Sample records for traits part 3b
-
Directory of Open Access Journals (Sweden)
Korbinian Riepl
Full Text Available The present study investigates how different emotions can alter social bargaining behavior. An important paradigm to study social bargaining is the Ultimatum Game. There, a proposer gets a pot of money and has to offer part of it to a responder. If the responder accepts, both players get the money as proposed by the proposer. If he rejects, none of the players gets anything. Rational choice models would predict that responders accept all offers above 0. However, evidence shows that responders typically reject a large proportion of all unfair offers. We analyzed participants' behavior when they played the Ultimatum Game as responders and simultaneously collected electroencephalogram data in order to quantify the feedback-related negativity and P3b components. We induced state affect (momentarily emotions unrelated to the task via short movie clips and measured trait affect (longer-lasting emotional dispositions via questionnaires. State happiness led to increased acceptance rates of very unfair offers. Regarding neurophysiology, we found that unfair offers elicited larger feedback-related negativity amplitudes than fair offers. Additionally, an interaction of state and trait affect occurred: high trait negative affect (subsuming a variety of aversive mood states led to increased feedback-related negativity amplitudes when participants were in an angry mood, but not if they currently experienced fear or happiness. We discuss that increased rumination might be responsible for this result, which might not occur, however, when people experience happiness or fear. Apart from that, we found that fair offers elicited larger P3b components than unfair offers, which might reflect increased pleasure in response to fair offers. Moreover, high trait negative affect was associated with decreased P3b amplitudes, potentially reflecting decreased motivation to engage in activities. We discuss implications of our results in the light of theories and research on
-
Riepl, Korbinian; Mussel, Patrick; Osinsky, Roman; Hewig, Johannes
2016-01-01
The present study investigates how different emotions can alter social bargaining behavior. An important paradigm to study social bargaining is the Ultimatum Game. There, a proposer gets a pot of money and has to offer part of it to a responder. If the responder accepts, both players get the money as proposed by the proposer. If he rejects, none of the players gets anything. Rational choice models would predict that responders accept all offers above 0. However, evidence shows that responders typically reject a large proportion of all unfair offers. We analyzed participants' behavior when they played the Ultimatum Game as responders and simultaneously collected electroencephalogram data in order to quantify the feedback-related negativity and P3b components. We induced state affect (momentarily emotions unrelated to the task) via short movie clips and measured trait affect (longer-lasting emotional dispositions) via questionnaires. State happiness led to increased acceptance rates of very unfair offers. Regarding neurophysiology, we found that unfair offers elicited larger feedback-related negativity amplitudes than fair offers. Additionally, an interaction of state and trait affect occurred: high trait negative affect (subsuming a variety of aversive mood states) led to increased feedback-related negativity amplitudes when participants were in an angry mood, but not if they currently experienced fear or happiness. We discuss that increased rumination might be responsible for this result, which might not occur, however, when people experience happiness or fear. Apart from that, we found that fair offers elicited larger P3b components than unfair offers, which might reflect increased pleasure in response to fair offers. Moreover, high trait negative affect was associated with decreased P3b amplitudes, potentially reflecting decreased motivation to engage in activities. We discuss implications of our results in the light of theories and research on depression and
-
Moghimbeigi, Abbas
2015-05-07
Poisson regression models provide a standard framework for quantitative trait locus (QTL) mapping of count traits. In practice, however, count traits are often over-dispersed relative to the Poisson distribution. In these situations, the zero-inflated Poisson (ZIP), zero-inflated generalized Poisson (ZIGP) and zero-inflated negative binomial (ZINB) regression may be useful for QTL mapping of count traits. Added genetic variables to the negative binomial part equation, may also affect extra zero data. In this study, to overcome these challenges, I apply two-part ZINB model. The EM algorithm with Newton-Raphson method in the M-step uses for estimating parameters. An application of the two-part ZINB model for QTL mapping is considered to detect associations between the formation of gallstone and the genotype of markers. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
McGirr, Alexander; Alda, Martin; Séguin, Monique; Cabot, Sophie; Lesage, Alain; Turecki, Gustavo
2009-10-01
There is substantial evidence suggesting that suicide aggregates in families. However, the extent of overlap between the liability to suicide and psychiatric disorders, particularly major depressive disorder, remains an important issue. Similarly, factors that account for the familial transmission of suicidal behavior remain unclear. Thus, through direct and blind assessment of first-degree relatives, the authors conducted a family study of suicide by examining three proband groups: probands who committed suicide in the context of major depressive disorder, living depressed probands with no history of suicidal behavior, and psychiatrically normal community comparison probands. Participants were 718 first-degree relatives from 120 families: 296 relatives of 51 depressed probands who committed suicide, 185 relatives of 34 nonsuicidal depressed probands, and 237 relatives of 35 community comparison subjects. Psychopathology, suicidal behavior, and behavioral measures were assessed via interviews. The relatives of probands who committed suicide had higher levels of suicidal behavior (10.8%) than the relatives of nonsuicidal depressed probands (6.5%) and community comparison probands (3.4%). Testing cluster B traits as intermediate phenotypes of suicide showed that the relatives of depressed probands who committed suicide had elevated levels of cluster B traits; familial predisposition to suicide was associated with increased levels of cluster B traits; cluster B traits demonstrated familial aggregation and were associated with suicide attempts among relatives; and cluster B traits mediated, at least in part, the relationship between familial predisposition and suicide attempts among relatives. Analyses were repeated for severity of attempts, where cluster B traits also met criteria for endophenotypes of suicide. Familial transmission of suicide and major depression, while partially overlapping, are distinct. Cluster B traits and impulsive-aggressive behavior represent
-
Directory of Open Access Journals (Sweden)
Dorthe S Bille
Full Text Available Two meta-analyses of genome-wide association studies (GWAS have suggested that four variants: rs2605100 in lysophospholipase-like 1 (LYPLAL1, rs10146997 in neuroxin 3 (NRXN3, rs545854 in methionine sulfoxide reductase A (MSRA, and rs987237 in transcription factor activating enhancer-binding protein 2 beta (TFAP2B associate with measures of central obesity. To elucidate potential underlying phenotypes we aimed to investigate whether these variants associated with: 1 quantitative metabolic traits, 2 anthropometric measures (waist circumference (WC, waist-hip ratio, and BMI, or 3 type 2 diabetes, and central and general overweight and obesity.The four variants were genotyped in Danish individuals using KASPar®. Quantitative metabolic traits were examined in a population-based sample (n = 6,038 and WC and BMI were furthermore analyzed in a combined study sample (n = 13,507. Case-control studies of diabetes and adiposity included 15,326 individuals. The major G-allele of LYPLAL1 rs2605100 associated with increased fasting serum triglyceride concentrations (per allele effect (β = 3%(1;5(95%CI, p(additive = 2.7×10(-3, an association driven by the male gender (p(interaction = 0.02. The same allele associated with increased fasting serum insulin concentrations (β = 3%(1;5, p(additive = 2.5×10(-3 and increased insulin resistance (HOMA-IR (β = 4%(1;6, p(additive = 1.5×10(-3. The minor G-allele of rs10146997 in NRXN3 associated with increased WC among women (β = 0.55cm (0.20;0.89, p(additive = 1.7×10(-3, p(interaction = 1.0×10(-3, but showed no associations with obesity related metabolic traits. The MSRA rs545854 and TFAP2B rs987237 showed nominal associations with central obesity; however, no underlying metabolic phenotypes became obvious, when investigating quantitative metabolic traits. None of the variants influenced the prevalence of type 2 diabetes.We demonstrate that several of the central
-
International Nuclear Information System (INIS)
Farhatullah, N.K.; Khalil, I.H.; Nahed, H.
2015-01-01
Higher heritability estimates along with high genetic advance values are effective in envisaging gain under selection in developing genotypes. The objective of the present study was to evaluate variability, heritability and genetic advance in 10 interspecific F2-3 families of Brassica species (B. napus * B. juncea, B. napus * B. rapa). These families were studied for heterospecific introgression of biochemical traits. Low to high heritability estimates were recorded for seed quality traits. Considerable variations within F2-3 families were observed for biochemical traits. Most of the F2-3 families for oil content and erucic showed moderate to high heritability indicating the slightest influence of environment thus modification of trait by selection would be more effective. Among F2-3 introgressed families Bn-510 x Bj-109 produced high oil i.e., 49.5% while Bn-532 x Br-118 (24.4%), Bn-533 x Bj-109 (24.1%) and high protein percentage in terms of mean performance. In the present research, individual segregating progenies of interspecific cross populations i.e., which possessed combination of desirable traits, were identified which could be incorporated in the future Breeding programs and it may facilitate varietal development. (author)
-
Supplementary data: Table 1. QTL for tassel related traits of F2:3 ...
Indian Academy of Sciences (India)
User
Supplementary data: Table 1. QTL for tassel related traits of F2:3 population across and RIL population through single-environment analysis (SEA). Trait. Population. Environment. QTL. Binlocusa. Flanking marker. Peak position. (cM). Range. (cM)b. Ac. Dd. Gene actione. R2(%)f. Subtotal R2. (%)g. F(0.05)h type. TTL. F2:3.
-
Carter, A H; Garland-Campbell, K; Morris, C F; Kidwell, K K
2012-04-01
Wheat is marketed based on end-use quality characteristics and better knowledge of the underlying genetics of specific quality parameters is essential to enhance the breeding process. A set of 188 recombinant inbred lines from a 'Louise' by 'Penawawa' mapping population was grown in two crop years at two locations in the Pacific Northwest region of the United States and data were collected on 17 end-use quality traits using established quality analysis protocols. Using an established genetic linkage map, composite interval mapping was used to identify QTL associated with 16 of the 17 quality traits. QTL were found on 13 of the 21 wheat chromosomes. A large number of QTL were located on chromosomes 3B and 4D and coincided with traits for milling quality and starch functionality. Chromosome 3B contained 10 QTL, which were localized to a 26.2 cM region. Chromosome 4D contained 7 QTL, all of which were located on an 18.8 cM region of this chromosome. The majority of the alleles for superior end-use quality were associated with the cultivar Louise. The identified QTL detected remained highly significant independent of grain yield and protein quantity. The identification of these QTL for end-use quality gives key insight into the relationship and complexity of end-use quality traits. It also improves our understanding of these relationships, thereby allowing plant breeders to make valuable gains from selection for these important traits.
-
17 CFR Appendix B to Part 3 - Statement of Acceptable Practices With Respect to Ethics Training
2010-04-01
... Practices With Respect to Ethics Training B Appendix B to Part 3 Commodity and Securities Exchanges... Practices With Respect to Ethics Training (a) The provisions of Section 4p(b) of the Act (7 U.S.C. 6p(b... ethics training sessions within six months of registration, and all registrants to attend such training...
-
Islam Md. Tasbirul; Abdullah A.B.; Mahmud Mohamad Zihad
2017-01-01
This paper presents reverse engineering (RE) of a complex automobile structural part, B-pillar. As a major part of the automobile body-in white (BiW), B-pillar has substantial opportunity for weight reduction by introducing variable thickness across its sections. To leverage such potential, an existing B-pillar was reverse engineered with a 3D optical scanner and computer aided design (CAD) application. First, digital data (i.e. in meshes) of exiting B-pillar was obtained by the scanner, and ...
-
Directory of Open Access Journals (Sweden)
Islam Md. Tasbirul
2017-01-01
Full Text Available This paper presents reverse engineering (RE of a complex automobile structural part, B-pillar. As a major part of the automobile body-in white (BiW, B-pillar has substantial opportunity for weight reduction by introducing variable thickness across its sections. To leverage such potential, an existing B-pillar was reverse engineered with a 3D optical scanner and computer aided design (CAD application. First, digital data (i.e. in meshes of exiting B-pillar was obtained by the scanner, and subsequently, this information was utilized in developing a complete 3D CAD model. CATIA V5 was used in the modeling where some of the essential work benches were “Digitized Shape Editor”, “Quick Surface Reconstruction”, “Wireframe and Surface Design”, “Freestyle”, “Generation Shape Design” and “Part design”. In the final CAD design, five different thicknesses were incorporated successfully in order to get a B-pillar with non-uniform sections. This research opened opportunities for thickness optimization and mold tooling design in real time manufacturing.
-
Fleeson, William; Jayawickreme, Eranda
2014-01-01
Personality researchers should modify models of traits to include mechanisms of differential reaction to situations. Whole Trait Theory does so via five main points. First, the descriptive side of traits should be conceptualized as density distributions of states. Second, it is important to provide an explanatory account of the Big 5 traits. Third, adding an explanatory account to the Big 5 creates two parts to traits, an explanatory part and a descriptive part, and these two parts should be recognized as separate entities that are joined into whole traits. Fourth, Whole Trait Theory proposes that the explanatory side of traits consists of social-cognitive mechanisms. Fifth, social-cognitive mechanisms that produce Big-5 states should be identified. PMID:26097268
-
12 CFR Appendix B to Part 228 - CRA Notice
2010-01-01
... 12 Banks and Banking 3 2010-01-01 2010-01-01 false CRA Notice B Appendix B to Part 228 Banks and... REINVESTMENT (REGULATION BB) Pt. 228, App. B Appendix B to Part 228—CRA Notice (a) Notice for main offices and... Federal Community Reinvestment Act (CRA), the Federal Reserve Board (Board) evaluates our record of...
-
Mehta, Minal B; Shewale, Swapnil V; Sequeira, Raymond N; Millar, John S; Hand, Nicholas J; Rader, Daniel J
2017-06-23
Maintenance of whole-body glucose homeostasis is critical to glycemic function. Genetic variants mapping to chromosome 8p23.1 in genome-wide association studies have been linked to glycemic traits in humans. The gene of known function closest to the mapped region, PPP1R3B (protein phosphatase 1 regulatory subunit 3B), encodes a protein (G L ) that regulates glycogen metabolism in the liver. We therefore sought to test the hypothesis that hepatic PPP1R3B is associated with glycemic traits. We generated mice with either liver-specific deletion ( Ppp1r3b Δ hep ) or liver-specific overexpression of Ppp1r3b The Ppp1r3b deletion significantly reduced glycogen synthase protein abundance, and the remaining protein was predominantly phosphorylated and inactive. As a consequence, glucose incorporation into hepatic glycogen was significantly impaired, total hepatic glycogen content was substantially decreased, and mice lacking hepatic Ppp1r3b had lower fasting plasma glucose than controls. The concomitant loss of liver glycogen impaired whole-body glucose homeostasis and increased hepatic expression of glycolytic enzymes in Ppp1r3b Δ hep mice relative to controls in the postprandial state. Eight hours of fasting significantly increased the expression of two critical gluconeogenic enzymes, phosphoenolpyruvate carboxykinase and glucose-6-phosphatase, above the levels in control livers. Conversely, the liver-specific overexpression of Ppp1r3b enhanced hepatic glycogen storage above that of controls and, as a result, delayed the onset of fasting-induced hypoglycemia. Moreover, mice overexpressing hepatic Ppp1r3b upon long-term fasting (12-36 h) were protected from blood ketone-body accumulation, unlike control and Ppp1r3b Δ hep mice. These findings indicate a major role for Ppp1r3b in regulating hepatic glycogen stores and whole-body glucose/energy homeostasis. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.
-
Caravaggio, Fernando; Fervaha, Gagan; Chung, Jun Ku; Gerretsen, Philip; Nakajima, Shinichiro; Plitman, Eric; Iwata, Yusuke; Wilson, Alan; Graff-Guerrero, Ariel
2016-04-01
While several studies have examined how particular personality traits are related to dopamine D2/3 receptor (D2/3R) availability in the striatum of humans, few studies have reported how multiple traits measured in the same persons are differentially related to D2/3R availability in different striatal sub-regions. We examined how personality traits measured with the Karolinska Scales of Personality are related to striatal D2/3R availability measured with [(11)C]-raclopride in 30 healthy humans. Based on previous the literature, five personality traits were hypothesized to be most likely related to D2/3R availability: impulsiveness, monotony avoidance, detachment, social desirability, and socialization. We found self-reported impulsiveness was negatively correlated with D2/3R availability in the ventral striatum and globus pallidus. After controlling for age and gender, monotony avoidance was also negatively correlated with D2/3R availability in the ventral striatum and globus pallidus. Socialization was positively correlated with D2/3R availability in the ventral striatum and putamen. After controlling for age and gender, the relationship between socialization and D2/3R availability in these regions survived correction for multiple comparisons (p-threshold=.003). Thus, within the same persons, different personality traits are differentially related to in vivo D2/3R availability in different striatal sub-regions. Copyright © 2016 Elsevier B.V. and ECNP. All rights reserved.
-
Medicare Utilization for Part B
U.S. Department of Health & Human Services — This link takes you to the Medicare utilization statistics for Part B (Supplementary Medical Insurance SMI) which includes the Medicare Part B Physician and Supplier...
-
14 CFR Appendix B to Part 135 - Airplane Flight Recorder Specifications
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane Flight Recorder Specifications B Appendix B to Part 135 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION.... B Appendix B to Part 135—Airplane Flight Recorder Specifications Parameters Range Installed system 1...
-
Li, Xiaonan; Ramchiary, Nirala; Dhandapani, Vignesh; Choi, Su Ryun; Hur, Yoonkang; Nou, Ill-Sup; Yoon, Moo Kyoung; Lim, Yong Pyo
2013-01-01
Brassica rapa is an important crop species that produces vegetables, oilseed, and fodder. Although many studies reported quantitative trait loci (QTL) mapping, the genes governing most of its economically important traits are still unknown. In this study, we report QTL mapping for morphological and yield component traits in B. rapa and comparative map alignment between B. rapa, B. napus, B. juncea, and Arabidopsis thaliana to identify candidate genes and conserved QTL blocks between them. A total of 95 QTL were identified in different crucifer blocks of the B. rapa genome. Through synteny analysis with A. thaliana, B. rapa candidate genes and intronic and exonic single nucleotide polymorphisms in the parental lines were detected from whole genome resequenced data, a few of which were validated by mapping them to the QTL regions. Semi-quantitative reverse transcriptase PCR analysis showed differences in the expression levels of a few genes in parental lines. Comparative mapping identified five key major evolutionarily conserved crucifer blocks (R, J, F, E, and W) harbouring QTL for morphological and yield components traits between the A, B, and C subgenomes of B. rapa, B. juncea, and B. napus. The information of the identified candidate genes could be used for breeding B. rapa and other related Brassica species. PMID:23223793
-
Peng, Fred Y; Weselake, Randall J
2013-05-01
The plant-specific B3 superfamily of transcription factors has diverse functions in plant growth and development. Using a genome-wide domain analysis, we identified 92, 187, 58, 90, 81, 55, and 77 B3 transcription factor genes in the sequenced genome of Arabidopsis, Brassica rapa, castor bean (Ricinus communis), cocoa (Theobroma cacao), soybean (Glycine max), maize (Zea mays), and rice (Oryza sativa), respectively. The B3 superfamily has substantially expanded during the evolution in eudicots particularly in Brassicaceae, as compared to monocots in the analysis. We observed domain duplication in some of these B3 proteins, forming more complex domain architectures than currently understood. We found that the length of B3 domains exhibits a large variation, which may affect their exact number of α-helices and β-sheets in the core structure of B3 domains, and possibly have functional implications. Analysis of the public microarray data indicated that most of the B3 gene pairs encoding Arabidopsis-rice orthologs are preferentially expressed in different tissues, suggesting their different roles in these two species. Using ESTs in crops, we identified many B3 genes preferentially expressed in reproductive tissues. In a sequence-based quantitative trait loci analysis in rice and maize, we have found many B3 genes associated with traits such as grain yield, seed weight and number, and protein content. Our results provide a framework for future studies into the function of B3 genes in different phases of plant development, especially the ones related to traits in major crops.
-
Zhao, X H; Wang, J Y; Zhang, G X; Wei, Y; Gu, Y P; Yu, Y B
2012-04-01
In our research, signal transducer and activator of transcription 5b (STAT5b) gene was studied as candidate gene associated with body weight and reproductive traits of Jinghai Yellow chicken. Single nucleotide polymorphisms (SNPs) of STAT5b gene were examined in both Jinghai Yellow chicken and three reference chicken populations including the Bian, Youxi and Arbor Acre chickens. Two SNPs (C-1591T and G-250A) were detected in the 5' flanking region of STAT5b gene. Association indicated that the C-1591T mutation is significantly associated with age at fist egg, The G-250A mutation is significantly related with hatch weight and body weight at 300 days. Additionally four STAT5b haplotypes (H1, CG; H2, TG; H3, AC and H4, TA) and their frequency distributions were estimated using the phase program. Diplotype H3H4 is dominant for 8, 16 week-age-weight and body weight at first egg. Thus STAT5b gene may be served as a potential genetic marker for growth and reproduction traits evaluation of the Jinghai Yellow chicken. This study will provide valuable information for the protection and breeding of Jinghai Yellow chicken.
-
Dellazizzo, Laura; Dugré, Jules R; Berwald, Marieke; Stafford, Marie-Christine; Côté, Gilles; Potvin, Stéphane; Dumais, Alexandre
2017-12-06
High rates of violence are found amid offenders with severe mental illnesses (SMI), substance use disorders (SUDs) and Cluster B personality disorders. Elevated rates of comorbidity lead to inconsistencies when it comes to this relationship. Furthermore, overlapping Cluster B personality traits have been associated with violence. Using multiple correspondence analysis and cluster analysis, this study was designed to differentiate profiles of 728 male inmates from penitentiary and psychiatric settings marked by personality traits, SMI and SUDs following different violent patterns. Six significantly differing clusters emerged. Cluster 1, "Sensation seekers", presented recklessness with SUDs and low prevalence's of SMI and auto-aggression. Two clusters committed more sexual offenses. While Cluster 2, "Opportunistic-sexual offenders", had more antisocial lifestyles and SUDs, Cluster 6, "Emotional-sexual offenders", displayed more emotional disturbances with SMI and violence. Clusters 3 and 4, representing "Life-course-persistent offenders", shared early signs of persistent antisocial conduct and severe violence. Cluster 3, "Early-onset violent delinquents", emerged as more severely antisocial with SUDs. Cluster 4, "Early-onset unstable-mentally ill delinquents", were more emotionally driven, with SMI and auto-aggression. Cluster 5, "Late-start offenders", was less severely violent, and emotionally driven with antisocial behavior beginning later. This study suggests the presence of specific psychopathological organizations in violent inmates. Copyright © 2017 Elsevier B.V. All rights reserved.
-
The Role of Semaphorin 3B (SEMA3B) in the Pathogenesis of Breast Cancer
2006-04-01
apoptotic and anti-proliferative effect on cancer lines it is in part by the inhibition of Akt pathway. In conclusion, we hypothesize that VEGF165...autocrine activity and by inhibiting the Akt pathway. 15. SUBJECT TERMS tumor suppressor gene, breast cancer and apoptosis 16. SECURITY...TGFβ TGFR2 Smad4 M D A M B A 54 9 H 12 99 H el a H 46 0 M C F7 ZR -7 5 H 15 7 2 31 GAPDH TGFR1 B. C 2H 24H 48H 72H SEMA3B SEMA3B
-
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1, Technology Evaluation; Vol. 2, Technology Logic Diagram and Vol. 3, Technology EvaLuation Data Sheets. Part A of Vols. 1 and 2 focuses on RA. Part B of Vols. 1 and 2 focuses on the D&D of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TM, an explanation of the problems facing the volume-specific program, a review of identified technologies, and rankings of technologies applicable to the site. Volume 2 (Pts. A. B. and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A. B, and C) contains the TLD data sheets. This volume provides the technology evaluation data sheets (TEDS) for ER/WM activities (D&D, RA and WM) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than is given for the technologies in Vol. 2.
-
Energy Technology Data Exchange (ETDEWEB)
NONE
1994-12-31
The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part B of the Proceedings contains 109 contributions from the following fields: physics; medical engineering; fluid mechanics, environmental engineering, and structural mechanics. Fourteen contributions dealing with nuclear physics, plasma physics, quantum physics, nuclear chemistry, and computational physics were selected for INIS. (J.B.).
-
International Nuclear Information System (INIS)
1993-01-01
The aim of the seminar was to present and discuss the latest results obtained in research at the Czech Technical University and collaborating institutions. Part B of the Proceedings contains 109 contributions from the following fields: physics; medical engineering; fluid mechanics, environmental engineering, and structural mechanics. Fourteen contributions dealing with nuclear physics, plasma physics, quantum physics, nuclear chemistry, and computational physics were selected for INIS. (J.B.)
-
Wright, Aidan G.C.; Simms, Leonard J.
2014-01-01
The current study examines the relations among contemporary models of pathological and normal range personality traits. Specifically, we report on (a) conjoint exploratory factor analyses of the Computerized Adaptive Test of Personality Disorder static form (CAT-PD-SF) with the Personality Inventory for the DSM-5 (PID-5; Krueger et al., 2012) and NEO Personality Inventory-3 First Half (NEI-PI-3FH; McCrae & Costa, 2007), and (b) unfolding hierarchical analyses of the three measures in a large general psychiatric outpatient sample (N = 628; 64% Female). A five-factor solution provided conceptually coherent alignment among the CAT-PD-SF, PID-5, and NEO-PI-3FH scales. Hierarchical solutions suggested that higher-order factors bear strong resemblance to dimensions that emerge from structural models of psychopathology (e.g., Internalizing and Externalizing spectra). These results demonstrate that the CAT-PD-SF adheres to the consensual structure of broad trait domains at the five-factor level. Additionally, patterns of scale loadings further inform questions of structure and bipolarity of facet and domain level constructs. Finally, hierarchical analyses strengthen the argument for using broad dimensions that span normative and pathological functioning to scaffold a quantitatively derived phenotypic structure of psychopathology to orient future research on explanatory, etiological, and maintenance mechanisms. PMID:24588061
-
The Results of Hemoglobinopathy Screening in Hatay, the Southern Part of Turkey
Directory of Open Access Journals (Sweden)
Gonul Oktay
2014-12-01
Full Text Available Aim: %u03B2-Thalassemia and hemoglobinopathies are common genetic disorders in Turkey. Because of this reason, either anemic people or couples before marriage are investigated for hemoglobinopathies routinly. In this retrospective study, our aim was to determine the frequency of %u03B2-thalassemia and hemoglobinopathies in Hatay, which is located in the southern part of Turkey. Material and Method: In this study, data from 70226 individuals, admitted to Antakya State Hospital Hemoglobinopathy Center in Hatay, both for the reason of anemia and before marriage investigations, were evaluated between January 2006 and October 2012. The blood samples were collected into EDTA-containing tubes and hematological parameters were analyzed using a Sysmex XT-2000i Hematology Analyzer. High performance liquid chromatography technique was used to determine the type of hemoglobin. Results: The frequency of hemoglobinopaties were 6% %u03B2-Thalassemia trait, 6.3% sickle cell trait, 12.9% %u03B1-thalassaemia trait? and 4.2 % other abnormal hemoglobinopaties variants. We detected 49 cases with homozygot %u03B2-thalassaemia, 60 cases with homozygot haemoglobin S, 33 cases with HbH disease (thalassaemia intermedia among all. Discussion: The frequency of %u03B2-thalassemia trait and other haemoglobinopathies in Hatay is found to be quite high as compared with other provinces in Turkey.
-
Resource Conservation and Recovery Act, Part B Permit Application
International Nuclear Information System (INIS)
1992-01-01
This report, Part B (Vol. 3) of the permit application for the WIPP facility, contains information related to the site characterization of the facility, including geology, design, rock salt evaluations, maps, drawings, and shaft excavations
-
Rusakovica, Julija; Kremer, Valentin D; Plötz, Thomas; Rohlf, Paige; Kyriazakis, Ilias
2017-09-29
There is increasing interest in the definition, measurement and use of traits associated with water use and drinking behaviour, mainly because water is a finite resource and its intake is an important part of animal health and well-being. Analysis of such traits has received little attention, due in part to the lack of appropriate technology to measure drinking behaviour. We exploited novel equipment to collect water intake data in two lines of turkey (A: 27,415 and B: 12,956 birds). The equipment allowed continuous recording of individual visits to the water station in a group environment. Our aim was to identify drinking behaviour traits of biological relevance, to estimate their genetic parameters and their genetic relationships with performance traits, and to identify drinking behaviour strategies among individuals. Visits to the drinkers were clustered into bouts, i.e. time intervals spent in drinking-related activity. Based on this, biologically relevant traits were defined: (1) number of visits per bout, (2) water intake per bout, (3) drinking time per bout, (4) drinking rate, (5) daily bout frequency, (6) daily bout duration, (7) daily drinking time and (8) daily water intake. Heritability estimates for most drinking behaviour traits were moderate to high and the most highly heritable traits were drinking rate (0.49 and 0.50) and daily drinking time (0.35 and 0.46 in lines A and B, respectively). Genetic correlations between drinking behaviour and performance traits were low except for moderate correlations between daily water intake and weight gain (0.46 and 0.47 in lines A and B, respectively). High estimates of breeding values for weight gain were found across the whole range of estimated breeding values for daily water intake, daily drinking time and water intake per bout. We show for the first time that drinking behaviour traits are moderately to highly heritable. Low genetic and phenotypic correlations with performance traits suggest that current
-
14 CFR Appendix B to Part 121 - Airplane Flight Recorder Specification
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane Flight Recorder Specification B... REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Pt. 121, App. B Appendix B to Part 121—Airplane... airplanes that can demonstrate the capability of deriving either the control input on control movement (one...
-
14 CFR Appendix B to Part 382 - Cross-Reference Table
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Cross-Reference Table B Appendix B to Part 382 Aeronautics and Space OFFICE OF THE SECRETARY, DEPARTMENT OF TRANSPORTATION (AVIATION PROCEEDINGS...: Old and New Rules Old section(382.x) New section(382.x) Subject General provisions: 1 1 Purpose. 3 7...
-
Directory of Open Access Journals (Sweden)
Antonella Dalle Zotte
2014-03-01
Full Text Available The aim of this study was to compare the effect and duration of dietary inclusion of 5% spirulina (Arthrospira platensis and/or 3% thyme (Thymus vulgaris on growing rabbit carcass composition, meat and bone rheological traits, and the vitamin B12 content of Longissimus dorsi (LD meat. The study involved 294 maternal line growing rabbits from the Pannon breeding programme. At weaning (5 wk, animals were randomly divided by dietary treatment into 7 groups of 42 rabbits each. A control group (C-C received a pellet with no supplementation throughout the trial (5-11 wk of age, whereas the other groups were fed diets supplemented with 5% spirulina (S, 3% thyme (T or with both ingredients (ST for either the entire growing period (5-11 wk of age; groups: S-S, T-T, ST-ST, respectively, or its final part only (8-11 wk of age; groups: C-S, C-T, C-ST, respectively. Results showed that regardless of the duration of supplementation, spirulina and thyme provided no effect on the traits examined, except for scapular fat content, whose value was higher in the S-S group than in the C-T group (P<0.05. Spirulina was confirmed as a rich source of vitamin B12 that was successfully transferred into LD meat, thus demonstrating its value as an effective natural supplement in producing food fortified with this vital element. Further studies are necessary to clarify the effect of spirulina on carcass fat deposition, bone development, and mineralisation.
-
Quantitative trait loci analysis of swine meat quality traits
DEFF Research Database (Denmark)
Li, H D; Lund, M S; Christensen, O F
2010-01-01
loss, and the Minolta color measurements L*, a*, and b* representing meat lightness, redness, and yellowness, respectively. The families consist of 3,883 progenies of 12 Duroc boars that were evaluated to identify the QTL. The linkage map consists of 462 SNP markers on 18 porcine autosomes...... were estimated from a posterior distribution of the QTL position. In total, 31 QTL for the 6 meat quality traits were found to be significant at the 5% chromosome-wide level, among which 11 QTL were significant at the 5% genome-wide level and 5 of these were significant at the 0.1% genome-wide level...... will be helpful for fine mapping and identifying genes affecting meat quality traits, and tightly linked markers may be incorporated into marker-assisted selection programs...
-
18 CFR 3b.5 - Legal guardians.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Legal guardians. 3b.5... INFORMATION General § 3b.5 Legal guardians. For the purposes of this part, the parent of any minor, or the legal guardian of any individual who has been declared to be incompetent due to physical or mental...
-
14 CFR Appendix B to Part 141 - Private Pilot Certification Course
2010-01-01
... (CONTINUED) SCHOOLS AND OTHER CERTIFICATED AGENCIES PILOT SCHOOLS Pt. 141, App. B Appendix B to Part 141...) Accident reporting requirements of the National Transportation Safety Board; (3) Applicable subjects of the... checks and end-of-course tests in accordance with the school's approved training course, consisting of...
-
17 CFR Appendix B to Part 420 - Sample Large Position Report
2010-04-01
..., and as collateral for financial derivatives and other securities transactions $ Total Memorandum 1... 17 Commodity and Securities Exchanges 3 2010-04-01 2010-04-01 false Sample Large Position Report B Appendix B to Part 420 Commodity and Securities Exchanges DEPARTMENT OF THE TREASURY REGULATIONS UNDER...
-
Directory of Open Access Journals (Sweden)
Panfeng Guan
2018-04-01
Full Text Available Major advances in wheat production are needed to address global food insecurity under future climate conditions, such as high temperatures. The grain yield of bread wheat (Triticum aestivum L. is a quantitatively inherited complex trait that is strongly influenced by interacting genetic and environmental factors. Here, we conducted global QTL analysis for five yield-related traits, including spike yield, yield components and plant height (PH, in the Nongda3338/Jingdong6 doubled haploid (DH population using a high-density SNP and SSR-based genetic map. A total of 12 major genomic regions with stable QTL controlling yield-related traits were detected on chromosomes 1B, 2A, 2B, 2D, 3A, 4A, 4B, 4D, 5A, 6A, and 7A across 12 different field trials with timely sown (normal and late sown (heat stress conditions. Co-location of yield components revealed significant tradeoffs between thousand grain weight (TGW and grain number per spike (GNS on chromosome 4A. Dissection of a “QTL-hotspot” region for grain weight on chromosome 4B was helpful in marker-assisted selection (MAS breeding. Moreover, this study identified a novel QTL for heat susceptibility index of thousand grain weight (HSITGW on chromosome 4BL that explains approximately 10% of phenotypic variation. QPh.cau-4B.2, QPh.cau-4D.1 and QPh.cau-2D.3 were coincident with the dwarfing genes Rht1, Rht2, and Rht8, and haplotype analysis revealed their pleiotropic architecture with yield components. Overall, our findings will be useful for elucidating the genetic architecture of yield-related traits and developing new wheat varieties with high and stable yield.
-
Directory of Open Access Journals (Sweden)
Shahram Niknafs
2014-04-01
Full Text Available The aim of the current study was to investigate the association of G4533815A SNP in STAT5B and A287G SNP in BMPR-IB genes with growth and reproduction related traits in chicken. A sample of 205 individuals from breeding station of Mazandaran native chicken population was selected randomly. All of the individuals were genotyped for both SNPs using PCR-RFLP technique. Marker-trait association analyses were performed using estimated breeding value of the traits as dependent variable in GLM procedure of SAS 9.1. Results suggested that breeding value least square means for genotypes of G4533815A SNP is significantly differed from each other for traits of body weight at 8 and 12 weeks (P<0.01. In the case of BMPR-IB gene, no significant difference was found. In conclusion, STAT5B gene may be associated with body growth in chicken and may be considered in Marker Assisted Selection program to improve chicken growth performance.
-
Carlson, Scott R; Thái, Stephanie
2010-10-01
Both augmented and reduced P3 amplitude have been associated with psychopathic personality. The Two Process Theory (TPT) suggests that there are two etiologically distinct traits underling psychopathy. One of these traits appears to be related to enhanced attention engagement and reduced anxiety. The other is related to impulsivity, social deviance and poor executive function. P3 is a multi-determined component indexing attention and working memory processes related to executive function. As such, we hypothesized that dissociable relationships would exist between these two dimensions and P3. We recorded P3 and the Contingent Negative Variation (CNV), an ERP response shown to be augmented in psychopaths, during an expectancy AX-continuous performance task from 60 undergraduates. We administered the Psychopathic Personality Inventory (PPI). One factor of the PPI, Fearless Dominance, was related to the dimension of the TPT predicted to reflect relatively better executive function. We found that Fearless Dominance was uniquely associated with P3 augmentation. More negative CNV and faster reaction time were also specifically related to Fearless Dominance. These results illustrate the need to examine the differential relationships between psychopathic traits and P3 amplitude. Copyright © 2010 Elsevier B.V. All rights reserved.
-
49 CFR Appendix B to Part 172 - Trefoil Symbol
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Trefoil Symbol B Appendix B to Part 172... SECURITY PLANS Pt. 172, App. B Appendix B to Part 172—Trefoil Symbol 1. Except as provided in paragraph 2 of this appendix, the trefoil symbol required for RADIOACTIVE labels and placards and required to be...
-
12 CFR Appendix B to Part 345 - CRA Notice
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false CRA Notice B Appendix B to Part 345 Banks and... REINVESTMENT Pt. 345, App. B Appendix B to Part 345—CRA Notice (a) Notice for main offices and, if an... Community Reinvestment Act (CRA), the Federal Deposit Insurance Corporation (FDIC) evaluates our record of...
-
12 CFR Appendix B to Part 25 - CRA Notice
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false CRA Notice B Appendix B to Part 25 Banks and... DEPOSIT PRODUCTION REGULATIONS Pt. 25, App. B Appendix B to Part 25—CRA Notice (a) Notice for main offices... the Federal Community Reinvestment Act (CRA), the Comptroller of the Currency evaluates our record of...
-
14 CFR 3.5 - Statements about products, parts, appliances and materials.
2010-01-01
..., appliances and materials. 3.5 Section 3.5 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION DEFINITIONS GENERAL REQUIREMENTS § 3.5 Statements about products, parts, appliances... product, part, appliance or material. (b) Prohibition against fraudulent and intentionally false...
-
2010-04-01
... INFORMATION Rules for Disclosure of Records § 3b.223 Fees. (a) Fees will be charged for the direct cost of... practicable, self-service duplication of requested documents may also be made on duplicating machines by the... to determine if they fall within the disclosure requirements of this part; and (3) When the system...
-
Association of porcine UCP3 gene polymorphisms with fatness traits ...
African Journals Online (AJOL)
Administrator
2011-04-25
Apr 25, 2011 ... ... for fatness traits in pig. Polymorphism in UCP3 gene may change the function ... NM_214049) and human UCP3 gene DNA sequence (GenBank accession No. NC_000011). ..... Sleep, 29: 645-649. Zhao J, Li H, Kong X, ...
-
QTL mapping of flag leaf-related traits in wheat (Triticum aestivum L.).
Liu, Kaiye; Xu, Hao; Liu, Gang; Guan, Panfeng; Zhou, Xueyao; Peng, Huiru; Yao, Yingyin; Ni, Zhongfu; Sun, Qixin; Du, Jinkun
2018-04-01
QTL controlling flag leaf length, flag leaf width, flag leaf area and flag leaf angle were mapped in wheat. This study aimed to advance our understanding of the genetic mechanisms underlying morphological traits of the flag leaves of wheat (Triticum aestivum L.). A recombinant inbred line (RIL) population derived from ND3331 and the Tibetan semi-wild wheat Zang1817 was used to identify quantitative trait loci (QTLs) controlling flag leaf length (FLL), flag leaf width (FLW), flag leaf area (FLA), and flag leaf angle (FLANG). Using an available simple sequence repeat genetic linkage map, 23 putative QTLs for FLL, FLW, FLA, and FLANG were detected on chromosomes 1B, 2B, 3A, 3D, 4B, 5A, 6B, 7B, and 7D. Individual QTL explained 4.3-68.52% of the phenotypic variance in different environments. Four QTLs for FLL, two for FLW, four for FLA, and five for FLANG were detected in at least two environments. Positive alleles of 17 QTLs for flag leaf-related traits originated from ND3331 and 6 originated from Zang1817. QTLs with pleiotropic effects or multiple linked QTL were also identified on chromosomes 1B, 4B, and 5A; these are potential target regions for fine-mapping and marker-assisted selection in wheat breeding programs.
-
33 CFR Appendix B to Part 277 - Hypothetical Example of Cost Apportionment
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Hypothetical Example of Cost... APPORTIONMENT OF BRIDGE ALTERATIONS Pt. 277, App. B Appendix B to Part 277—Hypothetical Example of Cost... bridge was completed in 1908 and the superstructure completed in 1909. For this hypothetical example it...
