics it is customary to recognise the cell as the most elementary integration unit for semiosis. Therefore intra and intercellular communication constitute the departure point for the study...... considering semiotic logic in order to construct our understanding of living phenomena. Given the central integrating role of signal transduction in physiological and ecological studies, this chapter outlines its semiotic implications. The multi-modality and modularity of signal molecules and relative...

  2. Ambient temperature signalling in plants.

    Science.gov (United States)

    Wigge, Philip A

    2013-10-01

    Plants are exposed to daily and seasonal fluctuations in temperature. Within the 'ambient' temperature range (about 12-27°C for Arabidopsis) temperature differences have large effects on plant growth and development, disease resistance pathways and the circadian clock without activating temperature stress pathways. It is this developmental sensing and response to non-stressful temperatures that will be covered in this review. Recent advances have revealed key players in mediating temperature signals. The bHLH transcription factor PHYTOCHROME INTERACTING FACTOR4 (PIF4) has been shown to be a hub for multiple responses to warmer temperature in Arabidopsis, including flowering and hypocotyl elongation. Changes in chromatin state are involved in transmitting temperature signals to the transcriptome. Determining the precise mechanisms of temperature perception represents an exciting goal for the field. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Multimedia signal coding and transmission

    CERN Document Server

    Ohm, Jens-Rainer

    2015-01-01

    This textbook covers the theoretical background of one- and multidimensional signal processing, statistical analysis and modelling, coding and information theory with regard to the principles and design of image, video and audio compression systems. The theoretical concepts are augmented by practical examples of algorithms for multimedia signal coding technology, and related transmission aspects. On this basis, principles behind multimedia coding standards, including most recent developments like High Efficiency Video Coding, can be well understood. Furthermore, potential advances in future development are pointed out. Numerous figures and examples help to illustrate the concepts covered. The book was developed on the basis of a graduate-level university course, and most chapters are supplemented by exercises. The book is also a self-contained introduction both for researchers and developers of multimedia compression systems in industry.

  4. Acoustic Localization with Infrasonic Signals

    Science.gov (United States)

    Threatt, Arnesha; Elbing, Brian

    2015-11-01

    Numerous geophysical and anthropogenic events emit infrasonic frequencies (<20 Hz), including volcanoes, hurricanes, wind turbines and tornadoes. These sounds, which cannot be heard by the human ear, can be detected from large distances (in excess of 100 miles) due to low frequency acoustic signals having a very low decay rate in the atmosphere. Thus infrasound could be used for long-range, passive monitoring and detection of these events. An array of microphones separated by known distances can be used to locate a given source, which is known as acoustic localization. However, acoustic localization with infrasound is particularly challenging due to contamination from other signals, sensitivity to wind noise and producing a trusted source for system development. The objective of the current work is to create an infrasonic source using a propane torch wand or a subwoofer and locate the source using multiple infrasonic microphones. This presentation will present preliminary results from various microphone configurations used to locate the source.

  5. The IRS-1 signaling system.

    Science.gov (United States)

    Myers, M G; Sun, X J; White, M F

    1994-07-01

    Insulin-receptor substrate 1 (IRS-1) is a principal substrate of the receptor tyrosine kinase for insulin and insulin-like growth factor 1, and a substrate for a tyrosine kinase activated by interleukin 4. IRS-1 undergoes multisite tyrosine phosphorylation and mediates downstream signals by 'docking' various proteins that contain Src homology 2 domains. IRS-1 appears to be a unique molecule; however, 4PS, a protein found mainly in hemopoietic cells, may represent another member of this family.

  6. Cell signalling and phospholipid metabolism

    Energy Technology Data Exchange (ETDEWEB)

    Boss, W.F.

    1990-01-01

    These studies explored whether phosphoinositide (PI) has a role in plants analogous to its role in animal cells. Although no parallel activity of PI in signal transduction was found in plant cells, activity of inositol phospholipid kinase was found to be modulated by light and by cell wall degrading enzymes. These studies indicate a major role for inositol phospholipids in plant growth and development as membrane effectors but not as a source of second messengers.

  7. Signals of new gauge bosons

    International Nuclear Information System (INIS)

    Djouadi, A.; Leike, A.; Riemann, T.; Schaile, D.; Verzegnassi, C.

    1991-12-01

    We analyze signals of additional neutral gauge bosons originating from E 6 and Left-Right models, at a future e + e - collider with 500 GeV c.m. energy. Radiative corrections as well as the experimental situation are taken into account. We show that masses considerably higher than the total energy can be probed, and that a discrimination between theoretical models is possible. (orig.)

  8. Signal and image multiresolution analysis

    CERN Document Server

    Ouahabi, Abdelialil

    2012-01-01

    Multiresolution analysis using the wavelet transform has received considerable attention in recent years by researchers in various fields. It is a powerful tool for efficiently representing signals and images at multiple levels of detail with many inherent advantages, including compression, level-of-detail display, progressive transmission, level-of-detail editing, filtering, modeling, fractals and multifractals, etc.This book aims to provide a simple formalization and new clarity on multiresolution analysis, rendering accessible obscure techniques, and merging, unifying or completing

  9. Job market signals and signs

    OpenAIRE

    Streb, Jorge M.

    2006-01-01

    What happens to job market signaling under two-dimensional asymmetric information? With 2 types of productivity and noise, the equilibrium remains separating if an extended single-crossing condition is satisfied. If not, there are partially pooling equilibria where only extreme types can be distinguished, and supplementary information is needed. On-the-job interaction gives employers private information on productivity, which employment relationships may reveal to the market. While sticky wag...

  10. Cytoskeleton in mast cell signaling

    Czech Academy of Sciences Publication Activity Database

    Dráber, Pavel; Sulimenko, Vadym; Dráberová, Eduarda

    2012-01-01

    Roč. 3, May (2012), s. 130 ISSN 1664-3224 R&D Projects: GA ČR GAP302/10/1701; GA ČR GPP302/11/P709; GA ČR GAP302/12/1673 Grant - others:ECST(XE) Action BM1007 Institutional research plan: CEZ:AV0Z50520514 Keywords : cytoskeleton * mast cell activation * signal transduction Subject RIV: EB - Genetics ; Molecular Biology

  11. Detection of signals in noise

    CERN Document Server

    McDonough, Robert N

    1995-01-01

    The Second Edition is an updated revision to the authors highly successful and widely used introduction to the principles and application of the statistical theory of signal detection. This book emphasizes those theories that have been found to be particularly useful in practice including principles applied to detection problems encountered in digital communications, radar, and sonar.Detection processing based upon the fast Fourier transform

  12. Intracellular calcium homeostasis and signaling.

    Science.gov (United States)

    Brini, Marisa; Calì, Tito; Ottolini, Denis; Carafoli, Ernesto

    2013-01-01

    Ca(2+) is a universal carrier of biological information: it controls cell life from its origin at fertilization to its end in the process of programmed cell death. Ca(2+) is a conventional diffusible second messenger released inside cells by the interaction of first messengers with plasma membrane receptors. However, it can also penetrate directly into cells to deliver information without the intermediation of first or second messengers. Even more distinctively, Ca(2+) can act as a first messenger, by interacting with a plasma membrane receptor to set in motion intracellular signaling pathways that involve Ca(2+) itself. Perhaps the most distinctive property of the Ca(2+) signal is its ambivalence: while essential to the correct functioning of cells, Ca(2+) becomes an agent that mediates cell distress, or even (toxic) cell death, if its concentration and movements inside cells are not carefully tuned. Ca(2+) is controlled by reversible complexation to specific proteins, which could be pure Ca(2+) buffers, or which, in addition to buffering Ca(2+), also decode its signal to pass it on to targets. The most important actors in the buffering of cell Ca(2+) are proteins that transport it across the plasma membrane and the membrane of the organelles: some have high Ca(2+) affinity and low transport capacity (e.g., Ca(2+) pumps), others have opposite properties (e.g., the Ca(2+) uptake system of mitochondria). Between the initial event of fertilization, and the terminal event of programmed cell death, the Ca(2+) signal regulates the most important activities of the cell, from the expression of genes, to heart and muscle contraction and other motility processes, to diverse metabolic pathways involved in the generation of cell fuels.

  13. Dynamics in atomic signaling games

    KAUST Repository

    Fox, Michael J.

    2015-04-08

    We study an atomic signaling game under stochastic evolutionary dynamics. There are a finite number of players who repeatedly update from a finite number of available languages/signaling strategies. Players imitate the most fit agents with high probability or mutate with low probability. We analyze the long-run distribution of states and show that, for sufficiently small mutation probability, its support is limited to efficient communication systems. We find that this behavior is insensitive to the particular choice of evolutionary dynamic, a property that is due to the game having a potential structure with a potential function corresponding to average fitness. Consequently, the model supports conclusions similar to those found in the literature on language competition. That is, we show that efficient languages eventually predominate the society while reproducing the empirical phenomenon of linguistic drift. The emergence of efficiency in the atomic case can be contrasted with results for non-atomic signaling games that establish the non-negligible possibility of convergence, under replicator dynamics, to states of unbounded efficiency loss.

  14. Calcium Signals from the Vacuole

    Directory of Open Access Journals (Sweden)

    Gerald Schönknecht

    2013-10-01

    Full Text Available The vacuole is by far the largest intracellular Ca2+ store in most plant cells. Here, the current knowledge about the molecular mechanisms of vacuolar Ca2+ release and Ca2+ uptake is summarized, and how different vacuolar Ca2+ channels and Ca2+ pumps may contribute to Ca2+ signaling in plant cells is discussed. To provide a phylogenetic perspective, the distribution of potential vacuolar Ca2+ transporters is compared for different clades of photosynthetic eukaryotes. There are several candidates for vacuolar Ca2+ channels that could elicit cytosolic [Ca2+] transients. Typical second messengers, such as InsP3 and cADPR, seem to trigger vacuolar Ca2+ release, but the molecular mechanism of this Ca2+ release still awaits elucidation. Some vacuolar Ca2+ channels have been identified on a molecular level, the voltage-dependent SV/TPC1 channel, and recently two cyclic-nucleotide-gated cation channels. However, their function in Ca2+ signaling still has to be demonstrated. Ca2+ pumps in addition to establishing long-term Ca2+ homeostasis can shape cytosolic [Ca2+] transients by limiting their amplitude and duration, and may thus affect Ca2+ signaling.

  15. Bile Acid Metabolism and Signaling

    Science.gov (United States)

    Chiang, John Y. L.

    2015-01-01

    Bile acids are important physiological agents for intestinal nutrient absorption and biliary secretion of lipids, toxic metabolites, and xenobiotics. Bile acids also are signaling molecules and metabolic regulators that activate nuclear receptors and G protein-coupled receptor (GPCR) signaling to regulate hepatic lipid, glucose, and energy homeostasis and maintain metabolic homeostasis. Conversion of cholesterol to bile acids is critical for maintaining cholesterol homeostasis and preventing accumulation of cholesterol, triglycerides, and toxic metabolites, and injury in the liver and other organs. Enterohepatic circulation of bile acids from the liver to intestine and back to the liver plays a central role in nutrient absorption and distribution, and metabolic regulation and homeostasis. This physiological process is regulated by a complex membrane transport system in the liver and intestine regulated by nuclear receptors. Toxic bile acids may cause inflammation, apoptosis, and cell death. On the other hand, bile acid-activated nuclear and GPCR signaling protects against inflammation in liver, intestine, and macrophages. Disorders in bile acid metabolism cause cholestatic liver diseases, dyslipidemia, fatty liver diseases, cardiovascular diseases, and diabetes. Bile acids, bile acid derivatives, and bile acid sequestrants are therapeutic agents for treating chronic liver diseases, obesity, and diabetes in humans. PMID:23897684

  16. Diabetes: Models, Signals and control

    Science.gov (United States)

    Cobelli, C.

    2010-07-01

    Diabetes and its complications impose significant economic consequences on individuals, families, health systems, and countries. The control of diabetes is an interdisciplinary endeavor, which includes significant components of modeling, signal processing and control. Models: first, I will discuss the minimal (coarse) models which describe the key components of the system functionality and are capable of measuring crucial processes of glucose metabolism and insulin control in health and diabetes; then, the maximal (fine-grain) models which include comprehensively all available knowledge about system functionality and are capable to simulate the glucose-insulin system in diabetes, thus making it possible to create simulation scenarios whereby cost effective experiments can be conducted in silico to assess the efficacy of various treatment strategies - in particular I will focus on the first in silico simulation model accepted by FDA as a substitute to animal trials in the quest for optimal diabetes control. Signals: I will review metabolic monitoring, with a particular emphasis on the new continuous glucose sensors, on the crucial role of models to enhance the interpretation of their time-series signals, and on the opportunities that they present for automation of diabetes control. Control: I will review control strategies that have been successfully employed in vivo or in silico, presenting a promise for the development of a future artificial pancreas and, in particular, I will discuss a modular architecture for building closed-loop control systems, including insulin delivery and patient safety supervision layers.

  17. Dynamics in atomic signaling games

    KAUST Repository

    Fox, Michael J.; Touri, Behrouz; Shamma, Jeff S.

    2015-01-01

    We study an atomic signaling game under stochastic evolutionary dynamics. There are a finite number of players who repeatedly update from a finite number of available languages/signaling strategies. Players imitate the most fit agents with high probability or mutate with low probability. We analyze the long-run distribution of states and show that, for sufficiently small mutation probability, its support is limited to efficient communication systems. We find that this behavior is insensitive to the particular choice of evolutionary dynamic, a property that is due to the game having a potential structure with a potential function corresponding to average fitness. Consequently, the model supports conclusions similar to those found in the literature on language competition. That is, we show that efficient languages eventually predominate the society while reproducing the empirical phenomenon of linguistic drift. The emergence of efficiency in the atomic case can be contrasted with results for non-atomic signaling games that establish the non-negligible possibility of convergence, under replicator dynamics, to states of unbounded efficiency loss.

  18. Signalling crosstalk in plants: emerging issues.

    Science.gov (United States)

    Taylor, Jane E; McAinsh, Martin R

    2004-01-01

    The Oxford English Dictionary defines crosstalk as 'unwanted transfer of signals between communication channels'. How does this definition relate to the way in which we view the organization and function of signalling pathways? Recent advances in the field of plant signalling have challenged the traditional view of a signalling transduction cascade as isolated linear pathways. Instead the picture emerging of the mechanisms by which plants transduce environmental signals is of the interaction between transduction chains. The manner in which these interactions occur (and indeed whether the transfer of these signals is 'unwanted' or beneficial) is currently the topic of intense research.

  19. Advanced digital signal processing and noise reduction

    CERN Document Server

    Vaseghi, Saeed V

    2008-01-01

    Digital signal processing plays a central role in the development of modern communication and information processing systems. The theory and application of signal processing is concerned with the identification, modelling and utilisation of patterns and structures in a signal process. The observation signals are often distorted, incomplete and noisy and therefore noise reduction, the removal of channel distortion, and replacement of lost samples are important parts of a signal processing system. The fourth edition of Advanced Digital Signal Processing and Noise Reduction updates an

  20. Problems of the Synthesis of Radar Signals,

    Science.gov (United States)

    1981-05-14

    recorded, finding out approximation/approach to certain signal x(t) , logical to ascribe a(w.) the phase spc -ctrum cf signal xft). the diffsrences...of the given cne). e will r~ spc -.ively d-stirguish se- cf Ch, signals of fixed Fericd cf rims X. frcm the sst cf Ch. signals of drbitrary duration X...XeXP~j IjM+a .t * An error in asymptotic soluticr can be ccnsidered now, being congruent/ squating found ChM signal z.,g(t) with ganerating signal

  1. Detection of Noise in Composite Step Signal Pattern by Visualizing Signal Waveforms

    Directory of Open Access Journals (Sweden)

    Chaman Verma

    2018-03-01

    Full Text Available The Step Composite Signals is the combination of vital informative signals that are compressed and coded to produce a predefined test image on a display device. It carries the desired sequence of information from source to destination. This information may be transmitted as digital signal, video information or data signal required as an input for the destination module. For testing of display panels, Composite Test Signals are the most important attribute of test signal transmission system. In the current research paper we present an approach for the noise detection in Composite Step Signal by analysing Composite Step Signal waveforms. The analysis of the signal waveforms reveals that the noise affected components of the signal and subsequently noise reduction process is initiated which targets noisy signal component only. Thus the quality of signal is not compromised during noise reduction process.