-
Culham, Ruth
2006-01-01
The acknowledged expert on the 6+1 traits of writing explains what the traits are and what they are not: The traits are not a curriculum; they are part and parcel of the writing process; they are a model, not a program; they are not a prepackaged replacement for teaching writing; and they are the language of the writing workshop. The author…
-
Cumulative indices for Spectrochima Acta, Part A and Spectrochimica Acta, Part B
International Nuclear Information System (INIS)
Scheeline, A.; Williams, B.; Williksen, E.; Jeffrey Steinfeld,; McEnroe, B.
1998-01-01
This article is an electronic publication in Spectrochimica Acta Electronica (SAE), a section of Spectrochimica Acta, Part B (SAB). The hardcopy text is accompanied by an electronic archive, stored on the SAE homepage at http://www.elsevier.nl/locate/sabe. The archive contains data, index and program files. The main article discusses the bibliographical purpose of the program and data files. A collective index for Spectrochimica Acta for volumes since it was split into Parts A and B, and continuing through 1991 for SAA and 1997 for SAB, is presented in DBF format, along with rudimentary data entry and access software. (Copyright (c) 1998 Elsevier Science B.V., Amsterdam. All rights reserved.)
-
10 CFR Appendix B to Part 600 - Audit Report Distributees
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Audit Report Distributees B Appendix B to Part 600 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Pt. 600, App. B Appendix B to Part 600—Audit Report Distributees Distributee: Manager, Eastern Region, Office of Inspector...
-
12 CFR Appendixes A-B to Part 41 - [Reserved
2010-01-01
... 12 Banks and Banking 1 2010-01-01 2010-01-01 false [Reserved] A Appendixes A-B to Part 41 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY FAIR CREDIT REPORTING Appendixes A-B to Part 41 [Reserved] ...
-
Young Children's Self-Concepts Include Representations of Abstract Traits and the Global Self.
Cimpian, Andrei; Hammond, Matthew D; Mazza, Giulia; Corry, Grace
2017-11-01
There is debate about the abstractness of young children's self-concepts-specifically, whether they include representations of (a) general traits and abilities and (b) the global self. Four studies (N = 176 children aged 4-7) suggested these representations are indeed part of early self-concepts. Studies 1 and 2 reexamined prior evidence that young children cannot represent traits and abilities. The results suggested that children's seemingly immature judgments in previous studies were due to peculiarities of the task context not the inadequacy of children's self-concepts. Similarly, Studies 3 and 4 revealed that, contrary to claims of immaturity in reasoning about the global self, young children update their global self-evaluations in flexible, context-sensitive ways. This evidence suggests continuity in the structure of self-concepts across childhood. © 2017 The Authors. Child Development © 2017 Society for Research in Child Development, Inc.
-
49 CFR Appendix B to Part 37 - FTA Regional Offices
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false FTA Regional Offices B Appendix B to Part 37 Transportation Office of the Secretary of Transportation TRANSPORTATION SERVICES FOR INDIVIDUALS WITH DISABILITIES (ADA) Pt. 37, App. B Appendix B to Part 37—FTA Regional Offices Region I, Federal Transit...
-
32 CFR Appendix B to Part 231 - In-Store Banking
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false In-Store Banking B Appendix B to Part 231.... 231, App. B Appendix B to Part 231—In-Store Banking A. Selection Process. The purpose of this guidance... provide in-store banking services when such services are desired and approved by the installation...
-
Cherel, Pierre; Pires, José; Glénisson, Jérôme; Milan, Denis; Iannuccelli, Nathalie; Hérault, Frédéric; Damon, Marie; Le Roy, Pascale
2011-08-29
Detection of quantitative trait loci (QTLs) affecting meat quality traits in pigs is crucial for the design of efficient marker-assisted selection programs and to initiate efforts toward the identification of underlying polymorphisms. The RYR1 and PRKAG3 causative mutations, originally identified from major effects on meat characteristics, can be used both as controls for an overall QTL detection strategy for diversely affected traits and as a scale for detected QTL effects. We report on a microsatellite-based QTL detection scan including all autosomes for pig meat quality and carcass composition traits in an F2 population of 1,000 females and barrows resulting from an intercross between a Pietrain and a Large White-Hampshire-Duroc synthetic sire line. Our QTL detection design allowed side-by-side comparison of the RYR1 and PRKAG3 mutation effects seen as QTLs when segregating at low frequencies (0.03-0.08), with independent QTL effects detected from most of the same population, excluding any carrier of these mutations. Large QTL effects were detected in the absence of the RYR1 and PRKGA3 mutations, accounting for 12.7% of phenotypic variation in loin colour redness CIE-a* on SSC6 and 15% of phenotypic variation in glycolytic potential on SSC1. We detected 8 significant QTLs with effects on meat quality traits and 20 significant QTLs for carcass composition and growth traits under these conditions. In control analyses including mutation carriers, RYR1 and PRKAG3 mutations were detected as QTLs, from highly significant to suggestive, and explained 53% to 5% of the phenotypic variance according to the trait. Our results suggest that part of muscle development and backfat thickness effects commonly attributed to the RYR1 mutation may be a consequence of linkage with independent QTLs affecting those traits. The proportion of variation explained by the most significant QTLs detected in this work is close to the influence of major-effect mutations on the least affected
-
Directory of Open Access Journals (Sweden)
Iannuccelli Nathalie
2011-08-01
Full Text Available Abstract Background Detection of quantitative trait loci (QTLs affecting meat quality traits in pigs is crucial for the design of efficient marker-assisted selection programs and to initiate efforts toward the identification of underlying polymorphisms. The RYR1 and PRKAG3 causative mutations, originally identified from major effects on meat characteristics, can be used both as controls for an overall QTL detection strategy for diversely affected traits and as a scale for detected QTL effects. We report on a microsatellite-based QTL detection scan including all autosomes for pig meat quality and carcass composition traits in an F2 population of 1,000 females and barrows resulting from an intercross between a Pietrain and a Large White-Hampshire-Duroc synthetic sire line. Our QTL detection design allowed side-by-side comparison of the RYR1 and PRKAG3 mutation effects seen as QTLs when segregating at low frequencies (0.03-0.08, with independent QTL effects detected from most of the same population, excluding any carrier of these mutations. Results Large QTL effects were detected in the absence of the RYR1 and PRKGA3 mutations, accounting for 12.7% of phenotypic variation in loin colour redness CIE-a* on SSC6 and 15% of phenotypic variation in glycolytic potential on SSC1. We detected 8 significant QTLs with effects on meat quality traits and 20 significant QTLs for carcass composition and growth traits under these conditions. In control analyses including mutation carriers, RYR1 and PRKAG3 mutations were detected as QTLs, from highly significant to suggestive, and explained 53% to 5% of the phenotypic variance according to the trait. Conclusions Our results suggest that part of muscle development and backfat thickness effects commonly attributed to the RYR1 mutation may be a consequence of linkage with independent QTLs affecting those traits. The proportion of variation explained by the most significant QTLs detected in this work is close to the
-
Krystkowiak, Karolina; Langner, Monika; Adamski, Tadeusz; Salmanowicz, Bolesław P; Kaczmarek, Zygmunt; Krajewski, Paweł; Surma, Maria
2017-02-01
The quality of wheat depends on a large complex of genes and environmental factors. The objective of this study was to identify quantitative trait loci controlling technological quality traits and their stability across environments, and to assess the impact of interaction between alleles at loci Glu-1 and Glu-3 on grain quality. DH lines were evaluated in field experiments over a period of 4 years, and genotyped using simple sequence repeat markers. Lines were analysed for grain yield (GY), thousand grain weight (TGW), protein content (PC), starch content (SC), wet gluten content (WG), Zeleny sedimentation value (ZS), alveograph parameter W (APW), hectolitre weight (HW), and grain hardness (GH). A number of QTLs for these traits were identified in all chromosome groups. The Glu-D1 locus influenced TGW, PC, SC, WG, ZS, APW, GH, while locus Glu-B1 affected only PC, ZS, and WG. Most important marker-trait associations were found on chromosomes 1D and 5D. Significant effects of interaction between Glu-1 and Glu-3 loci on technological properties were recorded, and in all types of this interaction positive effects of Glu-D1 locus on grain quality were observed, whereas effects of Glu-B1 locus depended on alleles at Glu-3 loci. Effects of Glu-A3 and Glu-D3 loci per se were not significant, while their interaction with alleles present at other loci encoding HMW and LMW were important. These results indicate that selection of wheat genotypes with predicted good bread-making properties should be based on the allelic composition both in Glu-1 and Glu-3 loci, and confirm the predominant effect of Glu-D1d allele on technological properties of wheat grains.
-
2010-01-01
... Farmer Program Primary Loan Servicing Actions) B Exhibit B-3 to Subpart B of Part 1900 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... GENERAL Adverse Decisions and Administrative Appeals Pt. 1900, Subpt. B, Exh. B-3 Exhibit B-3 to Subpart B...
-
Flanged joints with contact outside the bolt circle: ASME Part B design rules
International Nuclear Information System (INIS)
Rodabaugh, E.C.; Moore, S.E.
1976-05-01
The ASME Boiler and Pressure Vessel Code, Section VIII, Division 1, gives rules which are subdivided into ''Part A'' and ''Part B''. Part A covers flanged joints where contact between flanges occurs through a gasket located inside the bolt holes. Part B covers flanged joints with contact outside the bolt holes. This report (a) summarizes the theory for Part B flanged joints, (b) presents examples which show the significant differences between Part A flanged joints and Part B flanged joints, (c) presents the available test data relevant to the characteristics of Part B flanged joints, (d) gives listings of two computer programs which can be used to evaluate the characteristics of Part B flanged joints, and (e) gives recommendations for Code revisions and other aspects of Part B flanged-joint design
-
Valchev, Velichko H; van de Vijver, Fons J R; Nel, J Alewyn; Rothmann, Sebastiaan; Meiring, Deon
2013-06-01
The present study investigates the differences between 3 ethnocultural groups in South Africa in the use of traits and contextual information for personality descriptions and the interaction of these differences with social distance from the target person and with personality domains. Semistructured interviews asking for self- and other-descriptions were conducted with 1,027 Blacks, 84 Coloureds and Indians, and 105 Whites, representing the country's 11 official languages. In Part 1 we found similarities in the total set of categories used most often for personality description across the 3 groups-traits, behaviors, preferences, and perceptions (over 86%), which were context-free (over 66%)-as well as substantial differences between the groups in the relative use of these categories. In Part 2 we found that distance from the target person plays a role in cross-cultural differences in trait use and contextualization. In Part 3 we found significant interactions of culture with the use of traits and contextual information across agency-communion and 9 indigenous South African personality clusters similar to the Big Five. The responses of Blacks confirmed expectations for collectivistic groups (fewer traits and more contextualization) and of Whites for individualistic groups (more traits and less contextualization), and Coloureds and Indians had an intermediate pattern. The results are discussed in the framework of the trait and cultural psychology perspectives on personality. PsycINFO Database Record (c) 2013 APA, all rights reserved.
-
Václavík, Tomáš; Beckmann, Michael; Cord, Anna F; Bindewald, Anja M
2017-01-01
Ultraviolet-B (UV-B) radiation is a key but under-researched environmental factor that initiates diverse responses in plants, potentially affecting their distribution. To date, only a few macroecological studies have examined adaptations of plant species to different levels of UV-B. Here, we combined herbarium specimens of Hieracium pilosella L. and Echium vulgare L. with a novel UV-B dataset to examine differences in leaf hair traits between the plants' native and alien ranges. We analysed scans of 336 herbarium specimens using standardized measurements of leaf area, hair density (both species) and hair length (H. pilosella only). While accounting for other bioclimatic variables (i.e. temperature, precipitation) and effects of herbivory, we examined whether UV-B exposure explains the variability and geographical distribution of these traits in the native (Northern Hemisphere) vs. the alien (Southern Hemisphere) range. UV-B explained the largest proportion of the variability and geographical distribution of hair length in H. pilosella (relative influence 67.1%), and hair density in E. vulgare (66.2%). Corresponding with higher UV-B, foliar hairs were 25% longer for H. pilosella and 25% denser for E. vulgare in records from the Southern as compared to those from the Northern Hemisphere. However, focusing on each hemisphere separately or controlling for its effect in a regression analysis, we found no apparent influence of UV-B radiation on hair traits. Thus, our findings did not confirm previous experimental studies which suggested that foliar hairs may respond to higher UV-B intensities, presumably offering protection against detrimental levels of radiation. We cannot rule out UV-B radiation as a possible driver because UV-B radiation was the only considered variable that differed substantially between the hemispheres, while bioclimatic conditions (e.g. temperature, precipitation) and other considered variables (herbivory damage, collection date) were at similar
-
Cord, Anna F.; Bindewald, Anja M.
2017-01-01
Ultraviolet-B (UV-B) radiation is a key but under-researched environmental factor that initiates diverse responses in plants, potentially affecting their distribution. To date, only a few macroecological studies have examined adaptations of plant species to different levels of UV-B. Here, we combined herbarium specimens of Hieracium pilosella L. and Echium vulgare L. with a novel UV-B dataset to examine differences in leaf hair traits between the plants’ native and alien ranges. We analysed scans of 336 herbarium specimens using standardized measurements of leaf area, hair density (both species) and hair length (H. pilosella only). While accounting for other bioclimatic variables (i.e. temperature, precipitation) and effects of herbivory, we examined whether UV-B exposure explains the variability and geographical distribution of these traits in the native (Northern Hemisphere) vs. the alien (Southern Hemisphere) range. UV-B explained the largest proportion of the variability and geographical distribution of hair length in H. pilosella (relative influence 67.1%), and hair density in E. vulgare (66.2%). Corresponding with higher UV-B, foliar hairs were 25% longer for H. pilosella and 25% denser for E. vulgare in records from the Southern as compared to those from the Northern Hemisphere. However, focusing on each hemisphere separately or controlling for its effect in a regression analysis, we found no apparent influence of UV-B radiation on hair traits. Thus, our findings did not confirm previous experimental studies which suggested that foliar hairs may respond to higher UV-B intensities, presumably offering protection against detrimental levels of radiation. We cannot rule out UV-B radiation as a possible driver because UV-B radiation was the only considered variable that differed substantially between the hemispheres, while bioclimatic conditions (e.g. temperature, precipitation) and other considered variables (herbivory damage, collection date) were at similar
-
Directory of Open Access Journals (Sweden)
Tomáš Václavík
Full Text Available Ultraviolet-B (UV-B radiation is a key but under-researched environmental factor that initiates diverse responses in plants, potentially affecting their distribution. To date, only a few macroecological studies have examined adaptations of plant species to different levels of UV-B. Here, we combined herbarium specimens of Hieracium pilosella L. and Echium vulgare L. with a novel UV-B dataset to examine differences in leaf hair traits between the plants' native and alien ranges. We analysed scans of 336 herbarium specimens using standardized measurements of leaf area, hair density (both species and hair length (H. pilosella only. While accounting for other bioclimatic variables (i.e. temperature, precipitation and effects of herbivory, we examined whether UV-B exposure explains the variability and geographical distribution of these traits in the native (Northern Hemisphere vs. the alien (Southern Hemisphere range. UV-B explained the largest proportion of the variability and geographical distribution of hair length in H. pilosella (relative influence 67.1%, and hair density in E. vulgare (66.2%. Corresponding with higher UV-B, foliar hairs were 25% longer for H. pilosella and 25% denser for E. vulgare in records from the Southern as compared to those from the Northern Hemisphere. However, focusing on each hemisphere separately or controlling for its effect in a regression analysis, we found no apparent influence of UV-B radiation on hair traits. Thus, our findings did not confirm previous experimental studies which suggested that foliar hairs may respond to higher UV-B intensities, presumably offering protection against detrimental levels of radiation. We cannot rule out UV-B radiation as a possible driver because UV-B radiation was the only considered variable that differed substantially between the hemispheres, while bioclimatic conditions (e.g. temperature, precipitation and other considered variables (herbivory damage, collection date were at
-
Gagaoua, Mohammed; Picard, Brigitte; Monteils, Valérie
2018-06-01
This study investigated the effects of animal, carcass and muscle characteristics on initial color traits of steaks from 887 Charolais cattle. First, the fixed factors of year of birth, experiment and sex had strong impacts on color traits. From the covariates, increased age lead to intense color (low h*, -1.55 units) and darker and vivid meat (high a*, b* and C*: +4.56, +3.41 and +5.61, respectively). Increases in fatness score and carcass fat weight were associated with increases in a*, b* and C* (redness; +2.90 to +4.06 for a*; yellowness; +2.60 to +3.76 for b*; and vividness, +3.87 to +5.49 for C*) and a darker colored lean (L*; -1.56 to -3.23). As pH24h increased, a* (less red) and C* (less vivid) decreased (-3.06), whereas hue angle increased (+2.69) leading to poorer color. The selection of animals for high degree of muscularity or slaughter weight resulted in lighter and darker meat, respectively. The studied covariates could be used as indicators of Charolais beef color traits. Copyright © 2018 Elsevier Ltd. All rights reserved.
-
14 CFR Appendix B to Part 187 - Fees for FAA Services for Certain Flights
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Fees for FAA Services for Certain Flights B... (CONTINUED) ADMINISTRATIVE REGULATIONS FEES Pt. 187, App. B Appendix B to Part 187—Fees for FAA Services for... pay a fee for the FAA's rendering or providing certain services, including but not limited to the...
-
Quantitative Trait Loci Affecting Calving Traits in Danish Holstein Cattle
DEFF Research Database (Denmark)
Thomasen, J R; Guldbrandtsen, B; Sørensen, P
2008-01-01
The objectives of this study were 1) to detect quantitative trait loci (QTL) affecting direct and maternal calving traits at first calving in the Danish Holstein population, 2) to distinguish between pleiotropic and linked QTL for chromosome regions affecting more than one trait, and 3) to detect...
-
18 CFR Appendix B to Subpart H of... - Appendix B to Subpart H of Part 35
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Appendix B to Subpart H of Part 35 B Appendix B to Subpart H of Part 35 Conservation of Power and Water Resources FEDERAL... SCHEDULES AND TARIFFS Wholesale Sales of Electric Energy, Capacity and Ancillary Services at Market-Based...
-
26 CFR 48.6416(b)(3)-2 - Further manufacture included.
2010-04-01
... 26 Internal Revenue 16 2010-04-01 2010-04-01 true Further manufacture included. 48.6416(b)(3)-2... of Special Application to Retailers and Manufacturers Taxes § 48.6416(b)(3)-2 Further manufacture... overpayment by reason of any use in further manufacture, or sale as part of a second manufactured article...
-
Puthumana, Jayesh; Lee, Min-Chul; Park, Jun Chul; Kim, Hui-Su; Hwang, Dae-Sik; Han, Jeonghoon; Lee, Jae-Seong
2017-03-01
To evaluate the effects of ultraviolet B (UV-B) radiation at the developmental, reproductive, and molecular levels in aquatic invertebrates, we measured UV-B-induced acute toxicity, impairments in developmental and reproductive traits, and UV-B interaction with the entire family of cytochrome P450 (CYP) genes in the intertidal benthic copepod Tigriopus japonicus. We found a significant, dose-dependent reduction (Pcopepods through the predicted AhR-mediated up-regulation of CYP genes. Copyright © 2017 Elsevier B.V. All rights reserved.
-
32 CFR Appendix B to Part 45 - DD Form 214ws
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 214ws B Appendix B to Part 45 National... CERTIFICATE OF RELEASE OR DISCHARGE FROM ACTIVE DUTY (DD FORM 214/5 SERIES) Pt. 45, App. B Appendix B to Part 45—DD Form 214ws EC23OC91.007 ...
-
The relations of motivational traits with workplace deviance.
Diefendorff, James M; Mehta, Kajal
2007-07-01
The authors developed and tested new theoretical relations between approach and avoidance motivational traits and deviant work behaviors. Approach motivation was divided into 3 traits: personal mastery (i.e., desire to achieve), competitive excellence (i.e., desire to perform better than others), and behavioral activation system (BAS) sensitivity (i.e., responsiveness to rewards). Avoidance motivation, which reflects one's sensitivity to negative stimuli and the desire to escape such stimuli, was conceptualized as a unitary construct. Using structural equation modeling, the authors examined the relations of these 4 motivational traits with interpersonal and organizational deviance in a sample of primarily part-time employees. For the approach motivation traits, results showed that personal mastery was negatively related to interpersonal and organizational deviance, BAS sensitivity was positively related to interpersonal and organizational deviance, and competitive excellence was unrelated to both types of workplace deviance. Finally, avoidance motivation was positively related to organizational deviance and interacted with organizational constraints to predict interpersonal deviance.
-
16 CFR Appendix B to Part 436 - Sample Item 20(1) Table-Systemwide Outlet Summary
2010-01-01
... DISCLOSURE REQUIREMENTS AND PROHIBITIONS CONCERNING FRANCHISING Pt. 436, App. B Appendix B to Part 436—Sample... 1Outlet Type Column 2Year Column 3Outlets at the Start of the Year Column 4Outlets at the End of the Year...
-
Shouse, D. T.; Hendricks, R. C.; Lynch, A.; Frayne, C. W.; Stutrud, J. S.; Corporan, E.; Hankins, T.
2012-01-01
Alternate aviation fuels for military or commercial use are required to satisfy MIL-DTL-83133F(2008) or ASTM D 7566 (2010) standards, respectively, and are classified as "drop-in" fuel replacements. To satisfy legacy issues, blends to 50% alternate fuel with petroleum fuels are certified individually on the basis of processing and assumed to be feedstock agnostic. Adherence to alternate fuels and fuel blends requires "smart fueling systems" or advanced fuel-flexible systems, including combustors and engines, without significant sacrifice in performance or emissions requirements. This paper provides preliminary performance (Part A) and emissions and particulates (Part B) combustor sector data. The data are for nominal inlet conditions at 225 psia and 800 F (1.551 MPa and 700 K), for synthetic-paraffinic-kerosene- (SPK-) type (Fisher-Tropsch (FT)) fuel and blends with JP-8+100 relative to JP-8+100 as baseline fueling. Assessments are made of the change in combustor efficiency, wall temperatures, emissions, and luminosity with SPK of 0%, 50%, and 100% fueling composition at 3% combustor pressure drop. The performance results (Part A) indicate no quantifiable differences in combustor efficiency, a general trend to lower liner and higher core flow temperatures with increased FT fuel blends. In general, emissions data (Part B) show little differences, but with percent increase in FT-SPK-type fueling, particulate emissions and wall temperatures are less than with baseline JP-8. High-speed photography illustrates both luminosity and combustor dynamic flame characteristics.
-
29 CFR Appendix B to Part 825 - Certification of Health Care Provider (Forms WH-380E & WH-380F)
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Certification of Health Care Provider (Forms WH-380E & WH-380F) B Appendix B to Part 825 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR DIVISION, DEPARTMENT OF LABOR OTHER LAWS THE FAMILY AND MEDICAL LEAVE ACT OF 1993 Pt. 825, App. B Appendix B to Part...
-
41 CFR Appendix A to Subpart B of... - 3-Key Points and Principles
2010-07-01
... Principles A Appendix A to Subpart B of Part 102 Public Contracts and Property Management Federal Property.... B, App. A Appendix A to Subpart B of Part 102-3—Key Points and Principles This appendix provides... principles that may be applied to situations not covered elsewhere in this subpart. The guidance follows: Key...
-
Genetic and environmental effects on performance traits of ...
African Journals Online (AJOL)
Genetic and environmental effects on performance traits of Simmentaler cattle on the Transvaal Highveld. Tina Rust*. Highveld Region Agricultural Development Institute, .... ef'fect of the mtt' management system (m = 1,2,3,4),. bW = linear regression of the appropriate deviation from the mean of individual age at weaning (in ...
-
Zengel, Bettina; Ambler, James K; McCarthy, Randy J; Skowronski, John J
2017-01-01
This article reports results from a study in which participants encountered either (a) previously known informants who were positive (e.g. Abraham Lincoln), neutral (e.g., Jay Leno), or negative (e.g., Adolf Hitler), or (b) previously unknown informants. The informants ostensibly described either a trait-implicative positive behavior, a trait-implicative negative behavior, or a neutral behavior. These descriptions were framed as either the behavior of the informant or the behavior of another person. Results yielded evidence of informant-trait linkages for both self-informants and for informants who described another person. These effects were not moderated by informant type, behavior valence, or the congruency or incongruency between the prior knowledge of the informant and the behavior valence. Results are discussed in terms of theories of Spontaneous Trait Inference and Spontaneous Trait Transference.
-
Study of the CdX-B2X3-X (X=S, Se), CdTe-B-Te systems
International Nuclear Information System (INIS)
Odin, I.N.; Grin'ko, V.V.; Safronov, E.V.; Kozlovskij, V.F.
2001-01-01
Liquidus surfaces of the CdX-B 2 X 3 -X (X=S, Se), CdTe-B-Te systems are plotted for the first time. It is shown that in equilibrium solid solutions on the basis of ternary Cd 2 B 2 X 5 compounds and binary B 2 X 3 , CdX, BS 2 compounds take part with liquid phases. p gen -T and T-x projects of p-T-x phase diagram of B-S (59-100 at. % S), B-Se (59-100 at. % Se), B-Te systems are plotted . B 2 X 3 , BS 2 compounds are formed in that regions of compositions of B-X systems . In the B-Te system compounds are not formed. Ternary compounds are not formed in the CdTe-B-Te system [ru
-
Genetic analysis for grain quality traits in pakistani wheat varieties
International Nuclear Information System (INIS)
Minhas, N.M.; Ajmal, S.U.; Iqbal, Z.; Munir, M.
2014-01-01
A set of eight parental diallel involving seven commercial wheat cultivars and one breeding line was made to investigate the nature of gene action determining inheritance pattern of grain quality characters. Highly significant differences were observed among the genotypes for 1000 grain weight, protein content, wet gluten and lysine content. Adequacy tests were employed to estimate the fitness of data sets to additive dominance model. Both the tests i.e. analysis of uniformity of Wr, Vr and joint regression analysis validated the data of these traits for genetic analysis. Gene actions for grain quality traits were ascertained following Hayman's analysis of variance. Results of the genetic analysis revealed that both additive and dominance genetic components were involved in the manifestation of characters under study. However, additive gene effects were more pronounced in the genetic control of these traits. Non significance of b1, b2 and b3 values revealed the absence of directional dominance, symmetrical distribution of genes among the parental lines and absence of specific genes action respectively in all the traits. Maternal effects were also noted in 1000 grain weight, protein content and wet gluten percentage. It is concluded that additive effects are crucial in the expression of grain quality characters of wheat in germplasm under study and single plant selection may be recommended in segregating generations for effective improvement in these characters. (author)
-
Assessing the Utility of Compound Trait Estimates of Narrow Personality Traits.
Credé, Marcus; Harms, Peter D; Blacksmith, Nikki; Wood, Dustin
2016-01-01
It has been argued that approximations of narrow traits can be made through linear combinations of broad traits such as the Big Five personality traits. Indeed, Hough and Ones ( 2001 ) used a qualitative analysis of scale content to arrive at a taxonomy of how Big Five traits might be combined to approximate various narrow traits. However, the utility of such compound trait approximations has yet to be established beyond specific cases such as integrity and customer service orientation. Using data from the Eugene-Springfield Community Sample (Goldberg, 2008 ), we explore the ability of linear composites of scores on Big Five traits to approximate scores on 127 narrow trait measures from 5 well-known non-Big-Five omnibus measures of personality. Our findings indicate that individuals' standing on more than 30 narrow traits can be well estimated from 3 different types of linear composites of scores on Big Five traits without a substantial sacrifice in criterion validity. We discuss theoretical accounts for why such relationships exist as well as the theoretical and practical implications of these findings for researchers and practitioners.
-
Comparative mapping of quantitative trait loci for tassel-related traits ...
Indian Academy of Sciences (India)
QIANG YI
2018-03-15
Mar 15, 2018 ... in maize have evaluated flowering-related traits (Li et al. ... with Upadyayula et al. (2006). The measurements taken were TTL, the length (cm) of the tassel ...... M. Banziger, H. R. Mickelson and C. B. Penã–Valdivia), pp.
-
Impulsivity-related traits and their relation to DSM-5 section II and III personality disorders.
Few, Lauren R; Lynam, Donald R; Miller, Joshua D
2015-07-01
Difficulties with impulse control are considered a core feature of personality disorders (PDs) as assessed by the Diagnostic and Statistical Manual of Mental Disorders (5th edition [DSM-5]; American Psychiatric Association, 2013). Despite this, there has been relatively little examination of the manner in which DSM-5 PDs are characterized by multidimensional models of impulsivity that parse this broad umbrella construct into smaller, more unidimensional constructs. Using the UPPS model and measure of impulsivity (Whiteside & Lynam, 2001), the relations between 4 impulsivity-related traits and interview-rated scores on both DSM-5 Section II and III PDs and PD traits were examined in a community sample of individuals currently receiving psychological or psychiatric care (N = 106). As expected, the UPPS traits manifested correlations with the new Section III trait model that were generally consistent with the assertion that this new DSM-5 trait model reflects a pathological variant of the Five-Factor Model (FFM; e.g., UPPS traits associated with FFM conscientiousness were most strongly related to DSM-5 disinhibition traits). Overall, the UPPS traits accounted best for variance in DSM-5 Section II and III Cluster B PDs, consistent with these PDs being characterized, in part, by emotionally and cognitively based forms of impulsivity. (c) 2015 APA, all rights reserved).
-
Genetic variation at loci controlling quality traits in spring wheat
International Nuclear Information System (INIS)
Ali, N.; Iqbal, M.; Asif, M.
2013-01-01
Selection for quality traits in bread wheat (Triticum aestivum L.) during early breeding generations requires quick analytical methods that need small grain samples. Marker assisted selection can be useful for the improvement of quality traits in wheat. The present study was conducted to screen 117 Pakistani adapted spring wheat varieties with DNA markers linked with genes controlling composition of low and high molecular weight glutenin subunits (LMW-GS and HMW-GS, respectively), starch viscosity, Polyphenol oxidase (PPO) activity and grain hardness. DNA fragments associated with the presence/absence of quality related genes were amplified using Polymerase chain reaction (PCR) and detected using agarose gel electrophoresis. Positive allele of beta-secalin, which indicates presence of 1B.1R translocation, was found in 77 (66%) varieties. The marker PPO05 was found in 30 (26%) varieties, indicating lower PPO activity. Grain hardness controlled by Pinb-D1b allele was present in 49 (42%) varieties. Allele Wx-B1b which confers superior noodle quality was found in 48 (41%) varieties. HMW-GS encoded by Glu-D1d allele that exerts a positive effect on dough strength was present in 115 (98%) varieties. LMW-GS alleles Glu-A3d and Glu-B3 were observed in 21 (18%) and 76 (65%) varieties, respectively. Results of the present study may help wheat breeders in selecting parents for improving desirable quality attributes of future wheat varieties. The varieties, identified having desirable quality genes, in this study can be used in the wheat breeding programs aiming to improve quality traits. Early generation marker assisted selection can help to efficiently utilize resources of a breeding program. (author)
-
Energy Technology Data Exchange (ETDEWEB)
Toernqvist, Hans; Aumann, Thomas; Loeher, Bastian [Technische Universitaet Darmstadt, Darmstadt (Germany); Simon, Haik [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, Darmstadt (Germany); Johansson, Haakan [Chalmers Institute of Technology, Goeteborg (Sweden); Collaboration: R3B-Collaboration
2015-07-01
Existing experimental setups aim to exploit most of the improved capabilities and specifications of the upcoming FAIR facility at GSI. Their DAQ designs will require some re-evaluation and upgrades. This presentation summarizes the R3B experimental campaigns in 2014, where the R3B DAQ was subject to testing of several new features that will aid researchers in using larger and more complicated experimental setups in the future. It also acted as part of a small testing ground for the NUSTAR DAQ infrastructure. In order to allow to extract correlations between several experimental sites, new suggested triggering and timestamping implementations were tested over significant distances. Also, with growing experimental complexity comes a greater risk of problems that may be difficult to characterize and solve. To this end, essential remote monitoring and debugging tools have been used successfully.
-
Carcass traits and meat quality of two different rabbit genotypes
Directory of Open Access Journals (Sweden)
Maria D'Agata
2012-07-01
Full Text Available To evaluate the effect of genotype on carcass traits and meat quality, thirty-two rabbits for two genotypes (local population – LP; commercial hybrids – HY were used. Rabbits were weaned at 35 days old and slaughtered at 103 days of age for LP and 87 days of age for HY. Comparing the slaughtering traits of two genotypes, LP provided higher dressing out (59.4% vs 56.2%, Pvs 14.2%, Pvs 22.3, Pvs 8,9%, Pvs 0.86%, Pvs 1.12%; Pvs 19.2%; Pvs 31.6%; Pvs 3.8%; P*, higher redness (a*, yellowness (b* and C* value than HY (P
-
32 CFR Appendix B to Part 275 - Obtaining Customer Authorization
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Obtaining Customer Authorization B Appendix B to... OF 1978 Pt. 275, App. B Appendix B to Part 275—Obtaining Customer Authorization A. A DoD law... feasible, obtain the customer's consent. B. Any authorization obtained under paragraph A. of this appendix...
-
12 CFR Appendix B to Part 216 - Sample Clauses
2010-01-01
... CONSUMER FINANCIAL INFORMATION (REGULATION P) Pt. 216, App. B Appendix B to Part 216—Sample Clauses Link to..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and security (all...
-
49 CFR Appendix B to Part 230 - Diagrams and Drawings
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Diagrams and Drawings B Appendix B to Part 230 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... to Part 230—Diagrams and Drawings ER17No99.015 ER17No99.016 ER17No99.017 ER17No99.018 ER17No99.019...
-
International Nuclear Information System (INIS)
1993-12-01
The 216-B-3 Expansion Ponds Closure Plan (Revision 1) consists of a Part A Dangerous Waste Permit Application and a Resource Conservation and Recovery Act Closure Plan. An explanation of the Part A submitted with this document is provided at the beginning of the Part A Section. The closure plan consists of nine chapters and five appendices. The 216-B-3 Pond System consists of a series of four earthen, unlined, interconnected ponds and the 216-B-3-3 Ditch that receive waste water from various 200 East Area operating facilities. These four ponds, collectively. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the 216-B-3-3 Ditch. Water discharged to the 216-8-3-3 Ditch flows directly into the 216-B-3 Pond. In the past, waste water discharges to B Pond and the 216-B-3-3 Ditch contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the nonradioactive dangerous portion of mixed waste is regulated under RCRA. Mixed waste also may be considered a hazardous substance under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) when considering remediation of waste sites
-
12 CFR Appendix B to Part 573 - Sample Clauses
2010-01-01
... INFORMATION Pt. 573, App. B Appendix B to Part 573—Sample Clauses Link to an amendment published at 74 FR..., such as “call the following toll-free number: (insert number)”]. A-7—Confidentiality and security (all...
-
Plants with useful traits and related methods
Mackenzie, Sally Ann; De la Rosa Santamaria, Roberto
2016-10-25
The present invention provides methods for obtaining plants that exhibit useful traits by transient suppression of the MSH1 gene of the plants. Methods for identifying genetic loci that provide for useful traits in plants and plants produced with those loci are also provided. In addition, plants that exhibit the useful traits, parts of the plants including seeds, and products of the plants are provided as well as methods of using the plants.
-
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision-support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Part A of Vols. 1 and 2 focuses on D&D. Part B of Vols. 1 and 2 focuses on RA of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the ranking os remedial technologies. Volume 2 (Pts. A, B, and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A, B, and C) contains the TLD data sheets. The focus of Vol. 1, Pt. B, is RA, and it has been divided into six chapters. The first chapter is an introduction, which defines problems specific to the ER Program for ORNL. Chapter 2 provides a general overview of the TLD. Chapters 3 through 5 are organized into necessary subelement categories: RA, characterization, and robotics and automation. The final chapter contains regulatory compliance information concerning RA.
-
Energy Technology Data Exchange (ETDEWEB)
1992-06-01
This report, Part B (Vol. 3) of the permit application for the WIPP facility, contains information related to the site characterization of the facility, including geology, design, rock salt evaluations, maps, drawings, and shaft excavations. (CBS)
-
12 CFR Appendix B to Part 411 - Disclosure Form To Report Lobbying
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Disclosure Form To Report Lobbying B Appendix B to Part 411 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Pt. 411, App. B Appendix B to Part 411—Disclosure Form To Report Lobbying EC23SE91.003 EC23SE91.004...
-
Functional Traits for Carbon Access in Macrophytes.
Stepien, Courtney C; Pfister, Catherine A; Wootton, J Timothy
2016-01-01
Understanding functional trait distributions among organisms can inform impacts on and responses to environmental change. In marine systems, only 1% of dissolved inorganic carbon in seawater exists as CO2. Thus the majority of marine macrophytes not only passively access CO2 for photosynthesis, but also actively transport CO2 and the more common bicarbonate (HCO3-, 92% of seawater dissolved inorganic carbon) into their cells. Because species with these carbon concentrating mechanisms (CCMs) are non-randomly distributed in ecosystems, we ask whether there is a phylogenetic pattern to the distribution of CCMs among algal species. To determine macrophyte traits that influence carbon uptake, we assessed 40 common macrophyte species from the rocky intertidal community of the Northeast Pacific Ocean to a) query whether macrophytes have a CCM and b) determine the evolutionary history of CCMs, using ancestral state reconstructions and stochastic character mapping based on previously published data. Thirty-two species not only depleted CO2, but also concentrated and depleted HCO3-, indicative of a CCM. While analysis of CCMs as a continuous trait in 30 families within Phylum Rhodophyta showed a significant phylogenetic signal under a Brownian motion model, analysis of CCMs as a discrete trait (presence or absence) indicated that red algal families are more divergent than expected in their CCM presence or absence; CCMs are a labile trait within the Rhodophyta. In contrast, CCMs were present in each of 18 Ochrophyta families surveyed, indicating that CCMs are highly conserved in the brown algae. The trait of CCM presence or absence was largely conserved within Families. Fifteen of 23 species tested also changed the seawater buffering capacity, or Total Alkalinity (TA), shifting DIC composition towards increasing concentrations of HCO3- and CO2 for photosynthesis. Manipulating the external TA of the local environment may influence carbon availability in boundary layers and
-
Functional Traits for Carbon Access in Macrophytes
Pfister, Catherine A.; Wootton, J. Timothy
2016-01-01
Understanding functional trait distributions among organisms can inform impacts on and responses to environmental change. In marine systems, only 1% of dissolved inorganic carbon in seawater exists as CO2. Thus the majority of marine macrophytes not only passively access CO2 for photosynthesis, but also actively transport CO2 and the more common bicarbonate (HCO3-, 92% of seawater dissolved inorganic carbon) into their cells. Because species with these carbon concentrating mechanisms (CCMs) are non-randomly distributed in ecosystems, we ask whether there is a phylogenetic pattern to the distribution of CCMs among algal species. To determine macrophyte traits that influence carbon uptake, we assessed 40 common macrophyte species from the rocky intertidal community of the Northeast Pacific Ocean to a) query whether macrophytes have a CCM and b) determine the evolutionary history of CCMs, using ancestral state reconstructions and stochastic character mapping based on previously published data. Thirty-two species not only depleted CO2, but also concentrated and depleted HCO3-, indicative of a CCM. While analysis of CCMs as a continuous trait in 30 families within Phylum Rhodophyta showed a significant phylogenetic signal under a Brownian motion model, analysis of CCMs as a discrete trait (presence or absence) indicated that red algal families are more divergent than expected in their CCM presence or absence; CCMs are a labile trait within the Rhodophyta. In contrast, CCMs were present in each of 18 Ochrophyta families surveyed, indicating that CCMs are highly conserved in the brown algae. The trait of CCM presence or absence was largely conserved within Families. Fifteen of 23 species tested also changed the seawater buffering capacity, or Total Alkalinity (TA), shifting DIC composition towards increasing concentrations of HCO3- and CO2 for photosynthesis. Manipulating the external TA of the local environment may influence carbon availability in boundary layers and
-
QTL detection and elite alleles mining for stigma traits in Oryza sativa by association mapping
Directory of Open Access Journals (Sweden)
Xiaojing Dang
2016-08-01
Full Text Available Stigma traits are very important for hybrid seed production in Oryza sativa, which is a self-pollinated crop; however, the genetic mechanism controlling the traits is poorly understood. In this study, we investigated the phenotypic data of 227 accessions across two years and assessed their genotypic variation with 249 simple sequence repeat (SSR markers. By combining phenotypic and genotypic data, a genome-wide association (GWA map was generated. Large phenotypic variations in stigma length (STL, stigma brush-shaped part length (SBPL and stigma non-brush-shaped part length (SNBPL were found. Significant positive correlations were identified among stigma traits. In total, 2,072 alleles were detected among 227 accessions, with an average of 8.3 alleles per SSR locus. GWA mapping detected 6 quantitative trait loci (QTLs for the STL, 2 QTLs for the SBPL and 7 QTLs for the SNBPL. Eleven, 5, and 12 elite alleles were found for the STL, SBPL and SNBPL, respectively. Optimal cross designs were predicted for improving the target traits. The detected genetic variation in stigma traits and QTLs provides helpful information for cloning candidate STL genes and breeding rice cultivars with longer STLs in the future.