  2. EUROmediCAT signal detection

    DEFF Research Database (Denmark)

    Luteijn, Johannes Michiel; Morris, Joan K; Garne, Ester

    2016-01-01

    AIMS: Information about medication safety in pregnancy is inadequate. We aimed to develop a signal detection methodology to routinely identify unusual associations between medications and congenital anomalies using data collected by 15 European congenital anomaly registries. METHODS: EUROmedi...... for 40 385 medication anomaly combinations in the data. Simes multiple testing procedure with a 50% false discovery rate (FDR) identified associations least likely to be due to chance and those associations with more than two cases with the exposure and the anomaly were selected for further investigation...

  3. Small signal microwave amplifier design

    CERN Document Server

    Grosch, Theodore

    2000-01-01

    This book explains techniques and examples for designing stable amplifiers for high-frequency applications in which the signal is small and the amplifier circuit is linear. An in-depth discussion of linear network theory provides the foundation needed to develop actual designs. Examples throughout the book will show you how to apply the knowledge gained in each chapter leading to the complex design of low noise amplifiers. Many exercises at the end of each chapter will help students to practice their skills. The solutions to these design problems are available in an accompanying solutions book

  4. Fixed-point signal processing

    CERN Document Server

    Padgett, Wayne T

    2009-01-01

    This book is intended to fill the gap between the ""ideal precision"" digital signal processing (DSP) that is widely taught, and the limited precision implementation skills that are commonly required in fixed-point processors and field programmable gate arrays (FPGAs). These skills are often neglected at the university level, particularly for undergraduates. We have attempted to create a resource both for a DSP elective course and for the practicing engineer with a need to understand fixed-point implementation. Although we assume a background in DSP, Chapter 2 contains a review of basic theory

  5. Low power digital signal processing

    DEFF Research Database (Denmark)

    Paker, Ozgun

    2003-01-01

    hardwired ASICs and more than 6 21 times lower than current state of the art low-power DSP processors. An orthogonal but practical contribution of this thesis is the test bench implementation. A PCI-based FPGA board has been used to equip a standard desktop PC with tester facilities. The test bench proved...... to be a viable alternative to conventional expensive test equipment. Finally, the work presented in this thesis has been published at several IEEE workshops and conferences, and in the Journal of VLSI Signal Processing....

  6. New shaper of scintillation signals

    International Nuclear Information System (INIS)

    Brovchenko, V.G.

    2001-01-01

    Summation of the exponential shape pulse (abrupt front, exponential fall-off) with the pulse, proportional to its integral (the integration time constant is equal to the exponent fall-off constant), results in the pulse, the apex whereof is horizontal (parallel to the base line). Such a pulse is suitable for registration through standard analog-to-digital converters of the consecutive binary approximation, The described scheme is accomplished for verification of the basic principle of the shaper action. The parameters of the scheme are approximated to those ones, necessary for processing scintillation signals NaI(Tl) [ru

  7. Small Signal Loudspeaker Impedance Emulator

    DEFF Research Database (Denmark)

    Iversen, Niels Elkjær; Knott, Arnold

    2014-01-01

    Specifying the performance of audio amplifiers is typically done by playing sine waves into a pure ohmic load. However real loudspeaker impedances are not purely ohmic but characterized by the mechanical resonance between the mass of the diaphragm and the compliance of its suspension which vary...... from driver to driver. Therefore, a loudspeaker emulator capable of adjusting its impedance to that of a given driver is desired for measurement purposes. This paper proposes a loudspeaker emulator circuit for small signals. Simulations and experimental results are compared and show that it is possible...... to emulate the loudspeaker impedance with an electric circuit and that its resonance frequency can be changed by tuning two resistors....

  8. Biomedical signals, imaging, and informatics

    CERN Document Server

    Bronzino, Joseph D

    2014-01-01

    Known as the bible of biomedical engineering, The Biomedical Engineering Handbook, Fourth Edition, sets the standard against which all other references of this nature are measured. As such, it has served as a major resource for both skilled professionals and novices to biomedical engineering.Biomedical Signals, Imaging, and Informatics, the third volume of the handbook, presents material from respected scientists with diverse backgrounds in biosignal processing, medical imaging, infrared imaging, and medical informatics.More than three dozen specific topics are examined, including biomedical s

  9. Cognitive Algorithms for Signal Processing

    Science.gov (United States)

    2011-03-18

    Analysis of Millennial Spiritual Issues,” Zygon, Journal of Science and Religion , 43(4), 797-821, 2008. [46] R. Linnehan, C. Mutz, L.I. Perlovsky, B...dimensions of X and Y : (a) true ‘smile’ and ‘frown’ patterns are shown without clutter; (b) actual image available for recognition (signal is below...clutter in 2 dimensions of X(n) = (X, Y ), is given by l(X(n)|m = clutter) = 1/ (X •  Y ), X = (Xmax-Xmin),  Y = (Ymax-Ymin); (6) 13 Minimal

  10. Expert AE signal arrival detection

    Czech Academy of Sciences Publication Activity Database

    Chlada, Milan; Převorovský, Zdeněk

    2011-01-01

    Roč. 6, 3/4 (2011), s. 191-205 ISSN 1741-8410. [NDT in PROGRESS /4./. Praha, 05.11.2007-07.11.2007] R&D Projects: GA MPO(CZ) FR-TI1/274; GA ČR GA101/07/1518 Institutional research plan: CEZ:AV0Z20760514 Keywords : acoustic emission * signal arrival detection Subject RIV: BI - Acoustics http://www.inderscience.com/search/index.php?mainAction=search& action =record&rec_id=43215&prevQuery=&ps=10&m=or

  11. Signaling and the Education Premium

    OpenAIRE

    Gregory Kurtzon

    2004-01-01

    A large portion of the rise in the education premium can be explained by a signaling theory of education which predicts that in the future, increases in the education level of the workforce will actually cause the education premium to rise, simply because different workers are being labeled as “highly educated†. This prediction is supported by past behavior of the high school education premium. It runs counter to the view that increases in the relative supply of high education workers wil...

  12. Surface Weather, Signal Service and Weather Bureau

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Surface Weather, Signal Service and Weather Bureau (SWSSWB) Records primarily created by the United States Army Signal Service from 1819 until the paid and voluntary...

  13. Ghost signals in Allison emittance scanners

    International Nuclear Information System (INIS)

    Stockli, Martin P.; Leitner, M.; Moehs, D.P.; Keller, R.; Welton, R.F.

    2004-01-01

    For over 20 years, Allison scanners have been used to measure emittances of low-energy ion beams. We show that scanning large trajectory angles produces ghost signals caused by the sampled beamlet impacting on an electric deflection plate. The ghost signal strength is proportional to the amount of beam entering the scanner. Depending on the ions, and their velocity, the ghost signals can have the opposite or the same polarity as the main beam signals. The ghost signals cause significant errors in the emittance estimates because they appear at large trajectory angles. These ghost signals often go undetected because they partly overlap with the real signals, are mostly below the 1% level, and often hide in the noise. A simple deflection plate modification is shown to reduce the ghost signal strength by over 99%

  14. Detection of Transient Signals in Doppler Spectra

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Signal processing is used to detect transient signals in the presence of noise. Two embodiments are disclosed. In both embodiments, the time series from a remote...

  15. Sonic Hedgehog Signaling Promotes Tumor Growth

    National Research Council Canada - National Science Library

    Bushman, Wade

    2007-01-01

    ... of the DOD New Investigator award indicate that Shh signaling promotes tumor growth. This proposal addresses the hypothesis that Sonic hedgehog signaling promotes tumor growth by activating stromal cell gene expression...

  16. Induced disease resistance signaling in plants

    NARCIS (Netherlands)

    Verhagen, B.W.M.; Loon, L.C. van; Pieterse, C.M.J.

    2006-01-01

    To protect themselves from disease, plants have evolved sophisticated inducible defense mechanisms in which the signal molecules salicylic acid, jasmonic acid and ethylene often play crucial roles. Elucidation of signaling pathways controlling induced disease resistance is a major objective in

  17. Ghost Signals In Allison Emittance Scanners

    International Nuclear Information System (INIS)

    Stockli, Martin P.; Leitner, M.; Keller, R.; Moehs, D.P.; Welton, R. F.

    2005-01-01

    For over 20 years, Allison scanners have been used to measure emittances of low-energy ion beams. We show that scanning large trajectory angles produces ghost signals caused by the sampled beamlet impacting on an electric deflection plate. The ghost signal strength is proportional to the amount of beam entering the scanner. Depending on the ions, and their velocity, the ghost signals can have the opposite or the same polarity as the main beam signals. The ghost signals cause significant errors in the emittance estimates because they appear at large trajectory angles. These ghost signals often go undetected because they partly overlap with the real signals, are mostly below the 1% level, and often hide in the noise. A simple deflection plate modification is shown to reduce the ghost signal strength by over 99%

  18. Blind Signal Classification via Spare Coding

    Science.gov (United States)

    2016-04-10

    Blind Signal Classification via Sparse Coding Youngjune Gwon MIT Lincoln Laboratory gyj@ll.mit.edu Siamak Dastangoo MIT Lincoln Laboratory sia...achieve blind signal classification with no prior knowledge about signals (e.g., MCS, pulse shaping) in an arbitrary RF channel. Since modulated RF...classification method. Our results indicate that we can separate different classes of digitally modulated signals from blind sampling with 70.3% recall and 24.6

  19. Purinergic signalling in epithelial ion transport

    DEFF Research Database (Denmark)

    Novak, Ivana

    2011-01-01

    , including ion transport. In this review, I will first introduce the main components of the extracellular ATP signalling, which have become known as the purinergic signalling system. With more than 50 components or processes, just at cell membranes, it ranks as one of the most versatile signalling systems......-regulators of secretion. On an organ level, both receptor types can exert physiological functions and together with other partners in the purinergic signalling, integrated models for epithelial secretion and absorption are emerging....

  20. Signals of lepton number violation

    CERN Document Server

    Panella, O; Srivastava, Y N

    1999-01-01

    The production of like-sign-dileptons (LSD), in the high energy lepton number violating ( Delta L=+2) reaction, pp to 2jets+l/sup +/l /sup +/, (l=e, mu , tau ), of interest for the experiments to be performed at the forthcoming Large Hadron Collider (LHC), is reported, taking up a composite model scenario in which the exchanged virtual composite neutrino is assumed to be a Majorana particle. Numerical estimates of the corresponding signal cross-section that implement kinematical cuts needed to suppress the standard model background, are presented which show that in some regions of the parameter space the total number of LSD events is well above the background. Assuming non-observation of the LSD signal it is found that LHC would exclude a composite Majorana neutrino up to 700 GeV (if one requires 10 events for discovery). The sensitivity of LHC experiments to the parameter space is then compared to that of the next generation of neutrinoless double beta decay ( beta beta /sub 0 nu /) experiment, GENIUS, and i...

  1. Redox signaling in acute pancreatitis

    Science.gov (United States)

    Pérez, Salvador; Pereda, Javier; Sabater, Luis; Sastre, Juan

    2015-01-01

    Acute pancreatitis is an inflammatory process of the pancreatic gland that eventually may lead to a severe systemic inflammatory response. A key event in pancreatic damage is the intracellular activation of NF-κB and zymogens, involving also calcium, cathepsins, pH disorders, autophagy, and cell death, particularly necrosis. This review focuses on the new role of redox signaling in acute pancreatitis. Oxidative stress and redox status are involved in the onset of acute pancreatitis and also in the development of the systemic inflammatory response, being glutathione depletion, xanthine oxidase activation, and thiol oxidation in proteins critical features of the disease in the pancreas. On the other hand, the release of extracellular hemoglobin into the circulation from the ascitic fluid in severe necrotizing pancreatitis enhances lipid peroxidation in plasma and the inflammatory infiltrate into the lung and up-regulates the HIF–VEGF pathway, contributing to the systemic inflammatory response. Therefore, redox signaling and oxidative stress contribute to the local and systemic inflammatory response during acute pancreatitis. PMID:25778551

  2. Redox signaling in acute pancreatitis

    Directory of Open Access Journals (Sweden)

    Salvador Pérez

    2015-08-01

    Full Text Available Acute pancreatitis is an inflammatory process of the pancreatic gland that eventually may lead to a severe systemic inflammatory response. A key event in pancreatic damage is the intracellular activation of NF-κB and zymogens, involving also calcium, cathepsins, pH disorders, autophagy, and cell death, particularly necrosis. This review focuses on the new role of redox signaling in acute pancreatitis. Oxidative stress and redox status are involved in the onset of acute pancreatitis and also in the development of the systemic inflammatory response, being glutathione depletion, xanthine oxidase activation, and thiol oxidation in proteins critical features of the disease in the pancreas. On the other hand, the release of extracellular hemoglobin into the circulation from the ascitic fluid in severe necrotizing pancreatitis enhances lipid peroxidation in plasma and the inflammatory infiltrate into the lung and up-regulates the HIF–VEGF pathway, contributing to the systemic inflammatory response. Therefore, redox signaling and oxidative stress contribute to the local and systemic inflammatory response during acute pancreatitis.

  3. Prostaglandin Receptor Signaling in Disease

    Directory of Open Access Journals (Sweden)

    Toshiyuki Matsuoka

    2007-01-01

    Full Text Available Prostanoids, consisting of the prostaglandins (PGs and the thromboxanes (TXs, are a group of lipid mediators formed in response to various stimuli. They include PGD2, PGE2, PGF2α, PGI2, and TXA2. They are released outside of the cells immediately after synthesis, and exert their actions by binding to a G-protein coupled rhodopsin-type receptor on the surface of target cells. There are eight types of the prostanoid receptors conserved in mammals from mouse to human. They are the PGD receptor (DP, four subtypes of the PGE receptor (EP1, EP2, EP3, and EP4, the PGF receptor (FP, PGI receptor (IP, and TXA receptor (TP. Recently, mice deficient in each of these prostanoid receptors were generated and subjected to various experimental models of disease. These studies have revealed the roles of PG receptor signaling in various pathological conditions, and suggest that selective manipulation of the prostanoid receptors may be beneficial in treatment of the pathological conditions. Here we review these recent findings of roles of prostanoid receptor signaling and their therapeutic implications.

  4. Simulation of Silicon Photomultiplier Signals

    Science.gov (United States)

    Seifert, Stefan; van Dam, Herman T.; Huizenga, Jan; Vinke, Ruud; Dendooven, Peter; Lohner, Herbert; Schaart, Dennis R.

    2009-12-01

    In a silicon photomultiplier (SiPM), also referred to as multi-pixel photon counter (MPPC), many Geiger-mode avalanche photodiodes (GM-APDs) are connected in parallel so as to combine the photon counting capabilities of each of these so-called microcells into a proportional light sensor. The discharge of a single microcell is relatively well understood and electronic models exist to simulate this process. In this paper we introduce an extended model that is able to simulate the simultaneous discharge of multiple cells. This model is used to predict the SiPM signal in response to fast light pulses as a function of the number of fired cells, taking into account the influence of the input impedance of the SiPM preamplifier. The model predicts that the electronic signal is not proportional to the number of fired cells if the preamplifier input impedance is not zero. This effect becomes more important for SiPMs with lower parasitic capacitance (which otherwise is a favorable property). The model is validated by comparing its predictions to experimental data obtained with two different SiPMs (Hamamatsu S10362-11-25u and Hamamatsu S10362-33-25c) illuminated with ps laser pulses. The experimental results are in good agreement with the model predictions.

  5. Extracellular nucleotide signaling in plants

    Energy Technology Data Exchange (ETDEWEB)

    Stacey, Gary [Univ. of Missouri, Columbia, MO (United States)

    2016-09-08

    Over the life of this funded project, our research group identified and characterized two key receptor proteins in plants; one mediating the innate immunity response to chitin and the other elucidating the key receptor for extracellular ATP. In the case of chitin recognition, we recently described the quaternary structure of this receptor, shedding light on how the receptor functions. Perhaps more importantly, we demonstrated that all plants have the ability to recognize both chitin oligomers and lipochitooligosacchardes, fundamentally changing how the community views the evolution of these systems and strategies that might be used, for example, to extend symbiotic nitrogen fixation to non-legumes. Our discovery of DORN1 opens a new chapter in plant physiology documenting conclusively that eATP is an important extracellular signal in plants, as it is in animals. At this point, we cannot predict just how far reaching this discovery may prove to be but we are convinced that eATP signaling is fundamental to plant growth and development and, hence, we believe that the future will be very exciting for the study of DORN1 and its overall function in plants.

  6. Cytoskeleton in Mast Cell Signaling

    Science.gov (United States)

    Dráber, Pavel; Sulimenko, Vadym; Dráberová, Eduarda

    2012-01-01

    Mast cell activation mediated by the high affinity receptor for IgE (FcεRI) is a key event in allergic response and inflammation. Other receptors on mast cells, as c-Kit for stem cell factor and G protein-coupled receptors (GPCRs) synergistically enhance the FcεRI-mediated release of inflammatory mediators. Activation of various signaling pathways in mast cells results in changes in cell morphology, adhesion to substrate, exocytosis, and migration. Reorganization of cytoskeleton is pivotal in all these processes. Cytoskeletal proteins also play an important role in initial stages of FcεRI and other surface receptors induced triggering. Highly dynamic microtubules formed by αβ-tubulin dimers as well as microfilaments build up from polymerized actin are affected in activated cells by kinases/phosphatases, Rho GTPases and changes in concentration of cytosolic Ca2+. Also important are nucleation proteins; the γ-tubulin complexes in case of microtubules or Arp 2/3 complex with its nucleation promoting factors and formins in case of microfilaments. The dynamic nature of microtubules and microfilaments in activated cells depends on many associated/regulatory proteins. Changes in rigidity of activated mast cells reflect changes in intermediate filaments build up from vimentin. This review offers a critical appraisal of current knowledge on the role of cytoskeleton in mast cells signaling. PMID:22654883

  7. TOR Signaling and Nutrient Sensing.

    Science.gov (United States)

    Dobrenel, Thomas; Caldana, Camila; Hanson, Johannes; Robaglia, Christophe; Vincentz, Michel; Veit, Bruce; Meyer, Christian

    2016-04-29

    All living organisms rely on nutrients to sustain cell metabolism and energy production, which in turn need to be adjusted based on available resources. The evolutionarily conserved target of rapamycin (TOR) protein kinase is a central regulatory hub that connects environmental information about the quantity and quality of nutrients to developmental and metabolic processes in order to maintain cellular homeostasis. TOR is activated by both nitrogen and carbon metabolites and promotes energy-consuming processes such as cell division, mRNA translation, and anabolism in times of abundance while repressing nutrient remobilization through autophagy. In animals and yeasts, TOR acts antagonistically to the starvation-induced AMP-activated kinase (AMPK)/sucrose nonfermenting 1 (Snf1) kinase, called Snf1-related kinase 1 (SnRK1) in plants. This review summarizes the immense knowledge on the relationship between TOR signaling and nutrients in nonphotosynthetic organisms and presents recent findings in plants that illuminate the crucial role of this pathway in conveying nutrient-derived signals and regulating many aspects of metabolism and growth.

  8. Calcium signaling in smooth muscle.

    Science.gov (United States)

    Hill-Eubanks, David C; Werner, Matthias E; Heppner, Thomas J; Nelson, Mark T

    2011-09-01

    Changes in intracellular Ca(2+) are central to the function of smooth muscle, which lines the walls of all hollow organs. These changes take a variety of forms, from sustained, cell-wide increases to temporally varying, localized changes. The nature of the Ca(2+) signal is a reflection of the source of Ca(2+) (extracellular or intracellular) and the molecular entity responsible for generating it. Depending on the specific channel involved and the detection technology employed, extracellular Ca(2+) entry may be detected optically as graded elevations in intracellular Ca(2+), junctional Ca(2+) transients, Ca(2+) flashes, or Ca(2+) sparklets, whereas release of Ca(2+) from intracellular stores may manifest as Ca(2+) sparks, Ca(2+) puffs, or Ca(2+) waves. These diverse Ca(2+) signals collectively regulate a variety of functions. Some functions, such as contractility, are unique to smooth muscle; others are common to other excitable cells (e.g., modulation of membrane potential) and nonexcitable cells (e.g., regulation of gene expression).

  9. Temporal expectation weights visual signals over auditory signals.

    Science.gov (United States)

    Menceloglu, Melisa; Grabowecky, Marcia; Suzuki, Satoru

    2017-04-01

    Temporal expectation is a process by which people use temporally structured sensory information to explicitly or implicitly predict the onset and/or the duration of future events. Because timing plays a critical role in crossmodal interactions, we investigated how temporal expectation influenced auditory-visual interaction, using an auditory-visual crossmodal congruity effect as a measure of crossmodal interaction. For auditory identification, an incongruent visual stimulus produced stronger interference when the crossmodal stimulus was presented with an expected rather than an unexpected timing. In contrast, for visual identification, an incongruent auditory stimulus produced weaker interference when the crossmodal stimulus was presented with an expected rather than an unexpected timing. The fact that temporal expectation made visual distractors more potent and visual targets less susceptible to auditory interference suggests that temporal expectation increases the perceptual weight of visual signals.

  10. Evaluation of blind signal separation methods

    NARCIS (Netherlands)

    Schobben, D.W.E.; Torkkola, K.; Smaragdis, P.

    1999-01-01

    Recently many new Blind Signal Separation BSS algorithms have been introduced Authors evaluate the performance of their algorithms in various ways Among these are speech recognition rates plots of separated signals plots of cascaded mixingunmixing impulse responses and signal to noise ratios Clearly

  11. Audibility of modulation noise in stationary signals

    NARCIS (Netherlands)

    Neelen, J.J.M.

    1970-01-01

    Recordings of an acoustic signal on magnetic tape often show noise, which may be divided into two main classes: additive noise and multiplicative noise. A characteristic of the latter is that it is weak with weak signals and strong with strong signals. This modulation noise has been subjected to a

  12. Radar signal analysis and processing using Matlab

    CERN Document Server

    Mahafza, Bassem R

    2008-01-01

    Offering radar-related software for the analysis and design of radar waveform and signal processing, this book provides comprehensive coverage of radar signals and signal processing techniques and algorithms. It contains numerous graphical plots, common radar-related functions, table format outputs, and end-of-chapter problems. The complete set of MATLAB[registered] functions and routines are available for download online.

  13. Signal processing for boiling noise detection

    International Nuclear Information System (INIS)

    Ledwidge, T.J.; Black, J.L.

    1989-01-01

    The present paper deals with investigations of acoustic signals from a boiling experiment performed on the KNS I loop at KfK Karlsruhe. Signals have been analysed in frequency as well as in time domain. Signal characteristics successfully used to detect the boiling process have been found in time domain. (author). 6 refs, figs

  14. 33 CFR 118.130 - Fog signals.

    Science.gov (United States)

    2010-07-01

    ... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Fog signals. 118.130 Section 118... LIGHTING AND OTHER SIGNALS § 118.130 Fog signals. On waterways where visibility is frequently reduced due to fog or other causes, the District Commander may require or authorize the installation of one or...

  15. 30 CFR 56.14219 - Brakeman signals.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Brakeman signals. 56.14219 Section 56.14219... Safety Practices and Operational Procedures § 56.14219 Brakeman signals. When a train is under the direction of a brakeman and the train operator cannot clearly recognize the brakeman's signals, the train...

  16. 30 CFR 57.14219 - Brakeman signals.

    Science.gov (United States)

    2010-07-01

    ... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Brakeman signals. 57.14219 Section 57.14219... Equipment Safety Practices and Operational Procedures § 57.14219 Brakeman signals. When a train is under the direction of a brakeman and the train operator cannot clearly recognize the brakeman's signals, the train...

  17. 40 CFR 156.64 - Signal word.

    Science.gov (United States)

    2010-07-01

    ... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Signal word. 156.64 Section 156.64... REQUIREMENTS FOR PESTICIDES AND DEVICES Human Hazard and Precautionary Statements § 156.64 Signal word. (a... signal word, reflecting the highest Toxicity Category (Category I is the highest toxicity category) to...

  18. Next Steps in Signaling (NSIS): Framework

    NARCIS (Netherlands)

    Hancock, R.; Loughney, J.; van den Bosch, S.; Hancock, R.; Karagiannis, Georgios; Loughney, J.; van den Bosch, S.

    The Next Steps in Signaling (NSIS) working group is considering protocols for signaling information about a data flow along its path in the network. The NSIS suite of protocols is envisioned to support various signaling applications that need to install and/or manipulate such state in the network.

  19. 49 CFR 236.806 - Signal, home.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, home. 236.806 Section 236.806 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, home. A roadway signal at the entrance to a route or block to govern trains in entering and using...

  20. 49 CFR 236.804 - Signal, block.

    Science.gov (United States)

    2010-10-01

    ... 49 Transportation 4 2010-10-01 2010-10-01 false Signal, block. 236.804 Section 236.804 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... Signal, block. A roadway signal operated either automatically or manually at the entrance to a block. ...

  1. Programmable delay circuit for sparker signal analysis

    Digital Repository Service at National Institute of Oceanography (India)

    Pathak, D.

    The sparker echo signal had been recorded along with the EPC recorder trigger on audio cassettes in a dual channel analog recorder. The sparker signal in the analog form had to be digitised for further signal processing techniques to be performed...

  2. Adaptive Evolution of Signaling Partners

    Science.gov (United States)

    Urano, Daisuke; Dong, Taoran; Bennetzen, Jeffrey L.; Jones, Alan M.

    2015-01-01

    Proteins that interact coevolve their structures. When mutation disrupts the interaction, compensation by the partner occurs to restore interaction otherwise counterselection occurs. We show in this study how a destabilizing mutation in one protein is compensated by a stabilizing mutation in its protein partner and their coevolving path. The pathway in this case and likely a general principle of coevolution is that the compensatory change must tolerate both the original and derived structures with equivalence in function and activity. Evolution of the structure of signaling elements in a network is constrained by specific protein pair interactions, by requisite conformational changes, and by catalytic activity. The heterotrimeric G protein-coupled signaling is a paragon of this protein interaction/function complexity and our deep understanding of this pathway in diverse organisms lends itself to evolutionary study. Regulators of G protein Signaling (RGS) proteins accelerate the intrinsic GTP hydrolysis rate of the Gα subunit of the heterotrimeric G protein complex. An important RGS-contact site is a hydroxyl-bearing residue on the switch I region of Gα subunits in animals and most plants, such as Arabidopsis. The exception is the grasses (e.g., rice, maize, sugarcane, millets); these plants have Gα subunits that replaced the critical hydroxyl-bearing threonine with a destabilizing asparagine shown to disrupt interaction between Arabidopsis RGS protein (AtRGS1) and the grass Gα subunit. With one known exception (Setaria italica), grasses do not encode RGS genes. One parsimonious deduction is that the RGS gene was lost in the ancestor to the grasses and then recently acquired horizontally in the lineage S. italica from a nongrass monocot. Like all investigated grasses, S. italica has the Gα subunit with the destabilizing asparagine residue in the protein interface but, unlike other known grass genomes, still encodes an expressed RGS gene, SiRGS1. SiRGS1

  3. A signal theoretic introduction to random processes

    CERN Document Server

    Howard, Roy M

    2015-01-01

    A fresh introduction to random processes utilizing signal theory By incorporating a signal theory basis, A Signal Theoretic Introduction to Random Processes presents a unique introduction to random processes with an emphasis on the important random phenomena encountered in the electronic and communications engineering field. The strong mathematical and signal theory basis provides clarity and precision in the statement of results. The book also features:  A coherent account of the mathematical fundamentals and signal theory that underpin the presented material Unique, in-depth coverage of

  4. Signal trend identification with fuzzy methods

    International Nuclear Information System (INIS)

    Reifman, J.; Tsoukalas, L. H.; Wang, X.; Wei, T. Y. C.

    1999-01-01

    A fuzzy-logic-based methodology for on-line signal trend identification is introduced. Although signal trend identification is complicated by the presence of noise, fuzzy logic can help capture important features of on-line signals and classify incoming power plant signals into increasing, decreasing and steady-state trend categories. In order to verify the methodology, a code named PROTREN is developed and tested using plant data. The results indicate that the code is capable of detecting transients accurately, identifying trends reliably, and not misinterpreting a steady-state signal as a transient one

  5. Multidimensional signaling via wavelet packets

    Science.gov (United States)

    Lindsey, Alan R.

    1995-04-01

    This work presents a generalized signaling strategy for orthogonally multiplexed communication. Wavelet packet modulation (WPM) employs the basis functions from an arbitrary pruning of a full dyadic tree structured filter bank as orthogonal pulse shapes for conventional QAM symbols. The multi-scale modulation (MSM) and M-band wavelet modulation (MWM) schemes which have been recently introduced are handled as special cases, with the added benefit of an entire library of potentially superior sets of basis functions. The figures of merit are derived and it is shown that the power spectral density is equivalent to that for QAM (in fact, QAM is another special case) and hence directly applicable in existing systems employing this standard modulation. Two key advantages of this method are increased flexibility in time-frequency partitioning and an efficient all-digital filter bank implementation, making the WPM scheme more robust to a larger set of interferences (both temporal and sinusoidal) and computationally attractive as well.

  6. Generator of combined logical signals

    International Nuclear Information System (INIS)

    Laviron, Andre; Berard, Claude.

    1982-01-01

    The invention concerns a generator of combined logical signals to form combinations of two outputs at logical level 1 and N-2 outputs at logical level 0, among N generator outputs. This generator is characterized in that it includes a set of N means for storing combinations. Means enable the N storage means to be loaded with the logical levels corresponding to a pre-set starting combination, to control the operations for shifting the contents of the storage means and to control, by transfer facilities, the transfers of contents between these storage means. Controls enable the storage means to be actuated in order to obtain combinations of logical levels 1 and 0. The generation of combinations can be stopped after another pre-set combination. Application is for testing of safety circuits for nuclear power stations [fr

  7. Digital signal processing using MATLAB

    CERN Document Server

    Schilling, Robert L

    2016-01-01

    Focus on the development, implementation, and application of modern DSP techniques with DIGITAL SIGNAL PROCESSING USING MATLAB(R), 3E. Written in an engaging, informal style, this edition immediately captures your attention and encourages you to explore each critical topic. Every chapter starts with a motivational section that highlights practical examples and challenges that you can solve using techniques covered in the chapter. Each chapter concludes with a detailed case study example, a chapter summary with learning outcomes, and practical homework problems cross-referenced to specific chapter sections for your convenience. DSP Companion software accompanies each book to enable further investigation. The DSP Companion software operates with MATLAB(R) and provides intriguing demonstrations as well as interactive explorations of analysis and design concepts.