-
Quantitative genetic analysis of anxiety trait in bipolar disorder.
Contreras, J; Hare, E; Chavarría, G; Raventós, H
2018-01-01
Bipolar disorder type I (BPI) affects approximately 1% of the world population. Although genetic influences on bipolar disorder are well established, identification of genes that predispose to the illness has been difficult. Most genetic studies are based on categorical diagnosis. One strategy to overcome this obstacle is the use of quantitative endophenotypes, as has been done for other medical disorders. We studied 619 individuals, 568 participants from 61 extended families and 51 unrelated healthy controls. The sample was 55% female and had a mean age of 43.25 (SD 13.90; range 18-78). Heritability and genetic correlation of the trait scale from the Anxiety State and Trait Inventory (STAI) was computed by using the general linear model (SOLAR package software). we observed that anxiety trait meets the following criteria for an endophenotype of bipolar disorder type I (BPI): 1) association with BPI (individuals with BPI showed the highest trait score (F = 15.20 [5,24], p = 0.009), 2) state-independence confirmed after conducting a test-retest in 321 subjects, 3) co-segregation within families 4) heritability of 0.70 (SE: 0.060), p = 2.33 × 10 -14 and 5) genetic correlation with BPI was 0.20, (SE = 0.17, p = 3.12 × 10 -5 ). Confounding factors such as comorbid disorders and pharmacological treatment could affect the clinical relationship between BPI and anxiety trait. Further research is needed to evaluate if anxiety traits are specially related to BPI in comparison with other traits such as anger, attention or response inhibition deficit, pathological impulsivity or low self-directedness. Anxiety trait is a heritable phenotype that follows a normal distribution when measured not only in subjects with BPI but also in unrelated healthy controls. It could be used as an endophenotype in BPI for the identification of genomic regions with susceptibility genes for this disorder. Published by Elsevier B.V.
-
Mapping QTLs Controlling Flowering Time and Important Agronomic Traits in Pearl Millet.
Kumar, Sushil; Hash, C Tom; Nepolean, T; Satyavathi, C Tara; Singh, Govind; Mahendrakar, Mahesh D; Yadav, Rattan S; Srivastava, Rakesh K
2017-01-01
Pearl millet [ Pennisetum glaucum (L.) R. Br.] is a staple crop for the people of arid and semi-arid regions of the world. It is fast gaining importance as a climate resilient nutricereal. Exploiting the bold seeded, semi-dwarf, and early flowering genotypes in pearl millet is a key breeding strategy to enhance yield, adaptability, and for adequate food in resource-poor zones. Genetic variation for agronomic traits of pearl millet inbreds can be used to dissect complex traits through quantitative trait locus (QTL) mapping. This study was undertaken to map a set of agronomically important traits like flowering time (FT), plant height (PH), panicle length (PL), and grain weight (self and open-pollinated seeds) in the recombinant inbred line (RIL) population of ICMB 841-P3 × 863B-P2 cross. Excluding grain weight (open pollinated), heritabilities for FT, PH, PL, grain weight (selfed) were in high to medium range. A total of six QTLs for FT were detected on five chromosomes, 13 QTLs for PH on six chromosomes, 11 QTLs for PL on five chromosomes, and 14 QTLs for 1,000-grain weight (TGW) spanning five chromosomes. One major QTL on LG3 was common for FT and PH. Three major QTLs for PL, one each on LG1, LG2, and LG6B were detected. The large effect QTL for TGW (self) on LG6B had a phenotypic variance ( R 2 ) of 62.1%. The R 2 for FT, TGW (self), and PL ranged from 22.3 to 59.4%. A total of 21 digenic interactions were discovered for FT ( R 2 = 18-40%) and PL ( R 2 = 13-19%). The epistatic effects did not reveal any significant QTL × QTL × environment (QQE) interactions. The mapped QTLs for flowering time and other agronomic traits in present experiment can be used for marker-assisted selection (MAS) and genomic selection (GS) breeding programs.
-
Beta-thalassaemia trait: haematological parameters
International Nuclear Information System (INIS)
Yousafzai, Y.M.; Khan, S.; Raziq, F.
2010-01-01
Thalassaemia syndromes are a group of hereditary disorders characterised by a genetic deficiency in the synthesis of --globin genes. The objective of this study was to determine the haematological features -thalassaemia trait (BTT), and to determine the sensitivity of Mean Corpuscular Volume (MCV), Mean Corpuscular Haemoglobin (MCH) and -thalassaemia trait. Methods: A descriptive study was conducted in Hayatabad Medical Complex, Peshawar from May 2009 to May 2010 with 203 subjects having BTT. Blood samples were collected in EDTA anti-coagulated tubes. RBC indices were taken as part of complete blood count (CBC) by haematology analyser, and Haemoglobin (Hb) electrophoresis was done to determine the HbA2 percentage. The data was collected and analyzed on statistical software for demographic details, RBC indices and HBA2 levels. Results: Out of 203 patients, 92 (45%) were males and 111 (55%) were females. Most patients tested were in the 15-45 year age group. One-hundred-sixty (79%) patients had anaemia. MCV was lower than 76 fl in all the cases. Mean MCV was 59.1 fl. MCH was low, the mean MCH being 19.3 g/dl. MCH <26 gave sensitivity of 99% in detecting BTT. We calculated MI for these cases and found out that it was <12 in 75% of cases and <15 in 197 (97%). Conclusion: Beta-thalassaemia traits present with a microcytic hypochromic blood picture, detected on simple haematology analysers as low MCV and MCH and MI which provide a beta- thalassaemia trait. (author)
-
12 CFR Appendix B to Part 716 - SAMPLE CLAUSES
2010-01-01
...-dealers, and insurance agents”]; • Non-financial companies, such as [provide illustrative examples, such... CONSUMER FINANCIAL INFORMATION Pt. 716, App. B Appendix B to Part 716—SAMPLE CLAUSES This appendix only... disclose nonpublic personal information about you to the following types of third parties: • Financial...
-
42 CFR 405.801 - Part B appeals-general description.
2010-10-01
... 405.801 Public Health CENTERS FOR MEDICARE & MEDICAID SERVICES, DEPARTMENT OF HEALTH AND HUMAN... rights of a beneficiary under paragraph (a) of this section to appeal the carrier's initial determination... whether an individual has met basic Part B entitlement requirements are covered in subpart G of this part...
-
34 CFR Appendix B to Part 403 - Examples for 34 CFR 403.194-Comparability Requirements
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Examples for 34 CFR 403.194-Comparability Requirements... TECHNOLOGY EDUCATION PROGRAM Pt. 403, App. B Appendix B to Part 403—Examples for 34 CFR 403.194—Comparability... requirements in 34 CFR 403.194(a) include the following: Example 1: The local educational agency files with the...
-
DEFF Research Database (Denmark)
Petersen, Nils Holger
2015-01-01
A brief contextualising discussion of Western Music History and its relations to Theological Aesthetical Thought since Carolingian Times as an introduction to 3 music articles in Part 3 of the volume.......A brief contextualising discussion of Western Music History and its relations to Theological Aesthetical Thought since Carolingian Times as an introduction to 3 music articles in Part 3 of the volume....
-
17 CFR Appendix B to Part 160 - Sample Clauses
2010-04-01
... as [provide illustrative examples, such as “mortgage bankers”]; • Non-financial companies, such as... FINANCIAL INFORMATION Pt. 160, App. B Appendix B to Part 160—Sample Clauses This appendix only applies to privacy notices provided before January 1, 2011. Financial institutions, including a group of financial...
-
40 CFR Appendix B to Part 191 - Calculation of Annual Committed Effective Dose
2010-07-01
... SPENT NUCLEAR FUEL, HIGH-LEVEL AND TRANSURANIC RADIOACTIVE WASTES Pt. 191, App. B Appendix B to Part 191... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Calculation of Annual Committed Effective Dose B Appendix B to Part 191 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED...
-
12 CFR 563b.25 - What definitions apply to this part?
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false What definitions apply to this part? 563b.25... FROM MUTUAL TO STOCK FORM § 563b.25 What definitions apply to this part? The following definitions... (including controlling, controlled by, and under common control with) means the direct or indirect power to...
-
Radiation transport phenomena and modeling. Part A: Codes; Part B: Applications with examples
International Nuclear Information System (INIS)
Lorence, L.J. Jr.; Beutler, D.E.
1997-09-01
This report contains the notes from the second session of the 1997 IEEE Nuclear and Space Radiation Effects Conference Short Course on Applying Computer Simulation Tools to Radiation Effects Problems. Part A discusses the physical phenomena modeled in radiation transport codes and various types of algorithmic implementations. Part B gives examples of how these codes can be used to design experiments whose results can be easily analyzed and describes how to calculate quantities of interest for electronic devices
-
International Nuclear Information System (INIS)
1994-09-01
The Y-12 Plant Remedial Action Technology Logic Diagram (TLD) was developed to provide a decision-support tool that relates environmental restoration (ER) problems at the Y-12 Plant to potential technologies that can remediate theses problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed for sufficient development of these technologies to allow for technology transfer and application to remedial action (RA) activities. The TLD consists of three volumes. Volume 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the rankings of remedial technologies. Volume 2 contains the logic linkages among environmental management goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 contains the TLD data sheets. This report is Part B of Volume 3 and contains the Characterization and Robotics/Automation sections
-
Verified Subtyping with Traits and Mixins
Directory of Open Access Journals (Sweden)
Asankhaya Sharma
2014-07-01
Full Text Available Traits allow decomposing programs into smaller parts and mixins are a form of composition that resemble multiple inheritance. Unfortunately, in the presence of traits, programming languages like Scala give up on subtyping relation between objects. In this paper, we present a method to check subtyping between objects based on entailment in separation logic. We implement our method as a domain specific language in Scala and apply it on the Scala standard library. We have verified that 67% of mixins used in the Scala standard library do indeed conform to subtyping between the traits that are used to build them.
-
SNP variation in the promoter of the PRKAG3 gene and association with meat quality traits in pig.
Ryan, Marion T; Hamill, Ruth M; O'Halloran, Aisling M; Davey, Grace C; McBryan, Jean; Mullen, Anne M; McGee, Chris; Gispert, Marina; Southwood, Olwen I; Sweeney, Torres
2012-07-25
The PRKAG3 gene encodes the γ3 subunit of adenosine monophosphate activated protein kinase (AMPK), a protein that plays a key role in energy metabolism in skeletal muscle. Non-synonymous single nucleotide polymorphisms (SNPs) in this gene such as I199V are associated with important pork quality traits. The objective of this study was to investigate the relationship between gene expression of the PRKAG3 gene, SNP variation in the PRKAG3 promoter and meat quality phenotypes in pork. PRKAG3 gene expression was found to correlate with a number of traits relating to glycolytic potential (GP) and intramuscular fat (IMF) in three phenotypically diverse F1 crosses comprising of 31 Large White, 23 Duroc and 32 Pietrain sire breeds. The majority of associations were observed in the Large White cross. There was a significant association between genotype at the g.-311A>G locus and PRKAG3 gene expression in the Large White cross. In the same population, ten novel SNPs were identified within a 1.3 kb region spanning the promoter and from this three major haplotypes were inferred. Two tagging SNPs (g.-995A>G and g.-311A>G) characterised the haplotypes within the promoter region being studied. These two SNPs were subsequently genotyped in larger populations consisting of Large White (n = 98), Duroc (n = 99) and Pietrain (n = 98) purebreds. Four major haplotypes including promoter SNP's g.-995A>G and g.-311A>G and I199V were inferred. In the Large White breed, HAP1 was associated with IMF% in the M. longissmus thoracis et lumborum (LTL) and driploss%. HAP2 was associated with IMFL% GP-influenced traits pH at 24 hr in LTL (pHULT), pH at 45 min in LTL (pH(45)LT) and pH at 45 min in the M. semimembranosus muscle (pH(45)SM). HAP3 was associated with driploss%, pHULT pH(45)LT and b* Minolta. In the Duroc breed, associations were observed between HAP1 and driploss% and pHUSM. No associations were observed with the remaining haplotypes (HAP2, HAP3 and HAP4) in the Duroc breed. The
-
SNP variation in the promoter of the PRKAG3 gene and association with meat quality traits in pig
Directory of Open Access Journals (Sweden)
Ryan Marion T
2012-07-01
Full Text Available Abstract Background The PRKAG3 gene encodes the γ3 subunit of adenosine monophosphate activated protein kinase (AMPK, a protein that plays a key role in energy metabolism in skeletal muscle. Non-synonymous single nucleotide polymorphisms (SNPs in this gene such as I199V are associated with important pork quality traits. The objective of this study was to investigate the relationship between gene expression of the PRKAG3 gene, SNP variation in the PRKAG3 promoter and meat quality phenotypes in pork. Results PRKAG3 gene expression was found to correlate with a number of traits relating to glycolytic potential (GP and intramuscular fat (IMF in three phenotypically diverse F1 crosses comprising of 31 Large White, 23 Duroc and 32 Pietrain sire breeds. The majority of associations were observed in the Large White cross. There was a significant association between genotype at the g.-311A>G locus and PRKAG3 gene expression in the Large White cross. In the same population, ten novel SNPs were identified within a 1.3 kb region spanning the promoter and from this three major haplotypes were inferred. Two tagging SNPs (g.-995A>G and g.-311A>G characterised the haplotypes within the promoter region being studied. These two SNPs were subsequently genotyped in larger populations consisting of Large White (n = 98, Duroc (n = 99 and Pietrain (n = 98 purebreds. Four major haplotypes including promoter SNP’s g.-995A>G and g.-311A>G and I199V were inferred. In the Large White breed, HAP1 was associated with IMF% in the M. longissmus thoracis et lumborum (LTL and driploss%. HAP2 was associated with IMFL% GP-influenced traits pH at 24 hr in LTL (pHULT, pH at 45 min in LTL (pH45LT and pH at 45 min in the M. semimembranosus muscle (pH45SM. HAP3 was associated with driploss%, pHULT pH45LT and b* Minolta. In the Duroc breed, associations were observed between HAP1 and driploss% and pHUSM. No associations were observed with the remaining haplotypes (HAP2
-
Cultural traits as units of analysis.
O'Brien, Michael J; Lyman, R Lee; Mesoudi, Alex; VanPool, Todd L
2010-12-12
Cultural traits have long been used in anthropology as units of transmission that ostensibly reflect behavioural characteristics of the individuals or groups exhibiting the traits. After they are transmitted, cultural traits serve as units of replication in that they can be modified as part of an individual's cultural repertoire through processes such as recombination, loss or partial alteration within an individual's mind. Cultural traits are analogous to genes in that organisms replicate them, but they are also replicators in their own right. No one has ever seen a unit of transmission, either behavioural or genetic, although we can observe the effects of transmission. Fortunately, such units are manifest in artefacts, features and other components of the archaeological record, and they serve as proxies for studying the transmission (and modification) of cultural traits, provided there is analytical clarity over how to define and measure the units that underlie this inheritance process.
-
Genetic correlations between wool traits and meat quality traits in Merino sheep.
Mortimer, S I; Hatcher, S; Fogarty, N M; van der Werf, J H J; Brown, D J; Swan, A A; Jacob, R H; Geesink, G H; Hopkins, D L; Edwards, J E Hocking; Ponnampalam, E N; Warner, R D; Pearce, K L; Pethick, D W
2017-10-01
Genetic correlations between 29 wool production and quality traits and 25 meat quality and nutritional value traits were estimated for Merino sheep from an Information Nucleus (IN). Genetic correlations among the meat quality and nutritional value traits are also reported. The IN comprised 8 flocks linked genetically and managed across a range of sheep production environments in Australia. The wool traits included over 5,000 yearling and 3,700 adult records for fleece weight, fiber diameter, staple length, staple strength, fiber diameter variation, scoured wool color, and visual scores for breech and body wrinkle. The meat quality traits were measured on samples from the and included over 1,200 records from progeny of over 170 sires for intramuscular fat (IMF), shear force of meat aged for 5 d (SF5), 24 h postmortem pH (pHLL; also measured in the , pHST), fresh and retail meat color and meat nutritional value traits such as iron and zinc levels, and long-chain omega-3 and omega-6 polyunsaturated fatty acid levels. Estimated heritabilities for IMF, SF5, pHLL, pHST, retail meat color lightness (), myoglobin, iron, zinc and across the range of long-chain fatty acids were 0.58 ± 0.11, 0.10 ± 0.09, 0.15 ± 0.07, 0.20 ± 0.10, 0.59 ± 0.15, 0.31 ± 0.09, 0.20 ± 0.09, 0.11 ± 0.09, and range of 0.00 (eicosapentaenoic, docosapentaenoic, and arachidonic acids) to 0.14 ± 0.07 (linoleic acid), respectively. The genetic correlations between the wool production and meat quality traits were low to negligible and indicate that wool breeding programs will have little or no effect on meat quality. There were moderately favorable genetic correlations between important yearling wool production traits and the omega-3 fatty acids that were reduced for corresponding adult wool production traits, but these correlations are unlikely to be important in wool/meat breeding programs because they have high SE, and the omega-3 traits have little or no genetic variance. Significant genetic
-
46 CFR Appendix B to Part 154 - Stress Analyses Definitions
2010-10-01
... 46 Shipping 5 2010-10-01 2010-10-01 false Stress Analyses Definitions B Appendix B to Part 154...—Stress Analyses Definitions The following are the standard definitions of stresses for the analysis of an independent tank type B: Normal stress means the component of stress normal to the plane of reference...
-
45 CFR Appendix B to Part 73 - Code of Ethics for Government Service
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Code of Ethics for Government Service B Appendix B to Part 73 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION STANDARDS OF CONDUCT Pt. 73, App. B Appendix B to Part 73—Code of Ethics for Government Service Any person in...
-
The in-beam tracking detectors for R3B
Energy Technology Data Exchange (ETDEWEB)
Paschalis, Stefanos; Johansen, Jacob; Scheit, Heiko [Institut fuer Kernphysik, Technische Universitaet, D 64289 Darmstadt (Germany); Heil, Michael [GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, D-64291 Darmstadt (Germany); Aumann, Thomas [Institut fuer Kernphysik, Technische Universitaet, D 64289 Darmstadt (Germany); GSI Helmholtzzentrum fuer Schwerionenforschung GmbH, D-64291 Darmstadt (Germany); Krivshich, Anatoly [PNPI St. Petersburg, 188300 Gatchina (Russian Federation); Collaboration: R3B-Collaboration
2015-07-01
The R3B experiment is part of the NUSTAR pillar at FAIR. One of the great strengths of the R3B experiment is the kinematically complete measurement of reactions with exotic ions with energies of up to 1 AGeV. Key components of the R3B experiment are the neutron detector NeuLAND, the γ and charge-particle calorimeter CALIFA, the Si Tracker and the in-beam tracking detectors. A cornerstone instrument of the setup is the new dipole magnet (GLAD) which bends and momentum analyses the high-rigidity beams. A precise tracking of the charged particles through the magnetic field is crucial to resolve the masses of heavy ions and measure the momentum of the fragments with high resolution. In this contribution we present the technical design details of the in-beam tracking detectors that will be used in the R3B experiment together with recent results obtained from in-beam prototype testing. In particular, we discuss Si detectors, detectors based on plastic-scintillator fibers and paddles, straw-tube gas detectors and the overall performance of the system.
-
40 CFR Appendix B to Part 425 - Modified Monier-Williams Method
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Modified Monier-Williams Method B Appendix B to Part 425 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS LEATHER TANNING AND FINISHING POINT SOURCE CATEGORY Pt. 425, App. B Appendix B to...
-
Directory of Open Access Journals (Sweden)
Haiying Liu
2012-11-01
Full Text Available Insulin-like growth factor binding protein-3 (IGFBP-3 gene is important for regulation of growth and development in mammals. The present investigation was carried out to study DNA polymorphism by PCR-RFLP of IGFBP-3 gene and its effect on fibre traits of Chinese Inner Mongolian cashmere goats. The fibre traits data investigated were cashmere fibre diameter, combed cashmere weight, cashmere fibre length and guard hair length. Four hundred and forty-four animals were used to detect polymorphisms in the hircine IGFBP-3 gene. A 316-bp fragment of the IGFBP-3 gene in exon 2 was amplified and digested with HaeIII restriction enzyme. Three patterns of restriction fragments were observed in the populations. The frequency of AA, AB and BB genotypes was 0.58, 0.33 and 0.09 respectively. The allelic frequency of the A and B allele was 0.75 and 0.25 respectively. Nucleotide sequencing revealed a C>G transition in the exon 2 region of the IGFBP-3 gene resulting in R158G change which caused the polymorphism. Least squares analysis revealed a significant effect of genotypes on cashmere weight (p0.05. The animals of AB and BB genotypes showed higher cashmere weight, cashmere fibre length and hair length than the animals possessing AA genotype. These results suggested that polymorphisms in the hircine IGFBP-3 gene might be a potential molecular marker for cashmere weight in cashmere goats.
-
12 CFR Appendix B to Part 563e - CRA Notice
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false CRA Notice B Appendix B to Part 563e Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE TREASURY COMMUNITY REINVESTMENT Pt. 563e, App. B... Reinvestment Act (CRA), the Office of Thrift Supervision (OTS) evaluates our record of helping to meet the...
-
Abacar, Jose Daniel; Zhao-miao, Lin; Xin-cheng, Zhang; Cheng-qiang, Ding; She, Tang; Zheng-hui, Liu; Shao-hua, Wang; Yan-feng, Ding
2016-01-01
To select elite germplasms, 112 mutants derived from japonica rice cultivar Wuyujing 3 were evaluated. The yield components such as panicle number per square meter, grain number per panicle, and grain weight were measured. The quality traits such as percentage of chalky grains (PCG), brown rice yield (BRY), milled rice yield (MRY), degree of milling (DM), amylose content (AC), protein content (PC), and relationships among traits were inverstigated. Results showed that grain yield ranged from ...
-
Directory of Open Access Journals (Sweden)
Muhammad Cahyadi
2016-01-01
Full Text Available Quantitative trait locus (QTL is a particular region of the genome containing one or more genes associated with economically important quantitative traits. This study was conducted to identify QTL regions for body weight and growth traits in purebred Korean native chicken (KNC. F1 samples (n = 595 were genotyped using 127 microsatellite markers and 8 single nucleotide polymorphisms that covered 2,616.1 centi Morgan (cM of map length for 26 autosomal linkage groups. Body weight traits were measured every 2 weeks from hatch to 20 weeks of age. Weight of half carcass was also collected together with growth rate. A multipoint variance component linkage approach was used to identify QTLs for the body weight traits. Two significant QTLs for growth were identified on chicken chromosome 3 (GGA3 for growth 16 to18 weeks (logarithm of the odds [LOD] = 3.24, Nominal p value = 0.0001 and GGA4 for growth 6 to 8 weeks (LOD = 2.88, Nominal p value = 0.0003. Additionally, one significant QTL and three suggestive QTLs were detected for body weight traits in KNC; significant QTL for body weight at 4 weeks (LOD = 2.52, nominal p value = 0.0007 and suggestive QTL for 8 weeks (LOD = 1.96, Nominal p value = 0.0027 were detected on GGA4; QTLs were also detected for two different body weight traits: body weight at 16 weeks on GGA3 and body weight at 18 weeks on GGA19. Additionally, two suggestive QTLs for carcass weight were detected at 0 and 70 cM on GGA19. In conclusion, the current study identified several significant and suggestive QTLs that affect growth related traits in a unique resource pedigree in purebred KNC. This information will contribute to improving the body weight traits in native chicken breeds, especially for the Asian native chicken breeds.
-
Trait and perceived environmental competitiveness in achievement situations.
Elliot, Andrew J; Jury, Mickaël; Murayama, Kou
2018-06-01
Trait and perceived environmental competitiveness are typically studied separately, but they undoubtedly have a joint influence on goal pursuit and behavior in achievement situations. The present research was designed to study them together. We tested the relation between trait and perceived environmental competitiveness, and we tested these variables as separate and sequential predictors of both performance-based goals and performance attainment. In Studies 1a (N = 387 U.S. undergraduates) and 1b (N = 322 U.S. undergraduates), we assessed participants' trait and perceived environmental competitiveness, as well as third variable candidates. In Study 2 (N = 434 MTurk workers), we sought to replicate and extend Study 1 by adding reports of performance-based goal pursuit. In Study 3 (N = 403 U.S. undergraduates), we sought to replicate and extend Study 2 by adding real-world performance attainment. The studies focused on both the classroom and the workplace. Trait and perceived environmental competitiveness were shown to be positively related and to positively predict separate variance in performance-approach and performance-avoidance goal pursuit. Perceived environmental competitiveness and performance-based goal pursuit were shown to be sequential mediators of the indirect relation between trait competitiveness and performance attainment. These studies highlight the importance of attending to the interplay of the person and the (perceived) situation in analyses of competitive striving. © 2017 Wiley Periodicals, Inc.
-
Directory of Open Access Journals (Sweden)
Akira Ishikawa
Full Text Available Although growth and body composition traits are quantitative traits of medical and agricultural importance, the genetic and molecular basis of those traits remains elusive. Our previous genome-wide quantitative trait locus (QTL analyses in an intersubspecific backcross population between C57BL/6JJcl (B6 and wild Mus musculus castaneus mice revealed a major growth QTL (named Pbwg1 on a proximal region of mouse chromosome 2. Using the B6.Cg-Pbwg1 intersubspecific congenic strain created, we revealed 12 closely linked QTLs for body weight and body composition traits on an approximately 44.1-Mb wild-derived congenic region. In this study, we narrowed down genomic regions harboring three (Pbwg1.12, Pbwg1.3 and Pbwg1.5 of the 12 linked QTLs and searched for possible candidate genes for the QTLs. By phenotypic analyses of F2 intercross populations between B6 and each of four B6.Cg-Pbwg1 subcongenic strains with overlapping and non-overlapping introgressed regions, we physically defined Pbwg1.12 affecting body weight to a 3.8-Mb interval (61.5-65.3 Mb on chromosome 2. We fine-mapped Pbwg1.3 for body length to an 8.0-Mb interval (57.3-65.3 and Pbwg1.5 for abdominal white fat weight to a 2.1-Mb interval (59.4-61.5. The wild-derived allele at Pbwg1.12 and Pbwg1.3 uniquely increased body weight and length despite the fact that the wild mouse has a smaller body size than that of B6, whereas it decreased fat weight at Pbwg1.5. Exome sequencing and candidate gene prioritization suggested that Gcg and Grb14 are putative candidate genes for Pbwg1.12 and that Ly75 and Itgb6 are putative candidate genes for Pbwg1.5. These genes had nonsynonymous SNPs, but the SNPs were predicted to be not harmful to protein functions. These results provide information helpful to identify wild-derived quantitative trait genes causing enhanced growth and resistance to obesity.
-
The Vaporization of B2O3(l) to B2O3(g) and B2O2(g)
Jacobson, Nathan S.; Myers, Dwight L.
2011-01-01
The vaporization of B2O3 in a reducing environment leads to formation of both B2O3(g) and B2O2(g). While formation of B2O3(g) is well understood, many questions about the formation of B2O2(g) remain. Previous studies using B(s) + B2O3(l) have led to inconsistent thermodynamic data. In this study, it was found that after heating, B(s) and B2O3(l) appear to separate and variations in contact area likely led to the inconsistent vapor pressures of B2O2(g). To circumvent this problem, an activity of boron is fixed with a two-phase mixture of FeB and Fe2B. Both second and third law enthalpies of formation were measured for B2O2(g) and B2O3(g). From these the enthalpies of formation at 298.15 K are calculated to be -479.9 +/- 41.5 kJ/mol for B2O2(g) and -833.4 +/- 13.1 kJ/mol for B2O3(g). Ab initio calculations to determine the enthalpies of formation of B2O2(g) and B2O3(g) were conducted using the W1BD composite method and show good agreement with the experimental values.
-
Validation and dissection of quantitative trait loci for leaf traits in ...
Indian Academy of Sciences (India)
Validation and dissection of a QTL region for leaf traits in rice which has been reported in a number of independent studies were conducted. Three sets of near isogenic lines (NILs) were originated from a residual heterozygous line derived the indica cross Zhenshan 97B/Milyang 46. They were overlapping and totally ...
-
Interpretation of diagnostic data: 3. How to do it with a simple table (part B).
1983-10-01
The following guidelines are useful if you want to "do it with a simple table" (Table IV): First, identify the sensitivity and specificity of the sign, symptom or diagnostic test you plan to use. Many are already in the literature, and subspecialists should either know them for their field or be able to track them down for you. Depending on whether you are considering a sign, a symptom or a diagnostic laboratory test, you will want to track down a clinical subspecialist, a radiologist, a pathologist and so on. Start your table with a total of 1000 patients, as shown in location (a + b + c + d) of panel A. Using the information you have about the patient before you apply the diagnostic test, estimate the patient's pretest likelihood (prevalence or prior probability) of the target disorder -- let's say 10%. Take this proportion of the total (100) and place it in location (a + c); the remaining 900 patients go in location (b + d) (panel B). Multiply (a + c) (100) by the sensitivity of the diagnostic test (let's say 83%) and place the result (83) in cell a and the difference (17) in cell c; similarly, multiply (b + d) (900) by the specificity of the diagnostic test (let's say 91%) and place the result (819) in cell d and the difference (81) in cell b (panel C). If (a + b) and (c + d) do not add up to 1000, you will know you have made a mistake. You can now calculate the positive predictive value, a/(a + b), and the negative predictive value, d/(c + d), as shown in panel D. You have now reached a level of understanding a fair bit beyond the rule-in/rule-out strategy discussed in part 1 of our series. Furthermore, you can already do more than most clinicians, so you may want to stop here, at least for a while. On the other hand, you may want to go further and learn how to handle slightly more complex tables with multiple cut-off points. In the next article you will find more powerful ways to take advantage of the degree of positivity and negativity of diagnostic test
-
DEFF Research Database (Denmark)
Bille, Dorthe S; Banasik, Karina; Justesen, Johanne M
2011-01-01
Background Two meta-analyses of genome-wide association studies (GWAS) have suggested that four variants: rs2605100 in lysophospholipase-like 1 (LYPLAL1), rs10146997 in neuroxin 3 (NRXN3), rs545854 in methionine sulfoxide reductase A (MSRA), and rs987237 in transcription factor activating enhancer...... diabetes, and central and general overweight and obesity. Methodology/Principal Findings The four variants were genotyped in Danish individuals using KASPar®. Quantitative metabolic traits were examined in a population-based sample (n = 6,038) and WC and BMI were furthermore analyzed in a combined study...... sample (n = 13,507). Case-control studies of diabetes and adiposity included 15,326 individuals. The major G-allele of LYPLAL1 rs2605100 associated with increased fasting serum triglyceride concentrations (per allele effect (ß) = 3%(1;5(95%CI)), padditive = 2.7×10-3), an association driven by the male...
-
32 CFR Appendix B to Part 286 - Addressing FOIA Requests
2010-07-01
... Ballistic Missile Defense Organization Defense Systems Management College National Defense University Armed... 32 National Defense 2 2010-07-01 2010-07-01 false Addressing FOIA Requests B Appendix B to Part 286 National Defense Department of Defense (Continued) OFFICE OF THE SECRETARY OF DEFENSE (CONTINUED...
-
Genetic and QTL analyses of yield and a set of physiological traits in pepper
Alimi, N.A.; Bink, M.C.A.M.; Dieleman, J.A.; Nicolaï, M.; Wubs, M.; Heuvelink, E.; Magan, J.; Voorrips, R.E.; Jansen, J.; Rodrigues, P.C.; Heijden, van der G.W.A.M.; Vercauteren, A.; Vuylsteke, M.; Song, Y.; Glasbey, C.; Barocsi, A.; Lefebvre, V.; Palloix, A.; Eeuwijk, van F.A.
2013-01-01
An interesting strategy for improvement of a complex trait dissects the complex trait in a number of physiological component traits, with the latter having hopefully a simple genetic basis. The complex trait is then improved via improvement of its component traits. As first part of such a strategy
-
Schoormans, D; Verhoeven, J E; Denollet, J; van de Poll-Franse, L; Penninx, B W J H
2018-04-01
Backgrounds Accelerated cellular ageing, which can be examined by telomere length (TL), may be an overarching mechanism underlying the association between personality and adverse health outcomes. This 6-year longitudinal study examined the relation between personality and leukocyte telomere length (LTL) across time among adults with a wide age-range. Data from the Netherlands Study of Depression and Anxiety were used and included patients with a depression and/or anxiety disorder and healthy controls. Overall, 2936 persons (18-65 years, 66% female) had data on LTL at baseline and 1883 persons had LTL at 6-year follow-up. The Big Five personality traits (neuroticism, extraversion, openness to experience, agreeableness, and conscientiousness) and Type D personality were assessed. Neuroticism was negatively (B = -2.11, p = 0.03) and agreeableness was positively (B = 3.84, p = 0.03) related to LTL measured across two time points, which became just non-significant after adjusting for somatic health, lifestyle factors, and recent life stress (B = -1.99, p = 0.06; and B = 3.01, p = 0.10). Type D personality was negatively (B = -50.16, p Big Five traits high neuroticism and low agreeableness, and Type D personality were associated with shorter LTL measured across a 6-year period. Associations with the Big Five traits became non-significant after controlling for somatic health, lifestyle factors, and recent life stress, yet similar trends were observed. Type D personality remained independently associated with shorter LTL after full adjustment.
-
Influences of calf background information on health responses and carcass traits
Weights through production lifetime and various response traits following BRD vaccination and BVDV Type 1b challenge were evaluated in Nellore-Angus F2 and F3 half-blood steers in regard to their parental crosses and subjective temperament score at weaning. Although all steers were the same breed pe...
-
Cao, Liangzi; Hayashi, Kazuki; Tokui, Mayumi; Mori, Masahiko; Miura, Hideho; Onishi, Kazumitsu
2016-03-01
Pre-harvest sprouting (PHS) is one of the serious problems for wheat production, especially in rainy regions. Although seed dormancy is the most critical trait for PHS resistance, the control of heading time should also be considered to prevent seed maturation during unfavorable conditions. In addition, awning is known to enhance water absorption by the spike, causing PHS. In this study, we conducted QTL analysis for three PHS resistant related traits, seed dormancy, heading time and awn length, by using recombinant inbred lines from 'Zenkouji-komugi' (high PHS resistance) × 'Chinese Spring' (weak PHS resistance). QTLs for seed dormancy were detected on chromosomes 1B (QDor-1B) and 4A (QDor-4A), in addition to a QTL on chromosome 3A, which was recently cloned as TaMFT-3A. In addition, the accumulation of the QTLs and their epistatic interactions contributed significantly to a higher level of dormancy. QDor-4A is co-located with the Hooded locus for awn development. Furthermore, an effective QTL, which confers early heading by the Zenkouji-komugi allele, was detected on the short arm of chromosome 7B, where the Vrn-B3 locus is located. Understanding the genetic architecture of traits associated with PHS resistance will facilitate the marker assisted selection to breed new varieties with higher PHS resistance.
-
Polygenic Risk, Appetite Traits, and Weight Gain in Middle Childhood
Steinsbekk, Silje; Belsky, Daniel; Guzey, Ismail Cuneyt; Wardle, Jane; Wichstrøm, Lars
2018-01-01
IMPORTANCE Genome-wide association studies have identified genetic risks for obesity. These genetic risks influence development of obesity partly by accelerating weight gain in childhood. Research is needed to identify mechanisms to inform intervention. Cross-sectional studies suggest appetite traits as a candidate mechanism. Longitudinal studies are needed to test whether appetite traits mediate genetic influences on children’s weight gain. OBJECTIVE To test whether genetic risk for obesity predicts accelerated weight gain in middle childhood (ages 4–8 years) and whether genetic association with accelerated weight gain is mediated by appetite traits. DESIGN, SETTING, AND PARTICIPANTS Longitudinal study of a representative birth cohort at the Trondheim Early Secure Study, Trondheim, Norway, enrolled at age 4 years during 2007 to 2008, with follow-ups at ages 6 and 8 years. Participants were sampled from all children born in 2003 or 2004 who attended regular community health checkups for 4-year-olds (97.2%attendance; 82.0%consent rate, n = 2475). Nine hundred ninety-five children participated at age 4 years, 795 at age 6 years, and 699 at age 8 years. Analyses included 652 children with genotype, adiposity, and appetite data. MAIN OUTCOMES AND MEASURES Outcomes were body mass index and body-fat phenotypes measured from anthropometry (ages 4, 6, and 8 years) and bioelectrical impedance (ages 6 and 8 years). Genetic risk for obesity was measured using a genetic risk score composed of 32 single-nucleotide polymorphisms previously discovered in genome-wide association studies of adult body mass index. Appetite traits were measured at age 6 years with the Children’s Eating Behavior Questionnaire. RESULTS Of the 652 genotyped child participants, 323 (49.5%) were female, 58 (8.9%) were overweight, and 1 (0.2%) was obese. Children at higher genetic risk for obesity had higher baseline body mass index and fat mass compared with lower genetic risk peers, and they gained
-
Directory of Open Access Journals (Sweden)
Brandon Jeffrey
Full Text Available Fast pyrolysis has been identified as one of the biorenewable conversion platforms that could be a part of an alternative energy future, but it has not yet received the same attention as cellulosic ethanol in the analysis of genetic inheritance within potential feedstocks such as maize. Ten bio-oil compounds were measured via pyrolysis/gas chromatography-mass spectrometry (Py/GC-MS in maize cobs. 184 recombinant inbred lines (RILs of the intermated B73 x Mo17 (IBM Syn4 population were analyzed in two environments, using 1339 markers, for quantitative trait locus (QTL mapping. QTL mapping was performed using composite interval mapping with significance thresholds established by 1000 permutations at α = 0.05. 50 QTL were found in total across those ten traits with R2 values ranging from 1.7 to 5.8%, indicating a complex quantitative inheritance of these traits.
-
49 CFR Appendix B to Part 222 - Alternative Safety Measures
2010-10-01
.... 222, App. B Appendix B to Part 222—Alternative Safety Measures Introduction A public authority seeking... requirements associated with an SSM as listed in appendix A is revised or deleted, data or analysis supporting...); d. Photographic or video equipment deployed to capture images sufficient to document the violation...
-
Estimation of Genetic Parameters for Fat Deposition and Carcass Traits in Broilers
Zerehdaran, S.; Vereijken, A.L.J.; Arendonk, van J.A.M.; Waaij, van der E.H.
2004-01-01
Abdominal and subcutaneous fat are regarded as the main sources of waste in the slaughterhouse. Fat stored intramuscularly is regarded a favorite trait related to meat quality. The objective of current study was to estimate genetic parameters for fat deposition in the 3 different parts of body and
-
Directory of Open Access Journals (Sweden)
Silvano O Assanga
Full Text Available Stable quantitative trait loci (QTL are important for deployment in marker assisted selection in wheat (Triticum aestivum L. and other crops. We reported QTL discovery in wheat using a population of 217 recombinant inbred lines and multiple statistical approach including multi-environment, multi-trait and epistatic interactions analysis. We detected nine consistent QTL linked to different traits on chromosomes 1A, 2A, 2B, 5A, 5B, 6A, 6B and 7A. Grain yield QTL were detected on chromosomes 2B.1 and 5B across three or four models of GenStat, MapQTL, and QTLNetwork while the QTL on chromosomes 5A.1, 6A.2, and 7A.1 were only significant with yield from one or two models. The phenotypic variation explained (PVE by the QTL on 2B.1 ranged from 3.3-25.1% based on single and multi-environment models in GenStat and was pleiotropic or co-located with maturity (days to heading and yield related traits (test weight, thousand kernel weight, harvest index. The QTL on 5B at 211 cM had PVE range of 1.8-9.3% and had no significant pleiotropic effects. Other consistent QTL detected in this study were linked to yield related traits and agronomic traits. The QTL on 1A was consistent for the number of spikes m-2 across environments and all the four analysis models with a PVE range of 5.8-8.6%. QTL for kernels spike-1 were found in chromosomes 1A, 2A.1, 2B.1, 6A.2, and 7A.1 with PVE ranged from 5.6-12.8% while QTL for thousand kernel weight were located on chromosomes 1A, 2B.1, 5A.1, 6A.2, 6B.1 and 7A.1 with PVEranged from 2.7-19.5%. Among the consistent QTL, five QTL had significant epistatic interactions (additive × additive at least for one trait and none revealed significant additive × additive × environment interactions. Comparative analysis revealed that the region within the confidence interval of the QTL on 5B from 211.4-244.2 cM is also linked to genes for aspartate-semialdehyde dehydrogenase, splicing regulatory glutamine/lysine-rich protein 1 isoform X1
-
Identification of Marker-Trait Associations for Lint Traits in Cotton
Iqbal, Muhammad A.; Rahman, Mehboob-ur-
2017-01-01
Harvesting high quality lint, a long-awaited breeding goal—accomplished partly, can be achieved by identifying DNA markers which could be used for diagnosing cotton plants containing the desired traits. In the present studies, a total of 185 cotton genotypes exhibiting diversity for lint traits were selected from a set of 546 genotypes evaluated for fiber traits in 2009. These genotypes were extensively studied for three consecutive years (2011–2013) at three different locations. Significant genetic variations were found for average boll weight, ginning out turn (GOT), micronaire value, staple length, fiber bundle strength, and uniformity index. IR-NIBGE-3701 showed maximum GOT (43.63%). Clustering of genotypes using Ward's method was found more informative than that of the clusters generated by principal component analysis. A total of 382 SSRs were surveyed on 10 Gossypium hirsutum genotypes exhibiting contrasting fiber traits. Out of these, 95 polymorphic SSR primer pairs were then surveyed on 185 genotypes. The gene diversity averaged 0.191 and the polymorphic information content (PIC) averaged 0.175. Unweighted pair group method with arithmetic mean (UPGMA), principal coordinate analysis (PCoA), and STRUCTURE software grouped these genotypes into four major clusters each. Genetic distance within the clusters ranged from 0.0587 to 0.1030. A total of 47 (25.41%) genotypes exhibited shared ancestry. In total 6.8% (r2 ≥ 0.05) and 4.4% (r2 ≥ 0.1) of the marker pairs showed significant linkage disequilibrium (LD). A number of marker-trait associations (in total 75) including 13 for average boll weight, 18 for GOT percentage, eight for micronaire value, 18 for staple length, three for fiber bundle strength, and 15 for uniformity index were calculated. Out of these, MGHES-51 was associated with all the traits. Most of the marker-trait associations were novel while few validated the associations reported in the previous studies. High frequency of favorable
-
Choi, Kyeong-Mi; Shin, Eunjin; Liu, Qing; Yoo, Hwan-Soo; Kim, Young Choong; Sung, Sang Hyun; Hwang, Bang Yeon; Lee, Mi Kyeong
2011-07-01
Fraxinus rhynchophylla showed significant inhibitory activity on adipocyte differentiation in the 3T3-L1 preadipocyte cell line as assessed by measuring fat accumulation using Oil Red O staining. Further fractionation led to the isolation of two secoiridoids, oleuropein and hydroxyframoside B. Hydroxyframoside B significantly reduced fat accumulation and triglyceride content in differentiated 3T3-L1 cells without affecting cell viability, whereas oleuropein showed little effect. Further studies with interval treatment demonstrated that hydroxyframoside B exerted inhibitory activity on adipocyte differentiation when treated within 2 days (days 0-2) after differentiation induction. In addition, hydroxyframoside B significantly blocked the induction of adipogenic transcription factors such as C/EBP α, C/EBP β, and PPAR γ. Taken together, these results suggest that hydroxyframoside B inhibited early/middle stage of adipogenic differentiation, in part, via inhibition of C/EBP α, C/EBP β, and PPAR γ-dependent pathways. © Georg Thieme Verlag KG Stuttgart · New York.
-
25 CFR Appendix B to Part 276 - Financial Reporting Requirements
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Financial Reporting Requirements B Appendix B to Part 276...—Financial Reporting Requirements A. Purpose and scope. This appendix prescribes requirements for grantee to report financial information to the Bureau and to request advances and reimbursement when a letter-of...
-
49 CFR Appendix B to Part 178 - Alternative Leakproofness Test Methods
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Alternative Leakproofness Test Methods B Appendix... FOR PACKAGINGS Pt. 178, App. B Appendix B to Part 178—Alternative Leakproofness Test Methods In addition to the method prescribed in § 178.604 of this subchapter, the following leakproofness test methods...
-
Micalizzi, Lauren; Ronald, Angelica; Saudino, Kimberly J.
2015-01-01
A genetically informed cross-lagged model was applied to twin data to explore etiological links between autistic-like traits and affective problems in early childhood. The sample comprised 310 same-sex twin pairs (143 monozygotic and 167 dizygotic; 53% male). Autistic-like traits and affective problems were assessed at ages 2 and 3 using parent ratings. Both constructs were related within and across age (r = .30−.53) and showed moderate stability (r = .45−.54). Autistic-like traits and affective problems showed genetic and environmental influences at both ages. Whereas at age 2, the covariance between autistic-like traits and affective problems was entirely due to environmental influences (shared and nonshared), at age 3, genetic factors also contributed to the covariance between constructs. The stability paths, but not the cross-lagged paths, were significant, indicating that there is stability in both autistic-like traits and affective problems but they do not mutually influence each other across age. Stability effects were due to genetic, shared, and nonshared environmental influences. Substantial novel genetic and nonshared environmental influences emerge at age 3 and suggest change in the etiology of these constructs over time. During early childhood, autistic-like traits tend to occur alongside affective problems and partly overlapping genetic and environmental influences explain this association. PMID:26456961
-
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration, testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1 (Technology Evaluation), Vol. 2 (Technology Logic Diagram), and Vol. 3 (Technology Evaluation Data Sheets). Part A of Vols. 1. and 2 focuses on D&D. Part B of Vols. 1 and 2 focuses on the RA of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TLD, an explanation of the program-specific responsibilities, a review of identified technologies, and the rankings of remedial technologies. Volume 2 (Pts. A, B, and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A, B, and C) contains the TLD data sheets. Remedial action is the focus of Vol. 2, Pt. B, which has been divided into the three necessary subelements of the RA: characterization, RA, and robotics and automation. Each of these sections address general ORNL problems, which are then broken down by problem area/constituents and linked to potential remedial technologies. The diagrams also contain summary information about a technology`s status, its science and technology needs, and its implementation needs.
-
Electronic and structural properties of B i2S e3:Cu
Sobczak, Kamil; Strak, Pawel; Kempisty, Pawel; Wolos, Agnieszka; Hruban, Andrzej; Materna, Andrzej; Borysiuk, Jolanta
2018-04-01
Electronic and structural properties of B i2S e3 and its extension to copper doped B i2S e3:Cu were studied using combined ab initio simulations and transmission electron microscopy based techniques, including electron energy loss spectroscopy, energy filtered transmission electron microscopy, and energy dispersive x-ray spectroscopy. The stability of the mixed phases was investigated for substitutional and intercalation changes of basic B i2S e3 structure. Four systems were compared: B i2S e3 , structures obtaining by Cu intercalation of the van der Waals gap, by substitution of Bi by Cu in quintuple layers, and C u2Se . The structures were identified and their electronic properties were obtained. Transmission electron microscopy measurements of B i2S e3 and the B i2S e3:Cu system identified the first structure as uniform and the second as composite, consisting of a nonuniform lower-Cu-content matrix and randomly distributed high-Cu-concentration precipitates. Critical comparison of the ab initio and experimental data identified the matrix as having a B i2S e3 dominant part with randomly distributed Cu-intercalated regions having 1Cu-B i2S e3 structure. The precipitates were determined to have 3Cu-B i2S e3 structure.
-
Comparative analysis of the CRDA using BNL-TWIGL and RAMONA-3B
International Nuclear Information System (INIS)
Neogy, P.; Carew, J.F.
1983-06-01
A comparative analysis of the BWR control rod drop accident (CRDA) using BNL-TWIGL and RAMONA-3B has been performed as part of the BNL/NRC evaluation of methods currently used to analyze BWR CRDA events. A principal objective of this analysis was to test the two-dimensional neutronics model used in BNL-TWIGL aganist the full three-dimensional model in RAMONA-3B. Additionally, the results of analyzing the identical transient with the two codes were expected to help evaluate other approximate models used, such as the coarse mesh nodal neutronics scheme in RAMONA-3B and the equilibrium bulk boiling model in BNL-TWIGL
-
Dielectric and optical properties of glasses of CdO-B2O3 system
International Nuclear Information System (INIS)
Semin, V.N.; Mal'tsev, V.T.; Panich, A.E.
1986-01-01
Dielectric and optical properties of glasses of CdO-B 2 O 3 system are investigated. It is shown, that on changing the composition, cadmic-borate glasses undergo structural changes, similar to those, taking place in lead-borate glasses, and the maximum part of the boron atoms in the oxygen tetrahedral coordination is at CdO:B 2 O 3 =3:2
-
Directory of Open Access Journals (Sweden)
Edwin Widodo
2010-06-01
Full Text Available Zonna pellucidae can be develop as antigen potential candidates based on reversible immunocontraceptive vaccines. Immunogenic sites of bovine zonna pellucidae 3 (bZP3 could stimulated the presence of anti-bZP3 which be located on rabbit ZP and inhibit sperm-egg interaction on fertilization process. Purpose of this research is to detect spesific binding anti-bZP3 to rabbit oocytes using dot blotting and ELISA method. Sub cutan induction of bZP3 with Freund's adjuvant, CFA (Complete Freund's Adjuvant for initial immunization and following by IFA (Incomplete Freund's Adjuvant at the 14th day and 39th day. Control female rabbit injected by Tris-Cl buffer diluted in Freund's adjuvant without bZP3 antigen. Rabbit serum injected to rat for producing Rat Anti Rabbit Anti-bZP3. This research concludes spesific binding of anti-bZP3 with increasing purple colour on dot blotting methods. Anti-bZP3 increasing on 24th day and 31th day and still until 48th day. Measurement with ELISA methods showed increased titer on OD405. Highest titer showed on 31th day post immunization. Anti-bZP3 synthetized by bZP3 induced on rabbit detectable by immunohistochemistry methods on late primary oocytes, early secondary oocytes, growing secondary oocytes, and oocytes on de Graaf folicular phase. Keywords: Dot blotting, ELISA, bZP3, anti-bZP3
-
Growth models for morphological traits of sunn hemp
Directory of Open Access Journals (Sweden)
Cláudia Marques de Bem
2017-10-01
Full Text Available The objective of the present study was to fit Gompertz and Logistic nonlinear to descriptions of morphological traits of sunn hemp. Two uniformity trials were conducted and the crops received identical treatment in all experimental area. Sunn hemp seeds were sown in rows 0.5 m apart with a plant density of 20 plants per row meter in a usable area of 52 m × 50 m. The following morphological traits were evaluated: plant height (PH, number of leaves (NL, stem diameter (SD, and root length (RL. These traits were assessed daily during two sowing periods—seeds were sown on October 22, 2014 (first period and December 3, 2014 (second period. Four plants were randomly collected daily, beginning 7 days after first period and 13 days after for second period, totaling 94 and 76 evaluation days, respectively. For Gompertz models the equation was used y=a*e^((?-e?^((b-c*xiand Logistic models the equation was used yi= a/(1+e^((-b-c*xi. The inflection points of the Gompertz and Logistic models were calculated and the goodness of fit was quantified using the adjusted coefficient of determination, Akaike information criterion, standard deviation of residuals, mean absolute deviation, mean absolute percentage error, and mean prediction error. Differences were observed between the Gompertz and Logistic models and between the experimental periods in the parameter estimate for all morphological traits measured. Satisfactory growth curve fittings were achieved for plant height, number of leaves, and stem diameter in both models using the evaluation criteria: coefficient of determination (R², Akaike information criterion (AIC, standard deviation of residuals (SDR, mean absolute deviation (MAD, mean absolute percentage error (MAPE, and mean prediction error (MPE.
-
Moul, Caroline; Dobson-Stone, Carol; Brennan, John; Hawes, David; Dadds, Mark
2013-01-01
Background The serotonin system is thought to play a role in the aetiology of antisocial and aggressive behaviour in both adults and children however previous findings have been inconsistent. Recently, research has suggested that the function of the serotonin system may be specifically altered in a sub-set of antisocial populations – those with psychopathic (callous-unemotional) personality traits. We explored the relationships between callous-unemotional traits and functional polymorphisms of selected serotonin-system genes, and tested the association between callous-unemotional traits and serum serotonin levels independently of antisocial and aggressive behaviour. Method Participants were boys with antisocial behaviour problems aged 3–16 years referred to University of New South Wales Child Behaviour Research Clinics. Participants volunteered either a blood or saliva sample from which levels of serum serotonin (N = 66) and/or serotonin-system single nucleotide polymorphisms (N = 157) were assayed. Results Functional single nucleotide polymorphisms from the serotonin 1b receptor gene (HTR1B) and 2a receptor gene (HTR2A) were found to be associated with callous-unemotional traits. Serum serotonin level was a significant predictor of callous-unemotional traits; levels were significantly lower in boys with high callous-unemotional traits than in boys with low callous-unemotional traits. Conclusion Results provide support to the emerging literature that argues for a genetically-driven system-wide alteration in serotonin function in the aetiology of callous-unemotional traits. The findings should be interpreted as preliminary and future research that aims to replicate and further investigate these results is required. PMID:23457595
-
Qatar Exoplanet Survey : Qatar-3b, Qatar-4b, and Qatar-5b
Alsubai, Khalid; Mislis, Dimitris; Tsvetanov, Zlatan I.; Latham, David W.; Bieryla, Allyson; Buchhave, Lars A.; Esquerdo, Gilbert A.; Bramich, D. M.; Pyrzas, Stylianos; Vilchez, Nicolas P. E.; Mancini, Luigi; Southworth, John; Evans, Daniel F.; Henning, Thomas; Ciceri, Simona
2017-04-01
We report the discovery of Qatar-3b, Qatar-4b, and Qatar-5b, three new transiting planets identified by the Qatar Exoplanet Survey. The three planets belong to the hot Jupiter family, with orbital periods of {P}{{Q}3{{b}}} = 2.50792 days, {P}{{Q}4{{b}}} = 1.80539 days, and {P}{{Q}5{{b}}} = 2.87923 days. Follow-up spectroscopic observations reveal the masses of the planets to be {M}{{Q}3{{b}}} = 4.31 ± 0.47 {M}{{J}}, {M}{{Q}4{{b}}} = 6.10 ± 0.54 {M}{{J}}, and {M}{{Q}5{{b}}} = 4.32 ± 0.18 {M}{{J}}, while model fits to the transit light curves yield radii of {R}{{Q}3{{b}}} = 1.096 ± 0.14 {R}{{J}}, {R}{{Q}4{{b}}} = 1.135 ± 0.11 {R}{{J}}, and {R}{{Q}5{{b}}} = 1.107 ± 0.064 {R}{{J}}. The host stars are low-mass main sequence stars with masses and radii M Q3 = 1.145 ± 0.064 M ⊙, M Q4 = 0.896 ± 0.048 M ⊙, M Q5 = 1.128 ± 0.056 M ⊙ and R Q3 = 1.272 ± 0.14 R ⊙, R Q4 = 0.849 ± 0.063 R ⊙, and R Q5 = 1.076 ± 0.051 R ⊙ for Qatar-3, 4, and 5 respectively. The V magnitudes of the three host stars are V Q3 = 12.88, V Q4 = 13.60, and V Q5 = 12.82. All three new planets can be classified as heavy hot Jupiters (M > 4 M J).
-
Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)
Energy Technology Data Exchange (ETDEWEB)
Duangtum, Natapol [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Junking, Mutita; Sawasdee, Nunghathai [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Cheunsuchon, Boonyarit [Department of Pathology, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Limjindaporn, Thawornchai, E-mail: limjindaporn@yahoo.com [Department of Anatomy, Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand); Yenchitsomanus, Pa-thai, E-mail: grpye@mahidol.ac.th [Medical Molecular Biology Unit, Office for Research and Development Faculty of Medicine Siriraj Hospital, Mahidol University, Bangkok 10700 (Thailand)
2011-09-16
Highlights: {yields} Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). {yields} The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. {yields} The co-localization between kAE and KIF3B was detected in human kidney tissues. {yields} A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. {yields} KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of {alpha}-intercalated cells of the kidney collecting duct leads to the defect of the Cl{sup -}/HCO{sub 3}{sup -} exchange and the failure of proton (H{sup +}) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney {alpha}-intercalated cells.
-
Human kidney anion exchanger 1 interacts with kinesin family member 3B (KIF3B)
International Nuclear Information System (INIS)
Duangtum, Natapol; Junking, Mutita; Sawasdee, Nunghathai; Cheunsuchon, Boonyarit; Limjindaporn, Thawornchai; Yenchitsomanus, Pa-thai
2011-01-01
Highlights: → Impaired trafficking of kAE1 causes distal renal tubular acidosis (dRTA). → The interaction between kAE1 and kinesin family member 3B (KIF3B) is reported. → The co-localization between kAE and KIF3B was detected in human kidney tissues. → A marked reduction of kAE1 on the cell membrane was observed when KIF3B was knockdown. → KFI3B plays an important role in trafficking of kAE1 to the plasma membrane. -- Abstract: Impaired trafficking of human kidney anion exchanger 1 (kAE1) to the basolateral membrane of α-intercalated cells of the kidney collecting duct leads to the defect of the Cl - /HCO 3 - exchange and the failure of proton (H + ) secretion at the apical membrane of these cells, causing distal renal tubular acidosis (dRTA). In the sorting process, kAE1 interacts with AP-1 mu1A, a subunit of AP-1A adaptor complex. However, it is not known whether kAE1 interacts with motor proteins in its trafficking process to the plasma membrane or not. We report here that kAE1 interacts with kinesin family member 3B (KIF3B) in kidney cells and a dileucine motif at the carboxyl terminus of kAE1 contributes to this interaction. We have also demonstrated that kAE1 co-localizes with KIF3B in human kidney tissues and the suppression of endogenous KIF3B in HEK293T cells by small interfering RNA (siRNA) decreases membrane localization of kAE1 but increases its intracellular accumulation. All results suggest that KIF3B is involved in the trafficking of kAE1 to the plasma membrane of human kidney α-intercalated cells.
-
Short syntheses of enantiopure calystegine B-2, B-3, and B-4
DEFF Research Database (Denmark)
Skaanderup, Philip Robert; Madsen, Robert
2001-01-01
Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps.......Calystegine B-2 B-3, and B-4 have been prepared in 5 steps from the benzyl protected methyl 6-iodoglycopyranosides of glucose, galactose and mannose, respectively, by using a zinc-mediated domino reaction followed by ring-closing olefin metathesis as the key steps....
-
Shouse, D. T.; Neuroth, C.; Henricks, R. C.; Lynch, A.; Frayne, C.; Stutrud, J. S.; Corporan, E.; Hankins, T.
2010-01-01
Alternate aviation fuels for military or commercial use are required to satisfy MIL-DTL-83133F(2008) or ASTM D 7566 (2010) standards, respectively, and are classified as drop-in fuel replacements. To satisfy legacy issues, blends to 50% alternate fuel with petroleum fuels are certified individually on the basis of feedstock. Adherence to alternate fuels and fuel blends requires smart fueling systems or advanced fuel-flexible systems, including combustors and engines without significant sacrifice in performance or emissions requirements. This paper provides preliminary performance (Part A) and emissions and particulates (Part B) combustor sector data for synthetic-parafinic-kerosene- (SPK-) type fuel and blends with JP-8+100 relative to JP-8+100 as baseline fueling.
-
2010-07-01
... 314(b) of the USA Patriot Act and 31 CFR 103.110 B Appendix B to Part 103 Money and Finance: Treasury Regulations Relating to Money and Finance FINANCIAL RECORDKEEPING AND REPORTING OF CURRENCY AND FOREIGN TRANSACTIONS Pt. 103, App. B Appendix B to Part 103—Certification for Purposes of Section 314(b) of the USA...
-
Quantitative trait loci for yield and morphological traits in maize under drought stress
Directory of Open Access Journals (Sweden)
Nikolić Ana
2011-01-01
Full Text Available Drought is one of the most important factors contributing to crop yield loss. In order to develop maize varieties with drought tolerance, it is necessary to explore the genetic basis. Mapping quantitative trait loci (QTL that control the yield and associate agronomic traits is one way of understanding drought genetics. QTLs associated with grain yield (GY, leaf width (LW3, LW4 plant height (PH, ear height (EH, leaf number (NL, tassel branch number (TBN and tassel length (TL were studied with composite interval mapping. A total of 43 QTLs were detected, distributed on all chromosomes, except chromosome 9. Phenotypic variability determined for the identified QTLs for all the traits was in the range from 20.99 to 87.24%. Mapping analysis identified genomic regions associated with two traits in a manner that was consistent with phenotypic correlation among traits, supporting either pleiotropy or tight linkage among QTLs.
-
Directory of Open Access Journals (Sweden)
Nick eBouskill
2012-10-01
Full Text Available Trait-based microbial models show clear promise as tools to represent the diversity and activity of microorganisms across ecosystem gradients. These models parameterize specific traits that determine the relative fitness of an ‘organism’ in a given environment, and represent the complexity of biological systems across temporal and spatial scales. In this study we introduce a microbial community trait-based modeling framework (MicroTrait focused on nitrification (MicroTrait-N that represents the ammonia-oxidizing bacteria (AOB and ammonia-oxidizing archaea (AOA and nitrite oxidizing bacteria (NOB using traits related to enzyme kinetics and physiological properties. We used this model to predict nitrifier diversity, ammonia (NH3 oxidation rates and nitrous oxide (N2O production across pH, temperature and substrate gradients. Predicted nitrifier diversity was predominantly determined by temperature and substrate availability, the latter was strongly influenced by pH. The model predicted that transient N2O production rates are maximized by a decoupling of the AOB and NOB communities, resulting in an accumulation and detoxification of nitrite to N2O by AOB. However, cumulative N2O production (over six month simulations is maximized in a system where the relationship between AOB and NOB is maintained. When the reactions uncouple, the AOB become unstable and biomass declines rapidly, resulting in decreased NH3 oxidation and N2O production. We evaluated this model against site level chemical datasets from the interior of Alaska and accurately simulated NH3 oxidation rates and the relative ratio of AOA:AOB biomass. The predicted community structure and activity indicate (a parameterization of a small number of traits may be sufficient to broadly characterize nitrifying community structure and (b changing decadal trends in climate and edaphic conditions could impact nitrification rates in ways that are not captured by extant biogeochemical models.
-
Energy Technology Data Exchange (ETDEWEB)
Puthumana, Jayesh; Lee, Min-Chul; Park, Jun Chul; Kim, Hui-Su; Hwang, Dae-Sik; Han, Jeonghoon, E-mail: jeonghoon@skku.edu; Lee, Jae-Seong, E-mail: jslee2@skku.edu
2017-03-15
Highlights: • Impaired effects of UV-B on the copepod Tigriopus japonicus were examined. • Modulation of entire CYP genes were analyzed in response to UV-B. • CYP inhibitor (PBO) confirmed the role of CYP in UV-B induced mortality. • Low-dose UV-B found induce developmental delays, and higher doses cause reproductive impairments. • Study predicted the mechanistic effects of UV-B in copepods through the AhR-mediated up-regulation of CYP genes. - Abstract: To evaluate the effects of ultraviolet B (UV-B) radiation at the developmental, reproductive, and molecular levels in aquatic invertebrates, we measured UV-B-induced acute toxicity, impairments in developmental and reproductive traits, and UV-B interaction with the entire family of cytochrome P450 (CYP) genes in the intertidal benthic copepod Tigriopus japonicus. We found a significant, dose-dependent reduction (P < 0.05) in the survival of T. japonicus that began as a developmental delay and decreased fecundity. The 48 h LD10 and LD50 were 1.35 and 1.84 kJ/m{sup 2}, and the CYP inhibitor (PBO) elevated mortality, confirming the involvement of CYP genes in UV-B induced toxicity. Low-dose UV-B (1.5 kJ/m{sup 2}) induced developmental delays, and higher doses (6–18 kJ/m{sup 2}) caused reproductive impairments in ovigerous females. The significant up-regulation of CYP genes belonging to clans 2/3/MT/4/20 in T. japonicus exposed to UV-B (12 kJ/m{sup 2}) confirmed molecular interaction between UV-B and CYP genes. Moreover, orphan CYPs, such as CYP20A1, provide good insight on the deorphanization of invertebrate CYPs. Overall, these results demonstrate the involvement of UV-B radiation in the expression of all the CYP genes in T. japonicus and their susceptibility to UV-B radiation. This will provide a better understanding of the mechanistic effects of UV-B in copepods through the predicted AhR-mediated up-regulation of CYP genes.
-
International Nuclear Information System (INIS)
Puthumana, Jayesh; Lee, Min-Chul; Park, Jun Chul; Kim, Hui-Su; Hwang, Dae-Sik; Han, Jeonghoon; Lee, Jae-Seong
2017-01-01
Highlights: • Impaired effects of UV-B on the copepod Tigriopus japonicus were examined. • Modulation of entire CYP genes were analyzed in response to UV-B. • CYP inhibitor (PBO) confirmed the role of CYP in UV-B induced mortality. • Low-dose UV-B found induce developmental delays, and higher doses cause reproductive impairments. • Study predicted the mechanistic effects of UV-B in copepods through the AhR-mediated up-regulation of CYP genes. - Abstract: To evaluate the effects of ultraviolet B (UV-B) radiation at the developmental, reproductive, and molecular levels in aquatic invertebrates, we measured UV-B-induced acute toxicity, impairments in developmental and reproductive traits, and UV-B interaction with the entire family of cytochrome P450 (CYP) genes in the intertidal benthic copepod Tigriopus japonicus. We found a significant, dose-dependent reduction (P < 0.05) in the survival of T. japonicus that began as a developmental delay and decreased fecundity. The 48 h LD10 and LD50 were 1.35 and 1.84 kJ/m"2, and the CYP inhibitor (PBO) elevated mortality, confirming the involvement of CYP genes in UV-B induced toxicity. Low-dose UV-B (1.5 kJ/m"2) induced developmental delays, and higher doses (6–18 kJ/m"2) caused reproductive impairments in ovigerous females. The significant up-regulation of CYP genes belonging to clans 2/3/MT/4/20 in T. japonicus exposed to UV-B (12 kJ/m"2) confirmed molecular interaction between UV-B and CYP genes. Moreover, orphan CYPs, such as CYP20A1, provide good insight on the deorphanization of invertebrate CYPs. Overall, these results demonstrate the involvement of UV-B radiation in the expression of all the CYP genes in T. japonicus and their susceptibility to UV-B radiation. This will provide a better understanding of the mechanistic effects of UV-B in copepods through the predicted AhR-mediated up-regulation of CYP genes.
-
Cui, Fa; Fan, Xiaoli; Chen, Mei; Zhang, Na; Zhao, Chunhua; Zhang, Wei; Han, Jie; Ji, Jun; Zhao, Xueqiang; Yang, Lijuan; Zhao, Zongwu; Tong, Yiping; Wang, Tao; Li, Junming
2016-03-01
QTLs for kernel characteristics and tolerance to N stress were identified, and the functions of ten known genes with regard to these traits were specified. Kernel size and quality characteristics in wheat (Triticum aestivum L.) ultimately determine the end use of the grain and affect its commodity price, both of which are influenced by the application of nitrogen (N) fertilizer. This study characterized quantitative trait loci (QTLs) for kernel size and quality and examined the responses of these traits to low-N stress using a recombinant inbred line population derived from Kenong 9204 × Jing 411. Phenotypic analyses were conducted in five trials that each included low- and high-N treatments. We identified 109 putative additive QTLs for 11 kernel size and quality characteristics and 49 QTLs for tolerance to N stress, 27 and 14 of which were stable across the tested environments, respectively. These QTLs were distributed across all wheat chromosomes except for chromosomes 3A, 4D, 6D, and 7B. Eleven QTL clusters that simultaneously affected kernel size- and quality-related traits were identified. At nine locations, 25 of the 49 QTLs for N deficiency tolerance coincided with the QTLs for kernel characteristics, indicating their genetic independence. The feasibility of indirect selection of a superior genotype for kernel size and quality under high-N conditions in breeding programs designed for a lower input management system are discussed. In addition, we specified the functions of Glu-A1, Glu-B1, Glu-A3, Glu-B3, TaCwi-A1, TaSus2, TaGS2-D1, PPO-D1, Rht-B1, and Ha with regard to kernel characteristics and the sensitivities of these characteristics to N stress. This study provides useful information for the genetic improvement of wheat kernel size, quality, and resistance to N stress.
-
TSUNAMI INFORMATION SOURCES PART 3
Directory of Open Access Journals (Sweden)
Robert L. Wiegel
2009-01-01
Full Text Available This is Part 3 of Tsunami Information Sources published by Robert L. Wiegel, as Technical Report UCB/HEL 2006-3 of the Hydraulic Engineering Laboratory of the Department of Civil & Environmental Engineering of the University of California at Berkeley. Part 3 is published in "SCIENCE OF TSUNAMI HAZARDS" -with the author's permission -so that it can receive wider distribution and use by the Tsunami Scientific Community.
-
Christoffersen, Bradley O.; Gloor, Manuel; Fauset, Sophie; Fyllas, Nikolaos M.; Galbraith, David R.; Baker, Timothy R.; Kruijt, Bart; Rowland, Lucy; Fisher, Rosie A.; Binks, Oliver J.; Sevanto, Sanna; Xu, Chonggang; Jansen, Steven; Choat, Brendan; Mencuccini, Maurizio; McDowell, Nate G.; Meir, Patrick
2016-11-01
Forest ecosystem models based on heuristic water stress functions poorly predict tropical forest response to drought partly because they do not capture the diversity of hydraulic traits (including variation in tree size) observed in tropical forests. We developed a continuous porous media approach to modeling plant hydraulics in which all parameters of the constitutive equations are biologically interpretable and measurable plant hydraulic traits (e.g., turgor loss point πtlp, bulk elastic modulus ɛ, hydraulic capacitance Cft, xylem hydraulic conductivity ks,max, water potential at 50 % loss of conductivity for both xylem (P50,x) and stomata (P50,gs), and the leaf : sapwood area ratio Al : As). We embedded this plant hydraulics model within a trait forest simulator (TFS) that models light environments of individual trees and their upper boundary conditions (transpiration), as well as providing a means for parameterizing variation in hydraulic traits among individuals. We synthesized literature and existing databases to parameterize all hydraulic traits as a function of stem and leaf traits, including wood density (WD), leaf mass per area (LMA), and photosynthetic capacity (Amax), and evaluated the coupled model (called TFS v.1-Hydro) predictions, against observed diurnal and seasonal variability in stem and leaf water potential as well as stand-scaled sap flux. Our hydraulic trait synthesis revealed coordination among leaf and xylem hydraulic traits and statistically significant relationships of most hydraulic traits with more easily measured plant traits. Using the most informative empirical trait-trait relationships derived from this synthesis, TFS v.1-Hydro successfully captured individual variation in leaf and stem water potential due to increasing tree size and light environment, with model representation of hydraulic architecture and plant traits exerting primary and secondary controls, respectively, on the fidelity of model predictions. The plant
-
Al-Seraih, Alaa; Belguesmia, Yanath; Baah, John; Szunerits, Sabine; Boukherroub, Rabah; Drider, Djamel
2017-02-01
Enterococcus faecalis B3A-B3B produces the bacteriocin B3A-B3B with activity against Listeria monocytogenes, Staphylococcus aureus, methicillin-resistant Staphylococcus aureus (MRSA) and Clostridium perfringens, but apparently not against fungi or Gram-negative bacteria, except for Salmonella Newport. B3A-B3B enterocin has two different nucleotides but similar amino acid composition to the class IIb MR10A-MR10B enterocin. B3A-B3B consists of two peptides of predicted molecular mass of 5176.31 Da (B3A) and 5182.21 Da (B3B). Importantly, B3A-B3B impeded biofilm formation of the foodborne pathogen L. monocytogenes 162 grown on stainless steel. The antimicrobial treatment of stainless steel with nisin (1 or 16 mg ml -1 ) decreased the cell numbers by about 2 log CFU ml -1 , thereby impeding the biofilm formation by L. monocytogenes 162 or its nisin-resistant derivative strain L. monocytogenes 162R. Furthermore, the combination of nisin and B3A-B3B enterocin reduced the MIC required to inhibit this pathogen grown in planktonic or biofilm cultures.
-
Directory of Open Access Journals (Sweden)
Antonella Dalle Zotte
2010-01-01
Full Text Available The study compared the growth performance and carcass traits of 41 rabbits of both sexes derived from 3 genetic origins (GO: sire Vienna Blue (B, sire Burgundy Fawn (F and hybrid rabbits (H. From weaning they were reared indoor in bicellular cages and fed ad libitum the same pelleted diet until a fixed slaughter weight (2.8±0.11kg. The rabbits of the 3 GO differed in slaughter age (88 vs 109 vs 122d for H, B and F-GO, respectively; P<0.001. Growth performance of B was better than that of F, while that of H was better than B+F groups. Carcass traits were not modified by the GO; only perirenal fat percentage increased from H (1.2% to B (1.7% to F (2.5% of the reference carcass; P<0.05 accordingly to the slaughter age. The sex effect was significant only for the dressing out percentage, being higher in males than females (59.0 vs 57.6%; P<0.05.
-
Predicting Loneliness with Polygenic Scores of Social, Psychological, and Psychiatric Traits
Abdellaoui, Abdel; Nivard, Michel G; Hottenga, Jouke-Jan; Fedko, Iryna; Verweij, Karin J H; Baselmans, Bart M L; Ehli, Erik A; Davies, Gareth E; Bartels, Meike; Boomsma, Dorret I; Cacioppo, John T
2018-01-01
Loneliness is a heritable trait that accompanies multiple disorders. The association between loneliness and mental health indices may partly be due to inherited biological factors. We constructed polygenic scores for 27 traits related to behavior, cognition, and mental health and tested their
-
Circular Cationic Compounds B3Rgn+ of Triangular Ion B3 Trapping Rare Gases
Institute of Scientific and Technical Information of China (English)
ZHANG Ruiwen; LI Anyong; LI Zhuozhe
2017-01-01
The circular cationic compounds B3Rgn+(n=1-3,Rg=He-Rn) formed by the electron-deficient aromatic ion B3+ trapping rare gases were studied theoretically.The formed B-Rg bond has large bonding energy in the range of 60--209 kJ/mol,its length is close to the stun of covalent radii of B and Rg,for Ar-Rn.The analyses based on the natural bond orbitals and electron density topology show that the B-Rg bonds for Ar-Rn have strong covalent character.The geometric structures,binding energy,bond nature and thermodynamic stability of the boron-rare gas compounds show that these species for Ar-Rn may be experimentally available.Several different theoretical studies have demonstrated that these triangular cations are aromatic.
-
Polygenic Risk, Appetite Traits, and Weight Gain in Middle Childhood: A Longitudinal Study.
Steinsbekk, Silje; Belsky, Daniel; Guzey, Ismail Cuneyt; Wardle, Jane; Wichstrøm, Lars
2016-02-01
Genome-wide association studies have identified genetic risks for obesity. These genetic risks influence development of obesity partly by accelerating weight gain in childhood. Research is needed to identify mechanisms to inform intervention. Cross-sectional studies suggest appetite traits as a candidate mechanism. Longitudinal studies are needed to test whether appetite traits mediate genetic influences on children's weight gain. To test whether genetic risk for obesity predicts accelerated weight gain in middle childhood (ages 4-8 years) and whether genetic association with accelerated weight gain is mediated by appetite traits. Longitudinal study of a representative birth cohort at the Trondheim Early Secure Study, Trondheim, Norway, enrolled at age 4 years during 2007 to 2008, with follow-ups at ages 6 and 8 years. Participants were sampled from all children born in 2003 or 2004 who attended regular community health checkups for 4-year-olds (97.2% attendance; 82.0% consent rate, n = 2475). Nine hundred ninety-five children participated at age 4 years, 795 at age 6 years, and 699 at age 8 years. Analyses included 652 children with genotype, adiposity, and appetite data. Outcomes were body mass index and body-fat phenotypes measured from anthropometry (ages 4, 6, and 8 years) and bioelectrical impedance (ages 6 and 8 years). Genetic risk for obesity was measured using a genetic risk score composed of 32 single-nucleotide polymorphisms previously discovered in genome-wide association studies of adult body mass index. Appetite traits were measured at age 6 years with the Children's Eating Behavior Questionnaire. Of the 652 genotyped child participants, 323 (49.5%) were female, 58 (8.9%) were overweight, and 1 (0.2%) was obese. Children at higher genetic risk for obesity had higher baseline body mass index and fat mass compared with lower genetic risk peers, and they gained weight and fat mass more rapidly during follow-up. Each SD increase in genetic risk score was
-
32 CFR Appendix B to Part 327 - Internal Management Control Review Checklist
2010-07-01
... 32 National Defense 2 2010-07-01 2010-07-01 false Internal Management Control Review Checklist B... B to Part 327—Internal Management Control Review Checklist (a) Task: Personnel and/or Organization... See footnote 2 to this Appendix B. (1) I attest that the above listed internal controls provide...
-
Estimation of Genetic Parameters of Kleiber Ratio and Growth Traits in Kurdish Sheep
Directory of Open Access Journals (Sweden)
Davoud Ali Saghi
2016-11-01
restricted maximum likelihood (REML method fitting six animal models using WOMBAT (18: y =Xb+Zaa+e Model 1 y=Xb+Zaa+Zpepe+e Model 2 y =Xb+Zaa+Zmm+e\tCov(a,m=0\tModel 3 y =Xb+Zaa+Zmm+e\tCov(a,m=Aσam\tModel 4 y =Xb+Zaa+Zmm+Zpepe+e\tCov(a,m=0\tModel 5 y =Xb+Zaa+Zmm+Zpepe+e\tCov(a,m= Aσam\tModel 6 where y: is a vector of records, b: is a vector of fixed effects, a: is a vector of direct additive genetic effects, m: is a vector of maternal additive genetic effects, pe: is a vector of permanent environmental effects due to ewe, X, Za, Zm and Zpe are corresponding design matrices relating the fixed effects, direct additive genetic effects, maternal additive genetic effects and permanent environmental effects due to ewe to vector of y, respectively, e: is a vector of residual effects, and Cov(a,m: is the covariance between direct additive genetic and maternal additive genetic effects. Akaike’s Information Criterion (AIC was used for selecting the best model among the tested models (3: Where logLi: is the maximized log likelihood of model i at convergence and pi: is the number of the parameters in each model. Model with the lowest AIC was considered as the best model for each trait. Estimation of genetic and phenotypic correlations was accomplished using multi-trait analysis (with model 1. The fixed effects included in the multi-trait animal models were those in single-trait analyses. Results and Discussion The pre-weaning average daily gain in Kurdish lambs was 215.33±0.96 g, while this trait in post-weaning periods had a decreased trend. These values (especially in pre-weaning period indicated that Kurdish lambs have a good potential for growth. Results from the analysis of variance of ADG and KR in different ages showed that birth year and sex of the lambs significantly influenced studied traits (P< 0.01. Type of birth had significant effect (P< 0.01 on ADG0-3, ADG3-6, KR1 and KR2. The effect of ewe age was significant for ADG0-3 and KR1. The significant effects of fixed
-
Heritability studies for seed quality traits in introgressed segregating populations of brassica
International Nuclear Information System (INIS)
Farhatullah, S.; Nasim, A.; Fayyaz, L.