  8. Engagement Assessment Using EEG Signals

    Science.gov (United States)

    Li, Feng; Li, Jiang; McKenzie, Frederic; Zhang, Guangfan; Wang, Wei; Pepe, Aaron; Xu, Roger; Schnell, Thomas; Anderson, Nick; Heitkamp, Dean

    2012-01-01

    In this paper, we present methods to analyze and improve an EEG-based engagement assessment approach, consisting of data preprocessing, feature extraction and engagement state classification. During data preprocessing, spikes, baseline drift and saturation caused by recording devices in EEG signals are identified and eliminated, and a wavelet based method is utilized to remove ocular and muscular artifacts in the EEG recordings. In feature extraction, power spectrum densities with 1 Hz bin are calculated as features, and these features are analyzed using the Fisher score and the one way ANOVA method. In the classification step, a committee classifier is trained based on the extracted features to assess engagement status. Finally, experiment results showed that there exist significant differences in the extracted features among different subjects, and we have implemented a feature normalization procedure to mitigate the differences and significantly improved the engagement assessment performance.

  9. Signal propagation along the axon.

    Science.gov (United States)

    Rama, Sylvain; Zbili, Mickaël; Debanne, Dominique

    2018-03-08

    Axons link distant brain regions and are usually considered as simple transmission cables in which reliable propagation occurs once an action potential has been generated. Safe propagation of action potentials relies on specific ion channel expression at strategic points of the axon such as nodes of Ranvier or axonal branch points. However, while action potentials are generally considered as the quantum of neuronal information, their signaling is not entirely digital. In fact, both their shape and their conduction speed have been shown to be modulated by activity, leading to regulations of synaptic latency and synaptic strength. We report here newly identified mechanisms of (1) safe spike propagation along the axon, (2) compartmentalization of action potential shape in the axon, (3) analog modulation of spike-evoked synaptic transmission and (4) alteration in conduction time after persistent regulation of axon morphology in central neurons. We discuss the contribution of these regulations in information processing. Copyright © 2018 Elsevier Ltd. All rights reserved.

  10. TAM receptor signaling in development.

    Science.gov (United States)

    Burstyn-Cohen, Tal

    2017-01-01

    TYRO3, AXL and MERTK comprise the TAM family of receptor protein tyrosine kinases. Activated by their ligands, protein S (PROS1) and growth-arrest-specific 6 (GAS6), they mediate numerous cellular functions throughout development and adulthood. Expressed by a myriad of cell types and tissues, they have been implicated in homeostatic regulation of the immune, nervous, vascular, bone and reproductive systems. The loss-of-function of TAM signaling in adult tissues culminates in the destruction of tissue homeostasis and diseased states, while TAM gain-of-function in various tumors promotes cancer phenotypes. Combinatorial ligand-receptor interactions may elicit different molecular and cellular responses. Many of the TAM regulatory functions are essentially developmental, taking place both during embryogenesis and postnatally. This review highlights current knowledge on the role of TAM receptors and their ligands during these developmental processes in the immune, nervous, vascular and reproductive systems.

  11. Fundamentals of adaptive signal processing

    CERN Document Server

    Uncini, Aurelio

    2015-01-01

    This book is an accessible guide to adaptive signal processing methods that equips the reader with advanced theoretical and practical tools for the study and development of circuit structures and provides robust algorithms relevant to a wide variety of application scenarios. Examples include multimodal and multimedia communications, the biological and biomedical fields, economic models, environmental sciences, acoustics, telecommunications, remote sensing, monitoring, and, in general, the modeling and prediction of complex physical phenomena. The reader will learn not only how to design and implement the algorithms but also how to evaluate their performance for specific applications utilizing the tools provided. While using a simple mathematical language, the employed approach is very rigorous. The text will be of value both for research purposes and for courses of study.

  12. Molecular basis for mitochondrial signaling

    CERN Document Server

    2017-01-01

    This book covers recent advances in the study of structure, function, and regulation of metabolite, protein and ion translocating channels, and transporters in mitochondria. A wide array of cutting-edge methods are covered, ranging from electrophysiology and cell biology to bioinformatics, as well as structural, systems, and computational biology. At last, the molecular identity of two important channels in the mitochondrial inner membrane, the mitochondrial calcium uniporter and the mitochondrial permeability transition pore have been established. After years of work on the physiology and structure of VDAC channels in the mitochondrial outer membrane, there have been multiple discoveries on VDAC permeation and regulation by cytosolic proteins. Recent breakthroughs in structural studies of the mitochondrial cholesterol translocator reveal a set of novel unexpected features and provide essential clues for defining therapeutic strategies. Molecular Basis for Mitochondrial Signaling covers these and many more re...

  13. Canonical Wnt signaling in diabetic retinopathy.

    Science.gov (United States)

    Chen, Qian; Ma, Jian-Xing

    2017-10-01

    Diabetic retinopathy (DR) is a common eye complication of diabetes, and the pathogenic mechanism of DR is still under investigation. The canonical Wnt signaling pathway is an evolutionarily conserved pathway that plays fundamental roles in embryogenesis and adult tissue homeostasis. Wnt signaling regulates expression of multiple genes that control retinal development and eye organogenesis, and dysregulated Wnt signaling plays pathophysiological roles in many ocular diseases, including DR. This review highlights recent progress in studies of Wnt signaling in DR. We discuss Wnt signaling regulation in the retina and dysregulation of Wnt signaling associated with ocular diseases with an emphasis on DR. We also discuss the therapeutic potential of modulating Wnt signaling in DR. Continued studies in this field will advance our current understanding on DR and contribute to the development of new treatments. Copyright © 2017 Elsevier Ltd. All rights reserved.

  14. Signalling chains with probe and adjust learning

    Science.gov (United States)

    Gosti, Giorgio

    2018-04-01

    Many models explain the evolution of signalling in repeated stage games on social networks, differently in this study each signalling game evolves a communication strategy to transmit information across the network. Specifically, I formalise signalling chain games as a generalisation of Lewis' signalling games, where a number of players are placed on a chain network and play a signalling game in which they have to propagate information across the network. I show that probe and adjust learning allows the system to develop communication conventions, but it may temporarily perturb the system out of conventions. Through simulations, I evaluate how long the system takes to evolve a signalling convention and the amount of time it stays in it. This discussion presents a mechanism in which simple players can evolve signalling across a social network without necessarily understanding the entire system.

  15. Phantom phone signals: An investigation into the prevalence and predictors of imagined cell phone signals

    NARCIS (Netherlands)

    Tanis, M.A.; Beukeboom, C.J.; Hartmann, T.; Vermeulen, I.E.

    2015-01-01

    This paper aims to elucidate the peculiar phenomenon of imagined cell phone signals, or Phantom Phone Signals (PPS), which is defined as an individual's perception of a phone signal, indicating an incoming call, message, or social media notification, when in fact no such signal was transmitted. A

  16. Updating signal typing in voice: addition of type 4 signals.

    Science.gov (United States)

    Sprecher, Alicia; Olszewski, Aleksandra; Jiang, Jack J; Zhang, Yu

    2010-06-01

    The addition of a fourth type of voice to Titze's voice classification scheme is proposed. This fourth voice type is characterized by primarily stochastic noise behavior and is therefore unsuitable for both perturbation and correlation dimension analysis. Forty voice samples were classified into the proposed four types using narrowband spectrograms. Acoustic, perceptual, and correlation dimension analyses were completed for all voice samples. Perturbation measures tended to increase with voice type. Based on reliability cutoffs, the type 1 and type 2 voices were considered suitable for perturbation analysis. Measures of unreliability were higher for type 3 and 4 voices. Correlation dimension analyses increased significantly with signal type as indicated by a one-way analysis of variance. Notably, correlation dimension analysis could not quantify the type 4 voices. The proposed fourth voice type represents a subset of voices dominated by noise behavior. Current measures capable of evaluating type 4 voices provide only qualitative data (spectrograms, perceptual analysis, and an infinite correlation dimension). Type 4 voices are highly complex and the development of objective measures capable of analyzing these voices remains a topic of future investigation.

  17. Mitochondrial Energy and Redox Signaling in Plants

    Science.gov (United States)

    Schwarzländer, Markus

    2013-01-01

    Abstract Significance: For a plant to grow and develop, energy and appropriate building blocks are a fundamental requirement. Mitochondrial respiration is a vital source for both. The delicate redox processes that make up respiration are affected by the plant's changing environment. Therefore, mitochondrial regulation is critically important to maintain cellular homeostasis. This involves sensing signals from changes in mitochondrial physiology, transducing this information, and mounting tailored responses, by either adjusting mitochondrial and cellular functions directly or reprogramming gene expression. Recent Advances: Retrograde (RTG) signaling, by which mitochondrial signals control nuclear gene expression, has been a field of very active research in recent years. Nevertheless, no mitochondrial RTG-signaling pathway is yet understood in plants. This review summarizes recent advances toward elucidating redox processes and other bioenergetic factors as a part of RTG signaling of plant mitochondria. Critical Issues: Novel insights into mitochondrial physiology and redox-regulation provide a framework of upstream signaling. On the other end, downstream responses to modified mitochondrial function have become available, including transcriptomic data and mitochondrial phenotypes, revealing processes in the plant that are under mitochondrial control. Future Directions: Drawing parallels to chloroplast signaling and mitochondrial signaling in animal systems allows to bridge gaps in the current understanding and to deduce promising directions for future research. It is proposed that targeted usage of new technical approaches, such as quantitative in vivo imaging, will provide novel leverage to the dissection of plant mitochondrial signaling. Antioxid. Redox Signal. 18, 2122–2144. PMID:23234467

  18. Decoding resistant hypertension signalling pathways.

    Science.gov (United States)

    Parreira, Ricardo Cambraia; Lacerda, Leandro Heleno Guimarães; Vasconcellos, Rebecca; Lima, Swiany Silveira; Santos, Anderson Kenedy; Fontana, Vanessa; Sandrim, Valéria Cristina; Resende, Rodrigo Ribeiro

    2017-12-01

    Resistant hypertension (RH) is a clinical condition in which the hypertensive patient has become resistant to drug therapy and is often associated with increased cardiovascular morbidity and mortality. Several signalling pathways have been studied and related to the development and progression of RH: modulation of sympathetic activity by leptin and aldosterone, primary aldosteronism, arterial stiffness, endothelial dysfunction and variations in the renin-angiotensin-aldosterone system (RAAS). miRNAs comprise a family of small non-coding RNAs that participate in the regulation of gene expression at post-transcriptional level. miRNAs are involved in the development of both cardiovascular damage and hypertension. Little is known of the molecular mechanisms that lead to development and progression of this condition. This review aims to cover the potential roles of miRNAs in the mechanisms associated with the development and consequences of RH, and explore the current state of the art of diagnostic and therapeutic tools based on miRNA approaches. © 2017 The Author(s). Published by Portland Press Limited on behalf of the Biochemical Society.

  19. Tyrosine phosphorylation in signal transduction

    International Nuclear Information System (INIS)

    Roberts, T.M.; Kaplan, D.; Morgan, W.; Keller, T.; Mamon, H.; Piwnica-Worms, H.; Druker, B.; Whitman, M.; Morrison, D.; Cohen, B.; Schaffhausen, B.; Cantley, L.; Rapp, U.

    1988-01-01

    Recent work has focused on the elucidation of the mechanisms by which membrane-bound tyrosine kinases transmit signals within the cell. To examine the role of tyrosine phosphorylation the authors have employed the following strategy. First, they have utilized antibodies to phosphotyrosine (anti-P.Tyr) to identify candidate substrates of various tyrosine kinases, such as pp60 c-src , the CSF- receptor, or the platelet-derived growth factor (PDGF) receptor. Second, they have attempted to characterize the biochemical properties of the putative substrates and to determine in what manner these properties are modified by phosphorylation on tyrosine residues. In this endeavor, they are recapitulating the classic biochemical analysis used to study the effect of kinases on metabolism. The final portion of our work consists of using modern molecular biological strategies to clone the genes or cDNAs for the substrates and overproduce the relevant proteins for studies in vitro in defined systems. This paper describes the first and second aspects of this strategy, the identification and characterization of novel substrate molecules

  20. Advances in thermographic signal reconstruction

    Science.gov (United States)

    Shepard, Steven M.; Frendberg Beemer, Maria

    2015-05-01

    Since its introduction in 2001, the Thermographic Signal Reconstruction (TSR) method has emerged as one of the most widely used methods for enhancement and analysis of thermographic sequences, with applications extending beyond industrial NDT into biomedical research, art restoration and botany. The basic TSR process, in which a noise reduced replica of each pixel time history is created, yields improvement over unprocessed image data that is sufficient for many applications. However, examination of the resulting logarithmic time derivatives of each TSR pixel replica provides significant insight into the physical mechanisms underlying the active thermography process. The deterministic and invariant properties of the derivatives have enabled the successful implementation of automated defect recognition and measurement systems. Unlike most approaches to analysis of thermography data, TSR does not depend on flawbackground contrast, so that it can also be applied to characterization and measurement of thermal properties of flaw-free samples. We present a summary of recent advances in TSR, a review of the underlying theory and examples of its implementation.

  1. Interception of LPI radar signals

    Science.gov (United States)

    Lee, Jim P.

    1991-11-01

    Most current radars are designed to transmit short duration pulses with relatively high peak power. These radars can be detected easily by the use of relatively modest EW intercept receivers. Three radar functions (search, anti-ship missile (ASM) seeker, and navigation) are examined to evaluate the effectiveness of potential low probability of intercept (LPI) techniques, such as waveform coding, antenna profile control, and power management that a radar may employ against current Electronic Warfare (EW) receivers. The general conclusion is that it is possible to design a LPI radar which is effective against current intercept EW receivers. LPI operation is most easily achieved at close ranges and against a target with a large radar cross section. The general system sensitivity requirement for the detection of current and projected LPI radars is found to be on the order of -100 dBmi which cannot be met by current EW receivers. Finally, three potential LPI receiver architectures, using channelized, superhet, and acousto-optic receivers with narrow RF and video bandwidths are discussed. They have shown some potential in terms of providing the sensitivity and capability in an environment where both conventional and LPI signals are present.

  2. Signals for supersymmetry at HERA

    International Nuclear Information System (INIS)

    Dreiner, H.; Morawitz, P.

    1994-07-01

    We consider the baryon parity signals at HERA for the case of the MSSM production mechanisms and the decays via the lepton number violating couplings L i Q anti D. We can probe very small Yukawa couplings λ'> or ∼3.10 -6 , limited only by the decay length of the LSP. We assume the LSP to be the lightest neutralino and study its decays in detail. We present the matrix element squared for the tree-level decay amplitude of a generally mixed neutralino explicitly. We find that the branching fraction to charged leptons strongly depends on the SUSY parameters and can differ significantly from the naively expected 50%. The SUSY mass reaches of the studied processes in the ZEUS detector at HERA were found to be: (m(e, anti ν)+m( anti q)) ≤ 170 GeV, 195 GeV and 205 GeV for the L t Q anti D, L μ Q anti D and L e Q anti D couplings respectively. These are well above existing limits on R-parity violating (R p ) SUSY from previous experiments. We conclude that HERA offers a very promising discovery potential for R p SUSY. (orig.)

  3. Digital signal processing with kernel methods

    CERN Document Server

    Rojo-Alvarez, José Luis; Muñoz-Marí, Jordi; Camps-Valls, Gustavo

    2018-01-01

    A realistic and comprehensive review of joint approaches to machine learning and signal processing algorithms, with application to communications, multimedia, and biomedical engineering systems Digital Signal Processing with Kernel Methods reviews the milestones in the mixing of classical digital signal processing models and advanced kernel machines statistical learning tools. It explains the fundamental concepts from both fields of machine learning and signal processing so that readers can quickly get up to speed in order to begin developing the concepts and application software in their own research. Digital Signal Processing with Kernel Methods provides a comprehensive overview of kernel methods in signal processing, without restriction to any application field. It also offers example applications and detailed benchmarking experiments with real and synthetic datasets throughout. Readers can find further worked examples with Matlab source code on a website developed by the authors. * Presents the necess...

  4. Roles of STATs signaling in cardiovascular diseases.

    Science.gov (United States)

    Kishore, Raj; Verma, Suresh K

    2012-04-01

    In cardiac and many other systems, chronic stress activates avfamily of structurally and functionally conserved receptors and their downstream signaling molecules that entail tyrosine, serine or threonine phosphorylation to transfer the messages to the genetic machinery. However, the activation of the Janus kinases (JAKs) and their downstream signal transducer and activator of transcription (STATs) proteins is both characteristic of and unique to cytokine and growth factor signaling which plays a central role in heart physiology. Dysregulation of JAK-STAT signaling is associated with various cardiovascular diseases. The molecular signaling and specificity of the JAK-STAT pathway are modulated at many levels by distinct regulatory proteins. Here, we review recent studies on the regulation of the STAT signaling pathway that will enhance our ability to design rational therapeutic strategies for stress-induced heart failure.

  5. Acoustic signal recovery by thermal demodulation

    Science.gov (United States)

    Boullosa, R. R.; Santillán, Arturo O.

    2006-10-01

    One operating mode of recently developed thermoacoustic transducers is as an audio speaker that uses an input superimposed on a direct current; as a result, the audio signal occurs at the same frequency as the input signal. To extend the potential applications of these kinds of sources, the authors propose an alternative driving mode in which a simple thermoacoustic device, consisting of a metal film over a substrate and a heat sink, is excited with a high frequency sinusoid that is amplitude modulated by a lower frequency signal. They show that the modulating signal is recovered in the radiated waves due to a mechanism that is inherent to this type of thermoacoustic process. If the frequency of the carrier is higher than 30kHz and any modulating signal (the one of interest) is in the audio frequency range, only this signal will be heard. Thus, the thermoacoustic device operates as an audio-band, self-demodulating speaker.

  6. Signal Processing and Neural Network Simulator

    Science.gov (United States)

    Tebbe, Dennis L.; Billhartz, Thomas J.; Doner, John R.; Kraft, Timothy T.

    1995-04-01

    The signal processing and neural network simulator (SPANNS) is a digital signal processing simulator with the capability to invoke neural networks into signal processing chains. This is a generic tool which will greatly facilitate the design and simulation of systems with embedded neural networks. The SPANNS is based on the Signal Processing WorkSystemTM (SPWTM), a commercial-off-the-shelf signal processing simulator. SPW provides a block diagram approach to constructing signal processing simulations. Neural network paradigms implemented in the SPANNS include Backpropagation, Kohonen Feature Map, Outstar, Fully Recurrent, Adaptive Resonance Theory 1, 2, & 3, and Brain State in a Box. The SPANNS was developed by integrating SAIC's Industrial Strength Neural Networks (ISNN) Software into SPW.

  7. Selection-Mutation Dynamics of Signaling Games

    Directory of Open Access Journals (Sweden)

    Josef Hofbauer

    2015-01-01

    Full Text Available We study the structure of the rest points of signaling games and their dynamic behavior under selection-mutation dynamics by taking the case of three signals as our canonical example. Many rest points of the replicator dynamics of signaling games are not isolated and, therefore, not robust under perturbations. However, some of them attract open sets of initial conditions. We prove the existence of certain rest points of the selection-mutation dynamics close to Nash equilibria of the signaling game and show that all but the perturbed rest points close to strict Nash equilibria are dynamically unstable. This is an important result for the evolution of signaling behavior, since it shows that the second-order forces that are governed by mutation can increase the chances of successful signaling.

  8. Long-distance signalling in plant defence.

    Science.gov (United States)

    Heil, Martin; Ton, Jurriaan

    2008-06-01

    Plants use inducible defence mechanisms to fend off harmful organisms. Resistance that is induced in response to local attack is often expressed systemically, that is, in organs that are not yet damaged. In the search for translocated defence signals, biochemical studies follow the physical movement of putative signals, and grafting experiments use mutants that are impaired in the production or perception of these signals. Long-distance signals can directly activate defence or can prime for the stronger and faster induction of defence. Historically, research has focused on the vascular transport of signalling metabolites, but volatiles can play a crucial role as well. We compare the advantages and constraints of vascular and airborne signals for the plant, and discuss how they can act in synergy to achieve optimised resistance in distal plant parts.

  9. Modified BTC Algorithm for Audio Signal Coding

    Directory of Open Access Journals (Sweden)

    TOMIC, S.

    2016-11-01

    Full Text Available This paper describes modification of a well-known image coding algorithm, named Block Truncation Coding (BTC and its application in audio signal coding. BTC algorithm was originally designed for black and white image coding. Since black and white images and audio signals have different statistical characteristics, the application of this image coding algorithm to audio signal presents a novelty and a challenge. Several implementation modifications are described in this paper, while the original idea of the algorithm is preserved. The main modifications are performed in the area of signal quantization, by designing more adequate quantizers for audio signal processing. The result is a novel audio coding algorithm, whose performance is presented and analyzed in this research. The performance analysis indicates that this novel algorithm can be successfully applied in audio signal coding.

  10. Automatic modulation recognition of communication signals

    CERN Document Server

    Azzouz, Elsayed Elsayed

    1996-01-01

    Automatic modulation recognition is a rapidly evolving area of signal analysis. In recent years, interest from the academic and military research institutes has focused around the research and development of modulation recognition algorithms. Any communication intelligence (COMINT) system comprises three main blocks: receiver front-end, modulation recogniser and output stage. Considerable work has been done in the area of receiver front-ends. The work at the output stage is concerned with information extraction, recording and exploitation and begins with signal demodulation, that requires accurate knowledge about the signal modulation type. There are, however, two main reasons for knowing the current modulation type of a signal; to preserve the signal information content and to decide upon the suitable counter action, such as jamming. Automatic Modulation Recognition of Communications Signals describes in depth this modulation recognition process. Drawing on several years of research, the authors provide a cr...

  11. Signal and image processing in medical applications

    CERN Document Server

    Kumar, Amit; Rahim, B Abdul; Kumar, D Sravan

    2016-01-01

    This book highlights recent findings on and analyses conducted on signals and images in the area of medicine. The experimental investigations involve a variety of signals and images and their methodologies range from very basic to sophisticated methods. The book explains how signal and image processing methods can be used to detect and forecast abnormalities in an easy-to-follow manner, offering a valuable resource for researchers, engineers, physicians and bioinformatics researchers alike.

  12. Calcium and Nuclear Signaling in Prostate Cancer

    OpenAIRE

    Ivan V. Maly; Wilma A. Hofmann

    2018-01-01

    Recently, there have been a number of developments in the fields of calcium and nuclear signaling that point to new avenues for a more effective diagnosis and treatment of prostate cancer. An example is the discovery of new classes of molecules involved in calcium-regulated nuclear import and nuclear calcium signaling, from the G protein-coupled receptor (GPCR) and myosin families. This review surveys the new state of the calcium and nuclear signaling fields with the aim of identifying the un...

  13. Photoacoustic signal amplification through plasmonic nanoparticle aggregation

    OpenAIRE

    Bayer, Carolyn L.; Nam, Seung Yun; Chen, Yun-Sheng; Emelianov, Stanislav Y.

    2013-01-01

    Photoacoustic imaging, using targeted plasmonic metallic nanoparticles, is a promising noninvasive molecular imaging method. Analysis of the photoacoustic signal generated by plasmonic metallic nanoparticles is complex because of the dependence upon physical properties of both the nanoparticle and the surrounding environment. We studied the effect of the aggregation of gold nanoparticles on the photoacoustic signal amplitude. We found that the photoacoustic signal from aggregated silica-coate...

  14. High Frequency Components Recovery in Music Signals

    Directory of Open Access Journals (Sweden)

    V. Sebesta

    1999-04-01

    Full Text Available A new technique is presented which improves the subjective quality of band-limited music by recovery of high frequency components. Sequences of harmonics are found in the band-limited signal and these sequences are expanded to the high frequency band to estimate the lost part of spectrum. High frequency signal is generated to match this estimation and is added to the band-limited signal.

  15. Pseudo random signal processing theory and application

    CERN Document Server

    Zepernick, Hans-Jurgen

    2013-01-01

    In recent years, pseudo random signal processing has proven to be a critical enabler of modern communication, information, security and measurement systems. The signal's pseudo random, noise-like properties make it vitally important as a tool for protecting against interference, alleviating multipath propagation and allowing the potential of sharing bandwidth with other users. Taking a practical approach to the topic, this text provides a comprehensive and systematic guide to understanding and using pseudo random signals. Covering theoretical principles, design methodologies and applications

  16. Interactive Teaching of Adaptive Signal Processing

    OpenAIRE

    Stewart, R W; Harteneck, M; Weiss, S

    2000-01-01

    Over the last 30 years adaptive digital signal processing has progressed from being a strictly graduate level advanced class in signal processing theory to a topic that is part of the core curriculum for many undergraduate signal processing classes. The key reason is the continued advance of communications technology, with its need for echo control and equalisation, and the widespread use of adaptive filters in audio, biomedical, and control applications. In this paper we will review the basi...

  17. The Signalling Role of Promotion in Japan

    OpenAIRE

    Okamura, Kazuaki

    2011-01-01

    Under asymmetric information conditions regarding worker productivity between current and prospective employers, a worker's promotion signals his/her productivity. In this Paper, we tested the signalling role of promotion, using Japanese micro-level data. We found that among lower-level positions, promotion seems to signal a worker's ability, and both the business cycle and foreign-capital ratio of his/her company significantly strengthen this effects. These results suggest that external labo...

  18. The genetic algorithm for a signal enhancement

    International Nuclear Information System (INIS)

    Karimova, L.; Kuadykov, E.; Makarenko, N.

    2004-01-01

    The paper is devoted to the problem of time series enhancement, which is based on the analysis of local regularity. The model construction using this analysis does not require any a priori assumption on the structure of the noise and the functional relationship between original signal and noise. The signal itself may be nowhere differentiable with rapidly varying local regularity, what is overcome with the help of the new technique of increasing the local Hoelder regularity of the signal under research. A new signal with prescribed regularity is constructed using the genetic algorithm. This approach is applied to enhancement of time series in the paleoclimatology, solar physics, dendrochronology, meteorology and hydrology

  19. The genetic algorithm for a signal enhancement

    Energy Technology Data Exchange (ETDEWEB)

    Karimova, L. [Laboratory of Computer Modelling, Institute of Mathematics, Pushkin Street 125, 480100 Almaty (Kazakhstan)]. E-mail: karimova@math.kz; Kuadykov, E. [Laboratory of Computer Modelling, Institute of Mathematics, Pushkin Street 125, 480100 Almaty (Kazakhstan); Makarenko, N. [Laboratory of Computer Modelling, Institute of Mathematics, Pushkin Street 125, 480100 Almaty (Kazakhstan)

    2004-11-21

    The paper is devoted to the problem of time series enhancement, which is based on the analysis of local regularity. The model construction using this analysis does not require any a priori assumption on the structure of the noise and the functional relationship between original signal and noise. The signal itself may be nowhere differentiable with rapidly varying local regularity, what is overcome with the help of the new technique of increasing the local Hoelder regularity of the signal under research. A new signal with prescribed regularity is constructed using the genetic algorithm. This approach is applied to enhancement of time series in the paleoclimatology, solar physics, dendrochronology, meteorology and hydrology.

  20. Cross-talk in abscisic acid signaling

    Science.gov (United States)

    Fedoroff, Nina V.

    2002-01-01

    "Cross-talk" in hormone signaling reflects an organism's ability to integrate different inputs and respond appropriately, a crucial function at the heart of signaling network operation. Abscisic acid (ABA) is a plant hormone involved in bud and seed dormancy, growth regulation, leaf senescence and abscission, stomatal opening, and a variety of plant stress responses. This review summarizes what is known about ABA signaling in the control of stomatal opening and seed dormancy and provides an overview of emerging knowledge about connections between ABA, ethylene, sugar, and auxin synthesis and signaling.

  1. On-line signal trend identification

    International Nuclear Information System (INIS)

    Tambouratzis, T.; Antonopoulos-Domis, M.

    2004-01-01

    An artificial neural network, based on the self-organizing map, is proposed for on-line signal trend identification. Trends are categorized at each incoming signal as steady-state, increasing and decreasing, while they are further classified according to characteristics such signal shape and rate of change. Tests with model-generated signals illustrate the ability of the self-organizing map to accurately and reliably perform on-line trend identification in terms of both detection and classification. The proposed methodology has been found robust to the presence of white noise

  2. Signals and systems primer with Matlab

    CERN Document Server

    Poularikas, Alexander D

    2006-01-01

    Signals and Systems Primer with MATLAB® equally emphasizes the fundamentals of both analog and digital signals and systems. To ensure insight into the basic concepts and methods, the text presents a variety of examples that illustrate a wide range of applications, from microelectromechanical to worldwide communication systems. It also provides MATLAB functions and procedures for practice and verification of these concepts.Taking a pedagogical approach, the author builds a solid foundation in signal processing as well as analog and digital systems. The book first introduces orthogonal signals,

  3. Multivariate Analysis for the Processing of Signals

    Directory of Open Access Journals (Sweden)

    Beattie J.R.

    2014-01-01

    Full Text Available Real-world experiments are becoming increasingly more complex, needing techniques capable of tracking this complexity. Signal based measurements are often used to capture this complexity, where a signal is a record of a sample’s response to a parameter (e.g. time, displacement, voltage, wavelength that is varied over a range of values. In signals the responses at each value of the varied parameter are related to each other, depending on the composition or state sample being measured. Since signals contain multiple information points, they have rich information content but are generally complex to comprehend. Multivariate Analysis (MA has profoundly transformed their analysis by allowing gross simplification of the tangled web of variation. In addition MA has also provided the advantage of being much more robust to the influence of noise than univariate methods of analysis. In recent years, there has been a growing awareness that the nature of the multivariate methods allows exploitation of its benefits for purposes other than data analysis, such as pre-processing of signals with the aim of eliminating irrelevant variations prior to analysis of the signal of interest. It has been shown that exploiting multivariate data reduction in an appropriate way can allow high fidelity denoising (removal of irreproducible non-signals, consistent and reproducible noise-insensitive correction of baseline distortions (removal of reproducible non-signals, accurate elimination of interfering signals (removal of reproducible but unwanted signals and the standardisation of signal amplitude fluctuations. At present, the field is relatively small but the possibilities for much wider application are considerable. Where signal properties are suitable for MA (such as the signal being stationary along the x-axis, these signal based corrections have the potential to be highly reproducible, and highly adaptable and are applicable in situations where the data is noisy or

  4. Mitochondrial signaling in health and disease

    National Research Council Canada - National Science Library

    Orrenius, Sten; Packer, Lester; Cadenas, Enrique

    2012-01-01

    .... The text covers themes essential for the maintenance of mitochondrial activity, including electron transport and energy production, mitochondrial biogenesis and dynamics, mitochondrial signaling...