2014-01-01
Estimation of genetic parameters in the context of trait characterization is an essential component of future targeted crop improvement programs. Collection of knowledge about genetic behavior such as genetic variability and heritability etc., of the germplasm is the basic step for initiation of any breeding program. Genetic variability and Broad sense heritability for various seed quality traits in 10 brassica genotypes and their 12 F2 progenies comprising of introgressed hybrids were studied. The genotypes had highly significant variation for oil content, protein, glucosinolates contents, oleic, linolenic and erucic acid contents. Glucosinolates content and erucic acid showed high heritability in all F2 populations, while rest of the traits showed variable trends. The cross combination 547 x 118 (B. napus x B. campestris) proved to be a good interspecific hybrid that had high proportion of introgression and has high heritability for beneficial traits. The individual plants having combination of desirable traits were also identified from the F2 populations. (author)
-
2 CFR Appendix B to Part 230 - Selected Items of Cost
2010-01-01
... PRINCIPLES FOR NON-PROFIT ORGANIZATIONS (OMB CIRCULAR A-122) Pt. 230, App. B Appendix B to Part 230—Selected... use of patents and copyrights 45. Selling and marketing 46. Specialized service facilities 47. Taxes... of this appendix provide principles to be applied in establishing the allowability of certain items...
-
Big Five Personality Traits of Cybercrime Victims.
van de Weijer, Steve G A; Leukfeldt, E Rutger
2017-07-01
The prevalence of cybercrime has increased rapidly over the last decades and has become part of the everyday life of citizens. It is, therefore, of great importance to gain more knowledge on the factors related to an increased or decreased likelihood of becoming a cybercrime victim. The current study adds to the existing body of knowledge using a large representative sample of Dutch individuals (N = 3,648) to study the relationship between cybercrime victimization and the key traits from the Big Five model of personality (i.e., extraversion, agreeableness, conscientiousness, emotional stability, and openness to experience). First, multinomial logistic regression analyses were used to examine the associations between the personality traits and three victim groups, that is, cybercrime victims versus nonvictims, traditional crime victims versus nonvictims, and cybercrime victims versus traditional crime victims. Next, logistic regression analyses were performed to predict victimization of cyber-dependent crimes (i.e., hacking and virus infection) and cyber-enabled crimes (i.e., online intimidation, online consumer fraud, and theft from bank account). The analyses show that personality traits are not specifically associated with cybercrime victimization, but rather with victimization in general. Only those with higher scores on emotional stability were less likely to become a victim of cybercrime than traditional crime. Furthermore, the results indicate that there are little differences between personality traits related to victimization of cyber-enabled and cyber-dependent crimes. Only individuals with higher scores on openness to experience have higher odds of becoming a victim of cyber-enabled crimes.
-
[Problematic Internet use, time spent online and personality traits].
Laconi, S; Andréoletti, A; Chauchard, E; Rodgers, R F; Chabrol, H
2016-06-01
Internet addiction or problematic Internet use is a recent and increasingly recognized disorder which has been consistently associated with many psychiatric disorders, adding to the documented negative consequences of problematic Internet use. However, very few studies have examined the relationship between problematic Internet use and personality traits and none in a French sample. Moreover, those which have evaluated this relationship have mainly been conducted on small samples. The main goal of our study was to explore the relationship between problematic Internet use, time spent online and personality traits in a French sample, taking into account the presence of depressive symptoms, and gender. A sample of 276 participants aged from 18 to 50 (M=28; SD=8.9) completed a questionnaire assessing problematic Internet use, time spent online, the presence of ten personality traits and depressive symptoms. Our results revealed significant differences between genders. Among men, problematic Internet use was associated with personality clusters A and B while in women no cluster or personality traits were associated. Time spent online was predicted by schizoid personality traits among men and avoidant personality traits among women. Our results indicate that cluster A (schizoid and schizotypal) and cluster B traits (borderline and antisocial) play a more important role in problematic Internet use than cluster C traits among men. Differences between men and women regarding the relationships between personality traits, time online and problematic Internet use may be related to differences in the activities engaged in by men and women online. We observed that communication websites use was more prevalent among women while erotic, gambling and shopping websites use was more prevalent among men suggesting that the characteristics of problematic Internet use may vary according to gender. Few studies have examined the relationship between problematic Internet use, time spent
-
Energy Technology Data Exchange (ETDEWEB)
Saueressig, D.G.
1998-05-20
The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating, treatment, storage, and/or disposal units, such as the Central Waste Complex (this document, DOE/RL-91-17). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needed by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. A checklist indicating where information is contained in the Central Waste Complex permit application documentation, in relation to the Washington State Department of Ecology guidance, is located in the Contents section. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the Central Waste Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this Central Waste Complex permit application documentation is current as of May 1998.
-
Directory of Open Access Journals (Sweden)
B. O. Christoffersen
2016-11-01
Full Text Available Forest ecosystem models based on heuristic water stress functions poorly predict tropical forest response to drought partly because they do not capture the diversity of hydraulic traits (including variation in tree size observed in tropical forests. We developed a continuous porous media approach to modeling plant hydraulics in which all parameters of the constitutive equations are biologically interpretable and measurable plant hydraulic traits (e.g., turgor loss point πtlp, bulk elastic modulus ε, hydraulic capacitance Cft, xylem hydraulic conductivity ks,max, water potential at 50 % loss of conductivity for both xylem (P50,x and stomata (P50,gs, and the leaf : sapwood area ratio Al : As. We embedded this plant hydraulics model within a trait forest simulator (TFS that models light environments of individual trees and their upper boundary conditions (transpiration, as well as providing a means for parameterizing variation in hydraulic traits among individuals. We synthesized literature and existing databases to parameterize all hydraulic traits as a function of stem and leaf traits, including wood density (WD, leaf mass per area (LMA, and photosynthetic capacity (Amax, and evaluated the coupled model (called TFS v.1-Hydro predictions, against observed diurnal and seasonal variability in stem and leaf water potential as well as stand-scaled sap flux. Our hydraulic trait synthesis revealed coordination among leaf and xylem hydraulic traits and statistically significant relationships of most hydraulic traits with more easily measured plant traits. Using the most informative empirical trait–trait relationships derived from this synthesis, TFS v.1-Hydro successfully captured individual variation in leaf and stem water potential due to increasing tree size and light environment, with model representation of hydraulic architecture and plant traits exerting primary and secondary controls, respectively, on the fidelity of model
-
International Nuclear Information System (INIS)
Park, Hee Jung; Yang, Ok-Kyung; Park, Young Chul; Yum, Eul Kgun
2016-01-01
As a part of our continuing organometallic studies on diversification of nitrogen-containing biologically active heterocycles, we attempted to synthesize furo[2,3-b]- and furo[3,2-c]quinolines starting from o-halohydroxyquinolines and terminal alkynes with heterogeneous Pd(OAc)2 catalyst, which was supported by nanosized pore carbon ball. 2-substituted furo[2,3-b]quinolines and furo[3,2-c]quinolines were synthesized from the reaction of 3-iodoquinolin-2-ol and 3-iodoquinolin-4-ol, respectively, with diverse alkynes. The heteroannulation reaction proceeds with Sonogashira coupling followed by 5-endo-dig cyclization in good isolated yields under copper and ligand free conditions
-
Energy Technology Data Exchange (ETDEWEB)
Park, Hee Jung [Korea Basic Science Institute, Seoul (Korea, Republic of); Yang, Ok-Kyung; Park, Young Chul; Yum, Eul Kgun [Chungnam National University, Daejon (Korea, Republic of)
2016-06-15
As a part of our continuing organometallic studies on diversification of nitrogen-containing biologically active heterocycles, we attempted to synthesize furo[2,3-b]- and furo[3,2-c]quinolines starting from o-halohydroxyquinolines and terminal alkynes with heterogeneous Pd(OAc)2 catalyst, which was supported by nanosized pore carbon ball. 2-substituted furo[2,3-b]quinolines and furo[3,2-c]quinolines were synthesized from the reaction of 3-iodoquinolin-2-ol and 3-iodoquinolin-4-ol, respectively, with diverse alkynes. The heteroannulation reaction proceeds with Sonogashira coupling followed by 5-endo-dig cyclization in good isolated yields under copper and ligand free conditions.
-
Edwards, Elizabeth J; Edwards, Mark S; Lyvers, Michael
2016-08-01
Attentional control theory (ACT) describes the mechanisms associated with the relationship between anxiety and cognitive performance. We investigated the relationship between cognitive trait anxiety, situational stress and mental effort on phonological performance using a simple (forward-) and complex (backward-) word span task. Ninety undergraduate students participated in the study. Predictor variables were cognitive trait anxiety, indexed using questionnaire scores; situational stress, manipulated using ego threat instructions; and perceived level of mental effort, measured using a visual analogue scale. Criterion variables (a) performance effectiveness (accuracy) and (b) processing efficiency (accuracy divided by response time) were analyzed in separate multiple moderated-regression analyses. The results revealed (a) no relationship between the predictors and performance effectiveness, and (b) a significant 3-way interaction on processing efficiency for both the simple and complex tasks, such that at higher effort, trait anxiety and situational stress did not predict processing efficiency, whereas at lower effort, higher trait anxiety was associated with lower efficiency at high situational stress, but not at low situational stress. Our results were in full support of the assumptions of ACT and implications for future research are discussed. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
-
DEFF Research Database (Denmark)
Kávai, M; Rasmussen, J M; Baatrup, G
1988-01-01
, but the binding was low (2-3%) when compared to the binding of the corresponding IgG-IC (50-60%). Solid phase IC were prepared by coating microwells with heat-aggregated bovine serum albumin (BSA) followed by incubation with rabbit IgM anti-BSA antibody. The IC were reacted with human serum at 37 degrees C....... The binding of C3b-iC3b was determined by use of biotinylated F(ab')2 antibodies to C3b-C3c and avidin-coupled alkaline phosphatase. The incorporation of C3b-iC3b into solid-phase IgM-IC increased when increasing amounts of IgM antibody were reacted with the antigen. The binding reaction was slow, reaching...
-
Freshwater Biological Traits Database (Traits)
The traits database was compiled for a project on climate change effects on river and stream ecosystems. The traits data, gathered from multiple sources, focused on information published or otherwise well-documented by trustworthy sources.
-
Prioritizing quantitative trait loci for root system architecture in tetraploid wheat.
Maccaferri, Marco; El-Feki, Walid; Nazemi, Ghasemali; Salvi, Silvio; Canè, Maria Angela; Colalongo, Maria Chiara; Stefanelli, Sandra; Tuberosa, Roberto
2016-02-01
Optimization of root system architecture (RSA) traits is an important objective for modern wheat breeding. Linkage and association mapping for RSA in two recombinant inbred line populations and one association mapping panel of 183 elite durum wheat (Triticum turgidum L. var. durum Desf.) accessions evaluated as seedlings grown on filter paper/polycarbonate screening plates revealed 20 clusters of quantitative trait loci (QTLs) for root length and number, as well as 30 QTLs for root growth angle (RGA). Divergent RGA phenotypes observed by seminal root screening were validated by root phenotyping of field-grown adult plants. QTLs were mapped on a high-density tetraploid consensus map based on transcript-associated Illumina 90K single nucleotide polymorphisms (SNPs) developed for bread and durum wheat, thus allowing for an accurate cross-referencing of RSA QTLs between durum and bread wheat. Among the main QTL clusters for root length and number highlighted in this study, 15 overlapped with QTLs for multiple RSA traits reported in bread wheat, while out of 30 QTLs for RGA, only six showed co-location with previously reported QTLs in wheat. Based on their relative additive effects/significance, allelic distribution in the association mapping panel, and co-location with QTLs for grain weight and grain yield, the RSA QTLs have been prioritized in terms of breeding value. Three major QTL clusters for root length and number (RSA_QTL_cluster_5#, RSA_QTL_cluster_6#, and RSA_QTL_cluster_12#) and nine RGA QTL clusters (QRGA.ubo-2A.1, QRGA.ubo-2A.3, QRGA.ubo-2B.2/2B.3, QRGA.ubo-4B.4, QRGA.ubo-6A.1, QRGA.ubo-6A.2, QRGA.ubo-7A.1, QRGA.ubo-7A.2, and QRGA.ubo-7B) appear particularly valuable for further characterization towards a possible implementation of breeding applications in marker-assisted selection and/or cloning of the causal genes underlying the QTLs. © The Author 2016. Published by Oxford University Press on behalf of the Society for Experimental Biology.
-
Characterizing psychopathy using DSM-5 personality traits.
Strickland, Casey M; Drislane, Laura E; Lucy, Megan; Krueger, Robert F; Patrick, Christopher J
2013-06-01
Despite its importance historically and contemporarily, psychopathy is not recognized in the current Diagnostic and Statistical Manual of Mental Disorders, Fourth Edition, Text Revised (DSM-IV-TR). Its closest counterpart, antisocial personality disorder, includes strong representation of behavioral deviance symptoms but weak representation of affective-interpersonal features considered central to psychopathy. The current study evaluated the extent to which psychopathy and its distinctive facets, indexed by the Triarchic Psychopathy Measure, can be assessed effectively using traits from the dimensional model of personality pathology developed for DSM-5, operationalized by the Personality Inventory for DSM-5 (PID-5). Results indicate that (a) facets of psychopathy entailing impulsive externalization and callous aggression are well-represented by traits from the PID-5 considered relevant to antisocial personality disorder, and (b) the boldness facet of psychopathy can be effectively captured using additional PID-5 traits. These findings provide evidence that the dimensional model of personality pathology embodied in the PID-5 provides effective trait-based coverage of psychopathy and its facets.
-
Haile-Mariam, M; Pryce, J E
2017-05-01
Lactose is a major component of milk (typically around 5% of composition) that is not usually directly considered in national genetic improvement programs of dairy cattle. Daily test-day lactose yields and percentage data from pasture-based seasonal calving herds in Australia were analyzed to assess if lactose content can be used for predicting fitness traits and if an additional benefit is achieved by including lactose yield in selecting for milk yield traits. Data on lactose percentage collected from 2007 to 2014, from about 600 herds, were used to estimated genetic parameters for lactose percentage and lactose yield and correlations with other milk yield traits, somatic cell count (SCC), calving interval (CIV), and survival. Daily test-day data were analyzed using bivariate random regression models. In addition, multi-trait models were also performed mainly to assess the value of lactose to predict fitness traits. The heritability of lactose percentage (0.25 to 0.37) was higher than lactose yield (0.11 to 0.20) in the first parity. Genetically, the correlation of lactose percentage with protein percentage varied from 0.3 at the beginning of lactation to -0.24 at the end of the lactation in the first parity. Similar patterns in genetic correlations were also observed in the second and third parity. At all levels (i.e., genetic, permanent environmental, and residual), the correlation between milk yield and lactose yield was close to 1. The genetic and permanent environmental correlations between lactose percentage and SCC were stronger in the second and third parity and toward the end of the lactation (-0.35 to -0.50) when SCC levels are at their maximum. The genetic correlation between lactose percentage in the first 120 d and CIV (-0.23) was similar to correlation of CIV with protein percentage (-0.28), another component trait with the potential to predict fertility. Furthermore, the correlations of estimated breeding values of lactose percentage and estimated
-
Impaired B cell development in the absence of Krüppel-like factor 3.
Vu, Thi Thanh; Gatto, Dominique; Turner, Vivian; Funnell, Alister P W; Mak, Ka Sin; Norton, Laura J; Kaplan, Warren; Cowley, Mark J; Agenès, Fabien; Kirberg, Jörg; Brink, Robert; Pearson, Richard C M; Crossley, Merlin
2011-11-15
Krüppel-like factor 3 (Klf3) is a member of the Klf family of transcription factors. Klfs are widely expressed and have diverse roles in development and differentiation. In this study, we examine the function of Klf3 in B cell development by studying B lymphopoiesis in a Klf3 knockout mouse model. We show that B cell differentiation is significantly impaired in the bone marrow, spleen, and peritoneal cavity of Klf3 null mice and confirm that the defects are cell autonomous. In the bone marrow, there is a reduction in immature B cells, whereas recirculating mature cells are noticeably increased. Immunohistology of the spleen reveals a poorly structured marginal zone (MZ) that may in part be caused by deregulation of adhesion molecules on MZ B cells. In the peritoneal cavity, there are significant defects in B1 B cell development. We also report that the loss of Klf3 in MZ B cells is associated with reduced BCR signaling strength and an impaired ability to respond to LPS stimulation. Finally, we show increased expression of a number of Klf genes in Klf3 null B cells, suggesting that a Klf regulatory network may exist in B cells.
-
Amare, Azmeraw T.; Schubert, Klaus Oliver; Tekola-Ayele, Fasil; Hsu, Yi-Hsiang; Sangkuhl, Katrin; Jenkins, Gregory; Whaley, Ryan M.; Barman, Poulami; Batzler, Anthony; Altman, Russ B.; Arolt, Volker; Brockmöller, Jürgen; Chen, Chia-Hui; Domschke, Katharina; Hall-Flavin, Daniel K.; Hong, Chen-Jee; Illi, Ari; Ji, Yuan; Kampman, Olli; Kinoshita, Toshihiko; Leinonen, Esa; Liou, Ying-Jay; Mushiroda, Taisei; Nonen, Shinpei; Skime, Michelle K.; Wang, Liewei; Kato, Masaki; Liu, Yu-Li; Praphanphoj, Verayuth; Stingl, Julia C.; Bobo, William V.; Tsai, Shih-Jen; Kubo, Michiaki; Klein, Teri E.; Weinshilboum, Richard M.; Biernacka, Joanna M.; Baune, Bernhard T.
2018-01-01
Studies reported a strong genetic correlation between the Big Five personality traits and major depressive disorder (MDD). Moreover, personality traits are thought to be associated with response to antidepressants treatment that might partly be mediated by genetic factors. In this study, we examined whether polygenic scores (PGSs) derived from the Big Five personality traits predict treatment response and remission in patients with MDD who were prescribed selective serotonin reuptake inhibitors (SSRIs). In addition, we performed meta-analyses of genome-wide association studies (GWASs) on these traits to identify genetic variants underpinning the cross-trait polygenic association. The PGS analysis was performed using data from two cohorts: the Pharmacogenomics Research Network Antidepressant Medication Pharmacogenomic Study (PGRN-AMPS, n = 529) and the International SSRI Pharmacogenomics Consortium (ISPC, n = 865). The cross-trait GWAS meta-analyses were conducted by combining GWAS summary statistics on SSRIs treatment outcome and on the personality traits. The results showed that the PGS for openness and neuroticism were associated with SSRIs treatment outcomes at p trait GWAS meta-analyses, we identified eight loci associated with (a) SSRIs response and conscientiousness near YEATS4 gene and (b) SSRI remission and neuroticism eight loci near PRAG1, MSRA, XKR6, ELAVL2, PLXNC1, PLEKHM1, and BRUNOL4 genes. An assessment of a polygenic load for personality traits may assist in conjunction with clinical data to predict whether MDD patients might respond favorably to SSRIs. PMID:29559929
-
Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits.
Directory of Open Access Journals (Sweden)
Camilla Noelle Rathcke
Full Text Available CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly, it has been reported that rs10399931 (-329 G/A of CHI3LI contributes to the inter-individual plasma YKL-40 levels in patients with sarcoidosis, and that rs4950928 (-131 C/G is a susceptibility polymorphism for asthma and a decline in lung function. We hypothesized that single nucleotide polymorphisms (SNPs or haplotypes thereof the CHI3LI locus might influence risk of T2D. The aim of the present study was to investigate the putative association between SNPs and haplotype blocks of CHI3LI and T2D and T2D related quantitative traits.Eleven SNPs of CHI3LI were genotyped in 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0.88-1.10, p = 0.76, rs4950928 (0.98 (0.87-1.10, p = 0.68 or any of the other SNPs with T2D. Similarly, we found no significant association between any of the 11 tgSNPs and T2D related quantitative traits, all p>0.14. None of the identified haplotype blocks of CHI3LI showed any association with T2D, all p>0.16.None of the examined SNPs or haplotype blocks of CHI3LI showed any association with T2D or T2D related quantitative traits. Estimates of insulin resistance and dysregulated glucose homeostasis in T2D do not seem to be accounted for by the examined variations of CHI3LI.
-
Agronomic and seed quality traits dissected by genome-wide association mapping in Brassica napus
Directory of Open Access Journals (Sweden)
Niklas eKörber
2016-03-01
Full Text Available In Brassica napus breeding, traits related to commercial success are of highest importance for plant breeders. However, such traits can only be assessed in an advanced developmental stage. % as well as require high experimental effort due to their quantitative inheritance and the importance of genotype*environment interaction. Molecular markers genetically linked to such traits have the potential to accelerate the breeding process of B. napus by marker-assisted selection. Therefore, the objectives of this study were to identify (i genome regions associated with the examined agronomic and seed quality traits, (ii the interrelationship of population structure and the detected associations, and (iii candidate genes for the revealed associations. The diversity set used in this study consisted of 405 Brassica napus inbred lines which were genotyped using a 6K single nucleotide polymorphism (SNP array and phenotyped for agronomic and seed quality traits in field trials. In a genome-wide association study, we detected a total of 112 associations between SNPs and the seed quality traits as well as 46 SNP-trait associations for the agronomic traits with a P-value 100 and a sequence identity of > 70 % to A. thaliana or B. rapa could be found for the agronomic SNP-trait associations and 187 hits of potential candidate genes for the seed quality SNP-trait associations.
-
DEFF Research Database (Denmark)
Sun, C; Madsen, P; Lund, M S
2010-01-01
This study investigated the improvement in genetic evaluation of fertility traits by using production traits as secondary traits (MILK = 305-d milk yield, FAT = 305-d fat yield, and PROT = 305-d protein yield). Data including 471,742 records from first lactations of Denmark Holstein cows, covering...... the years of inseminations during first lactations from 1995 to 2004, were analyzed. Six fertility traits (i.e., interval in days from calving to first insemination, calving interval, days open, interval in days from first to last insemination, numbers of inseminations per conception, and nonreturn rate...... stability and predictive ability than single-trait models for all the fertility traits, except for nonreturn rate within 56 d after first service. The stability and predictive ability for the model including MILK or PROT were similar to the model including all 3 milk production traits and better than...
-
Ecological interactions drive evolutionary loss of traits.
Ellers, Jacintha; Kiers, E Toby; Currie, Cameron R; McDonald, Bradon R; Visser, Bertanne
2012-10-01
Loss of traits can dramatically alter the fate of species. Evidence is rapidly accumulating that the prevalence of trait loss is grossly underestimated. New findings demonstrate that traits can be lost without affecting the external phenotype, provided the lost function is compensated for by species interactions. This is important because trait loss can tighten the ecological relationship between partners, affecting the maintenance of species interactions. Here, we develop a new perspective on so-called `compensated trait loss' and how this type of trait loss may affect the evolutionary dynamics between interacting organisms. We argue that: (1) the frequency of compensated trait loss is currently underestimated because it can go unnoticed as long as ecological interactions are maintained; (2) by analysing known cases of trait loss, specific factors promoting compensated trait loss can be identified and (3) genomic sequencing is a key way forwards in detecting compensated trait loss. We present a comprehensive literature survey showing that compensated trait loss is taxonomically widespread, can involve essential traits, and often occurs as replicated evolutionary events. Despite its hidden nature, compensated trait loss is important in directing evolutionary dynamics of ecological relationships and has the potential to change facultative ecological interactions into obligatory ones. © 2012 Blackwell Publishing Ltd/CNRS.
-
40 CFR Appendix B to Part 132 - Great Lakes Water Quality Initiative
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Great Lakes Water Quality Initiative B Appendix B to Part 132 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS... Water Quality Initiative Methodology for Deriving Bioaccumulation Factors Great Lakes States and Tribes...
-
Boz, M A; Sarıca, M; Yamak, U S
2017-04-01
1. This study investigates the slaughter, carcass and meat quality traits of artificially and naturally hatched geese in intensive and free-range production systems. 2. The study was conducted with 114 naturally hatched and 102 artificially hatched geese. From each replicate of the intensive and free-range systems, one female and one male goose were slaughtered at the ages of 14, 16 and 18 weeks (a total of 32 geese per slaughter week). 3. Artificially hatched geese had higher slaughter weights (5280 vs. 4404 g), carcass weights (3520 vs. 2863), dressing percentages (66.6-65.2% vs. 65.0-63.6%) and carcass part, feather and edible inner organ weights. The ratio of both edible inner organs and abdominal fat was higher in naturally hatched geese. Breast meat L*, a* and pH values and thigh meat dry matter values were higher in artificially hatched geese, whereas thigh meat b* and pH values were higher in naturally hatched geese. 4. Intensively reared geese had higher slaughter weights (4900 vs. 4783 g), carcass weights (3253 vs. 3130 g) and abdominal fat weights (280 vs. 250 g), as well as higher dressing percentages (66.3-64.9% vs. 65.3-63.9%). Breast meat b* and thigh meat L* values were higher in the intensive system, while breast and thigh pH values, dripping loss and cooking loss were higher in the free-range system. Water-holding capacity was higher in the intensive system. 5. In conclusion, artificially hatched, intensively reared geese had the highest slaughter weights; however, both artificially and naturally hatched geese raised in a free-range system reached acceptable slaughter weights and can thus be recommended for use with this type of production system.
-
Automatic prediction of facial trait judgments: appearance vs. structural models.
Directory of Open Access Journals (Sweden)
Mario Rojas
Full Text Available Evaluating other individuals with respect to personality characteristics plays a crucial role in human relations and it is the focus of attention for research in diverse fields such as psychology and interactive computer systems. In psychology, face perception has been recognized as a key component of this evaluation system. Multiple studies suggest that observers use face information to infer personality characteristics. Interactive computer systems are trying to take advantage of these findings and apply them to increase the natural aspect of interaction and to improve the performance of interactive computer systems. Here, we experimentally test whether the automatic prediction of facial trait judgments (e.g. dominance can be made by using the full appearance information of the face and whether a reduced representation of its structure is sufficient. We evaluate two separate approaches: a holistic representation model using the facial appearance information and a structural model constructed from the relations among facial salient points. State of the art machine learning methods are applied to a derive a facial trait judgment model from training data and b predict a facial trait value for any face. Furthermore, we address the issue of whether there are specific structural relations among facial points that predict perception of facial traits. Experimental results over a set of labeled data (9 different trait evaluations and classification rules (4 rules suggest that a prediction of perception of facial traits is learnable by both holistic and structural approaches; b the most reliable prediction of facial trait judgments is obtained by certain type of holistic descriptions of the face appearance; and c for some traits such as attractiveness and extroversion, there are relationships between specific structural features and social perceptions.
-
Magnetic and Moessbauer studies on GdCo3B2 and DyCo3B2
International Nuclear Information System (INIS)
Malik, S.K.; Umarji, A.M.; Shenoy, G.K.
1984-10-01
Magnetization and Moessbauer studies have been carried out on GdCo 3 B 2 and DyCo 3 B 2 . These compounds are magnetically ordered with Curie temperatures of 56 0 and 21 0 K respectively. The Co atoms are either nonmagnetic or carry a small moment in these compounds. The saturation moment of DyCo 3 B 2 at 5 0 K is smaller than the Dy 3+ free-ion value. From 161 Dy Moessbauer studies, the measured hyperfine magnetic field at the Dy site is also observed to be smaller than the free-ion value. 155 Gd Moessbauer measurements in GdCo 3 B 2 reveal the presence of large crystalline electric fields at the rare earth site. This causes the moment and the hyperfine field at the Dy site in DyCo 3 B 2 to be reduced from its free-ion value
-
Smith, Glenn; Cummings, Veda
The document summarizes data collected from 40 State Education Agency Part B administrators responding to a survey asking states to report information relative to the Local Education Agency application process, management of flo-thru of Part B funds, management of incentive grant funds, use of discretionary Part B funds, and promotion of inservice…
-
32 CFR Appendix B to Part 77 - DD Form 2581, Operation Transition Employer Registration
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false DD Form 2581, Operation Transition Employer Registration B Appendix B to Part 77 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE... to Part 77—DD Form 2581, Operation Transition Employer Registration ER10AU94.042 ER10AU94.043 ...
-
Verma, Subhash; Thakur, Aneesh; Katoch, Shailja; Shekhar, Chander; Wani, Aasim Habib; Kumar, Sandeep; Dohroo, Shweta; Singh, Geetanjali; Sharma, Mandeep
2017-10-01
Cattle are an integral part of the largely agrarian economy of India. Indigenous breeds of cattle comprise about 80% of total cattle population of the country and contribute significantly to the overall milk production. There are 40 recognized indigenous breeds of cattle and a number of uncharacterized non-descript cattle. Pahari cattle of Himachal Pradesh in Northern India are one such non-descript indigenous breed. Here we describe a comprehensive evaluation of haematobiochemical parameters and innate and adaptive immune response traits of Pahari cattle and a comparison with Jersey crossbred cattle. The study shows demonstrable differences in the two breeds with respect to some innate and adaptive immunological traits. This is a first attempt to characterize immune response traits of Pahari cattle and the results of the study provide an understanding of breed differences in immune status of cattle which could be useful for their breeding and conservations programs. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Plasma diagnostics package. Volume 2: Spacelab 2 section. Part B: Thesis projects
Pickett, Jolene S. (Compiler); Frank, L. A. (Compiler); Kurth, W. S. (Compiler)
1988-01-01
This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B.
-
Shirdelmoghanloo, Hamid; Taylor, Julian D; Lohraseb, Iman; Rabie, Huwaida; Brien, Chris; Timmins, Andy; Martin, Peter; Mather, Diane E; Emebiri, Livinus; Collins, Nicholas C
2016-04-22
Molecular markers and knowledge of traits associated with heat tolerance are likely to provide breeders with a more efficient means of selecting wheat varieties able to maintain grain size after heat waves during early grain filling. A population of 144 doubled haploids derived from a cross between the Australian wheat varieties Drysdale and Waagan was mapped using the wheat Illumina iSelect 9,000 feature single nucleotide polymorphism marker array and used to detect quantitative trait loci for heat tolerance of final single grain weight and related traits. Plants were subjected to a 3 d heat treatment (37 °C/27 °C day/night) in a growth chamber at 10 d after anthesis and trait responses calculated by comparison to untreated control plants. A locus for single grain weight stability was detected on the short arm of chromosome 3B in both winter- and autumn-sown experiments, determining up to 2.5 mg difference in heat-induced single grain weight loss. In one of the experiments, a locus with a weaker effect on grain weight stability was detected on chromosome 6B. Among the traits measured, the rate of flag leaf chlorophyll loss over the course of the heat treatment and reduction in shoot weight due to heat were indicators of loci with significant grain weight tolerance effects, with alleles for grain weight stability also conferring stability of chlorophyll ('stay-green') and shoot weight. Chlorophyll loss during the treatment, requiring only two non-destructive readings to be taken, directly before and after a heat event, may prove convenient for identifying heat tolerant germplasm. These results were consistent with grain filling being limited by assimilate supply from the heat-damaged photosynthetic apparatus, or alternatively, accelerated maturation in the grains that was correlated with leaf senescence responses merely due to common genetic control of senescence responses in the two organs. There was no evidence for a role of mobilized stem reserves (water
-
Ancestrality and evolution of trait syndromes in finches (Fringillidae).
Ponge, Jean-François; Zuccon, Dario; Elias, Marianne; Pavoine, Sandrine; Henry, Pierre-Yves; Théry, Marc; Guilbert, Éric
2017-12-01
Species traits have been hypothesized by one of us (Ponge, 2013) to evolve in a correlated manner as species colonize stable, undisturbed habitats, shifting from "ancestral" to "derived" strategies. We predicted that generalism, r-selection, sexual monomorphism, and migration/gregariousness are the ancestral states (collectively called strategy A) and evolved correlatively toward specialism, K-selection, sexual dimorphism, and residence/territoriality as habitat stabilized (collectively called B strategy). We analyzed the correlated evolution of four syndromes, summarizing the covariation between 53 traits, respectively, involved in ecological specialization, r-K gradient, sexual selection, and dispersal/social behaviors in 81 species representative of Fringillidae, a bird family with available natural history information and that shows variability for all these traits. The ancestrality of strategy A was supported for three of the four syndromes, the ancestrality of generalism having a weaker support, except for the core group Carduelinae (69 species). It appeared that two different B-strategies evolved from the ancestral state A, both associated with highly predictable environments: one in poorly seasonal environments, called B1, with species living permanently in lowland tropics, with "slow pace of life" and weak sexual dimorphism, and one in highly seasonal environments, called B2, with species breeding out-of-the-tropics, migratory, with a "fast pace of life" and high sexual dimorphism.
-
Genome-wide association study on reproductive traits in Jinghai Yellow Chicken.
Zhang, G X; Fan, Q C; Wang, J Y; Zhang, T; Xue, Q; Shi, H Q
2015-12-01
To identify molecular markers and candidate genes associated with reproductive traits, a genome-wide analysis was performed in Jinghai Yellow Chickens to analyze body weight at first oviposition (BWF), age at first oviposition (AFE), weight of the egg at first oviposition (FEW), egg weight at the age of 300 days (EW300), number of eggs produced by 300 days of age (EN300), egg hatchability (HA) and multiple selection index for egg production (MSI). The results showed that seven single nucleotide polymorphisms (SNPs) were associated with reproductive traits (Preproductive traits were identified (Preproductive traits will greatly advance the understanding of the genetic basis and molecular mechanisms underlying reproductive traits and may have practical significance in breeding programs for the improvements of reproductive traits in the Jinghai Yellow Chicken. Copyright © 2015 Elsevier B.V. All rights reserved.
-
32 CFR Appendix B to Part 290 - DCAA's FOIA Points of Contact
2010-07-01
... (CONTINUED) FREEDOM OF INFORMATION ACT PROGRAM DEFENSE CONTRACT AUDIT AGENCY (DCAA) FREEDOM OF INFORMATION ACT PROGRAM Pt. 290, App. B Appendix B to Part 290—DCAA's FOIA Points of Contact (Regional Offices.... Pacific Ocean and Asian Islands. Asia except the Middle East. Australia. Georgia DCAA Eastern Regional...
-
Eryilmaz, Ali; Kara, Ahmet
2017-01-01
The aim of the study is to compare teachers and pre-service teachers in terms of personality traits and career adaptability. The relationships between personality traits and career adaptability are also investigated. A total of 176 pre-service teachers took part in the study, including 90 men and 76 women, and a total of 204 teachers took part in…
-
Oostrom, J.K.; Born, M.Ph.; Serlie, A.W.; Van der Molen, H.T.
2012-01-01
To explain why situational judgment tests are often correlated with personality measures, Motowidlo, Hooper, and Jackson (2006a, 2006b) developed the implicit trait policy theory. Implicit trait policies are beliefs about causal relationships between personality traits and behavioral effectiveness.
-
Innate and adaptive immune traits are differentially affected by genetic and environmental factors
Mangino, Massimo; Roederer, Mario; Beddall, Margaret H.; Nestle, Frank O.; Spector, Tim D.
2017-01-01
The diversity and activity of leukocytes is controlled by genetic and environmental influences to maintain balanced immune responses. However, the relative contribution of environmental compared with genetic factors that affect variations in immune traits is unknown. Here we analyse 23,394 immune phenotypes in 497 adult female twins. 76% of these traits show a predominantly heritable influence, whereas 24% are mostly influenced by environment. These data highlight the importance of shared childhood environmental influences such as diet, infections or microbes in shaping immune homeostasis for monocytes, B1 cells, γδ T cells and NKT cells, whereas dendritic cells, B2 cells, CD4+ T and CD8+ T cells are more influenced by genetics. Although leukocyte subsets are influenced by genetics and environment, adaptive immune traits are more affected by genetics, whereas innate immune traits are more affected by environment. PMID:28054551
-
Scoring of nonmetric cranial traits: a methodological approach
GUALDI-RUSSO, E.; TASCA, M. A.; BRASILI, P.
1999-01-01
The purpose of the present study was to analyse the replicability of the scoring of discontinuous traits. This was assessed on a sample of 100 skulls from the Frassetto collection (Dipartimento di Biologia Evoluzionistica Sperimentale of Bologna University) analysed through intraobserver comparisons: the discontinuous traits were determined on the same skulls and by the same observer on 3 separate occasions. The scoring was also assessed through interobserver comparisons: 3 different observers performed an independent survey on the same skulls. The results show that there were no significant differences in the discontinuous trait frequencies between the 3 different scorings by the same observer, but there were sometimes significant differences between different observers. Caution should thus be taken in applying the frequencies of these traits to population research. After an indispensable control of material conditions (subject age included), consideration must be given to standardisation procedures between observers, otherwise this may be an additional source of variability in cranial discontinuous trait scoring. PMID:10634693
-
Morphological traits as variety descriptors of Arachis pintoi
Directory of Open Access Journals (Sweden)
Caroline Marques Castro
2007-01-01
Full Text Available Arachis pintoi is outstanding in the present agricultural scenery for adapting well to varied environments andin view of its high yield of quality fodder. It is therefore used as forage crop in different countries. In the last 15 years, morethan ten cultivars were released in different countries; none of them is protected in Brazil. To protect a cultivar the minimumdescriptors of the species must be determined. In this study, F2 populations of A. pintoi were evaluated by the number ofbristles on the petiole, number of bristles on the basal and distal leaflets, length and width of internodes, length and width ofbasal and distal leaflets, and flower color. The objective was the determination of morphological traits for variety identificationof forage peanut. The performance of the F2 progenies was trait-dependent. The heritability of all traits was high, indicatingthat a great part of the variation observed in these genotypes is genetic. This reinforces the usefulness of these traits as varietydescriptors of forage peanut.
-
Genetic architecture of clinical mastitis traits in dairy cattle
DEFF Research Database (Denmark)
Sahana, Goutam; Guldbrandtsen, Bernt; Lund, Mogens Sandø
2012-01-01
investigate the genetic architecture of clinical mastitis and somatic cell score traits in dairy cattle using a high density (HD) SNP panel. Mastitis, an inflammation of the mammary gland most commonly caused by bacterial infection, is a frequent disease in dairy cattle. Clinical mastitis and somatic cell...... score from first three lactations were studied for association with SNP markers in 4,200 progeny-tested Nordic Holstein bulls. Single trait breeding values were used as phenotypes. All the individuals were genotyped with BovineSNP50 Beadchip. Part of this population was also genotyped with the Bovine...... mixed model analysis. After Bonferroni correction 12, 372 SNP exhibited genome-wide significant associations with mastitis related traits. A total 61 QTL regions on 22 chromosomes associated with mastitis related traits were identified. The SNP with highest effect explained 5.6% of the variance...
-
Data of evolutionary structure change: 1B04B-3BAAA [Confc[Archive
Lifescience Database Archive (English)
Full Text Available 1B04B-3BAAA 1B04 3BAA B A MDRQQAERRAAELRELLNRYGYEYYVLDRPSVPDAEYDR...NLKTIRSLPLRLKEPVSLEARGEAFMPKASFLRLNEERKAR--ELFANPRNAAAGSLRQLDPKVAASRQLDLFVYGLADAEALGIASHSEALDYLQALGFKVNPERRR...DGLAISLRYENGVFVRGATRGDGTVGENITENLRTVRSVPMRLTEPISVEVRGECYMPKQSFVALNEEREENGQDIFANPRNAAAGSLRQLDTKIVAKRNLNTFLYTV... 353 TYR CA 427 3BAA A 3BAAA...hain>A 3BAAA EREENGQDIFAN
-
INVESTIGATION OF b-VALUE VARIATIONS IN THE AFRICAN AND PARTS OF EURASIAN PLATES
Directory of Open Access Journals (Sweden)
Awoyemi, M. O.
2017-06-01
Full Text Available Numerous earthquakes have occurred along the collision zones of the African and parts of Eurasian plates. Some of these earthquakes along these zones have generated tsunamis. To mitigate this hazard, knowledge of b-values of the Gutenberg – Richter relation for tectonic earthquakes in the African and parts of Eurasian plates is essential. The temporal variations of b-values were evaluated using sliding time windows with each window containing a total of 100 events with a view to utilizing the results as a precursor for the earthquake occurrence. The spatial variation of b-values of the study area was also delineated by dividing it into grids and calculating the b-values for each grid using constant radius and constant number of events. Results obtained from the temporal variation of b-values showed that earthquakes of large magnitudes occurred when the b-values were low while earthquakes of small magnitudes occurred when the b-values were high throughout the study period. The results of the spatial distribution of b-values also showed that earthquakes of large magnitudes occurred in areas of low b-values while earthquakes of small magnitudes occurred in areas of high b-values. The study therefore concluded that the temporal and spatial variations of b-values might be considered as a precursor for earthquake prediction.
-
78 FR 77487 - Renewal of Agency Information Collection for IDEIA Part B and C Child Count
2013-12-23
... Education Improvement Act (IDEIA) Part B and C Child Count authorized by OMB Control Number 1076-0176. This... for special education and related services for Indian children aged 0 to 5 with disabilities on... children aged 0 to 2 covered by IDEIA Part C. In IDEIA Part B--Assistance for Education of All Children...