  5. Digital signal processing an experimental approach

    CERN Document Server

    Engelberg, Shlomo

    2008-01-01

    Digital Signal Processing is a mathematically rigorous but accessible treatment of digital signal processing that intertwines basic theoretical techniques with hands-on laboratory instruction. Divided into three parts, the book covers various aspects of the digital signal processing (DSP) ""problem."" It begins with the analysis of discrete-time signals and explains sampling and the use of the discrete and fast Fourier transforms. The second part of the book???covering digital to analog and analog to digital conversion???provides a practical interlude in the mathematical content before Part II

  6. Signalling and obfuscation for congestion control

    Science.gov (United States)

    Mareček, Jakub; Shorten, Robert; Yu, Jia Yuan

    2015-10-01

    We aim to reduce the social cost of congestion in many smart city applications. In our model of congestion, agents interact over limited resources after receiving signals from a central agent that observes the state of congestion in real time. Under natural models of agent populations, we develop new signalling schemes and show that by introducing a non-trivial amount of uncertainty in the signals, we reduce the social cost of congestion, i.e., improve social welfare. The signalling schemes are efficient in terms of both communication and computation, and are consistent with past observations of the congestion. Moreover, the resulting population dynamics converge under reasonable assumptions.

  7. Advanced Methods of Biomedical Signal Processing

    CERN Document Server

    Cerutti, Sergio

    2011-01-01

    This book grew out of the IEEE-EMBS Summer Schools on Biomedical Signal Processing, which have been held annually since 2002 to provide the participants state-of-the-art knowledge on emerging areas in biomedical engineering. Prominent experts in the areas of biomedical signal processing, biomedical data treatment, medicine, signal processing, system biology, and applied physiology introduce novel techniques and algorithms as well as their clinical or physiological applications. The book provides an overview of a compelling group of advanced biomedical signal processing techniques, such as mult

  8. Radar signal processing and its applications

    CERN Document Server

    Hummel, Robert; Stoica, Petre; Zelnio, Edmund

    2003-01-01

    Radar Signal Processing and Its Applications brings together in one place important contributions and up-to-date research results in this fast-moving area. In twelve selected chapters, it describes the latest advances in architectures, design methods, and applications of radar signal processing. The contributors to this work were selected from the leading researchers and practitioners in the field. This work, originally published as Volume 14, Numbers 1-3 of the journal, Multidimensional Systems and Signal Processing, will be valuable to anyone working or researching in the field of radar signal processing. It serves as an excellent reference, providing insight into some of the most challenging issues being examined today.

  9. Computing angle of arrival of radio signals

    Science.gov (United States)

    Borchardt, John J.; Steele, David K.

    2017-11-07

    Various technologies pertaining to computing angle of arrival of radio signals are described. A system that is configured for computing the angle of arrival of a radio signal includes a cylindrical sheath wrapped around a cylindrical object, where the cylindrical sheath acts as a ground plane. The system further includes a plurality of antennas that are positioned about an exterior surface of the cylindrical sheath, and receivers respectively coupled to the antennas. The receivers output measurements pertaining to the radio signal. A processing circuit receives the measurements and computes the angle of arrival of the radio signal based upon the measurements.

  10. Plant monitoring and signal validation at HFIR

    International Nuclear Information System (INIS)

    Mullens, J.A.

    1991-01-01

    This paper describes a monitoring system for the Oak Ridge National Laboratory's (ORNL'S) High Flux Isotope Reactor (HFIR). HFIR is an 85 MW pressurized water reactor designed to produce isotopes and intense neutron beams. The monitoring system is described with respect to plant signals and computer system; monitoring overview; data acquisition, logging and network distribution; signal validation; status displays; reactor condition monitoring; reactor operator aids. Future work will include the addition of more plant signals, more signal validation and diagnostic capabilities, improved status display, integration of the system with the RELAP plant simulation and graphical interface, improved operator aids, and an alarm filtering system. 8 refs., 7 figs. (MB)

  11. Ultrafast Nonlinear Signal Processing in Silicon Waveguides

    DEFF Research Database (Denmark)

    Oxenløwe, Leif Katsuo; Mulvad, Hans Christian Hansen; Hu, Hao

    2012-01-01

    We describe recent demonstrations of exploiting highly nonlinear silicon waveguides for ultrafast optical signal processing. We describe wavelength conversion and serial-to-parallel conversion of 640 Gbit/s data signals and 1.28 Tbit/s demultiplexing and all-optical sampling.......We describe recent demonstrations of exploiting highly nonlinear silicon waveguides for ultrafast optical signal processing. We describe wavelength conversion and serial-to-parallel conversion of 640 Gbit/s data signals and 1.28 Tbit/s demultiplexing and all-optical sampling....

  12. Estimation of neural energy in microelectrode signals

    Science.gov (United States)

    Gaumond, R. P.; Clement, R.; Silva, R.; Sander, D.

    2004-09-01

    We considered the problem of determining the neural contribution to the signal recorded by an intracortical electrode. We developed a linear least-squares approach to determine the energy fraction of a signal attributable to an arbitrary number of autocorrelation-defined signals buried in noise. Application of the method requires estimation of autocorrelation functions Rap(tgr) characterizing the action potential (AP) waveforms and Rn(tgr) characterizing background noise. This method was applied to the analysis of chronically implanted microelectrode signals from motor cortex of rat. We found that neural (AP) energy consisted of a large-signal component which grows linearly with the number of threshold-detected neural events and a small-signal component unrelated to the count of threshold-detected AP signals. The addition of pseudorandom noise to electrode signals demonstrated the algorithm's effectiveness for a wide range of noise-to-signal energy ratios (0.08 to 39). We suggest, therefore, that the method could be of use in providing a measure of neural response in situations where clearly identified spike waveforms cannot be isolated, or in providing an additional 'background' measure of microelectrode neural activity to supplement the traditional AP spike count.

  13. Corticosteroid signaling in frog metamorphosis.

    Science.gov (United States)

    Kulkarni, Saurabh S; Buchholz, Daniel R

    2014-07-01

    Stress in fetal and larval life can impact later health and fitness in humans and wildlife. Long-term effects of early life stress are mediated by altered stress physiology induced during the process of relaying environmental effects on development. Amphibian metamorphosis has been an important model system to study the role of hormones in development in an environmental context. Thyroid hormone (TH) is necessary and sufficient to initiate the dramatic morphological and physiological changes of metamorphosis, but TH alone is insufficient to complete metamorphosis. Other hormones, importantly corticosteroid hormones (CSs), influence the timing and nature of post-embryonic development. Stressors or treatments with CSs delay or accelerate metamorphic change, depending on the developmental stage of treatment. Also, TH and CSs have synergistic, antagonistic, and independent effects on gene regulation. Importantly, the identity of the endogenous corticosteroid hormone or receptor underlying any gene induction or remodeling event has not been determined. Levels of both CSs, corticosterone and aldosterone, peak at metamorphic climax, and the corticosteroid receptors, glucocorticoid and mineralocorticoid receptors, have wide expression distribution among tadpole tissues. Conclusive experiments to identify the endogenous players have been elusive due to difficulties in experimental control of corticosteroid production and signaling. Current data are consistent with the hypothesis that the two CSs and their receptors serve largely overlapping functions in regulating metamorphosis and synergy with TH. Knowledge of the endogenous players is critical to understanding the basic mechanisms and significance of corticosteroid action in regulating post-embryonic development in environmental contexts. Copyright © 2014 Elsevier Inc. All rights reserved.

  14. Phase synchronization of instrumental music signals

    Science.gov (United States)

    Mukherjee, Sayan; Palit, Sanjay Kumar; Banerjee, Santo; Ariffin, M. R. K.; Bhattacharya, D. K.

    2014-06-01

    Signal analysis is one of the finest scientific techniques in communication theory. Some quantitative and qualitative measures describe the pattern of a music signal, vary from one to another. Same musical recital, when played by different instrumentalists, generates different types of music patterns. The reason behind various patterns is the psycho-acoustic measures - Dynamics, Timber, Tonality and Rhythm, varies in each time. However, the psycho-acoustic study of the music signals does not reveal any idea about the similarity between the signals. For such cases, study of synchronization of long-term nonlinear dynamics may provide effective results. In this context, phase synchronization (PS) is one of the measures to show synchronization between two non-identical signals. In fact, it is very critical to investigate any other kind of synchronization for experimental condition, because those are completely non identical signals. Also, there exists equivalence between the phases and the distances of the diagonal line in Recurrence plot (RP) of the signals, which is quantifiable by the recurrence quantification measure τ-recurrence rate. This paper considers two nonlinear music signals based on same raga played by two eminent sitar instrumentalists as two non-identical sources. The psycho-acoustic study shows how the Dynamics, Timber, Tonality and Rhythm vary for the two music signals. Then, long term analysis in the form of phase space reconstruction is performed, which reveals the chaotic phase spaces for both the signals. From the RP of both the phase spaces, τ-recurrence rate is calculated. Finally by the correlation of normalized tau-recurrence rate of their 3D phase spaces and the PS of the two music signals has been established. The numerical results well support the analysis.

  15. Calcium signalling silencing in atrial fibrillation.

    Science.gov (United States)

    Greiser, Maura

    2017-06-15

    Subcellular calcium signalling silencing is a novel and distinct cellular and molecular adaptive response to rapid cardiac activation. Calcium signalling silencing develops during short-term sustained rapid atrial activation as seen clinically during paroxysmal atrial fibrillation (AF). It is the first 'anti-arrhythmic' adaptive response in the setting of AF and appears to counteract the maladaptive changes that lead to intracellular Ca 2+ signalling instability and Ca 2+ -based arrhythmogenicity. Calcium signalling silencing results in a failed propagation of the [Ca 2+ ] i signal to the myocyte centre both in patients with AF and in a rabbit model. This adaptive mechanism leads to a substantial reduction in the expression levels of calcium release channels (ryanodine receptors, RyR2) in the sarcoplasmic reticulum, and the frequency of Ca 2+ sparks and arrhythmogenic Ca 2+ waves remains low. Less Ca 2+ release per [Ca 2+ ] i transient, increased fast Ca 2+ buffering strength, shortened action potentials and reduced L-type Ca 2+ current contribute to a substantial reduction of intracellular [Na + ]. These features of Ca 2+ signalling silencing are distinct and in contrast to the changes attributed to Ca 2+ -based arrhythmogenicity. Some features of Ca 2+ signalling silencing prevail in human AF suggesting that the Ca 2+ signalling 'phenotype' in AF is a sum of Ca 2+ stabilizing (Ca 2+ signalling silencing) and Ca 2+ destabilizing (arrhythmogenic unstable Ca 2+ signalling) factors. Calcium signalling silencing is a part of the mechanisms that contribute to the natural progression of AF and may limit the role of Ca 2+ -based arrhythmogenicity after the onset of AF. © 2017 The Authors. The Journal of Physiology © 2017 The Physiological Society.

  16. The Hippo signaling functions through the Notch signaling to regulate intrahepatic bile duct development in mammals

    Science.gov (United States)

    Wu, Nan; Nguyen, Quy; Wan, Ying; Zhou, Tiaohao; Venter, Julie; Frampton, Gabriel A; DeMorrow, Sharon; Pan, Duojia; Meng, Fanyin; Glaser, Shannon; Alpini, Gianfranco; Bai, Haibo

    2018-01-01

    The Hippo signaling pathway and the Notch signaling pathway are evolutionary conserved signaling cascades that have important roles in embryonic development of many organs. In murine liver, disruption of either pathway impairs intrahepatic bile duct development. Recent studies suggested that the Notch signaling receptor Notch2 is a direct transcriptional target of the Hippo signaling pathway effector YAP, and the Notch signaling is a major mediator of the Hippo signaling in maintaining biliary cell characteristics in adult mice. However, it remains to be determined whether the Hippo signaling pathway functions through the Notch signaling in intrahepatic bile duct development. We found that loss of the Hippo signaling pathway tumor suppressor Nf2 resulted in increased expression levels of the Notch signaling pathway receptor Notch2 in cholangiocytes but not in hepatocytes. When knocking down Notch2 on the background of Nf2 deficiency in mouse livers, the excessive bile duct development induced by Nf2 deficiency was suppressed by heterozygous and homozygous deletion of Notch2 in a dose-dependent manner. These results implicated that Notch signaling is one of the downstream effectors of the Hippo signaling pathway in regulating intrahepatic bile duct development. PMID:28581486

  17. Process Dissociation and Mixture Signal Detection Theory

    Science.gov (United States)

    DeCarlo, Lawrence T.

    2008-01-01

    The process dissociation procedure was developed in an attempt to separate different processes involved in memory tasks. The procedure naturally lends itself to a formulation within a class of mixture signal detection models. The dual process model is shown to be a special case. The mixture signal detection model is applied to data from a widely…

  18. Power Spectrum Estimation of Randomly Sampled Signals

    DEFF Research Database (Denmark)

    Velte, Clara M.; Buchhave, Preben; K. George, William

    2014-01-01

    proportional to velocity magnitude that consist of well-defined frequency content, which makes bias easy to spot. The idea is that if the algorithms are not able to produce correct statistics from this simple signal, then they will certainly not be able to function well for a more complex measured LDA signal...

  19. Atmospheric signals produced by cavity rebound

    International Nuclear Information System (INIS)

    Jones, E.M.; App, F.N.; Whitaker, R.W.

    1993-01-01

    An analysis of the atmospheric acoustic signals produced by a class of low-yield tests conducted just below the base of the alluvial cover in Yucca Flat of the Nevada Test Site (NTS), has revealed a clear manifestation of an elastic, cavity rebound signal. We use modeling as the basis for understanding the observed phenomena

  20. Intestinal Hedgehog signaling in tumors and inflammation

    NARCIS (Netherlands)

    Büller, N.V.J.A.

    2015-01-01

    In this thesis we investigated the role of Hedgehog signaling in tumors and inflammation. By using an inducible Indian Hedgehog (Ihh) knockout mouse we show that Ihh signals via the mesenchyme to the proliferating cells in the crypt to attenuate proliferation. Despite its anti-proliferative role in

  1. Prediction of twin-arginine signal peptides

    DEFF Research Database (Denmark)

    Bendtsen, Jannick Dyrløv; Nielsen, Henrik; Widdick, D.

    2005-01-01

    expressions, whereas hydrophobicity discrimination of Tat- and Sec- signal peptides is carried out by an artificial neural network. A potential cleavage site of the predicted Tat signal peptide is also reported. The TatP prediction server is available as a public web server at http://www.cbs.dtu.dk/services/TatP/....

  2. Cloning and superluminal signaling£

    Indian Academy of Sciences (India)

    Cloning; cloning fidelity; superluminal signaling; state discrimination. PACS No. 03.65.Bz. 1. .... The possibility of superluminal signaling in quantum mechanics stems from the concept .... quantum mechanics and relativity [13]. .... [13] A Shimony, in Foundations of quantum mechanics in the light of new technology edited by.