-
Discovery of quantitative trait loci for crossability from a synthetic wheat genotype
Institute of Scientific and Technical Information of China (English)
Li Zhang; Jin Wang; Ronghua Zhou; Jizeng Jia
2011-01-01
Crossability between wheat and rye is an important trait for wheat improvement.No quantitative trait loci (QTLs) were detected from wheat ancestors previously.The objectives of this study were to dissect the QTLs for crossability using 111 introgression lines (ILs) derived from synthetic hexaploid wheat.A total of 1275 SSR markers were screened for polymorphism between the two parents,and 552 markers of them displayed polymorphism,of which 64 were selected for genotyping the 111 BC5F6 ILs.Field trials were performed in a Latinized α-lattice design in Luoyang and Jiaozuo of Henan Province of China in 2007-2008 and 2008-2009 cropping seasons.One-way ANOVA and interval mapping (IM) analysis were used to detect QTL for crossability between wheat and rye.A total of 13 putative QTLs were detected.Five of them,QCa.caas.1A,QCa.caas.2D,QCa.caas.4B,QCa.caas.5B and QCa.caas.6A,were detected in both trials and three of them,QCa.caas.2D,QCa.caas.4B and QCa.caas.6A,were novel.The positive effect allele of the four QTLs came from the donor parent Am3 except QCa.caas.6A that came from the recurrent parent Laizhou953.ILs with both higher positive effect alleles and favorable agronomic traits developed in present study are elite germplasm for wide crossing in wheat.Results from the current study suggest that wheat ancestors can be rich in new sources of crossability genes.
-
Quantitative trait loci for behavioural traits in chicken
Buitenhuis, A.J.; Rodenburg, T.B.; Siwek, M.Z.; Cornelissen, S.J.B.; Nieuwland, M.G.B.; Crooijmans, R.P.M.A.; Groenen, M.A.M.; Koene, P.; Bovenhuis, H.; Poel, van der J.J.
2005-01-01
The detection of quantitative trait loci (QTL) of behavioural traits has mainly been focussed on mouse and rat. With the rapid development of molecular genetics and the statistical tools, QTL mapping for behavioural traits in farm animals is developing. In chicken, a total of 30 QTL involved in
-
Directory of Open Access Journals (Sweden)
Ludwig Czibere
Full Text Available Behavioral endophenotypes are determined by a multitude of counteracting but precisely balanced molecular and physiological mechanisms. In this study, we aim to identify potential novel molecular targets that contribute to the multigenic trait "anxiety". We used microarrays to investigate the gene expression profiles of different brain regions within the limbic system of mice which were selectively bred for either high (HAB or low (LAB anxiety-related behavior, and also show signs of comorbid depression-like behavior. We identified and confirmed sex-independent differences in the basal expression of 13 candidate genes, using tissue from the entire brain, including coronin 7 (Coro7, cathepsin B (Ctsb, muscleblind-like 1 (Mbnl1, metallothionein 1 (Mt1, solute carrier family 25 member 17 (Slc25a17, tribbles homolog 2 (Trib2, zinc finger protein 672 (Zfp672, syntaxin 3 (Stx3, ATP-binding cassette, sub-family A member 2 (Abca2, ectonucleotide pyrophosphatase/phosphodiesterase 5 (Enpp5, high mobility group nucleosomal binding domain 3 (Hmgn3 and pyruvate dehydrogenase beta (Pdhb. Additionally, we confirmed brain region-specific differences in the expression of synaptotagmin 4 (Syt4.Our identification of about 90 polymorphisms in Ctsb suggested that this gene might play a critical role in shaping our mouse model's behavioral endophenotypes. Indeed, the assessment of anxiety-related and depression-like behaviors of Ctsb knock-out mice revealed an increase in depression-like behavior in females. Altogether, our results suggest that Ctsb has significant effects on emotionality, irrespective of the tested mouse strain, making it a promising target for future pharmacotherapy.
-
Kumar, Rakesh; Gupta, I. D.; Verma, Archana; Verma, Nishant; Vineeth, M. R.
2015-01-01
Aim: The present study was undertaken to identify novel single nucleotide polymorphism (SNP) in Exon 3 of HSP90AA1 gene and to analyze their association with respiration rate (RR) and rectal temperature (RT) in Sahiwal cows. Materials and Methods: The present study was carried out in Sahiwal cows (n=100) with the objectives to identify novel SNP in exon 3 of HSP90AA1 gene and to explore the association with heat tolerance traits. CLUSTAL-W multiple sequence analysis was used to identify novel SNPs in exon 3 of HSP90AA1 gene in Sahiwal cows. Gene and genotype frequencies of different genotypes were estimated by standard procedure POPGENE version 1.32 (University of Alberta, Canada). The significant effect of SNP variants on physiological parameters, e.g. RR and RT were analyzed using the General Linear model procedure of SAS Version 9.2. Results: The polymerase chain reaction product with the amplicon size of 450 bp was successfully amplified, covering exon 3 region of HSP90AA1 gene in Sahiwal cows. On the basis of comparative sequence analysis of Sahiwal samples (n=100), transitional mutations were detected at locus A1209G as compared to Bos taurus (NCBI GenBank AC_000178.1). After chromatogram analysis, three genotypes AA, AG, and GG with respective frequencies of 0.23, 0.50, and 0.27 ascertained. RR and RT were recorded once during probable extreme hours in winter, spring, and summer seasons. It was revealed that significant difference (pheat tolerance trait was found in Sahiwal cattle. The homozygotic animals with AA genotype had lower heat tolerance coefficient (HTC) (1.78±0.04a), as compared to both AG and GG genotypes (1.85±0.03b and 1.91±0.02c), respectively. The gene and genotype frequencies for the locus A1209G were ascertained. Conclusions: Novel SNP was found at the A1209G position showed all possible three genotypes (homozygous and heterozygous). Temperature humidity index has a highly significant association with RR, RT, and HTC in all the seasons
-
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Interrogation. 343b.3 Section 343b.3 Aliens... NATURALIZATION FOR RECOGNITION BY A FOREIGN STATE § 343b.3 Interrogation. When Form N-565 presents a prima facie... issuance of the certificate. Interrogation of the applicant shall be conducted before the application is...
-
Christoffersen, Bradley O.; Gloor, Manuel; Fauset, Sophie; Fyllas, Nikolaos M.; Galbraith, David R.; Baker, Timothy R.; Kruijt, Bart; Rowland, Lucy; Fisher, Rosie A.; Binks, Oliver J.; Sevanto, Sanna; Xu, Chonggang; Jansen, Steven; Choat, Brendan; Mencuccini, Maurizio; McDowell, Nate G.; Meir, Patrick
2016-01-01
Forest ecosystem models based on heuristic water stress functions poorly predict tropical forest response to drought partly because they do not capture the diversity of hydraulic traits (including variation in tree size) observed in tropical forests. We developed a continuous porous media
-
Response Monitoring and Adjustment: Differential Relations with Psychopathic Traits
Bresin, Konrad; Finy, M. Sima; Sprague, Jenessa; Verona, Edelyn
2014-01-01
Studies on the relation between psychopathy and cognitive functioning often show mixed results, partially because different factors of psychopathy have not been considered fully. Based on previous research, we predicted divergent results based on a two-factor model of psychopathy (interpersonal-affective traits and impulsive-antisocial traits). Specifically, we predicted that the unique variance of interpersonal-affective traits would be related to increased monitoring (i.e., error-related negativity) and adjusting to errors (i.e., post-error slowing), whereas impulsive-antisocial traits would be related to reductions in these processes. Three studies using a diverse selection of assessment tools, samples, and methods are presented to identify response monitoring correlates of the two main factors of psychopathy. In Studies 1 (undergraduates), 2 (adolescents), and 3 (offenders), interpersonal-affective traits were related to increased adjustment following errors and, in Study 3, to enhanced monitoring of errors. Impulsive-antisocial traits were not consistently related to error adjustment across the studies, although these traits were related to a deficient monitoring of errors in Study 3. The results may help explain previous mixed findings and advance implications for etiological models of psychopathy. PMID:24933282
-
Personality traits and the risk for Parkinson disease: a prospective study.
Sieurin, Johanna; Gustavsson, Petter; Weibull, Caroline Elise; Feldman, Adina Leiah; Petzinger, Giselle Maria; Gatz, Margaret; Pedersen, Nancy Lee; Wirdefeldt, Karin
2016-02-01
In this study, we explored the association between the personality traits, neuroticism and introversion, and risk of Parkinson disease (PD). A population-based cohort study was conducted using questionnaire data from the Swedish Twin Registry for twins born 1926-1958 (n > 29,000). Personality traits were assessed in 1973 by a short form of Eysenck's Personality Inventory. The cohort was followed from 1974 to 2012 through Swedish patient and cause of death registers for PD ascertainment. Cox proportional hazards regression was used to estimate subsequent risk of PD, adjusting for attained age, sex and smoking. A mediation analysis was performed to further explore the role of smoking in the relationship between personality trait and PD. Confounding by familial factors was explored using a within-pair analysis. During a mean follow-up time of 36.8 years, 197 incident PD cases were identified. Both neuroticism and introversion were associated with an increased risk of PD after adjustment. Smoking was a significant mediator in the relationship between personality traits and PD that partly accounted for the effect of introversion, whereas it acted as a suppressor for the effect of neuroticism on PD risk. In the within-pair analyses, associations for neuroticism and introversion were attenuated. In conclusion, our study provides evidence that neuroticism is associated with an increased risk of PD that is in part suppressed by smoking. There was a weak association between introversion and PD and this effect was at least partly mediated through smoking. The observed effects may partly be explained by familial factors shared by twins.
-
Alternative strategies for Medicare payment of outpatient prescription drugs--Part B and beyond.
Danzon, Patricia M; Wilensky, Gail R; Means, Kathleen E
2005-03-01
Reimbursement options for pharmaceuticals reimbursed under Medicare Part B (physician-dispensed drugs) are changing and the new comprehensive Part D Medicare outpatient drug benefit brings further changes. The Medicare Prescription Drug, Improvement and Modernization Act of 2003 (MMA) replaces traditional policy, of reimbursing Part B drugs at 95% of average wholesale price (AWP, a list price), with a percentage markup over the manufacturer's average selling price; in 2005 an indirect competitive procurement option will be introduced. In our view, although AWP-based reimbursement has been fraught with problems in the past, these could be fixed by constraining growth in AWP and periodically adjusting the discount off AWP. With these revisions, an AWP-based rule would preserve incentives for competitive discounting and deliver savings to Medicare. By contrast, basing Medicare reimbursement on a manufacturer's average selling price undermines incentives for discounting and, like any cost-based reimbursement rule, may result in higher prices to both public and private purchasers. Indirect competitive procurement for drugs alone, using specialty pharmacies, pharmacy benefit managers, or prescription drug plans, is unlikely to constrain costs to acceptable levels unless contractors retain flexibility to use standard benefit management tools. Folding Part B and Part D into comprehensive contracting with health plans for full health services is likely to offer the most efficient approach to managing the drug benefit.
-
Quantum theory of the solid state part B
Callaway, Joseph
1974-01-01
Quantum Theory of the Solid State, Part B describes the concepts and methods of the central problems of the quantum theory of solids. This book discusses the developed machinery applied to impurities, disordered systems, effects of external fields, transport phenomena, and superconductivity. The representation theory, low field diamagnetic susceptibility, electron-phonon interaction, and Landau theory of fermi liquids are also deliberated. This text concludes with an introduction to many-body theory and some applications. This publication is a suitable textbook for students who have completed
-
Anderegg, L. D.; Berner, L. T.; Badgley, G.; Hillerislambers, J.; Law, B. E.
2017-12-01
Functional traits could facilitate ecological prediction by provide scale-free tools for modeling ecosystem function. Yet much of their utility lies in three key assumptions: 1) that global patterns of trait covariation are the result of universal trade-offs independent of taxonomic scale, so empirical trait-trait relationships can be used to constrain vegetation models 2) that traits respond predictably to environmental gradients and can therefore be reliably quantified to parameterize models and 3) that well sampled traits influence productivity. We use an extensive dataset of within-species leaf trait variation in North American conifers combined with global leaf trait datasets to test these assumptions. We examine traits central to the `leaf economics spectrum', and quantify patterns of trait variation at multiple taxonomic scales. We also test whether site environment explains geographic trait variation within conifers, and ask whether foliar traits explain geographic variation in relative growth rates. We find that most leaf traits vary primarily between rather than within species globally, but that a large fraction of within-PFT trait variation is within-species. We also find that some leaf economics spectrum relationships differ in sign within versus between species, particularly the relationship between leaf lifespan and LMA. In conifers, we find weak and inconsistent relationships between site environment and leaf traits, making it difficult capture within-species leaf trait variation for regional model parameterization. Finally, we find limited relationships between tree relative growth rate and any foliar trait other than leaf lifespan, with leaf traits jointly explaining 42% of within-species growth variation but environmental factors explaining 77% of variation. We suggest that additional traits, particularly whole plant allometry/allocation traits may be better than leaf traits for improving vegetation model performance at smaller taxonomic and
-
1989-03-01
1978. Williams. B.C. Qualitative Analysis of MOS Circuits. Artificial Inteligence . 1984. 24.. Wilson. K. From Association to Structure. Amsterdam:North...D-A208 378 RADC-TR-88-324, Vol II (of nine), Part B Interim Report March 1969 4. NORTHEAST ARTIFICIAL INTELLIGENCE CONSORTIUM ANNUAL REPORT 1987...II (of nine), Part B 6a. NAME OF PERFORMING ORGANIZATION 6b. OFFICE SYMBOL 7a. NAME OF MONITORING ORGANIZATION Northeast Artificial (ff ’aolicbl
-
Personality traits of children before and after epilepsy surgery.
Braams, Olga; Schappin, Renske; Meekes, Joost; van Rijen, Peter C; van Nieuwenhuizen, Onno; Braun, Kees P; Jennekens-Schinkel, Aag
2017-07-01
We studied how children with epilepsy (CWE) who are candidates for epilepsy surgery, perceive themselves with respect to overarching personality traits and whether the traits change after surgery. We explored influences of demographic and illness variables. A total of 23 CWE [mean age at inclusion 12.8 (sd 2.3); 12 girls] participated. Using the Dutch Personality Questionnaire Juniors (DPQ-J), we assessed 20 of the CWE shortly before epilepsy surgery and compared the results to those of 39 age- and gender-matched healthy controls. Furthermore, we obtained follow-up scores 6, 12 and 24 months after epilepsy surgery from the clinical group. CWE who were candidates for epilepsy surgery scored above average in inadequacy, perseverance, social inadequacy and recalcitrance, whereas healthy peers scored average. Over the two years' period after epilepsy surgery we found no changes, apart from a decrease of social inadequacy. Sporadic illness and demographic variables were related to some personality traits. However, neither post-surgical seizure freedom nor cessation of AEDs did noticeably change the self-evaluations of CWE. Asking CWE to evaluate their personality themselves may offer a shared basis for individually tailored behavior intervention in order to help them adapting to their ameliorated circumstances after surgery. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Directory of Open Access Journals (Sweden)
Hedayat eBagheri
2012-08-01
Full Text Available A recombinant inbred line (RIL population was produced based on a wide cross between the rapid-cycling and self-compatible genotypes L58, a Caixin vegetable type, and R-o-18, a yellow sarson oil type. A linkage map based on 160 F7 lines was constructed using 100 SNP, 130 AFLP®, 27 InDel and 13 publicly available SSR markers. The map covers a total length of 1150 cM with an average resolution of 4.3 cM/marker. To demonstrate the versatility of this new population, 17 traits, related to plant architecture and seed characteristics, were subjected to QTL analysis. A total of 47 QTLs were detected, each explaining between 6 to 54% of the total phenotypic variance for the concerned trait. The genetic analysis shows that this population is a useful new tool for analyzing genetic variation for interesting traits in B. rapa, and for further exploitation of the recent availability of the B. rapa whole genome sequence for gene cloning and gene function analysis.
-
International Nuclear Information System (INIS)
Saueressig, D.G.
1998-01-01
The Hanford Facility Dangerous Waste Permit Application is considered to be a single application organized into a General Information Portion (document number DOE/RL-91-28) and a Unit-Specific Portion. The scope of the Unit-Specific Portion is limited to Part B permit application documentation submitted for individual, operating, treatment, storage, and/or disposal units, such as the Central Waste Complex (this document, DOE/RL-91-17). Both the General Information and Unit-Specific portions of the Hanford Facility Dangerous Waste Permit Application address the content of the Part B permit application guidance prepared by the Washington State Department of Ecology (Ecology 1996) and the U.S. Environmental Protection Agency (40 Code of Federal Regulations 270), with additional information needed by the Hazardous and Solid Waste Amendments and revisions of Washington Administrative Code 173-303. For ease of reference, the Washington State Department of Ecology alpha-numeric section identifiers from the permit application guidance documentation (Ecology 1996) follow, in brackets, the chapter headings and subheadings. A checklist indicating where information is contained in the Central Waste Complex permit application documentation, in relation to the Washington State Department of Ecology guidance, is located in the Contents section. Documentation contained in the General Information Portion is broader in nature and could be used by multiple treatment, storage, and/or disposal units (e.g., the glossary provided in the General Information Portion). Wherever appropriate, the Central Waste Complex permit application documentation makes cross-reference to the General Information Portion, rather than duplicating text. Information provided in this Central Waste Complex permit application documentation is current as of May 1998
-
Directory of Open Access Journals (Sweden)
Lu Jiang
Full Text Available Kernel shape related traits (KSRTs have been shown to have important influences on grain yield. The previous studies that emphasize kernel length (KL and kernel width (KW lack a comprehensive evaluation of characters affecting kernel shape. In this study, materials of the basic generations (B73, Mo17, and B73 × Mo17, 82 intermated B73 × Mo17 (IBM individuals, and the corresponding triple testcross (TTC populations were used to evaluate heterosis, investigate correlations, and characterize the quantitative trait loci (QTL for six KSRTs: KL, KW, length to width ratio (LWR, perimeter length (PL, kernel area (KA, and circularity (CS. The results showed that the mid-parent heterosis (MPH for most of the KSRTs was moderate. The performance of KL, KW, PL, and KA exhibited significant positive correlation with heterozygosity but their Pearson's R values were low. Among KSRTs, the strongest significant correlation was found between PL and KA with R values was up to 0.964. In addition, KW, PL, KA, and CS were shown to be significant positive correlation with 100-kernel weight (HKW. 28 QTLs were detected for KSRTs in which nine were augmented additive, 13 were augmented dominant, and six were dominance × additive epistatic. The contribution of a single QTL to total phenotypic variation ranged from 2.1% to 32.9%. Furthermore, 19 additive × additive digenic epistatic interactions were detected for all KSRTs with the highest total R2 for KW (78.8%, and nine dominance × dominance digenic epistatic interactions detected for KL, LWR, and CS with the highest total R2 (55.3%. Among significant digenic interactions, most occurred between genomic regions not mapped with main-effect QTLs. These findings display the complexity of the genetic basis for KSRTs and enhance our understanding on heterosis of KSRTs from the quantitative genetic perspective.
-
Mayo-Gamble, Tilicia L; Barnes, Priscilla A; Cunningham Erves, Jennifer; Middlestadt, Susan E; Lin, Hsien-Chang
2017-02-21
This study examined the meaning of sickle cell trait and sickle cell trait screening from the lay perspective of African Americans. African Americans (N = 300), ages 18-35 and unaware of their sickle cell trait status, completed two open-ended questions from a larger survey. One question asked for their understanding of sickle cell trait; the other asked for their understanding of sickle cell trait screening. Content analysis occurred in two phases: (1) In vivo and holistic coding; and (2) focused coding. Four categories emerged illustrating lay conceptions of sickle cell trait; (1) Perceived as an illness; (2) Perceived recognition of the inheritance pattern of sickle cell trait; (3) Perceived lack of knowledge of sickle cell trait; and (4) Perceived importance of sickle cell trait. Five categories emerged illustrating lay conceptions for sickle cell trait screening: (1) Perceived recognition that screening means getting tested for sickle cell trait; (2) Perceived lack of knowledge of sickle cell trait screening; (3) Perceived health benefit of sickle cell trait screening; (4) Perceived importance of sickle cell trait screening; and (5) Perceived barriers to sickle cell trait screening. Sickle cell trait and sickle cell trait screening are concepts that are both regarded as important among this high-risk population. However, there is still misunderstanding concerning the hereditary nature and reproductive implications of sickle cell trait. Interventions seeking to improve communication on the need for sickle cell trait screening should begin by identifying what the population at large understands, knows and/or believes to improve their ability to make informed health decisions.
-
International Nuclear Information System (INIS)
Druce, S.G.; Eyre, B.L.
1978-08-01
This is the final part of a series of three reports examining the upper shelf fracture toughness of A533B Class 1 pressure vessel steel. Part I (AERE R 8968) critically reviews the current elasto plastic fracture mechanics methodologies employed to characterise toughness following extensive yielding and Part II (AERE R 8969) examines several sources of fracture mechanics data pertinent to A533B Class 1 in the longitudinal (RW) orientation. Part III is a review of the effects of (i) position and orientation within the plate (ii) welding processes and post weld heat treatment and (iii) neutron irradiation as measured by Charpy impact testing. It is concluded that the upper shelf factor energy is dependent on orientation and position and can be reduced by welding, extended post weld heat treatments and neutron irradiation. Neutron irradiation effects are known to be strongly dependent on composition and metallurgical conditions, but an explanation for the variability following extended post weld treatments has yet to be resolved. (author)
-
A Major Locus for Quantitatively Measured Shank Skin Color Traits in Korean Native Chicken
Directory of Open Access Journals (Sweden)
S. Jin
2016-11-01
Full Text Available Shank skin color of Korean native chicken (KNC shows large color variations. It varies from white, yellow, green, bluish or grey to black, whilst in the majority of European breeds the shanks are typically yellow-colored. Three shank skin color-related traits (i.e., lightness [L*], redness [a*], and yellowness [b*] were measured by a spectrophotometer in 585 progeny from 68 nuclear families in the KNC resource population. We performed genome scan linkage analysis to identify loci that affect quantitatively measured shank skin color traits in KNC. All these birds were genotyped with 167 DNA markers located throughout the 26 autosomes. The SOLAR program was used to conduct multipoint variance-component quantitative trait locus (QTL analyses. We detected a major QTL that affects b* value (logarithm of odds [LOD] = 47.5, p = 1.60×10−49 on GGA24 (GGA for Gallus gallus. At the same location, we also detected a QTL that influences a* value (LOD = 14.2, p = 6.14×10−16. Additionally, beta-carotene dioxygenase 2 (BCDO2, the obvious positional candidate gene under the linkage peaks on GGA24, was investigated by the two association tests: i.e., measured genotype association (MGA and quantitative transmission disequilibrium test (QTDT. Significant associations were detected between BCDO2 g.9367 A>C and a* (PMGA = 1.69×10−28; PQTDT = 2.40×10−25. The strongest associations were between BCDO2 g.9367 A>C and b* (PMGA = 3.56×10−66; PQTDT = 1.68×10−65. However, linkage analyses conditional on the single nucleotide polymorphism indicated that other functional variants should exist. Taken together, we demonstrate for the first time the linkage and association between the BCDO2 locus on GGA24 and quantitatively measured shank skin color traits in KNC.
-
Estimation of genetic parameters for reproductive traits in alpacas.
Cruz, A; Cervantes, I; Burgos, A; Morante, R; Gutiérrez, J P
2015-12-01
One of the main deficiencies affecting animal breeding programs in Peruvian alpacas is the low reproductive performance leading to low number of animals available to select from, decreasing strongly the selection intensity. Some reproductive traits could be improved by artificial selection, but very few information about genetic parameters exists for these traits in this specie. The aim of this study was to estimate genetic parameters for six reproductive traits in alpacas both in Suri (SU) and Huacaya (HU) ecotypes, as well as their genetic relationship with fiber and morphological traits. Dataset belonging to Pacomarca experimental farm collected between 2000 and 2014 was used. Number of records for age at first service (AFS), age at first calving (AFC), copulation time (CT), pregnancy diagnosis (PD), gestation length (GL), and calving interval (CI) were, respectively, 1704, 854, 19,770, 5874, 4290 and 934. Pedigree consisted of 7742 animals. Regarding reproductive traits, model of analysis included additive and residual random effects for all traits, and also permanent environmental effect for CT, PD, GL and CI traits, with color and year of recording as fixed effects for all the reproductive traits and also age at mating and sex of calf for GL trait. Estimated heritabilities, respectively for HU and SU were 0.19 and 0.09 for AFS, 0.45 and 0.59 for AFC, 0.04 and 0.05 for CT, 0.07 and 0.05 for PD, 0.12 and 0.20 for GL, and 0.14 and 0.09 for CI. Genetic correlations between them ranged from -0.96 to 0.70. No important genetic correlations were found between reproductive traits and fiber or morphological traits in HU. However, some moderate favorable genetic correlations were found between reproductive and either fiber and morphological traits in SU. According to estimated genetic correlations, some reproductive traits might be included as additional selection criteria in HU. Copyright © 2015 Elsevier B.V. All rights reserved.
-
Data Gathering Bias: Trait Vulnerability to Psychotic Symptoms?
Directory of Open Access Journals (Sweden)
Ana Catalan
Full Text Available Jumping to conclusions (JTC is associated with psychotic disorder and psychotic symptoms. If JTC represents a trait, the rate should be (i increased in people with elevated levels of psychosis proneness such as individuals diagnosed with borderline personality disorder (BPD, and (ii show a degree of stability over time.The JTC rate was examined in 3 groups: patients with first episode psychosis (FEP, BPD patients and controls, using the Beads Task. PANSS, SIS-R and CAPE scales were used to assess positive psychotic symptoms. Four WAIS III subtests were used to assess IQ.A total of 61 FEP, 26 BPD and 150 controls were evaluated. 29 FEP were revaluated after one year. 44% of FEP (OR = 8.4, 95% CI: 3.9-17.9 displayed a JTC reasoning bias versus 19% of BPD (OR = 2.5, 95% CI: 0.8-7.8 and 9% of controls. JTC was not associated with level of psychotic symptoms or specifically delusionality across the different groups. Differences between FEP and controls were independent of sex, educational level, cannabis use and IQ. After one year, 47.8% of FEP with JTC at baseline again displayed JTC.JTC in part reflects trait vulnerability to develop disorders with expression of psychotic symptoms.
-
Schneider, J F; Rempel, L A; Rohrer, G A
2012-10-01
The primary objective of this study was to determine genetic and genomic parameters among swine (Sus scrofa) farrowing traits. Genetic parameters were obtained using MTDFREML. Genomic parameters were obtained using GENSEL. Genetic and residual variances obtained from MTDFREML were used as priors for the Bayes C analysis of GENSEL. Farrowing traits included total number born (TNB), number born alive (NBA), number born dead (NBD), number stillborn (NSB), number of mummies (MUM), litter birth weight (LBW), and average piglet birth weight (ABW). Statistically significant heritabilities included TNB (0.09, P = 0.048), NBA (0.09, P = 0.041), LBW (0.20, P = 0.002), and ABW (0.26, P NBA (0.97, P NBA-LBW (0.56, P NBA (0.06), NBD (0.00), NSB (0.01), MUM (0.00), LBW (0.11), and ABW (0.31). Limited information is available in the literature about genomic parameters. Only the GP estimate for NSB is significantly lower than what has been published. The GP estimate for ABW is greater than the estimate for heritability found in this study. Other traits with significant heritability had GP estimates half the value of heritability. This research indicates that significant genetic markers will be found for TNB, NBA, LBW, and ABW that will have either immediate use in industry or provide a roadmap to further research with fine mapping or sequencing of areas of significance. Furthermore, these results indicate that genomic selection implemented at an early age would have similar annual progress as traditional selection, and could be incorporated along with traditional selection procedures to improve genetic progress of litter traits.
-
QTL Analysis of Kernel-Related Traits in Maize Using an Immortalized F2 Population
Hu, Yanmin; Li, Weihua; Fu, Zhiyuan; Ding, Dong; Li, Haochuan; Qiao, Mengmeng; Tang, Jihua
2014-01-01
Kernel size and weight are important determinants of grain yield in maize. In this study, multivariate conditional and unconditional quantitative trait loci (QTL), and digenic epistatic analyses were utilized in order to elucidate the genetic basis for these kernel-related traits. Five kernel-related traits, including kernel weight (KW), volume (KV), length (KL), thickness (KT), and width (KWI), were collected from an immortalized F2 (IF2) maize population comprising of 243 crosses performed at two separate locations over a span of two years. A total of 54 unconditional main QTL for these five kernel-related traits were identified, many of which were clustered in chromosomal bins 6.04–6.06, 7.02–7.03, and 10.06–10.07. In addition, qKL3, qKWI6, qKV10a, qKV10b, qKW10a, and qKW7a were detected across multiple environments. Sixteen main QTL were identified for KW conditioned on the other four kernel traits (KL, KWI, KT, and KV). Thirteen main QTL were identified for KV conditioned on three kernel-shape traits. Conditional mapping analysis revealed that KWI and KV had the strongest influence on KW at the individual QTL level, followed by KT, and then KL; KV was mostly strongly influenced by KT, followed by KWI, and was least impacted by KL. Digenic epistatic analysis identified 18 digenic interactions involving 34 loci over the entire genome. However, only a small proportion of them were identical to the main QTL we detected. Additionally, conditional digenic epistatic analysis revealed that the digenic epistasis for KW and KV were entirely determined by their constituent traits. The main QTL identified in this study for determining kernel-related traits with high broad-sense heritability may play important roles during kernel development. Furthermore, digenic interactions were shown to exert relatively large effects on KL (the highest AA and DD effects were 4.6% and 6.7%, respectively) and KT (the highest AA effects were 4.3%). PMID:24586932
-
Transdiagnostic cognitive processes in high trait anger.
Owen, John M
2011-03-01
Trait anger is a personality construct that refers to stable individual differences in the propensity to experience anger as an emotional state. The objective of this paper is to review relevant empirical studies in order to determine whether the transdiagnostic cognitive processes that have been identified across the DSM-IV Axis I disorders (specifically, selective attention, memory biases, reasoning biases and recurrent negative thinking) are also an underlying characteristic of high trait anger. On the basis of the review it is concluded that, whilst the research base is limited, there is good evidence that high trait anger is associated with selective attention to hostile social cues, the tendency to interpret the behaviour of others as indicating potential hostility and the tendency to ruminate over past anger-provoking experiences. The range of cognitive processes identified in high trait anger is consistent with those identified in the Axis I disorders. It is concluded that these findings provide support for (i) the broad applicability of the transdiagnostic approach as a theoretical framework for understanding a range of psychological conditions, not limited to the Axis I disorders, and (ii) the validity of conceptualising high trait anger as an aspect of personality functioning that is maintained, at least in part, by cognitive processes. Cognitive and motivational factors (specifically, beliefs and goals) that may underlie the hostile information-processing biases and recurrent negative thinking associated with high trait anger are discussed, and consideration is given to the clinical relevance of the findings of the review. Copyright © 2010 Elsevier Ltd. All rights reserved.
-
Towards a unified model for leaf trait and trait-environment relationships
Wang, H.; Harrison, S. P.; Prentice, I. C.; Peng, C.; Yang, Y.
2016-12-01
A widely accepted core set of leaf traits describes key aspects of plant function including the coupling among carbon, nitrogen and water cycles at the leaf, plant and ecosystem scales. Our current research focuses on two questions: (1) what dimensions of correlated variation among traits apply across all vascular plants irrespective of environment; (2) how, and to what extent, can variations in community mean values of leaf traits be predicted along environmental gradients? Based on a large quantitative trait data set covering the major environmental gradients across China, we are tackling these questions via two complementary approaches: multivariate analysis of trait-trait, trait-site, and trait-environment relationships, and the development of conceptual models and testable hypotheses for the dependencies of each trait on other traits and/or specific environmental predictors. Preliminary multivariate analyses suggest the existence of at least two independent axes of variation in leaf traits, and show robust relationships between trait syndromes and growing-season climate variables. A minimal conceptual model then considers nitrogen per unit leaf area (Narea) as a function of leaf mass per unit area (LMA) and carboxylation capacity (Vcmax); LMA as a function of irradiance, temperature and water and/or nutrient stress; Vcmax as a function of irradiance, temperature and the long-term ci:ca ratio (indexed by δ13C); and the ci:ca ratio as a function of vapour pressure deficit, temperature and atmospheric pressure. Each of these dependencies has support from observations, pointing the way towards a comprehensive set of equations to predict community-mean values of core traits in next-generation terrestrial ecosystem models.
-
Directory of Open Access Journals (Sweden)
Azmeraw T. Amare
2018-03-01
Full Text Available Studies reported a strong genetic correlation between the Big Five personality traits and major depressive disorder (MDD. Moreover, personality traits are thought to be associated with response to antidepressants treatment that might partly be mediated by genetic factors. In this study, we examined whether polygenic scores (PGSs derived from the Big Five personality traits predict treatment response and remission in patients with MDD who were prescribed selective serotonin reuptake inhibitors (SSRIs. In addition, we performed meta-analyses of genome-wide association studies (GWASs on these traits to identify genetic variants underpinning the cross-trait polygenic association. The PGS analysis was performed using data from two cohorts: the Pharmacogenomics Research Network Antidepressant Medication Pharmacogenomic Study (PGRN-AMPS, n = 529 and the International SSRI Pharmacogenomics Consortium (ISPC, n = 865. The cross-trait GWAS meta-analyses were conducted by combining GWAS summary statistics on SSRIs treatment outcome and on the personality traits. The results showed that the PGS for openness and neuroticism were associated with SSRIs treatment outcomes at p < 0.05 across PT thresholds in both cohorts. A significant association was also found between the PGS for conscientiousness and SSRIs treatment response in the PGRN-AMPS sample. In the cross-trait GWAS meta-analyses, we identified eight loci associated with (a SSRIs response and conscientiousness near YEATS4 gene and (b SSRI remission and neuroticism eight loci near PRAG1, MSRA, XKR6, ELAVL2, PLXNC1, PLEKHM1, and BRUNOL4 genes. An assessment of a polygenic load for personality traits may assist in conjunction with clinical data to predict whether MDD patients might respond favorably to SSRIs.
-
Shu, Nan; Hu, Mengyue; Ling, Zhaoli; Liu, Peihua; Wang, Fan; Xu, Ping; Zhong, Zeyu; Sun, Binbin; Zhang, Mian; Li, Feng; Xie, Qiushi; Liu, Xiaodong; Liu, Li
2016-01-01
Liver injury is a common adverse effect of atorvastatin. This study aimed to investigate atorvastatin-induced hepatotoxicity in diabetic rats induced by high-fat diet combined with streptozotocin. The results showed that 40 mg/kg atorvastatin was lethal to diabetic rats, whose mean survival time was 6.2 days. Severe liver injury also occurred in diabetic rats treated with 10 mg/kg and 20 mg/kg atorvastatin. The in vitro results indicated that atorvastatin cytotoxicity in hepatocytes of diabetic rats was more severe than normal and high-fat diet feeding rats. Expressions and activities of hepatic Cyp3a and SLCO1B1 were increased in diabetic rats, which were highly correlated with hepatotoxicity. Antioxidants (glutathione and N-Acetylcysteine), Cyp3a inhibitor ketoconazole and SLCO1B1 inhibitor gemfibrozil suppressed cytotoxicity and ROS formation in primary hepatocytes of diabetic rats. In HepG2 cells, up-regulations of CYP3A4 and SLCO1B1 potentiated hepatotoxicity and ROS generation, whereas knockdowns of CYP3A4 and SLCO1B1 as well as CYP3A4/SLCO1B1 inhibitions showed the opposite effects. Phenobarbital pretreatment was used to induce hepatic Cyp3a and SLCO1B1 in rats. Phenobarbital aggravated atorvastatin-induced hepatotoxicity, while decreased plasma exposure of atorvastatin. All these findings demonstrated that the upregulations of hepatic Cyp3a and SLCO1B1 in diabetic rats potentiated atorvastatin-induced hepatotoxicity via increasing ROS formation. PMID:27624558
-
Alpha band frequency differences between low-trait and high-trait anxious individuals.
Ward, Richard T; Smith, Shelby L; Kraus, Brian T; Allen, Anna V; Moses, Michael A; Simon-Dack, Stephanie L
2018-01-17
Trait anxiety has been shown to cause significant impairments on attentional tasks. Current research has identified alpha band frequency differences between low-trait and high-trait anxious individuals. Here, we further investigated the underlying alpha band frequency differences between low-trait and high-trait anxious individuals during their resting state and the completion of an inhibition executive functioning task. Using human participants and quantitative electroencephalographic recordings, we measured alpha band frequency in individuals both high and low in trait anxiety during their resting state, and while they completed an Eriksen Flanker Task. Results indicated that high-trait anxious individuals exhibit a desynchronization in alpha band frequency from a resting state to when they complete the Eriksen Flanker Task. This suggests that high-trait anxious individuals maintain fewer attentional resources at rest and must martial resources for task performance as compared with low-trait anxious individuals, who appear to maintain stable cognitive resources between rest and task performance. These findings add to the cognitive neuroscience literature surrounding the role of alpha band frequency in low-trait and high-trait anxious individuals.
-
Cherel, Pierre; Pires, José; Glénisson, Jérôme; Milan, Denis; Iannuccelli, Nathalie; Herault, Frédéric; Damon, Marie; Le Roy, Pascale
2011-01-01
Abstract Background Detection of quantitative trait loci (QTLs) affecting meat quality traits in pigs is crucial for the design of efficient marker-assisted selection programs and to initiate efforts toward the identification of underlying polymorphisms. The RYR1 and PRKAG3 causative mutations, originally identified from major effects on meat characteristics, can be used both as controls for an overall QTL detection strategy for diversely affected traits and as a scale for detected QTL effect...
-
216-B-3 expansion ponds closure plan
International Nuclear Information System (INIS)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA
-
216-B-3 expansion ponds closure plan
Energy Technology Data Exchange (ETDEWEB)
1994-10-01
This document describes the activities for clean closure under the Resource Conservation and Recovery Act of 1976 (RCRA) of the 216-B-3 Expansion Ponds. The 216-B-3 Expansion Ponds are operated by the US Department of Energy, Richland Operations Office (DOE-RL) and co-operated by Westinghouse Hanford Company (Westinghouse Hanford). The 216-B-3 Expansion Ponds consists of a series of three earthen, unlined, interconnected ponds that receive waste water from various 200 East Area operating facilities. The 3A, 3B, and 3C ponds are referred to as Expansion Ponds because they expanded the capability of the B Pond System. Waste water (primarily cooling water, steam condensate, and sanitary water) from various 200 East Area facilities is discharged to the Bypass pipe (Project X-009). Water discharged to the Bypass pipe flows directly into the 216-B-3C Pond. The ponds were operated in a cascade mode, where the Main Pond overflowed into the 3A Pond and the 3A Pond overflowed into the 3C Pond. The 3B Pond has not received waste water since May 1985; however, when in operation, the 3B Pond received overflow from the 3A Pond. In the past, waste water discharges to the Expansion Ponds had the potential to have contained mixed waste (radioactive waste and dangerous waste). The radioactive portion of mixed waste has been interpreted by the US Department of Energy (DOE) to be regulated under the Atomic Energy Act of 1954; the dangerous waste portion of mixed waste is regulated under RCRA.
-
DEFF Research Database (Denmark)
Cayuso, Jordi; Dzementsei, Aliaksandr; Fischer, Johanna C
2016-01-01
Positioning organs in the body often requires the movement of multiple tissues, yet the molecular and cellular mechanisms coordinating such movements are largely unknown. Here, we show that bidirectional signaling between EphrinB1 and EphB3b coordinates the movements of the hepatic endoderm...... and adjacent lateral plate mesoderm (LPM), resulting in asymmetric positioning of the zebrafish liver. EphrinB1 in hepatoblasts regulates directional migration and mediates interactions with the LPM, where EphB3b controls polarity and movement of the LPM. EphB3b in the LPM concomitantly repels hepatoblasts...
-
Japanese contributions to IAEA INTOR Workshop, Phase Two A, Part 3
International Nuclear Information System (INIS)
Mori, Shigeru; Tomabechi, Ken; Fujisawa, Noboru
1988-02-01
This report corresponds to Chapter I and II of Japanese contribution report to IAEA INTOR Workshop, Phase Two A, Part 3. The major objectives of the INTOR Workshop Part 3 are to evaluate innovative ideas which would significantly improve the tokamak concept, to study new-selected critical technical issues, that affect the feasibility or practicability of the INTOR concept, to assess scientific and technical data bases, and to conduct critical analyses of the existing INTOR-like designs with the aim of preparing a useful information base for future design work for ITER. To perform the innovations, critical issues, and data base, the following six groups are organized; (A) Impurity control, (B) Operational limits and confinement, (C) Current drive and heating, (D) Electromagnetics, (E) Configuration and maintenance, (F) Blanket and first wall. In addition to those groups, the two disciplinary groups are also organized to do the critical analyses of the existing INTOR-like designs; (G) Physics and (H) Engineering. (author)
-
Directory of Open Access Journals (Sweden)
Jose Daniel Abacar
2016-01-01
Full Text Available To select elite germplasms, 112 mutants derived from japonica rice cultivar Wuyujing 3 were evaluated. The yield components such as panicle number per square meter, grain number per panicle, and grain weight were measured. The quality traits such as percentage of chalky grains (PCG, brown rice yield (BRY, milled rice yield (MRY, degree of milling (DM, amylose content (AC, protein content (PC, and relationships among traits were inverstigated. Results showed that grain yield ranged from 2.15 to 12.49 t/hm2 with a mean of 6.4 t/hm2 and number of grains per square meter contributed for 94.64% in grain yield variation. For quality traits, all rice mutants had short size (grain length ≤ 5.5 mm and bold shape (grain length to width ratio = 1.10–2.00. Most of rice mutants (87.5% had PCG values below 20%. All mutants had MRY values above 50%, AC values below 20%, and PC values below 10%. Percentage of chalky grains was significantly negatively correlated with MRY and positively correlated with DM. BRY and MRY were significantly negatively correlated with DM. PC was significantly and positively correlated with MRY and negatively correlated with DM, while AC had no significant correlation with these quality traits. It was concluded that there were 25 rice mutants which fulfilled the major requirements of Jiangsu standard japonica rice such as low percentage of chalky grains, low amylose content, optimal protein content, and which could be used as elite germplasms. Thus the mutants identified may lead to significant progress in improvement of rice quality.
-
Physiognomy: Personality Traits Prediction by Learning
Institute of Scientific and Technical Information of China (English)
Ting Zhang; Ri-Zhen Qin; Qiu-Lei Dong; Wei Gao; Hua-Rong Xu; Zhan-Yi Hu
2017-01-01
Evaluating individuals' personality traits and intelligence from their faces plays a crucial role in interpersonal relationship and important social events such as elections and court sentences.To assess the possible correlations between personality traits (also measured intelligence) and face images,we first construct a dataset consisting of face photographs,personality measurements,and intelligence measurements.Then,we build an end-to-end convolutional neural network for prediction of personality traits and intelligence to investigate whether self-reported personality traits and intelligence can be predicted reliably from a face image.To our knowledge,it is the first work where deep learning is applied to this problem.Experimental results show the following three points:1)"Rule-consciousness" and "Tension" can be reliably predicted from face images.2) It is difficult,if not impossible,to predict intelligence from face images,a finding in accord with previous studies.3) Convolutional neural network (CNN) features outperform traditional handcrafted features in predicting traits.
-
Gregory, K E; Maurer, R R
1991-03-01
Brown Swiss-Hereford (BS-H) reciprocal cross embryos were transferred to BS and H recipient cows and Red Poll-Angus (RP-A) reciprocal cross embryos were transferred to RP and A recipient cows to estimate the relative contributions of ovum cytoplasm and uterine influences to prenatal maternal effects. Calves resulting from embryo transfers (ET) were weaned early (3 to 5 d). Reciprocal cross mating also were made by natural service (NS) between BS and H and between RP and A breeds; part of the offspring were weaned at 3 to 5 d, and the remainder nursed their dams to an age of 150 to 180 d. This was done to estimate breed differences in prenatal and postnatal effects combined and to separate the effects of prenatal maternal influences from postnatal maternal influences of these breeds. Females produced in both ET and NS parts of the experiment were retained to produce three calf crops to an age of about 4.5 yr. The following traits were analyzed: percentage of conception rate; percentage of calf survival; percentage of calves produced per cow exposed; birth and weaning weights of calves produced; and periodic weights, heights, and condition scores of females to an age of 4.5 yr. Neither breed of donor (cytoplasmic influence) nor breed of recipient (uterine influence) had consistently important effects on the traits evaluated. In NS matings, differences between reciprocal crosses were small for most of the traits evaluated. Method of rearing (nursed vs weaned at 3 to 5 d) had no effect on reproductive and maternal traits for RP-A reciprocal cross females, but females that nursed generally were heavier, were taller, and had higher condition scores at most ages than early-weaned females. For the BS-H reciprocal cross, early-weaned females were favored over females reared by their dams in percentage of calves produced per cow exposed, but the method of rearing did not affect other reproductive or maternal traits. BS-H reciprocal cross females that nursed their dams were
-
Directory of Open Access Journals (Sweden)
Palacios, M.
2008-12-01
Full Text Available The use of clay-based product waste as an alternative prime material in Portland cement raw mixes raises the ZnO, ZrO2 and B2O3 content in the clinker. These compounds are found in the enamelled surface of the tile added to the raw mix. The present study explores the effect of adding 0.5 and 2% ZnO, ZrO2 and B2O3 to the raw mix, separately and jointly, on clinkerization and the distribution and morphology of the mineral phases in the clinker. The findings showed that while ZnO and ZrO2 are fixed in the clinker, B2O3 is partially volatized. Zinc oxide acted as a flux, while neither ZrO2 nor B2O3 increased the molten phase. The addition of the oxides to the raw mix changed the content of the main mineral phases in the clinker. Zinc oxide lowered the C3S and C3A contents, ZrO2 reduced the ferritic phase and B2O3 stabilized C2S. New mineral phases, namely 3CaO·ZnO·2Al2O3 and CaZrO3, were identified in the clinkers obtained when 2% ZnO and ZrO2 were added to the raw mix.El empleo de residuos cerámicos como materia prima alternativa en la fabricación del crudo de cemento Portland, aumenta el contenido de ZnO, ZrO2 y B2O3 en el clinker. Estos elementos se encuentran en la capa esmaltada de los residuos cerámicos incorporados al crudo. Por ello el presente trabajo de investigación aborda el estudio del efecto que tiene la adición en el crudo de contenidos del 0,5 y 2% de ZnO, ZrO2 y B2O3 de manera individual y conjunta en los procesos de clinkerización, en la distribución y morfología de las fases mineralógicas del clinker.Los resultados obtenidos han demostrado que el ZnO y ZrO2 permanecen fijados en el clinker, sin embargo el B2O3 se volatiliza parcialmente. El ZnO actúa como fundente, mientras que el ZrO2 y el B2O3 no aumentan el contenido de fase fundida. La adición de estos óxidos al crudo modifica el contenido de las principales fases mineralógicas del clinker. El ZnO disminuye los contenidos de C3S y C3A, el ZrO2 disminuye
-
45 CFR 1220.3-2 - Part-time volunteers.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Part-time volunteers. 1220.3-2 Section 1220.3-2... SERVICE PAYMENT OF VOLUNTEER LEGAL EXPENSES Civil and Administrative Proceedings § 1220.3-2 Part-time volunteers. ACTION will reimburse sponsors for the reasonable expenses incidental to the defense of part-time...
-
Directory of Open Access Journals (Sweden)
Jeong HU
2015-01-01
Full Text Available Hyeon-Uk Jeong,1 Mihwa Kwon,2 Yongnam Lee,3 Ji Seok Yoo,3 Dae Hee Shin,3 Im-Sook Song,2 Hye Suk Lee1 1College of Pharmacy, The Catholic University of Korea, Bucheon 420-743, Korea; 2College of Pharmacy and Research Institute of Pharmaceutical Sciences, Kyungpook National University, Daegu 702-701, Korea; 3Central R&D Institute, Yungjin Pharm Co., Ltd., Suwon 443-270, Korea Abstract: We investigated the in vitro transport characteristics of catalposide in HEK293 cells overexpressing organic anion transporter 1 (OAT1, OAT3, organic anion transporting polypeptide 1B1 (OATP1B1, OATP1B3, organic cation transporter 1 (OCT1, OCT2, P-glycoprotein (P-gp, and breast cancer resistance protein (BCRP. The transport mechanism of catalposide was investigated in HEK293 and LLC-PK1 cells overexpressing the relevant transporters. The uptake of catalposide was 319-, 13.6-, and 9.3-fold greater in HEK293 cells overexpressing OAT3, OATP1B1, and OATP1B3 transporters, respectively, than in HEK293 control cells. The increased uptake of catalposide via the OAT3, OATP1B1, and OATP1B3 transporters was decreased to basal levels in the presence of representative inhibitors such as probenecid, furosemide, and cimetidine (for OAT3 and cyclosporin A, gemfibrozil, and rifampin (for OATP1B1 and OATP1B3. The concentration-dependent OAT3-mediated uptake of catalposide revealed the following kinetic parameters: Michaelis constant (Km =41.5 µM, maximum uptake rate (Vmax =46.2 pmol/minute, and intrinsic clearance (CLint =1.11 µL/minute. OATP1B1- and OATP1B3-mediated catalposide uptake also showed concentration dependency, with low CLint values of 0.035 and 0.034 µL/minute, respectively. However, the OCT1, OCT2, OAT1, P-gp, and BCRP transporters were apparently not involved in the uptake of catalposide into cells. In addition, catalposide inhibited the transport activities of OAT3, OATP1B1, and OATP1B3 with half-maximal inhibitory concentration values of 83, 200, and 235 µ
-
Wright, Zara E; Pahlen, Shandell; Krueger, Robert F
2017-05-01
The Diagnostic and Statistical Manual for Mental Disorders-Fifth Edition (DSM-5) proposes an alternative model for personality disorders, which includes maladaptive-level personality traits. These traits can be operationalized by the Personality Inventory for the DSM-5 (PID-5). Although there has been extensive research on genetic and environmental influences on normative level personality, the heritability of the DSM-5 traits remains understudied. The present study addresses this gap in the literature by assessing traits indexed by the PID-5 and the International Personality Item Pool NEO (IPIP-NEO) in adult twins (N = 1,812 individuals). Research aims include (a) replicating past findings of the heritability of normative level personality as measured by the IPIP-NEO as a benchmark for studying maladaptive level traits, (b) ascertaining univariate heritability estimates of maladaptive level traits as measured by the PID-5, (c) establishing how much variation in personality pathology can be attributed to the same genetic components affecting variation in normative level personality, and (d) determining residual variance in personality pathology domains after variance attributable to genetic and environmental components of general personality has been removed. Results revealed that PID-5 traits reflect similar levels of heritability to that of IPIP-NEO traits. Further, maladaptive and normative level traits that correlate at the phenotypic level also correlate at the genotypic level, indicating overlapping genetic components contribute to variance in both. Nevertheless, we also found evidence for genetic and environmental components unique to maladaptive level personality traits, not shared with normative level traits. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
-
Ezcurra, I; Wycliffe, P; Nehlin, L; Ellerström, M; Rask, L
2000-10-01
The transcriptional activator ABI3 is a key regulator of gene expression during embryo maturation in crucifers. In monocots, the related VP1 protein regulates the Em promoter synergistically with abscisic acid (ABA). We identified cis-elements in the Brassica napus napin napA promoter mediating regulation by ABI3 and ABA, by analyzing substitution mutation constructs of napA in transgenic tobacco plantlets ectopically expressing ABI3. In transient analysis using particle bombardment of tobacco leaf sections, a tetramer of the distB ABRE (abscisic acid-responsive element) mediated transactivation by ABI3 and ABI3-dependent response to ABA, whereas a tetramer of the composite RY/G complex, containing RY repeats and a G-box, mediated only ABA-independent transactivation by ABI3. Deletion of the conserved B2 and B3 domains of ABI3 abolished transactivation of napA by ABI3. The two domains of ABI3 interact with different cis-elements: B2 is necessary for ABA-independent and ABA-dependent activations through the distB ABRE, whereas B3 interacts with the RY/G complex. Thus B2 mediates the interaction of ABI3 with the protein complex at the ABRE. The regulation of napA by ABI3 differs from Em regulation by VP1, in that the B3 domain of ABI3 is essential for the ABA-dependent regulation of napA.
-
Mõttus, René; Realo, Anu; Allik, Jüri; Esko, Tõnu; Metspalu, Andres; Johnson, Wendy
2015-01-01
The study investigated differences in the Five-Factor Model (FFM) domains and facets across adulthood. The main questions were whether personality scales reflected coherent units of trait development and thereby coherent personality traits more generally. These questions were addressed by testing if the components of the trait scales (items for facet scales and facets for domain scales) showed consistent age group differences. For this, measurement invariance (MI) framework was used. In a sample of 2,711 Estonians who had completed the NEO Personality Inventory 3 (NEO PI-3), more than half of the facet scales and one domain scale did not meet the criterion for weak MI (factor loading equality) across 12 age groups spanning ages from 18 to 91 years. Furthermore, none of the facet and domain scales met the criterion for strong MI (intercept equality), suggesting that items of the same facets and facets of the same domains varied in age group differences. When items were residualized for their respective facets, 46% of them had significant (p traits should show similar age group differences. Given this, the FFM domains and facets as embodied in the NEO PI-3 do not reflect aetiologically coherent traits. PMID:25751273
-
Enrichment of W2B5 from WO3 and B2O3 by Double SHS Method
Directory of Open Access Journals (Sweden)
Bora DERIN
2018-02-01
Full Text Available A second self-propagating high-temperature synthesis (SHS was carried out to enrich the W2B5 content in the SHS product containing a mixture of various tungsten boride compounds. In the experiment, the process called Double-SHS (D-SHS was conducted in two steps. In the first SHS reaction, an initial molar composition ratio of WO3:B2O3:Mg mixture was selected as 1:3:8. The product was then hot-leached with hydrochloric acid to eliminate MgO and Mg3B2O6 phases. The leached product, consisting of 72.6 wt.% W2B5, 16.1 wt.% WB, 8.4 wt.% W2B, and 2.9 wt.% W, was again reacted with the Mg and B2O3 mixture by second SHS. After another acid leaching step, W2B5 content in the D-SHS product was found to be 98.2 wt.%. The study showed that D-SHS is an effective method for boron enrichment in the tungsten compounds.DOI: http://dx.doi.org/10.5755/j01.ms.24.1.17834
-
Genetic relationship between methane emissions and conformation traits in Danish Holstein cattle
DEFF Research Database (Denmark)
Zetouni, Larissa; Kargo, Morten; Lassen, Jan
2016-01-01
Conformation traits have been widely explored in dairy cattle evaluation, being a part of the total merit index for Holstein cows in different countries. They have been used as a way to access the cow’s condition in general, based on its body features. Lots of studies have analyzed the relationship...... traits in Holstein cows: height (H), body depth (BD), chest width (CW), dairy character (DC) and body condition score (BCS). Data was collected on 1114 Holstein cows from 11 commercial herds in Denmark. Methane emission was measured during milking in milking robots, and then quantifed using information...... between conformation traits and other traits of interest in dairy cattle, such as fertility, longevity and feed effciency, but little is known about how methane emissions correlate with conformation traits. Therefore, our goal was to evaluate the genetic correlations between methane and six conformation...
-
International Nuclear Information System (INIS)
Kim, Sung-Hak; Park, Jinah; Choi, Moon-Chang; Kim, Hwang-Phill; Park, Jung-Hyun; Jung, Yeonjoo; Lee, Ju-Hee; Oh, Do-Youn; Im, Seock-Ah; Bang, Yung-Jue; Kim, Tae-You
2007-01-01
DNA methyltransferases (DNMT) 3B is a de novo DNMT that represses transcription independent of DNMT activity. In order to gain a better insight into DNMT3B-mediated transcriptional repression, we performed a yeast two-hybrid analysis using DNMT3B as a bait. Of the various binding candidates, ZHX1, a member of zinc-finger and homeobox protein, was found to interact with DNMT3B in vivo and in vitro. N-terminal PWWP domain of DNMT3B was required for its interaction with homeobox motifs of ZHX1. ZHX1 contains nuclear localization signal at C-terminal homeobox motif, and both ZHX1 and DNMT3B were co-localized in nucleus. Furthermore, we found that ZHX1 enhanced the transcriptional repression mediated by DNMT3B when DNMT3B is directly targeted to DNA. These results showed for First the direct linkage between DNMT and zinc-fingers homeoboxes protein, leading to enhanced gene silencing by DNMT3B
-
O'Shea, D M; Dotson, V M; Fieo, R A
2017-12-01
Personality traits have been shown to be predictors of depressive symptoms in late life. Thus, we examined whether other more modifiable sources of individual differences such as self-efficacy and self-perceptions of aging would mediate the association between personality traits and depressive symptoms in older adults. Data were obtained from 3,507 older adult participants who took part in the 2012 Health and Retirement Study. The "Big Five" personality traits, self-efficacy, aging perceptions, and depressive symptoms were assessed. Mediation analyses tested the hypothesis that self-efficacy and aging perceptions would mediate the relationship between personality traits and depressive symptoms. All five personality traits were significant predictors of depressive symptoms. Neuroticism was positively associated with depressive symptoms and had the greatest effect compared with the other personality traits. There was a significant indirect effect of neuroticism, extraversion, and conscientiousness on depressive symptoms (including both mediators). The mediating effect of aging perceptions on the relationship between neuroticism and depressive symptoms was the strongest compared with self-efficacy, accounting for approximately 80% of the total indirect effect. Our results provide support for interventions aimed at improving self-perceptions related to efficacy and aging in order to reduce depressive symptoms in older adults. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.
-
Energy Technology Data Exchange (ETDEWEB)
Wang, Tianhong; Jiang, Yue; Wang, Guo-Li [Harbin Institute of Technology, Department of Physics, Harbin (China); Wang, Zhi-Hui [Beifang University of Nationalities, School of Electrical and Information Engineering, Yinchuan (China); Jiang, Libo [University of Pittsburgh, Department of Physics and Astronomy, Pittsburgh, PA (United States)
2017-01-15
In this paper, we study the OZI-allowed two-body strong decays of 3{sup -} heavy-light mesons. Experimentally the charmed D{sub 3}{sup *}(2760) and the charm-strange D{sub s3}{sup *}(2860) states with these quantum numbers have been discovered. For the bottomed B(5970) state, which was found by the CDF Collaboration recently, its quantum number has not been decided yet and we assume it is a 3{sup -} meson in this paper. The theoretical prediction for the strong decays of bottom-strange state B{sub s3}{sup *} is also given. The relativistic wave functions of 3{sup -} heavy mesons are constructed and their numerical values are obtained by solving the corresponding Bethe-Salpeter equation with instantaneous approximation. The transition matrix is calculated by using the PCAC and low energy theorem, following which the decay widths are obtained. For D{sub 3}{sup *}(2760) and D{sub s3}{sup *}(2860), the total strong decay widths are 72.6 and 47.6 MeV, respectively. For B{sub 3}{sup *} with M = 5978 MeV and B{sub s3}{sup *} with M = 6178 MeV, their strong decay widths are 22.9 and 40.8 MeV, respectively. (orig.)
-
Ottaviani, Gianluigi; Tsakalos, James L; Keppel, Gunnar; Mucina, Ladislav
2018-01-01
Complex processes related to biotic and abiotic forces can impose limitations to assembly and composition of plant communities. Quantifying the effects of these constraints on plant functional traits across environmental gradients, and among communities, remains challenging. We define ecological constraint ( C i ) as the combined, limiting effect of biotic interactions and environmental filtering on trait expression (i.e., the mean value and range of functional traits). Here, we propose a set of novel parameters to quantify this constraint by extending the trait-gradient analysis (TGA) methodology. The key parameter is ecological constraint, which is dimensionless and can be measured at various scales, for example, on population and community levels. It facilitates comparing the effects of ecological constraints on trait expressions across environmental gradients, as well as within and among communities. We illustrate the implementation of the proposed parameters using the bark thickness of 14 woody species along an aridity gradient on granite outcrops in southwestern Australia. We found a positive correlation between increasing environmental stress and strength of ecological constraint on bark thickness expression. Also, plants from more stressful habitats (shrublands on shallow soils and in sun-exposed locations) displayed higher ecological constraint for bark thickness than plants in more benign habitats (woodlands on deep soils and in sheltered locations). The relative ease of calculation and dimensionless nature of C i allow it to be readily implemented at various scales and make it widely applicable. It therefore has the potential to advance the mechanistic understanding of the ecological processes shaping trait expression. Some future applications of the new parameters could be investigating the patterns of ecological constraints (1) among communities from different regions, (2) on different traits across similar environmental gradients, and (3) for the same
-
Dubas, Judith Semon; Baams, Laura; Doornwaard, Suzan M; van Aken, Marcel A G
2017-10-01
Research on how dark personality traits develop and relate to risky behaviors and family relations during adolescence is scarce. This study used a person-oriented approach to examine (a) whether distinct groups of adolescents could be identified based on their developmental profiles of callous-unemotional (CU), grandiose manipulative (GM), and dysfunctional impulsivity (DI) traits and (b) whether these groups differ in their problem behaviors and parent-adolescent relationship quality. Latent class growth analyses on 4-wave data of 1,131 Dutch adolescents revealed 3 personality profiles: (1) a dark impulsive group (13.9%), with high scores on all 3 traits (CU, GM, and DI) that were stable over time; (2) an impulsive group (26.1%), with high and increasing levels of impulsivity and relatively low scores on CU and GM; and (3) and a low risk group (60.0%), with relatively low levels on all 3 personality characteristics, with impulsivity decreasing over time. Compared with adolescents in the low risk group, adolescents in the dark impulsive and impulsive groups reported higher initial levels of substance use, sexual risk behaviors, permissive sexual attitudes, parent-adolescent conflict, and lower parent-adolescent satisfaction, as well as greater increases in sexual risk behavior over time. Compared with adolescents in the impulsive group, those in the dark impulsive group showed the highest levels of risk behaviors. Hence, dark personality traits coupled with impulsivity may be indicative of an earlier and more severe trajectory of problem behaviors that may differ from the trajectory of youth who are only impulsive. (PsycINFO Database Record (c) 2017 APA, all rights reserved).
-
Quantitative trait loci (QTL) mapping for inflorescence length traits in ...
African Journals Online (AJOL)
User
2011-05-02
May 2, 2011 ... character affected by ecological surroundings, growth ... developed from each F2 by bud self-pollination for QTL analysis. ... Quantitative traits measured for the each individual plant in F2 the population and F3 families ..... sex and parental interactions (Liu et al., 1996). ... evolution of solanaceous species.
-
Quantitative trait loci for fertility traits in Finnish Ayrshire cattle
Directory of Open Access Journals (Sweden)
Viitala Sirja M
2008-03-01
Full Text Available Abstract A whole genome scan was carried out to detect quantitative trait loci (QTL for fertility traits in Finnish Ayrshire cattle. The mapping population consisted of 12 bulls and 493 sons. Estimated breeding values for days open, fertility treatments, maternal calf mortality and paternal non-return rate were used as phenotypic data. In a granddaughter design, 171 markers were typed on all 29 bovine autosomes. Associations between markers and traits were analysed by multiple marker regression. Multi-trait analyses were carried out with a variance component based approach for the chromosomes and trait combinations, which were observed significant in the regression method. Twenty-two chromosome-wise significant QTL were detected. Several of the detected QTL areas were overlapping with milk production QTL previously identified in the same population. Multi-trait QTL analyses were carried out to test if these effects were due to a pleiotropic QTL affecting fertility and milk yield traits or to linked QTL causing the effects. This distinction could only be made with confidence on BTA1 where a QTL affecting milk yield is linked to a pleiotropic QTL affecting days open and fertility treatments.
-
Directory of Open Access Journals (Sweden)
Ben J Hayes
2010-09-01
Full Text Available Prediction of genetic merit using dense SNP genotypes can be used for estimation of breeding values for selection of livestock, crops, and forage species; for prediction of disease risk; and for forensics. The accuracy of these genomic predictions depends in part on the genetic architecture of the trait, in particular number of loci affecting the trait and distribution of their effects. Here we investigate the difference among three traits in distribution of effects and the consequences for the accuracy of genomic predictions. Proportion of black coat colour in Holstein cattle was used as one model complex trait. Three loci, KIT, MITF, and a locus on chromosome 8, together explain 24% of the variation of proportion of black. However, a surprisingly large number of loci of small effect are necessary to capture the remaining variation. A second trait, fat concentration in milk, had one locus of large effect and a host of loci with very small effects. Both these distributions of effects were in contrast to that for a third trait, an index of scores for a number of aspects of cow confirmation ("overall type", which had only loci of small effect. The differences in distribution of effects among the three traits were quantified by estimating the distribution of variance explained by chromosome segments containing 50 SNPs. This approach was taken to account for the imperfect linkage disequilibrium between the SNPs and the QTL affecting the traits. We also show that the accuracy of predicting genetic values is higher for traits with a proportion of large effects (proportion black and fat percentage than for a trait with no loci of large effect (overall type, provided the method of analysis takes advantage of the distribution of loci effects.
-
49 CFR Appendix B to Part 599 - Engine Disablement Procedures for the CARS Program
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Engine Disablement Procedures for the CARS Program B Appendix B to Part 599 Transportation Other Regulations Relating to Transportation (Continued...—Engine Disablement Procedures for the CARS Program ER29JY09.006 ...
-
Fajardo, Alex; Piper, Frida I
2011-01-01
• The focus of the trait-based approach to study community ecology has mostly been on trait comparisons at the interspecific level. Here we quantified intraspecific variation and covariation of leaf mass per area (LMA) and wood density (WD) in monospecific forests of the widespread tree species Nothofagus pumilio to determine its magnitude and whether it is related to environmental conditions and ontogeny. We also discuss probable mechanisms controlling the trait variation found. • We collected leaf and stem woody tissues from 30-50 trees of different ages (ontogeny) from each of four populations at differing elevations (i.e. temperatures) and placed at each of three locations differing in soil moisture. • The total variation in LMA (coefficient of variation (CV) = 21.14%) was twice that of WD (CV = 10.52%). The total variation in traits was never less than 23% when compared with interspecific studies. Differences in elevation (temperature) for the most part explained variation in LMA, while differences in soil moisture and ontogeny explained the variation in WD. Traits covaried similarly in the altitudinal gradient only. • Functional traits of N. pumilio exhibited nonnegligible variation; LMA varied for the most part with temperature, while WD mostly varied with moisture and ontogeny. We demonstrate that environmental variation can cause important trait variation without species turnover. © The Authors (2010). Journal compilation © New Phytologist Trust (2010).
-
Genetic analysis of relative traits for a drought-sensitive mutant
International Nuclear Information System (INIS)
Gao Kangning; Wang Huaqi
2009-01-01
A drought-sensitive mutant (M616), selected from Handao 616 (HD616) by 60 Co γ-irradiation at 200Gy, was used. Some morphological and yield related traits of M166 and HD616 related to drought resistance were investigated. We further developed F 1 and F 2 reciprocal hybrid combinations derived from the crosses between M616 and HD616, between M616 and IRAT109, respectively, and genetic analysis of 3 traits including plant height, culm width of main stem and seed setting rate on main panicle were camed out. The results showed that M616 showed obviously sensitive to drought stress. Analysis of variance for three traits in upland and paddy between F 1 reciprocal hybrid combinations showed that each trait had no significant difference, and indicated that there were no differences of cytoplasmic hereditary effect. In addition, 3 traits of F 2 populations, were found that the frequency distributions of culm width showed normal distribution, indicating that culm width was polygenic trait, and the frequency distribution of plant height and seed setting rate did not show normal distribution, indicating that the two traits were qualitative-quantitative traits. Genetic analysis of relative traits for a drought-sensitive mutant of upland rice was a basic work for the gene location and cloning. (authors)
-
Energy Technology Data Exchange (ETDEWEB)
None
1977-01-17
Results are presented of an 8-month study to develop alternative non-site-specific OTEC facilities/platform requirements for an integrated OTEC test program which may include land and floating test facilities. Volume II--Appendixes is bound in three parts (A, B, and C) which together comprise a compendium of the most significant detailed data developed during the study. Part B provides an annotated test list and describes component tests and system tests.
-
Mapping of quantitative trait loci controlling Orobanche foetida Poir ...
African Journals Online (AJOL)
Mapping of quantitative trait loci controlling Orobanche foetida Poir. resistance in faba bean (Vicia faba L.) R Díaz-Ruiz, A Torres, MV Gutierrez, D Rubiales, JI Cubero, M Kharrat, Z Satovic, B Román ...
-
Kilmer, Donald C.
Third (part 3) in a set of four guides designed for the student interested in a vocation in electrical work, this guide includes four units: Unit VI--Ohm's Law, covering six lessons (voltage, current-flow and resistance, the Ohm's Law formula, formula for finding voltage, formula for finding resistance); Unit VII--Voltages, covering five lessons…
-
Terenina, E; Babigumira, B M; Le Mignon, G; Bazovkina, D; Rousseau, S; Salin, F; Bendixen, C; Mormede, P
2013-02-01
growth rate (P = 0.01); lean content and intramuscular fat (P < 0.01), which are the most important traits for carcass value; dopamine receptor D3 (DRD3) with carcass composition (P < 0.05); and vasopressin receptor 1B (AVPR1B) with meat quality traits (P ≤ 0.05). The effect of these polymorphisms on neuroendocrine parameters (eg DRD3 and HPA axis or AVPR1B and catecholamines) indicates information regarding their biological mechanism of action. Copyright © 2013 Elsevier Inc. All rights reserved.
-
Directory of Open Access Journals (Sweden)
Soliemanifar O
2015-04-01
The aim of this study was to investigate the role of personality traits, learning styles and metacognition in predicting critical thinking. Instrument & Methods: In this descriptive correlative study, 240 students (130 girls and 110 boys of Ahvaz Shahid Chamran University were selected by multi-stage random sampling method. The instruments for collecting data were NEO Five-Factor Inventory, learning style inventory of Kolb (LSI, metacognitive assessment inventory (MAI of Schraw & Dennison (1994 and California Critical Thinking Skills Test (CCTST. The data were analyzed using Pearson correlation coefficient, stepwise regression analysis and Canonical correlation analysis. Findings: Openness to experiment (b=0.41, conscientiousness (b=0.28, abstract conceptualization (b=0.39, active experimentation (b=0.22, reflective observation (b=0.12, knowledge of cognition (b=0.47 and regulation of cognition (b=0.29 were effective in predicting critical thinking. Openness to experiment and conscientiousness (r2=0.25, active experimentation, abstract conceptualization and reflective observation learning styles (r2=0.21 and knowledge and regulation of cognition metacognitions (r2=0.3 had an important role in explaining critical thinking. The linear combination of critical thinking skills (evaluation, analysis, inference was predictable by a linear combination of dispositional-cognitive factors (openness, conscientiousness, abstract conceptualization, active experimentation, knowledge of cognition and regulation of cognition. Conclusion: Personality traits, learning styles and metacognition, as dispositional-cognitive factors, play a significant role in students' critical thinking.
-
International Nuclear Information System (INIS)
Sadowski, E.T.
1988-11-01
As part of the study of the higher energy-level structure of 11 B, cross sections for elastic and inelastic scattering of neutrons from isotopically enriched 10 B samples have been measured for incident neutron energies from 3.03 MeV to 6.45 MeV in 250 keV increments and from 7.02 MeV to 12.01 MeV in 500 keV increments. Inelastic angular distributions for scattering to the states in parentheses in 10 B have been measured from the indicated energy up to 12.01 MeV; (0.718) from 3.02 MeV; (1.74) from 3.27 MeV; (2.15) from 3.77 MeV; (3.59) from 5.52 MeV; (4.77) from 7.02 MeV. The measurements at 3.02, 3.51, 4.02, and 4.51 MeV were done at nine laboratory angles from 20/degree/ to 158/degree/ in 17.5/degree/ increments with a sample that is isotopically 95.86% 10 B. All other distributions measured scattering at 11 laboratory angles from 18/degree/ to 158/degree/ in 15/degree/ increments from a sample that is isotopically 99.49% 10 B. The data are corrected for air scattering, sample attenuation, minor isotope impurity, multiple scattering, and elastic and inelastic scattering from the sample of the neutron source continuum and contaminants. An eight-channel, multilevel R-matrix analysis was performed on the data. Level energies, spins, and parities were deduced for twelve levels above 13 MeV excitation in 11 B. Only two definite and three tentative assignments for T = /1/2/ levels had been made previously above 13 MeV. The two definite levels were confirmed. Good agreement between the data and the R-matrix calculation in all analyzed channels was obtained for the proposed structure. 122 refs., 40 figs., 7 tabs
-
Herfindal, Ivar; van de Pol, Martijn; Nielsen, Jan Tøttrup; Sæther, Bernt-Erik; Møller, Anders Pape
2015-01-01
1.Environmental variation can induce life history changes that can last over a large part of the lifetime of an organism. If multiple demographic traits are affected, expected changes in climate may influence environmental covariances among traits in a complex manner. Thus, examining the
-
Lifescience Database Archive (English)
Full Text Available List Contact us BodyParts3D Table of 3D organ model IDs and organ names (PART-OF Tree) Data detail Data name Table of 3D org...an model IDs and organ names (PART-OF Tree) DOI 10.18908/lsdba.nbdc00837-002 Description of ...data contents List of downloadable 3D organ models in a tab-delimited text file format, describing the correspondence between 3D org...an model IDs and organ names available in PART-OF Tree. D...atabase Site Policy | Contact Us Table of 3D organ model IDs and organ names (PART-OF Tree) - BodyParts3D | LSDB Archive ...
-
Quantitative Trait Loci Associated with Drought Tolerance in Brachypodium distachyon
Directory of Open Access Journals (Sweden)
Yiwei Jiang
2017-05-01
Full Text Available The temperate wild grass Brachypodium distachyon (Brachypodium serves as model system for studying turf and forage grasses. Brachypodium collections show diverse responses to drought stress, but little is known about the genetic mechanisms of drought tolerance of this species. The objective of this study was to identify quantitative trait loci (QTLs associated with drought tolerance traits in Brachypodium. We assessed leaf fresh weight (LFW, leaf dry weight (LDW, leaf water content (LWC, leaf wilting (WT, and chlorophyll fluorescence (Fv/Fm under well-watered and drought conditions on a recombinant inbred line (RIL population from two parents (Bd3-1 and Bd1-1 known to differ in their drought adaptation. A linkage map of the RIL population was constructed using 467 single nucleotide polymorphism (SNP markers obtained from genotyping-by-sequencing. The Bd3-1/Bd1-1 map spanned 1,618 cM and had an average distance of 3.5 cM between adjacent single nucleotide polymorphisms (SNPs. Twenty-six QTLs were identified in chromosome 1, 2, and 3 in two experiments, with 14 of the QTLs under well-watered conditions and 12 QTLs under drought stress. In Experiment 1, a QTL located on chromosome 2 with a peak at 182 cM appeared to simultaneously control WT, LWC, and Fv/Fm under drought stress, accounting for 11–18.7% of the phenotypic variation. Allelic diversity of candidate genes DREB2B, MYB, and SPK, which reside in one multi-QTL region, may play a role in the natural variation in whole plant drought tolerance in Brachypodium. Co-localization of QTLs for multiple drought-related traits suggest that the gene(s involved are important regulators of drought tolerance in Brachypodium.
-
Kong, Guanghui; Zhao, Yao; Jing, Maofeng; Huang, Jie; Yang, Jin; Xia, Yeqiang; Kong, Liang; Ye, Wenwu; Xiong, Qin; Qiao, Yongli; Dong, Suomeng; Ma, Wenbo; Wang, Yuanchao
2015-08-01
Plant pathogens secrete an arsenal of effector proteins to impair host immunity. Some effectors possess enzymatic activities that can modify their host targets. Previously, we demonstrated that a Phytophthora sojae RXLR effector Avr3b acts as a Nudix hydrolase when expressed in planta; and this enzymatic activity is required for full virulence of P. sojae strain P6497 in soybean (Glycine max). Interestingly, recombinant Avr3b produced by E. coli does not have the hydrolase activity unless it was incubated with plant protein extracts. Here, we report the activation of Avr3b by a prolyl-peptidyl isomerase (PPIase), cyclophilin, in plant cells. Avr3b directly interacts with soybean cyclophilin GmCYP1, which activates the hydrolase activity of Avr3b in a PPIase activity-dependent manner. Avr3b contains a putative Glycine-Proline (GP) motif; which is known to confer cyclophilin-binding in other protein substrates. Substitution of the Proline (P132) in the putative GP motif impaired the interaction of Avr3b with GmCYP1; as a result, the mutant Avr3bP132A can no longer be activated by GmCYP1, and is also unable to promote Phytophthora infection. Avr3b elicits hypersensitive response (HR) in soybean cultivars producing the resistance protein Rps3b, but Avr3bP132A lost its ability to trigger HR. Furthermore, silencing of GmCYP1 rendered reduced cell death triggered by Avr3b, suggesting that GmCYP1-mediated Avr3b maturation is also required for Rps3b recognition. Finally, cyclophilins of Nicotiana benthamiana can also interact with Avr3b and activate its enzymatic activity. Overall, our results demonstrate that cyclophilin is a "helper" that activates the enzymatic activity of Avr3b after it is delivered into plant cells; as such, cyclophilin is required for the avirulence and virulence functions of Avr3b.
-
International Nuclear Information System (INIS)
Lee, M.S.; Terry, B.S.; Grieveson, P.
1993-01-01
The interfacial phenomena occurring during the contacting of liquid Al-B, Al-Ti-B, and Al-Zr-B melts with KF-AlF 3 liquid fluxes have been investigated by optical examination of quenched metal drops previously immersed in the liquid fluxes. Reactions in the Al-B/KF-AlF 3 system involve the formation of metastable AlB 12 at the metal/flux interface. At high KBF 4 levels in the flux, the AlB 12 is dispersed in the flux and also at low KBF 4 levels in the metal. Reactions in the Al-Ti-B/KF-AlF 3 system involve the formation of TiB 2 , which may be dispersed in either the metal or the flux depending upon the composition of the flux. The results obtained for the Al-Ti-B/NaF-AlF 3 and Al-Zr-B/KF-AlF 3 systems were similar to those observed for the Al-Ti-B/KF-AlF 3 system
-
Meat Quality and Physicochemical Trait Assessments of Berkshire and Commercial 3-way Crossbred Pigs
Subramaniyan, Sivakumar Allur; Kang, Da Rae; Belal, Shah Ahmed; Cho, Eun-So-Ri; Jung, Jong-Hyun; Jung, Young-Chul; Choi, Yang-Il; Shim, Kwan-Seob
2016-01-01
In this study, we compared qualities and physiochemical traits of meat from Berkshire (black color) pigs with those of meat from 3-way Landrace (white color) ? Yorkshire (white color) ? Duroc (red color) crossbred pigs (LYD). Meat quality characteristics, including pH, color, drip loss, cooking loss, and free amino acid, fatty acid, vitamin, and mineral contents of longissimus dorsi muscles, were compared. Meat from Berkshire pigs had deeper meat color (redness), higher pH, and lower drip los...
-
49 CFR Appendix B to Part 40 - DOT Drug Testing Semi-Annual Laboratory Report to Employers
2010-10-01
... TRANSPORTATION WORKPLACE DRUG AND ALCOHOL TESTING PROGRAMS Pt. 40, App. B Appendix B to Part 40—DOT Drug Testing.... Specimen Results Reported (total number) By Test Reason (a) Pre-employment (number) (b) Post-Accident...