  3. Wnt Signaling in Kidney Development and Disease.

    Science.gov (United States)

    Wang, Yongping; Zhou, Chengji J; Liu, Youhua

    2018-01-01

    Wnt signal cascade is an evolutionarily conserved, developmental pathway that regulates embryogenesis, injury repair, and pathogenesis of human diseases. It is well established that Wnt ligands transmit their signal via canonical, β-catenin-dependent and noncanonical, β-catenin-independent mechanisms. Mounting evidence has revealed that Wnt signaling plays a key role in controlling early nephrogenesis and is implicated in the development of various kidney disorders. Dysregulations of Wnt expression cause a variety of developmental abnormalities and human diseases, such as congenital anomalies of the kidney and urinary tract, cystic kidney, and renal carcinoma. Multiple Wnt ligands, their receptors, and transcriptional targets are upregulated during nephron formation, which is crucial for mediating the reciprocal interaction between primordial tissues of ureteric bud and metanephric mesenchyme. Renal cysts are also associated with disrupted Wnt signaling. In addition, Wnt components are important players in renal tumorigenesis. Activation of Wnt/β-catenin is instrumental for tubular repair and regeneration after acute kidney injury. However, sustained activation of this signal cascade is linked to chronic kidney diseases and renal fibrosis in patients and experimental animal models. Mechanistically, Wnt signaling controls a diverse array of biologic processes, such as cell cycle progression, cell polarity and migration, cilia biology, and activation of renin-angiotensin system. In this chapter, we have reviewed recent findings that implicate Wnt signaling in kidney development and diseases. Targeting this signaling may hold promise for future treatment of kidney disorders in patients. Copyright © 2018 Elsevier Inc. All rights reserved.

  4. Motion sensing using WLAN signal fluctuations

    NARCIS (Netherlands)

    Kavitha Muthukrishnan, K.; Lijding, M.E.M.; Meratnia, Nirvana; Havinga, Paul J.M.

    2006-01-01

    The ability to infer the motion of the user has previously been possible only with the usage of additional hardware. In this paper we show how motion sensing can be obtained just by observing the WLAN radio’s signal strength and its fluctuations. For the first time, we have analyzed the signal

  5. Net analyte signal based statistical quality control

    NARCIS (Netherlands)

    Skibsted, E.T.S.; Boelens, H.F.M.; Westerhuis, J.A.; Smilde, A.K.; Broad, N.W.; Rees, D.R.; Witte, D.T.

    2005-01-01

    Net analyte signal statistical quality control (NAS-SQC) is a new methodology to perform multivariate product quality monitoring based on the net analyte signal approach. The main advantage of NAS-SQC is that the systematic variation in the product due to the analyte (or property) of interest is

  6. Demystifying communication signal lost for network redundancy ...

    African Journals Online (AJOL)

    These studies report on the communication signal lost factors that were analyzed and supported by evidences on coverage analysis activities for Automatic Meter Reading (AMR) systems. We have categorized the influential signal lost factors into four core elements that were concluded based on our field measurement ...

  7. Spectral integration in binaural signal detection

    NARCIS (Netherlands)

    Breebaart, D.J.; Par, van de S.L.J.D.E.; Kohlrausch, A.G.

    1997-01-01

    For both monaural and binaural masking, the spectral content of the masker and of the signal to be detected are important stimulus properties influencing the detection process. It is generally accepted that the auditory system separates the incoming signals in several frequency bands. It is not

  8. Electrical Signaling, Photosynthesis and Systemic Acquired Acclimation

    Directory of Open Access Journals (Sweden)

    Magdalena Szechyńska-Hebda

    2017-09-01

    Full Text Available Electrical signaling in higher plants is required for the appropriate intracellular and intercellular communication, stress responses, growth and development. In this review, we have focus on recent findings regarding the electrical signaling, as a major regulator of the systemic acquired acclimation (SAA and the systemic acquired resistance (SAR. The electric signaling on its own cannot confer the required specificity of information to trigger SAA and SAR, therefore, we have also discussed a number of other mechanisms and signaling systems that can operate in combination with electric signaling. We have emphasized the interrelation between ionic mechanism of electrical activity and regulation of photosynthesis, which is intrinsic to a proper induction of SAA and SAR. In a special way, we have summarized the role of non-photochemical quenching and its regulator PsbS. Further, redox status of the cell, calcium and hydraulic waves, hormonal circuits and stomatal aperture regulation have been considered as components of the signaling. Finally, a model of light-dependent mechanisms of electrical signaling propagation has been presented together with the systemic regulation of light-responsive genes encoding both, ion channels and proteins involved in regulation of their activity. Due to space limitations, we have not addressed many other important aspects of hormonal and ROS signaling, which were presented in a number of recent excellent reviews.

  9. Thyroid hormone signaling in the hypothalamus

    NARCIS (Netherlands)

    Alkemade, Anneke; Visser, Theo J.; Fliers, Eric

    2008-01-01

    PURPOSE OF REVIEW: Proper thyroid hormone signaling is essential for brain development and adult brain function. Signaling can be disrupted at many levels due to altered thyroid hormone secretion, conversion or thyroid hormone receptor binding. RECENT FINDINGS: Mutated genes involved in thyroid

  10. Signal-regulated systems and networks

    CSIR Research Space (South Africa)

    Van Zyl, TL

    2010-07-01

    Full Text Available The article presents the use of signal regulatory networks (SRNs), a biologically inspired model based on gene regulatory networks. SRNs are a way of understanding a class of self-organizing IT systems, signal-regulated systems (SRSs). This article...

  11. A Study on Setting of Traffic Signal

    OpenAIRE

    本多, 義明

    1981-01-01

    In this paper,effect of traffic signal setting are Studied according to regional characteristics. Firstly, regional and accident characteristics are analized by factor analysis. Secondly,88 regions in Aichi Prefecture are clustered into six clusters. Finally,effect of traffic signal setting is discussed.

  12. Type I signal peptidases of Bacillus subtilis

    NARCIS (Netherlands)

    Tjalsma, Harold; Bolhuis, Albert; Bron, Sierd; Jongbloed, Jan; Meijer, Wilfried J.J.; Noback, Michiel; van Roosmalen, Maarten; Venema, Gerhardus; van Dijl, Jan Maarten; Hopsu Havu, VK; Jarvinen, M; Kirschke, H

    1997-01-01

    Bacillus subtilis contains at least three chromosomally-encoded type I signal peptidases (SPases; SipS, SipT, and SipU), which remove signal peptides from secretory proteins. In addition, certain B. subtilis (natto) strains contain plasmid-encoded type I SPases (SipP). The known type I SPases from

  13. Jamming Signal Reduction in Spread Spectrum Systems.

    Science.gov (United States)

    1979-04-26

    the addition of an appropriate equalizer netowrk . The original signal and the estimate of the jamming signal are matched and added by a resistor...ADDRESS(SI different from Controllln~ OWce) IS. SECURITY CLASS. (of this report) Unclassified IS.. OECLASSIFICATION /DOWNGRAD IHO SCHEDULE $6. DISTRIB

  14. Wnt Signaling in Cancer Stem Cell Biology

    NARCIS (Netherlands)

    de Sousa E Melo, Felipe; Vermeulen, Louis

    2016-01-01

    Aberrant regulation of Wnt signaling is a common theme seen across many tumor types. Decades of research have unraveled the epigenetic and genetic alterations that result in elevated Wnt pathway activity. More recently, it has become apparent that Wnt signaling levels identify stem-like tumor cells

  15. Multi-Modal Intelligent Traffic Signal Systems Signal Plans for Roadside Equipment

    Data.gov (United States)

    Department of Transportation — Data were collected during the Multi-Modal Intelligent Transportation Signal Systems (MMITSS) study. MMITSS is a next-generation traffic signal system that seeks to...

  16. Spectral Correlation of Multicarrier Modulated Signals and Its Application for Signal Detection

    Directory of Open Access Journals (Sweden)

    Zhang Haijian

    2010-01-01

    Full Text Available Spectral correlation theory for cyclostationary time-series signals has been studied for decades. Explicit formulas of spectral correlation function for various types of analog-modulated and digital-modulated signals are already derived. In this paper, we investigate and exploit the cyclostationarity characteristics for two kinds of multicarrier modulated (MCM signals: conventional OFDM and filter bank based multicarrier (FBMC signals. The spectral correlation characterization of MCM signal can be described by a special linear periodic time-variant (LPTV system. Using this LPTV description, we have derived the explicit theoretical formulas of nonconjugate and conjugate cyclic autocorrelation function (CAF and spectral correlation function (SCF for OFDM and FBMC signals. According to theoretical spectral analysis, Cyclostationary Signatures (CS are artificially embedded into MCM signal and a low-complexity signature detector is, therefore, presented for detecting MCM signal. Theoretical analysis and simulation results demonstrate the efficiency and robustness of this CS detector compared to traditionary energy detector.

  17. Handbook of Signal Processing in Acoustics

    CERN Document Server

    Havelock, David; Vorländer, Michael

    2009-01-01

    The Handbook of Signal Processing in Acoustics presents signal processing as it is practiced in the field of acoustics. The Handbook is organized by areas of acoustics, with recognized leaders coordinating the self-contained chapters of each section. It brings together a wide range of perspectives from over 100 authors to reveal the interdisciplinary nature of signal processing in acoustics. Success in acoustic applications often requires juggling both the acoustic and the signal processing parameters of the problem. This handbook brings the key issues from both into perspective and is complementary to other reference material on the two subjects. It is a unique resource for experts and practitioners alike to find new ideas and techniques within the diversity of signal processing in acoustics.

  18. Modularized Smad-regulated TGFβ signaling pathway.

    Science.gov (United States)

    Li, Yongfeng; Wang, Minli; Carra, Claudio; Cucinotta, Francis A

    2012-12-01

    The transforming Growth Factor β (TGFβ) signaling pathway is a prominent regulatory signaling pathway controlling various important cellular processes. TGFβ signaling can be induced by several factors including ionizing radiation. The pathway is regulated in a negative feedback loop through promoting the nuclear import of the regulatory Smads and a subsequent expression of inhibitory Smad7, that forms ubiquitin ligase with Smurf2, targeting active TGFβ receptors for degradation. In this work, we proposed a mathematical model to study the Smad-regulated TGFβ signaling pathway. By modularization, we are able to analyze mathematically each component subsystem and recover the nonlinear dynamics of the entire network system. Meanwhile the excitability, a common feature observed in the biological systems, in the TGFβ signaling pathway is discussed and supported as well by numerical simulation, indicating the robustness of the model. Published by Elsevier Inc.

  19. Seizure detection algorithms based on EMG signals

    DEFF Research Database (Denmark)

    Conradsen, Isa

    Background: the currently used non-invasive seizure detection methods are not reliable. Muscle fibers are directly connected to the nerves, whereby electric signals are generated during activity. Therefore, an alarm system on electromyography (EMG) signals is a theoretical possibility. Objective...... on the amplitude of the signal. The other algorithm was based on information of the signal in the frequency domain, and it focused on synchronisation of the electrical activity in a single muscle during the seizure. Results: The amplitude-based algorithm reliably detected seizures in 2 of the patients, while...... the frequency-based algorithm was efficient for detecting the seizures in the third patient. Conclusion: Our results suggest that EMG signals could be used to develop an automatic seizuredetection system. However, different patients might require different types of algorithms /approaches....

  20. Signal classification for acoustic neutrino detection

    International Nuclear Information System (INIS)

    Neff, M.; Anton, G.; Enzenhöfer, A.; Graf, K.; Hößl, J.; Katz, U.; Lahmann, R.; Richardt, C.

    2012-01-01

    This article focuses on signal classification for deep-sea acoustic neutrino detection. In the deep sea, the background of transient signals is very diverse. Approaches like matched filtering are not sufficient to distinguish between neutrino-like signals and other transient signals with similar signature, which are forming the acoustic background for neutrino detection in the deep-sea environment. A classification system based on machine learning algorithms is analysed with the goal to find a robust and effective way to perform this task. For a well-trained model, a testing error on the level of 1% is achieved for strong classifiers like Random Forest and Boosting Trees using the extracted features of the signal as input and utilising dense clusters of sensors instead of single sensors.

  1. Electronic devices for analog signal processing

    CERN Document Server

    Rybin, Yu K

    2012-01-01

    Electronic Devices for Analog Signal Processing is intended for engineers and post graduates and considers electronic devices applied to process analog signals in instrument making, automation, measurements, and other branches of technology. They perform various transformations of electrical signals: scaling, integration, logarithming, etc. The need in their deeper study is caused, on the one hand, by the extension of the forms of the input signal and increasing accuracy and performance of such devices, and on the other hand, new devices constantly emerge and are already widely used in practice, but no information about them are written in books on electronics. The basic approach of presenting the material in Electronic Devices for Analog Signal Processing can be formulated as follows: the study with help from self-education. While divided into seven chapters, each chapter contains theoretical material, examples of practical problems, questions and tests. The most difficult questions are marked by a diamon...

  2. Ras signaling in aging and metabolic regulation.

    Science.gov (United States)

    Slack, Cathy

    2017-12-07

    Aberrant signal transduction downstream of the Ras GTPase has a well-established role in tumorigenesis. Mutations that result in hyperactivation of Ras are responsible for a third of all human cancers. Hence, small molecule inhibitors of the Ras signal transduction cascade have been under intense focus as potential cancer treatments. In both invertebrate and mammalian models, emerging evidence has also implicated components of the Ras signaling pathway in aging and metabolic regulation. Here, I review the current evidence for Ras signaling in these newly discovered roles highlighting the interactions between the Ras pathway and other longevity assurance mechanisms. Defining the role of Ras signaling in maintaining age-related health may have important implications for the development of interventions that could not only increase lifespan but also delay the onset and/or progression of age-related functional decline.

  3. ROS and ROS-Mediated Cellular Signaling

    Directory of Open Access Journals (Sweden)

    Jixiang Zhang

    2016-01-01

    Full Text Available It has long been recognized that an increase of reactive oxygen species (ROS can modify the cell-signaling proteins and have functional consequences, which successively mediate pathological processes such as atherosclerosis, diabetes, unchecked growth, neurodegeneration, inflammation, and aging. While numerous articles have demonstrated the impacts of ROS on various signaling pathways and clarify the mechanism of action of cell-signaling proteins, their influence on the level of intracellular ROS, and their complex interactions among multiple ROS associated signaling pathways, the systemic summary is necessary. In this review paper, we particularly focus on the pattern of the generation and homeostasis of intracellular ROS, the mechanisms and targets of ROS impacting on cell-signaling proteins (NF-κB, MAPKs, Keap1-Nrf2-ARE, and PI3K-Akt, ion channels and transporters (Ca2+ and mPTP, and modifying protein kinase and Ubiquitination/Proteasome System.

  4. Distributed traffic signal control using fuzzy logic

    Science.gov (United States)

    Chiu, Stephen

    1992-01-01

    We present a distributed approach to traffic signal control, where the signal timing parameters at a given intersection are adjusted as functions of the local traffic condition and of the signal timing parameters at adjacent intersections. Thus, the signal timing parameters evolve dynamically using only local information to improve traffic flow. This distributed approach provides for a fault-tolerant, highly responsive traffic management system. The signal timing at an intersection is defined by three parameters: cycle time, phase split, and offset. We use fuzzy decision rules to adjust these three parameters based only on local information. The amount of change in the timing parameters during each cycle is limited to a small fraction of the current parameters to ensure smooth transition. We show the effectiveness of this method through simulation of the traffic flow in a network of controlled intersections.

  5. Mathematical properties of a semi-classical signal analysis method: Noisy signal case

    KAUST Repository

    Liu, Dayan

    2012-08-01

    Recently, a new signal analysis method based on a semi-classical approach has been proposed [1]. The main idea in this method is to interpret a signal as a potential of a Schrodinger operator and then to use the discrete spectrum of this operator to analyze the signal. In this paper, we are interested in a mathematical analysis of this method in discrete case considering noisy signals. © 2012 IEEE.

  6. Mathematical properties of a semi-classical signal analysis method: Noisy signal case

    KAUST Repository

    Liu, Dayan; Laleg-Kirati, Taous-Meriem

    2012-01-01

    Recently, a new signal analysis method based on a semi-classical approach has been proposed [1]. The main idea in this method is to interpret a signal as a potential of a Schrodinger operator and then to use the discrete spectrum of this operator to analyze the signal. In this paper, we are interested in a mathematical analysis of this method in discrete case considering noisy signals. © 2012 IEEE.

  7. Social knowledge and signals in primates.

    Science.gov (United States)

    Bergman, Thore J; Sheehan, Michael J

    2013-07-01

    Primates are notable for having a rich and detailed understanding of their social environment and there has been great interest in the evolution and function of social knowledge in primates. Indeed, primates have been shown to have impressive understandings of not only other group members but also the complex relationships among them. To be useful, however, social knowledge requires memories from previous encounters and observations about individual traits that are stable. Here, we argue that social systems or traits that make social knowledge more costly or less accurate will favor signals that either supplement or replace social knowledge. Thus, the relationship between signals and social knowledge can be complementary or antagonistic depending on the type of signal. Our goal in this review is to elucidate the relationships between signals and social knowledge in primates. We categorize signals into three types, each with different relationships to social knowledge. (1) Identity signals directly facilitate social knowledge, (2) current-state signals supplement information gained through social knowledge, and (3) badges of status replace social knowledge. Primates rely extensively on identity information, but it remains to be determined to what extent this is based on receiver perception of individual variation or senders using identity signals. Primates frequently utilize current-state signals including signals of intent to augment their interactions with familiar individuals. Badges of status are rare in primates, and the cases where they are used point to a functional and evolutionary trade-off between badges of status and social knowledge. However, the nature of this relationship needs further exploration. © 2012 Wiley Periodicals, Inc.

  8. The Hedgehog Signal Induced Modulation of Bone Morphogenetic Protein Signaling: An Essential Signaling Relay for Urinary Tract Morphogenesis

    Science.gov (United States)

    Nakagata, Naomi; Miyagawa, Shinichi; Suzuki, Kentaro; Kitazawa, Sohei; Yamada, Gen

    2012-01-01

    Background Congenital diseases of the urinary tract are frequently observed in infants. Such diseases present a number of developmental anomalies such as hydroureter and hydronephrosis. Although some genetically-modified mouse models of growth factor signaling genes reproduce urinary phenotypes, the pathogenic mechanisms remain obscure. Previous studies suggest that a portion of the cells in the external genitalia and bladder are derived from peri-cloacal mesenchymal cells that receive Hedgehog (Hh) signaling in the early developmental stages. We hypothesized that defects in such progenitor cells, which give rise to urinary tract tissues, may be a cause of such diseases. Methodology/Principal Findings To elucidate the pathogenic mechanisms of upper urinary tract malformations, we analyzed a series of Sonic hedgehog (Shh) deficient mice. Shh−/− displayed hydroureter and hydronephrosis phenotypes and reduced expression of several developmental markers. In addition, we suggested that Shh modulation at an early embryonic stage is responsible for such phenotypes by analyzing the Shh conditional mutants. Tissue contribution assays of Hh-responsive cells revealed that peri-cloacal mesenchymal cells, which received Hh signal secreted from cloacal epithelium, could contribute to the ureteral mesenchyme. Gain- and loss-of-functional mutants for Hh signaling revealed a correlation between Hh signaling and Bone morphogenetic protein (Bmp) signaling. Finally, a conditional ablation of Bmp receptor type IA (BmprIA) gene was examined in Hh-responsive cell lineages. This system thus made it possible to analyze the primary functions of the growth factor signaling relay. The defective Hh-to-Bmp signaling relay resulted in severe urinary tract phenotypes with a decrease in the number of Hh-responsive cells. Conclusions/Significance This study identified the essential embryonic stages for the pathogenesis of urinary tract phenotypes. These results suggested that Hh

  9. Signals in Science - On the Importance of Signaling in Gaining Attention in Science

    NARCIS (Netherlands)

    H.P. van Dalen (Hendrik); K. Henkens

    2004-01-01

    textabstractWhich signals are important in gaining attention in science? For a group of 1,371 scientific articles published in 17 demography journals in the years 1990-1992 we track their influence and discern which signals are important in receiving citations. Three types of signals are examined:

  10. Silicon Photonics for Signal Processing of Tbit/s Serial Data Signals

    DEFF Research Database (Denmark)

    Oxenløwe, Leif Katsuo; Ji, Hua; Galili, Michael

    2012-01-01

    In this paper, we describe our recent work on signal processing of terabit per second optical serial data signals using pure silicon waveguides. We employ nonlinear optical signal processing in nanoengineered silicon waveguides to perform demultiplexing and optical waveform sampling of 1.28-Tbit/...

  11. All-optical signal processing of OTDM and OFDM signals based on time-domain Optical Fourier Transformation

    DEFF Research Database (Denmark)

    Clausen, Anders; Guan, Pengyu; Mulvad, Hans Christian Hansen

    2014-01-01

    All-optical time-domain Optical Fourier Transformation utilised for signal processing of ultra-high-speed OTDM signals and OFDM signals will be presented.......All-optical time-domain Optical Fourier Transformation utilised for signal processing of ultra-high-speed OTDM signals and OFDM signals will be presented....

  12. Calibration of Galileo signals for time metrology.

    Science.gov (United States)

    Defraigne, Pascale; Aerts, Wim; Cerretto, Giancarlo; Cantoni, Elena; Sleewaegen, Jean-Marie

    2014-12-01

    Using global navigation satellite system (GNSS) signals for accurate timing and time transfer requires the knowledge of all electric delays of the signals inside the receiving system. GNSS stations dedicated to timing or time transfer are classically calibrated only for Global Positioning System (GPS) signals. This paper proposes a procedure to determine the hardware delays of a GNSS receiving station for Galileo signals, once the delays of the GPS signals are known. This approach makes use of the broadcast satellite inter-signal biases, and is based on the ionospheric delay measured from dual-frequency combinations of GPS and Galileo signals. The uncertainty on the so-determined hardware delays is estimated to 3.7 ns for each isolated code in the L5 frequency band, and 4.2 ns for the ionosphere-free combination of E1 with a code of the L5 frequency band. For the calibration of a time transfer link between two stations, another approach can be used, based on the difference between the common-view time transfer results obtained with calibrated GPS data and with uncalibrated Galileo data. It is shown that the results obtained with this approach or with the ionospheric method are equivalent.

  13. GEFs: Dual regulation of Rac1 signaling.

    Science.gov (United States)

    Marei, Hadir; Malliri, Angeliki

    2017-04-03

    GEFs play a critical role in regulating Rac1 signaling. They serve as signaling nodes converting upstream signals into downstream Rac1-driven cellular responses. Through associating with membrane-bound Rac1, GEFs facilitate the exchange of GDP for GTP, thereby activating Rac1. As a result, Rac1 undergoes conformational changes that mediate its interaction with downstream effectors, linking Rac1 to a multitude of physiological and pathological processes. Interestingly, there are at least 20 GEFs involved in Rac1 activation, suggesting a more complex role of GEFs in regulating Rac1 signaling apart from promoting the exchange of GDP for GTP. Indeed, accumulating evidence implicates GEFs in directing the specificity of Rac1-driven signaling cascades, although the underlying mechanisms were poorly defined. Recently, through conducting a comparative study, we highlighted the role of 2 Rac-specific GEFs, Tiam1 and P-Rex1, in dictating the biological outcome downstream of Rac1. Importantly, further proteomic analysis uncovered a GEF activity-independent function for both GEFs in modulating the Rac1 interactome, which results in the stimulation of GEF-specific signaling cascades. Here, we provide an overview of our recent findings and discuss the role of GEFs as master regulators of Rac1 signaling with a particular focus on GEF-mediated modulation of cell migration following Rac1 activation.

  14. The function of endocytosis in Wnt signaling.

    Science.gov (United States)

    Brunt, Lucy; Scholpp, Steffen

    2018-03-01

    Wnt growth factors regulate one of the most important signaling networks during development, tissue homeostasis and disease. Despite the biological importance of Wnt signaling, the mechanism of endocytosis during this process is ill described. Wnt molecules can act as paracrine signals, which are secreted from the producing cells and transported through neighboring tissue to activate signaling in target cells. Endocytosis of the ligand is important at several stages of action: One central function of endocytic trafficking in the Wnt pathway occurs in the source cell. Furthermore, the β-catenin-dependent Wnt ligands require endocytosis for signal activation and to regulate gene transcription in the responding cells. Alternatively, Wnt/β-catenin-independent signaling regulates endocytosis of cell adherence plaques to control cell migration. In this comparative review, we elucidate these three fundamental interconnected functions, which together regulate cellular fate and cellular behavior. Based on established hypotheses and recent findings, we develop a revised picture for the complex function of endocytosis in the Wnt signaling network.

  15. Attending to weak signals: the leader's challenge.

    Science.gov (United States)

    Kerfoot, Karlene

    2005-12-01

    Halverson and Isham (2003) quote sources that report the accidental death rate of simply being in a hospital is " ... four hundred times more likely than your risk of death from traveling by train, forty times higher than driving a car, and twenty times higher than flying in a commercial aircraft" (p. 13). High-reliability organizations such as nuclear power plants and aircraft carriers have been pioneers in the business of recognizing weak signals. Weike and Sutcliffe (2001) note that high-reliability organizations distinguish themselves from others because of their mindfulness which enables them to see the significance of weak signals and to give strong interventions to weak signals. To act mindfully, these organizations have an underlying mental model of continually updating, anticipating, and focusing the possibility of failure using the intelligence that weak signals provides. Much of what happens is unexpected in health care. However, with a culture that is continually looking for weak signals, and intervenes and rescues when these signals are detected, the unexpected happens less often. This is the epitome of how leaders can build a culture of safety that focuses on recognizing the weak signals to manage the unforeseen.

  16. MP3 compression of Doppler ultrasound signals.

    Science.gov (United States)

    Poepping, Tamie L; Gill, Jeremy; Fenster, Aaron; Holdsworth, David W

    2003-01-01

    The effect of lossy, MP3 compression on spectral parameters derived from Doppler ultrasound (US) signals was investigated. Compression was tested on signals acquired from two sources: 1. phase quadrature and 2. stereo audio directional output. A total of 11, 10-s acquisitions of Doppler US signal were collected from each source at three sites in a flow phantom. Doppler signals were digitized at 44.1 kHz and compressed using four grades of MP3 compression (in kilobits per second, kbps; compression ratios in brackets): 1400 kbps (uncompressed), 128 kbps (11:1), 64 kbps (22:1) and 32 kbps (44:1). Doppler spectra were characterized by peak velocity, mean velocity, spectral width, integrated power and ratio of spectral power between negative and positive velocities. The results suggest that MP3 compression on digital Doppler US signals is feasible at 128 kbps, with a resulting 11:1 compression ratio, without compromising clinically relevant information. Higher compression ratios led to significant differences for both signal sources when compared with the uncompressed signals. Copyright 2003 World Federation for Ultrasound in Medicine & Biology

  17. Acoustic signal analysis in the creeping discharge

    International Nuclear Information System (INIS)

    Nakamiya, T; Sonoda, Y; Tsuda, R; Ebihara, K; Ikegami, T

    2008-01-01

    We have previously succeeded in measuring the acoustic signal due to the dielectric barrier discharge and discriminating the dominant frequency components of the acoustic signal. The dominant frequency components appear over 20kHz of acoustic signal by the dielectric barrier discharge. Recently surface discharge control technology has been focused from practical applications such as ozonizer, NO X reactors, light source or display. The fundamental experiments are carried to examine the creeping discharge using the acoustic signal. When the high voltage (6kV, f = 10kHz) is applied to the electrode, the discharge current flows and the acoustic sound is generated. The current, voltage waveforms of creeping discharge and the sound signal detected by the condenser microphone are stored in the digital memory scope. In this scheme, Continuous Wavelet Transform (CWT) is applied to discriminate the acoustic sound of the micro discharge and the dominant frequency components are studied. CWT results of sound signal show the frequency spectrum of wideband up to 100kHz. In addition, the energy distributions of acoustic signal are examined by CWT

  18. Macroevolution of perfume signalling in orchid bees.

    Science.gov (United States)

    Weber, Marjorie G; Mitko, Lukasz; Eltz, Thomas; Ramírez, Santiago R

    2016-11-01

    Theory predicts that both stabilising selection and diversifying selection jointly contribute to the evolution of sexual signalling traits by (1) maintaining the integrity of communication signals within species and (2) promoting the diversification of traits among lineages. However, for many important signalling traits, little is known about whether these dynamics translate into predictable macroevolutionary signatures. Here, we test for macroevolutionary patterns consistent with sexual signalling theory in the perfume signals of neotropical orchid bees, a group well studied for their chemical sexual communication. Our results revealed both high species-specificity and elevated rates of evolution in perfume signals compared to nonsignalling traits. Perfume complexity was correlated with the number of congeners in a species' range, suggesting that perfume evolution may be tied to the remarkably high number of orchid bee species coexisting together in some neotropical communities. Finally, sister-pair comparisons were consistent with both rapid divergence at speciation and character displacement upon secondary contact. Together, our results provide new insight into the macroevolution of sexual signalling in insects. © 2016 The Authors. Ecology Letters published by CNRS and John Wiley & Sons Ltd.

  19. Signals and systems laboratory with Matlab

    CERN Document Server

    Palamides, Alex

    2010-01-01

    Introduction to MATLAB®Working EnvironmentGetting StartedMemory ManagementVectorsMatricesPlotting with MATLABComplex NumbersM-FilesInput-Output CommandsFile ManagementLogical-Relational OperatorsControl FlowSymbolic VariablesPolynomials(Pseudo)Random NumbersSignalsCategorization by the Variable TypeBasic Continuous-Time SignalsDiscrete-Time SignalsProperties of SignalsTransformations of the Time Variable for Continuous-Time SignalsTransformations of the Time Variable for Discrete-Time SignalsSystemsSystems ClassificationProperties of SystemsTime Domain System AnalysisImpulse ResponseContinuous Time Convolution Convolution PropertiesInterconnections of SystemsStabilityDiscrete-Time ConvolutionSystems Described by Difference EquationsFiltersStability Criterion for Discrete-Time SystemsSystems Described by Differential EquationsStep Response of a SystemFourier SeriesOrthogonality of Complex Exponential SignalsComplex Exponential Fourier SeriesTrigonometric Fourier SeriesFourier Series in the Cosine with Phase F...

  20. Magnetoencephalography signals are influenced by skull defects.

    Science.gov (United States)

    Lau, S; Flemming, L; Haueisen, J

    2014-08-01

    Magnetoencephalography (MEG) signals had previously been hypothesized to have negligible sensitivity to skull defects. The objective is to experimentally investigate the influence of conducting skull defects on MEG and EEG signals. A miniaturized electric dipole was implanted in vivo into rabbit brains. Simultaneous recording using 64-channel EEG and 16-channel MEG was conducted, first above the intact skull and then above a skull defect. Skull defects were filled with agar gels, which had been formulated to have tissue-like homogeneous conductivities. The dipole was moved beneath the skull defects, and measurements were taken at regularly spaced points. The EEG signal amplitude increased 2-10 times, whereas the MEG signal amplitude reduced by as much as 20%. The EEG signal amplitude deviated more when the source was under the edge of the defect, whereas the MEG signal amplitude deviated more when the source was central under the defect. The change in MEG field-map topography (relative difference measure, RDM(∗)=0.15) was geometrically related to the skull defect edge. MEG and EEG signals can be substantially affected by skull defects. MEG source modeling requires realistic volume conductor head models that incorporate skull defects. Copyright © 2013 International Federation of Clinical Neurophysiology. Published by Elsevier Ireland Ltd. All rights reserved.