-
Directory of Open Access Journals (Sweden)
Fatemeh Moradipour
2017-10-01
Full Text Available Introduction: Cucumber (Cucumis sativus L. is one of the most widely cultivated vegetables. Plant length is a quantitative trait is controlled by many genes. These traits are difficult to study due to the complex nature of their inheritance. The combining ability estimation is useful in determining the breeding value of cucumber lines by suggesting the appropriate use in a breeding program. In studying combining ability, the most commonly utilized experimental approach is the diallel design. General combining ability is a measure of additive genetic action; and specific combining ability (SCA is deviation from additivity. General combining ability is a main effect and SCA is an interaction. The aim is to determine the breeding value of the cross. Heterosis has been utilized to exploit dominance variance through production of hybrids. There are reports on positive and negative heterosis in cucumber however, there are differences between reports. This research was conducted to estimate general and specific combining ability and heterosis in cucumber inbred lines and hybrids to produce hybrids with high yield and quality. Material and Methods: In the spring of 2014, the seven parental lines and their 21 F1 hybrid were planted at the University of Guilan, in loamy sand field. Three replications were arranged in a randomized complete block design. The sandy loam soil was prepared by plowing and disking and formed into raised beds by plowed and harrow prior to plant establishment. Rows were on 1 m centers and plants were about 25 cm apart in the row. Prior to planting 150 kg·ha-1 of nitrogen from urea and 100 kg·ha-1 of phosphorous from triple superphosphate and 80 kg·ha-1 of potassium sulfate was applied. Side dressing with the same amount of nitrogen and phosphorus occurred at 50% flowering stage. Irrigation with 250 m3·ha-1, three times weekly, was begun at plant first flowering. In each replication, 12 individuals of each line or hybrid were
-
Huang, Hao; Li, Ruohan; Yuan, Jinxian; Zhou, Xin; Liu, Xi; Ou, Shu; Xu, Tao; Chen, Yangmei
2016-05-15
EphB family receptor tyrosine kinases, in cooperation with cell surface-bound ephrinB ligands, play a critical role in maintenance of dendritic spine morphogenesis, axons guidance, synaptogenesis, synaptic reorganization and plasticity in the central nervous system (CNS). However, the expression pattern of ephrinB/EphB in intractable temporal lobe epilepsy (TLE) and the underlying molecular mechanisms during epileptogenesis remain poorly understood. Here we investigated the expression pattern and cellular distribution of ephrinB/EphB in intractable TLE patients and lithium chloride-pilocarpine induced TLE rats using real-time quantitative polymerase chain reaction (RT-qPCR), immunohistochemistry, double-labeled immunofluorescence and Western blot analysis. Compared to control groups, ephrinB3 and EphB3 mRNA expression were significantly up-regulated in intractable TLE patients and TLE rats, while the mRNA expression trend of ephrinB1/2 and EphB1/2/4/6 in intractable TLE patients and TLE rats were inconsistent. Western blot analysis and semi-quantitative immunohistochemistry confirmed that ephrinB3 and EphB3 protein level were up-regulated in intractable TLE patients and TLE rats. At the same time, double-labeled immunofluorescence indicate that ephrinB3 was expressed mainly in the cytoplasm and protrusions of glia and neurons, while EphB3 was expressed mainly in the cytoplasm of neurons. Taken together, up-regulated expression of ephrinB3/EphB3 in intractable TLE patients and experimental TLE rats suggested that ephrinB3/EphB3 might be involved in the pathogenesis of TLE. Copyright © 2016 Elsevier B.V. All rights reserved.
-
Platelet [3H]imipramine binding in affective disorders: trait versus state characteristics
International Nuclear Information System (INIS)
Baron, M.; Barkai, A.; Gruen, R.; Peselow, E.; Fieve, R.R.; Quitkin, F.
1986-01-01
Platelet [3H]imipramine binding (Bmax) was determined in 67 patients with major affective illness (33 euthymic bipolar, 34 depressed unipolar) and 58 normal control subjects. Bipolar patients had significantly lower Bmax values than did control subjects. The mean Bmax in the unipolar patients was lower than in the control subjects, but the difference was not statistically significant. Dissociation constant (Kd) values did not distinguish patients in either category from control subjects. The significantly lower Bmax in euthymic bipolar patients and the apparent state independence of Bmax in some but not all unipolar patients suggest that platelet imipramine binding may be a trait marker in a subset of affective disorders
-
Emotion-Induced Retrograde Amnesia and Trait Anxiety
Miu, Andrei C.; Heilman, Renata M.; Opre, Adrian; Miclea, Mircea
2005-01-01
Emotional arousal can both enhance and impair memory. Considering that both emotional memory and trait anxiety (TA) have been associated with adrenergic activity, the authors investigated whether there is an association between 2 opposite emotional memory biases and the TA. The authors used a procedure recently put forward by B. A. Strange, R.…
-
Directory of Open Access Journals (Sweden)
Stela McLachlan
Full Text Available Red blood cell (RBC traits are routinely measured in clinical practice as important markers of health. Deviations from the physiological ranges are usually a sign of disease, although variation between healthy individuals also occurs, at least partly due to genetic factors. Recent large scale genetic studies identified loci associated with one or more of these traits; further characterization of known loci and identification of new loci is necessary to better understand their role in health and disease and to identify potential molecular mechanisms. We performed meta-analysis of Metabochip association results for six RBC traits-hemoglobin concentration (Hb, hematocrit (Hct, mean corpuscular hemoglobin (MCH, mean corpuscular hemoglobin concentration (MCHC, mean corpuscular volume (MCV and red blood cell count (RCC-in 11 093 Europeans from seven studies of the UCL-LSHTM-Edinburgh-Bristol (UCLEB Consortium. We identified 394 non-overlapping SNPs in five loci at genome-wide significance: 6p22.1-6p21.33 (with HFE among others, 6q23.2 (with HBS1L among others, 6q23.3 (contains no genes, 9q34.3 (only ABO gene and 22q13.1 (with TMPRSS6 among others, replicating previous findings of association with RBC traits at these loci and extending them by imputation to 1000 Genomes. We further characterized associations between ABO SNPs and three traits: hemoglobin, hematocrit and red blood cell count, replicating them in an independent cohort. Conditional analyses indicated the independent association of each of these traits with ABO SNPs and a role for blood group O in mediating the association. The 15 most significant RBC-associated ABO SNPs were also associated with five cardiometabolic traits, with discordance in the direction of effect between groups of traits, suggesting that ABO may act through more than one mechanism to influence cardiometabolic risk.
-
QTL Analysis of Major Agronomic Traits in Soybean
Institute of Scientific and Technical Information of China (English)
CHEN Qing-shan; ZHANG Zhong-chen; LIU Chun-yan; XIN Da-wei; QIU Hong-mei; SHAN Da-peng; SHAN Cai-yun; HU Guo-hua
2007-01-01
Soybean is a main crop, and most agronomic traits of soybean are quantitative; therefore, there is very important studying and applying value to locating these traits. A F2:10 RIL population containing 154 lines, derived from the cross between Charleston as female and Dongnong 594 as male parent, were used in this experiment. A genetic linkage map was constructed with 164 SSR primers, which were screened with the two parents and amplified on the 154 lines. 12 agronomic traits different between the two parents were investigated, and QTLs of all the traits were analyzed using the software Windows QTL Cartographer V2.0. The agronomic traits included quality traits: protein content, oil content, and content of protein and oil; yield traits: pods per plant, seed weight per plant, arnd 100 seeds weight; and other agronomic traits: plant height, days to maturity, branches, nod number in main stem, average leaf length, and average leaf width. The results showed that 68 QTLs in total were found for the 12 agronomic traits. The number of QTLs per trait varied from 3 for the average leaf width to 11 for 100 seeds weight and plant height, and was 5.8 on average. Good accordance was seen in many QTLs between the results of this study and the results obtained by other similar studies; therefore, these QTLs may be valuable for molecular marker assistant selection in soybean. In this study, 68 major QTLs of 12 important traits of soybean were analyzed.
-
40 CFR Appendix A to Part 191 - Table for Subpart B
2010-07-01
... the definition of high-level waste in the NWPA); (d) Each 1,000,000 curies of other radionuclides (i.e... Commission as high-level radioactive waste in accordance with part B of the definition of high-level waste in... PROGRAMS ENVIRONMENTAL RADIATION PROTECTION STANDARDS FOR MANAGEMENT AND DISPOSAL OF SPENT NUCLEAR FUEL...
-
Perceived Personality Traits of Individuals with Anorexia Nervosa
Watters, Jessica E.; Malouff, John M.
2012-01-01
Background: Prior research has found evidence of a general negative personality stereotype for individuals who have anorexia nervosa (AN). Methods: This study examined the expected personality characteristics of individuals with AN using the Five-Factor Model of personality to allow identification of specific personality traits that are part of…
-
Advanced complex analysis a comprehensive course in analysis, part 2b
Simon, Barry
2015-01-01
A Comprehensive Course in Analysis by Poincaré Prize winner Barry Simon is a five-volume set that can serve as a graduate-level analysis textbook with a lot of additional bonus information, including hundreds of problems and numerous notes that extend the text and provide important historical background. Depth and breadth of exposition make this set a valuable reference source for almost all areas of classical analysis. Part 2B provides a comprehensive look at a number of subjects of complex analysis not included in Part 2A. Presented in this volume are the theory of conformal metrics (includ
-
Directory of Open Access Journals (Sweden)
Soshma Jan
2015-06-01
Full Text Available An experiment comprising of 24 wheat genotypes was undertaken during 2011-12, at New Developmental Research Farm, The University of Agriculture Peshawar, to elucidate information on the nature and magnitude of genetic variability, index of transmissibility and assessing the level of genetic improvement of the quantitative characters. The experimental material comprising 19 F3 populations along with their 5 parents of bread wheat were evaluated in randomized complete block design (RCBD with three replications. Analysis of variance exhibited highly significant (P ≤ 0.01 differences among genotypes for all the traits studied. F3 population Ghaznavi-98 x Pirsabak-05 showed maximum mean value for 1000-grain weight (47.3 g and biological yield (11474.9 kg ha-1, whereas, maximum values for grain yield (4027.3 kg ha-1, and harvest index (48.1% were observed for Pirsabak-05 x AUP-4006. Moreover, maximum spike length (11 cm was recorded for cross combination Pirsabak-05 x Pirsabak-04 and Janbaz x Pirsabak-05, respectively. In addition, Pirsabak-04 showed maximum value for number of grains spike-1 (55.0. Genetic variances were of greater magnitude than environmental variances for all the traits except for spike length and 1000-grain weight. Heritability estimates were of higher magnitude ranged from 0.64 to 0.92 for harvest index, biological yield, grain yield, and grains spike-1. Moderate to low heritability (0.40-0.46 was observed for 1000-grain weight, and spike length, respectively. Genetic gain was for spike length (0.48 cm, grains spike-1 (8.57, 1000-grain weight (2.93 g, grain yield (639.87 kg ha-1, biological yield (1790.03 kg ha-1, and harvest index (5.32 %. From high values of heritability and genetic advance, it could be concluded that selection for traits like grains spike-1 suggested good selection criteria and could be effective for future breeding programs. DOI: http://dx.doi.org/10.3126/ije.v4i2.12630 International Journal of Environment
-
Meta-analysis of Big Five personality traits in autism spectrum disorder.
Lodi-Smith, Jennifer; Rodgers, Jonathan D; Cunningham, Sara A; Lopata, Christopher; Thomeer, Marcus L
2018-04-01
The present meta-analysis synthesizes the emerging literature on the relationship of Big Five personality traits to autism spectrum disorder. Studies were included if they (1) either (a) measured autism spectrum disorder characteristics using a metric that yielded a single score quantification of the magnitude of autism spectrum disorder characteristics and/or (b) studied individuals with an autism spectrum disorder diagnosis compared to individuals without an autism spectrum disorder diagnosis and (2) measured Big Five traits in the same sample or samples. Fourteen reviewed studies include both correlational analyses and group comparisons. Eighteen effect sizes per Big Five trait were used to calculate two overall effect sizes per trait. Meta-analytic effects were calculated using random effects models. Twelve effects (per trait) from nine studies reporting correlations yielded a negative association between each Big Five personality trait and autism spectrum disorder characteristics (Fisher's z ranged from -.21 (conscientiousness) to -.50 (extraversion)). Six group contrasts (per trait) from six studies comparing individuals diagnosed with autism spectrum disorder to neurotypical individuals were also substantial (Hedges' g ranged from -.88 (conscientiousness) to -1.42 (extraversion)). The potential impact of personality on important life outcomes and new directions for future research on personality in autism spectrum disorder are discussed in light of results.
-
Autistic and schizotypal traits and global functioning in bipolar I disorder.
Abu-Akel, Ahmad; Clark, Jennifer; Perry, Amy; Wood, Stephen J; Forty, Liz; Craddock, Nick; Jones, Ian; Gordon-Smith, Katherine; Jones, Lisa
2017-01-01
To determine the expression of autistic and positive schizotypal traits in a large sample of adults with bipolar I disorder (BD I), and the effect of co-occurring autistic and positive schizotypal traits on global functioning in BD I. Autistic and positive schizotypal traits were self-assessed in 797 individuals with BD-I recruited by the Bipolar Disorder Research Network. Differences in global functioning (rated using the Global Assessment Scale) during lifetime worst depressive and manic episodes (GASD and GASM respectively) were calculated in groups with high/low autistic and positive schizotypal traits. Regression analyses assessed the interactive effect of autistic and positive schizotypal traits on global functioning. 47.2% (CI=43.7-50.7%) showed clinically significant levels of autistic traits, and 23.22% (95% CI=20.29-26.14) showed clinically significant levels of positive schizotypal traits. In the worst episode of mania, the high autistic, high positive schizotypal group had better global functioning compared to the other groups. Individual differences analyses showed that high levels of both traits were associated with better global functioning in both mood states. Autistic and schizotypal traits were assessed using self-rated questionnaires. Expression of autistic and schizotypal traits in adults with BD I is prevalent, and may be important to predict illness aetiology, prognosis, and diagnostic practices in this population. Future work should focus on replicating these findings in independent samples, and on the biological and/or psychosocial mechanisms underlying better global functioning in those who have high levels of both autistic and positive schizotypal traits. Copyright © 2016 Elsevier B.V. All rights reserved.
-
Heritability of semen traits in German Warmblood stallions.
Gottschalk, M; Sieme, H; Martinsson, G; Distl, O
2016-07-01
The objectives of the present study were to evaluate genetic parameters for semen quality traits of 241 fertile German Warmblood stallions regularly employed in artificial insemination (AI). Stallions were owned by the National Studs Celle and Warendorf in Germany. Semen traits analyzed were gel-free volume, sperm concentration, total number of sperm, progressive motility and total number of progressively motile sperm. Semen protocols from a total of 63,972 ejaculates were collected between the years 2001 and 2014 for the present analysis. A multivariate linear animal model was employed for estimation of additive genetic and permanent environmental variances among stallions and breeding values (EBVs) for semen traits. Heritabilities estimated for all German Warmblood stallions were highest for gel-free volume (h(2)=0.28) and lowest for total number of progressively motile sperm (h(2)=0.13). The additive genetic correlation among gel-free volume and sperm concentration was highly negative (rg=-0.76). Average reliabilities of EBVs were at 0.37-0.68 for the 241 stallions with own records. The inter-stallion variance explained between 33 and 61% of the trait variance, underlining the major impact of the individual stallion on semen quality traits analyzed here. Recording of semen traits from stallions employed in AI may be recommended because EBVs achieve sufficient accuracies to improve semen quality in future generations. Due to favorable genetic correlations, sperm concentration, total number of sperm and total number of progressively motile sperm may be increased simultaneously. Copyright © 2016 Elsevier B.V. All rights reserved.
-
Directory of Open Access Journals (Sweden)
M.R. Zadeh Esfahlan
2014-07-01
Full Text Available To study the effects of nitrogen and zinc fertilizer on the morphological traits and essential oil yield of St. John’s wort (Hypericum perforatum a greenhouse experiment in a factorial randomized complete block design with three replications was conducted at University of Tabriz, Iran in 2012. Treatments consisted of three levels of zinc sulphate with a concentration of zinc fertilizer (zero, 3 and 6 parts per thousand and four levels of nitrogen fertilizer (zero, 50, 100, 150 kg/ha. One half of the fertilizers were applied 20 days after planting of plants and the rest 40 days after transplanting. Traits evaluated were plant height, inflorescence number, leaf area, plant fresh and dry weights and plant essential oil content. The results showed that the traits under study were affected by rate of fertilizer applications. Highest plant height, number of inflorescences, leaf area and essential oil yield were obtained by using 150 kg/ha of nitrogen and applying zinc with 0.006 concentration. Highest fresh and dry weights of above ground parts were also produced by using 150 kg/ha of nitrogen fertilizer along with zinc fertilizer 0.003.
-
Neuropsychology and neuropharmacology of P3a and P3b.
Polich, John; Criado, José R
2006-05-01
Perspectives on the P300 event-related brain potential (ERP) are reviewed by outlining the distinction between the P3a and P3b subcomponents. The critical factor for eliciting P3a is how target/standard discrimination difficulty rather than novelty modulates task processing. The neural loci of P3a and P3b generation are sketched and a theoretical model is developed. P3a originates from stimulus-driven disruption of frontal attention engagement during task processing. P3b originates when temporal-parietal mechanisms process the stimulus information for memory storage. The neuropharmacological implications of this view are then outlined by evaluating how acute and chronic use of ethanol, marijuana, and nicotine affect P3a and P3b. The findings suggest that the circuit underlying ERP generation is influenced in a different ways for acute intake and varies between chronic use levels across drugs. Theoretical implications are assessed.
-
Political Attitudes Develop Independently of Personality Traits
Hatemi, Peter K.; Verhulst, Brad
2015-01-01
The primary assumption within the recent personality and political orientations literature is that personality traits cause people to develop political attitudes. In contrast, research relying on traditional psychological and developmental theories suggests the relationship between most personality dimensions and political orientations are either not significant or weak. Research from behavioral genetics suggests the covariance between personality and political preferences is not causal, but due to a common, latent genetic factor that mutually influences both. The contradictory assumptions and findings from these research streams have yet to be resolved. This is in part due to the reliance on cross-sectional data and the lack of longitudinal genetically informative data. Here, using two independent longitudinal genetically informative samples, we examine the joint development of personality traits and attitude dimensions to explore the underlying causal mechanisms that drive the relationship between these features and provide a first step in resolving the causal question. We find change in personality over a ten-year period does not predict change in political attitudes, which does not support a causal relationship between personality traits and political attitudes as is frequently assumed. Rather, political attitudes are often more stable than the key personality traits assumed to be predicting them. Finally, the results from our genetic models find that no additional variance is accounted for by the causal pathway from personality traits to political attitudes. Our findings remain consistent with the original construction of the five-factor model of personality and developmental theories on attitude formation, but challenge recent work in this area. PMID:25734580
-
Political attitudes develop independently of personality traits.
Hatemi, Peter K; Verhulst, Brad
2015-01-01
The primary assumption within the recent personality and political orientations literature is that personality traits cause people to develop political attitudes. In contrast, research relying on traditional psychological and developmental theories suggests the relationship between most personality dimensions and political orientations are either not significant or weak. Research from behavioral genetics suggests the covariance between personality and political preferences is not causal, but due to a common, latent genetic factor that mutually influences both. The contradictory assumptions and findings from these research streams have yet to be resolved. This is in part due to the reliance on cross-sectional data and the lack of longitudinal genetically informative data. Here, using two independent longitudinal genetically informative samples, we examine the joint development of personality traits and attitude dimensions to explore the underlying causal mechanisms that drive the relationship between these features and provide a first step in resolving the causal question. We find change in personality over a ten-year period does not predict change in political attitudes, which does not support a causal relationship between personality traits and political attitudes as is frequently assumed. Rather, political attitudes are often more stable than the key personality traits assumed to be predicting them. Finally, the results from our genetic models find that no additional variance is accounted for by the causal pathway from personality traits to political attitudes. Our findings remain consistent with the original construction of the five-factor model of personality and developmental theories on attitude formation, but challenge recent work in this area.
-
A guide: sale of power opportunities for distributed generators. Part B. The guide
Energy Technology Data Exchange (ETDEWEB)
NONE
2005-07-01
This report is Part B of a series of three produced to help prospective distributed generators familiarise themselves with the electricity market in Great Britain (England, Scotland and Wales) and to assist potential generators to identify options for the sale of their electrical output. Part A is an introductory guide and Part C lists sources of further information, useful contact details and a glossary. Part B covers the key issues in some depth and is designed for those with some background knowledge. It examines: the electricity supply industry in Great Britain including the physical and commercial electricity supply chains and the commercial arrangements for trading; the legislative framework including networks, price controls, licensing and exemptions; the value of power produced by small generators including factors affecting the value of power, wholesale market value, Renewables Obligation Certificates (ROCs), Climate Change Levy exemption certificates and the EU Emissions Trading Scheme; options for the sale of power including market trading, supplier and consolidator contracts, exempt and licensed supply, and finance; and the costs and benefits of power sales options including the initial and ongoing costs of selling power.
-
Halveti-Şâbânî Şeyhi Mustafa Kemâleddîn Bekrî ve Hediyyetü’l-Ahbâb Adlı Eseri
Directory of Open Access Journals (Sweden)
Halim Gül
2013-03-01
Full Text Available AbstractThis article studies the life and woks of Kemaleddin Bekrî, who affiliated himself to Khalvati-Shabani Sheikh Abdullatîf b. Hüsameddîn el-Halebî, and who was growed up under Abd al-Ghani al-Nabulsi’s control. His work “Hadiyyat al-Ahbab fi ma li’l-Khalveti min al-Şuruti va’l-Adab”, which explains the conditions and rules of “khalvet” was also studied. The work consists of preface, eight parts and an epilogue and all parts examined in detail.ÖzetBu makalede, Abdülganî Nablusî’nin (ö.1143/1730 gözetiminde yetişen, halvetî-Şabânî şeyhi Abdullatîf b. Hüsameddîn el-Halebî’ye intisap eden Mustafa Kemaleddin Bekrî’nin hayatı ve eserleri incelenmiştir. Bu çerçevede onun tasavvufi bir kavram olan halvetin âdab ve şartlarını izah eden “Hediyyetü’l ahbâb fî mâ li’l-halveti mine’ş-şurûti ve’l-âdâb” adlı risalesinin incelenmesi ve değerlendirmesi üzerinde durulmuştur. Söz konusu eser, mukaddime sekiz bölüm ve bir hatimeden oluşmaktadır.Le Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî et son Traité qui s’intitule Hadiyya al-ahbâbRésuméDans cet article, on va étudier d’abord la vie et les œuvres du Shaykh Khalwatî-Sha‘bânî Mustafâ Kamâl al-Dîn Bakrî qui a été éduqué par le célèbre soufi ‘Abd al-Ghanî Nablûsî (m. 1143/1730 et a été initié par ‘Abd al-Latîf b. Husâm al-Dîn al-Halabî. Puis, plus particulièrement, on va analyser son traité qui s’intitule ‘Hadiyya al-ahbâb fî mâ li’l-khalwatî min al-shurût wa’l-âdâb’. Ce traité – qui a été composé de dix-huit chapitres et d’une conclusion – étudie les convenances et les conditions de la retraite spirituelle, khalwa, une des notions soufies importantes
-
The split-sting trait in Apis mellifera induced by cobalt 60 gamma radiation
International Nuclear Information System (INIS)
Silva, Vera Lucia Maciel
1993-01-01
The Split-Sting (SS) trait in honey bees, induced by gamma radiation, was discovered by Soares (1975). Bees with this trait are unable to sting, because the parts that compose the sting are separated. Many studies have been done in order to understand this new mutation. We studied the effect of gamma radiation on induction of the SS trait in feral bee strains. The doses were applied to the phase of larvae of queens with 5 days old. The following results were obtained: all doses of radiation induced the SS trait. There was an increase in the percentage of queens with SS with an increase in radiation dose; the SS trait induced by radiation is probably phenocopy; SS bees were observed in nature; increase of the rate mortality and malformation with an increase in radiation dose. (author)
-
47 CFR Appendix B to Part 400 - Initial Certification for E-911 Grant Applicants
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Initial Certification for E-911 Grant... ADMINISTRATION, DEPARTMENT OF COMMERCE, AND NATIONAL HIGHWAY TRAFFIC SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION E-911 GRANT PROGRAM Pt. 400, App. B Appendix B to Part 400—Initial Certification for E-911 Grant...
-
Directory of Open Access Journals (Sweden)
Ruixiang Liu
Full Text Available The yield of maize grain is a highly complex quantitative trait that is controlled by multiple quantitative trait loci (QTLs with small effects, and is frequently influenced by multiple genetic and environmental factors. Thus, it is challenging to clone a QTL for grain yield in the maize genome. Previously, we identified a major QTL, qKNPR6, for kernel number per row (KNPR across multiple environments, and developed two nearly isogenic lines, SL57-6 and Ye478, which differ only in the allelic constitution at the short segment harboring the QTL. Recently, qKNPR6 was re-evaluated in segregating populations derived from SL57-6×Ye478, and was narrowed down to a 2.8 cM interval, which explained 56.3% of the phenotypic variance of KNPR in 201 F(2∶3 families. The QTL simultaneously affected ear length, kernel weight and grain yield. Furthermore, a large F(2 population with more than 12,800 plants, 191 recombinant chromosomes and 10 overlapping recombinant lines placed qKNPR6 into a 0.91 cM interval corresponding to 198Kb of the B73 reference genome. In this region, six genes with expressed sequence tag (EST evidence were annotated. The expression pattern and DNA diversity of the six genes were assayed in Ye478 and SL57-6. The possible candidate gene and the pathway involved in inflorescence development were discussed.
-
Quantitative trait locus (QTL) analysis of pod related traits in different ...
African Journals Online (AJOL)
Administrator
2011-09-26
Sep 26, 2011 ... assistant breeding selection. Key words: Soybean, pod traits, QTL, different environments. INTRODUCTION. Yield related traits in soybean are generally controlled by multiple genes and environmental dependent (Kwon and. Torrie, 1964). Epigenetics of genes controlling these traits also affect the yield.
-
Meng, Ge; Zheng, Meilin; Wang, Mei; Tong, Jing; Ge, Weijuan; Zhang, Jiehe; Zheng, Aqun; Li, Jingya; Gao, Lixin; Li, Jia
2016-10-21
A new series of 2-substituted imino-3-substituted-5- heteroarylidene-1,3-thiazolidine-4-ones as the potent bidentate PTP1B inhibitors were designed and synthesized in this paper. All of the new compounds were characterized and identified by spectra analysis. The biological screening test against PTP1B showed that some of these compounds have the positive inhibitory activity against PTP1B. The activity of the compounds with 5-substituted pyrrole on 5-postion of 1,3-thiazolidine-4-one are more potent than that of those compounds with 5-substituted pyridine group. Compound 14b, 14h and 14i showed IC50 values of 8.66 μM, 6.83 μM and 6.09 μM against PTP1B, respectively. Docking analysis of these active compounds with PTP1B showed the possible interaction modes of these biheterocyclic compounds with the active sites of PTP1B. The inhibition tests against oncogenetic CDC25B were also conducted on this set of compounds to evaluate the selectivity and possible anti-neoplastic activity. Compound 14b also showed the lowest IC50 of 1.66 μM against CDC25B among all the possible inhibitors, including 14g, 14h, 14i and 15c. Some pharmacological parameters including VolSurf, steric and electric descriptors of all the compounds were calculated to give some hints about the relative relationship with the biological activity. The result of this study might give some light on designing the possible anti-cancer drugs targeting at phosphatases. The most active compound 14i might be used as the lead compound for further structure modification of the new low molecular weight PTP1B inhibitors with the N-containing heterocyclic skeleton. Copyright © 2016. Published by Elsevier Masson SAS.
-
Clinicians' Judgments of the Clinical Utility of Personality Disorder Trait Descriptions.
Crego, Cristina; Sleep, Chelsea E; Widiger, Thomas A
2016-01-01
Proposed for the Diagnostic and Statistical Manual of Mental Disorders, 5th Edition (DSM-5) was a five-domain, 25-dimensional trait model that would have constituted a significant part of the diagnostic criteria for each personality disorder. A primary concern with respect to the proposal was that clinicians might find such an approach to be unacceptable. This study provides results from three independent data collections that compared clinicians' clinical utility ratings for each iteration of the DSM-5 dimensional trait assignments, along with an alternative list of traits derived from the Five Factor Form (FFF). The clinicians considered the final trait assignments that were posted for the avoidant, narcissistic, obsessive-compulsive, and schizoid personality disorders to be significantly less acceptable than the original assignments. They also considered the FFF trait assignments to be preferable to the DSM-5 final postings with respect to the avoidant, narcissistic, obsessive-compulsive, dependent, and histrionic personality disorders. The implications of these results for future editions of the diagnostic manual are discussed.
-
Personality Traits, Ego Development, and the Redemptive Self.
Guo, Jen; Klevan, Miriam; McAdams, Dan P
2016-09-20
Life narratives are the internalized stories that people construct to provide meaning, purpose, and coherence in their lives. Prior research suggests that psychologically healthy and socially engaged adults generally narrate their lives in a prototypical fashion labeled the redemptive self, consisting of five themes: (a) a sense of childhood advantage, (b) empathy for others' sufferings, (c) moral steadfastness, (d) turning of negative events into positive outcomes (redemption sequences), and (e) prosocial goals. The current study examines trait correlates of the redemptive self in 157 late-midlife adults. Summing thematic scores across 12 life story interview scenes, the redemptive self was positively associated with four of the Big Five traits: extraversion, conscientiousness, agreeableness, and emotional stability, but unrelated to cognitive features of personality, as assessed on openness and ego development. The findings suggest those with positive socio-emotional personality traits, but not necessarily a proclivity for sophisticated thoughts, tend to have redemptive life stories. © 2016 by the Society for Personality and Social Psychology, Inc.
-
Plant traits as indicators: loss or gain of information?
Czech Academy of Sciences Publication Activity Database
de Bello, Francesco; Mudrák, Ondřej
2013-01-01
Roč. 16, č. 3 (2013), s. 353-354 ISSN 1402-2001 Institutional support: RVO:67985939 Keywords : plant traits * taxonomic indicators * plant traits Subject RIV: EH - Ecology, Behaviour Impact factor: 2.416, year: 2013
-
A Revised Mechanism for the Activation of Complement C3 to C3b
Rodriguez, Elizabeth; Nan, Ruodan; Li, Keying; Gor, Jayesh; Perkins, Stephen J.
2015-01-01
The solution structure of complement C3b is crucial for the understanding of complement activation and regulation. C3b is generated by the removal of C3a from C3. Hydrolysis of the C3 thioester produces C3u, an analog of C3b. C3b cleavage results in C3c and C3d (thioester-containing domain; TED). To resolve functional questions in relation to C3b and C3u, analytical ultracentrifugation and x-ray and neutron scattering studies were used with C3, C3b, C3u, C3c, and C3d, using the wild-type allotype with Arg102. In 50 mm NaCl buffer, atomistic scattering modeling showed that both C3b and C3u adopted a compact structure, similar to the C3b crystal structure in which its TED and macroglobulin 1 (MG1) domains were connected through the Arg102–Glu1032 salt bridge. In physiological 137 mm NaCl, scattering modeling showed that C3b and C3u were both extended in structure, with the TED and MG1 domains now separated by up to 6 nm. The importance of the Arg102–Glu1032 salt bridge was determined using surface plasmon resonance to monitor the binding of wild-type C3d(E1032) and mutant C3d(A1032) to immobilized C3c. The mutant did not bind, whereas the wild-type form did. The high conformational variability of TED in C3b in physiological buffer showed that C3b is more reactive than previously thought. Because the Arg102-Glu1032 salt bridge is essential for the C3b-Factor H complex during the regulatory control of C3b, the known clinical associations of the major C3S (Arg102) and disease-linked C3F (Gly102) allotypes of C3b were experimentally explained for the first time. PMID:25488663
-
The person within: memory codes for persons and traits using fMRI repetition suppression.
Heleven, Elien; Van Overwalle, Frank
2016-01-01
Neuroimaging studies on trait inference demonstrated that the ventral medial prefrontal cortex (mPFC) houses neural representations of memory codes for traits . In this study, we investigate the neural code not only of traits, but also of persons who exemplify these traits. We used repetition suppression, which is a rapid suppression of the neuroimaging signal upon repeated presentation of the same stimulus or core stimulus characteristics-in this case, the implied trait and person. Participants inferred familiar person's traits. At each trial, a critical (target) sentence described a behavior that implied a trait, and was preceded by a (prime) sentence that implied the same trait and portrayed the same person, the same trait but portrayed a different person or did not imply a trait and portrayed a different person. As predicted, we found partly overlapping repetition suppression areas in the ventral mPFC when persons and traits were repeated, indicating that not only traits but also familiar persons have a neural code in the ventral mPFC. We also found a negative correlation between activation when reading about a new person and participants' social network size, indicating that experience with larger social groups results in less recruitment of a person code. © The Author (2015). Published by Oxford University Press. For Permissions, please email: journals.permissions@oup.com.
-
Brand, B; Baes, C; Mayer, M; Reinsch, N; Seidenspinner, T; Thaller, G; Kühn, Ch
2010-03-01
Linkage, linkage disequilibrium, and combined linkage and linkage disequilibrium analyses were performed to map quantitative trait loci (QTL) affecting calving and conformation traits on Bos taurus autosome 18 (BTA18) in the German Holstein population. Six paternal half-sib families consisting of a total of 1,054 animals were genotyped on 28 genetic markers in the telomeric region on BTA18 spanning approximately 30 Mb. Calving traits, body type traits, and udder type traits were investigated. Using univariately estimated breeding values, maternal and direct effects on calving ease and stillbirth were analyzed separately for first- and further-parity calvings. The QTL initially identified by separate linkage and linkage disequilibrium analyses could be confirmed by a combined linkage and linkage disequilibrium analysis for udder composite index, udder depth, fore udder attachment, front teat placement, body depth, rump angle, and direct effects on calving ease and stillbirth. Concurrence of QTL peaks and a similar shape of restricted log-likelihood ratio profiles were observed between udder type traits and for body depth and calving traits, respectively. Association analyses were performed for markers flanking the most likely QTL positions by applying a mixed model including a fixed allele effect of the maternally inherited allele and a random polygenic effect. Results indicated that microsatellite marker DIK4234 (located at 53.3 Mb) is associated with maternal effects on stillbirth, direct effects on calving ease, and body depth. A comparison of effects for maternally inherited DIK4234 alleles indicated a favorable, positive correlation of maternal and direct effects on calving. Additionally, the association of maternally inherited DIK4234 marker alleles with body depth implied that conformation traits might provide the functional background of the QTL for calving traits. For udder type traits, the strong coincidence of QTL peaks and the position of the QTL in a
-
Busch, Franziska; Mobasheri, Ali; Shayan, Parviz; Lueders, Cora; Stahlmann, Ralf; Shakibaei, Mehdi
2012-01-01
Resveratrol, an activator of histone deacetylase Sirt-1, has been proposed to have beneficial health effects due to its antioxidant and anti-inflammatory properties. However, the mechanisms underlying the anti-inflammatory effects of resveratrol and the intracellular signaling pathways involved are poorly understood. An in vitro model of human tenocytes was used to examine the mechanism of resveratrol action on IL-1β-mediated inflammatory signaling. Resveratrol suppressed IL-1β-induced activation of NF-κB and PI3K in a dose- and time-dependent manner. Treatment with resveratrol enhanced the production of matrix components collagen types I and III, tenomodulin, and tenogenic transcription factor scleraxis, whereas it inhibited gene products involved in inflammation and apoptosis. IL-1β-induced NF-κB and PI3K activation was inhibited by resveratrol or the inhibitors of PI3K (wortmannin), c-Src (PP1), and Akt (SH-5) through inhibition of IκB kinase, IκBα phosphorylation, and inhibition of nuclear translocation of NF-κB, suggesting that PI3K signaling pathway may be one of the signaling pathways inhibited by resveratrol to abrogate NF-κB activation. Inhibition of PI3K by wortmannin attenuated IL-1β-induced Akt and p65 acetylation, suggesting that p65 is a downstream component of PI3K/Akt in these responses. The modulatory effects of resveratrol on IL-1β-induced activation of NF-κB and PI3K were found to be mediated at least in part by the association between Sirt-1 and scleraxis and deacetylation of NF-κB and PI3K. Overall, these results demonstrate that activated Sirt-1 plays an essential role in the anti-inflammatory effects of resveratrol and this may be mediated at least in part through inhibition/deacetylation of PI3K and NF-κB. PMID:22936809
-
Rueffler, Claus
2006-01-01
The course of evolution is restricted by constraints. A special type of constraint is a trade-off where different traits are negatively correlated. In this situation a mutant type that shows an improvement in one trait suffers from a decreased performance through another trait. In a fixed fitness
-
Bokore, Firdissa E; Cuthbert, Richard D; Knox, Ron E; Randhawa, Harpinder S; Hiebert, Colin W; DePauw, Ron M; Singh, Asheesh K; Singh, Arti; Sharpe, Andrew G; N'Diaye, Amidou; Pozniak, Curtis J; McCartney, Curt; Ruan, Yuefeng; Berraies, Samia; Meyer, Brad; Munro, Catherine; Hay, Andy; Ammar, Karim; Huerta-Espino, Julio; Bhavani, Sridhar
2017-12-01
Quantitative trait loci controlling stripe rust resistance were identified in adapted Canadian spring wheat cultivars providing opportunity for breeders to stack loci using marker-assisted breeding. Stripe rust or yellow rust, caused by Puccinia striiformis Westend. f. sp. tritici Erikss., is a devastating disease of common wheat (Triticum aestivum L.) in many regions of the world. The objectives of this research were to identify and map quantitative trait loci (QTL) associated with stripe rust resistance in adapted Canadian spring wheat cultivars that are effective globally, and investigate opportunities for stacking resistance. Doubled haploid (DH) populations from the crosses Vesper/Lillian, Vesper/Stettler, Carberry/Vesper, Stettler/Red Fife and Carberry/AC Cadillac were phenotyped for stripe rust severity and infection response in field nurseries in Canada (Lethbridge and Swift Current), New Zealand (Lincoln), Mexico (Toluca) and Kenya (Njoro), and genotyped with SNP markers. Six QTL for stripe rust resistance in the population of Vesper/Lillian, five in Vesper/Stettler, seven in Stettler/Red Fife, four in Carberry/Vesper and nine in Carberry/AC Cadillac were identified. Lillian contributed stripe rust resistance QTL on chromosomes 4B, 5A, 6B and 7D, AC Cadillac on 2A, 2B, 3B and 5B, Carberry on 1A, 1B, 4A, 4B, 7A and 7D, Stettler on 1A, 2A, 3D, 4A, 5B and 6A, Red Fife on 2D, 3B and 4B, and Vesper on 1B, 2B and 7A. QTL on 1A, 1B, 2A, 2B, 3B, 4A, 4B, 5B, 7A and 7D were observed in multiple parents. The populations are compelling sources of recombination of many stripe rust resistance QTL for stacking disease resistance. Gene pyramiding should be possible with little chance of linkage drag of detrimental genes as the source parents were mostly adapted cultivars widely grown in Canada.
-
Trait-specific dependence in romantic relationships.
Ellis, Bruce J; Simpson, Jeffry A; Campbell, Lorne
2002-10-01
Informed by three theoretical frameworks--trait psychology, evolutionary psychology, and interdependence theory--we report four investigations designed to develop and test the reliability and validity of a new construct and accompanying multiscale inventory, the Trait-Specific Dependence Inventory (TSDI). The TSDI assesses comparisons between present and alternative romantic partners on major dimensions of mate value. In Study 1, principal components analyses revealed that the provisional pool of theory-generated TSDI items were represented by six factors: Agreeable/Committed, Resource Accruing Potential, Physical Prowess, Emotional Stability, Surgency, and Physical Attractiveness. In Study 2, confirmatory factor analysis replicated these results on a different sample and tested how well different structural models fit the data. Study 3 provided evidence for the convergent and discriminant validity of the six TSDI scales by correlating each one with a matched personality trait scale that did not explicitly incorporate comparisons between partners. Study 4 provided further validation evidence, revealing that the six TSDI scales successfully predicted three relationship outcome measures--love, time investment, and anger/upset--above and beyond matched sets of traditional personality trait measures. These results suggest that the TSDI is a reliable, valid, and unique construct that represents a new trait-specific method of assessing dependence in romantic relationships. The construct of trait-specific dependence is introduced and linked with other theories of mate value.
-
Examining Dark Triad traits in relation to mental toughness and physical activity in young adults
Directory of Open Access Journals (Sweden)
Sabouri S
2016-01-01
Full Text Available Sarah Sabouri,1 Markus Gerber,2 Dena Sadeghi Bahmani,3 Sakari Lemola,4 Peter J Clough,5 Nadeem Kalak,3 Mahin Shamsi,1 Edith Holsboer-Trachsler,3 Serge Brand2,3 1Faculty of Educational Sciences and Psychology, AllamehTabataba’i University, Tehran, Iran; 2Department of Sport, Exercise and Health, Sport Science Section, University of Basel, 3Center for Affective, Stress and Sleep Disorders, Psychiatric Clinics of the University of Basel, 4Faculty of Psychology, University of Basel, Basel, Switzerland; 5Department of Psychology, Manchester Metropolitan University, Manchester, UK Objective: The Dark Triad (DT describes a set of three closely related personality traits: Machiavellianism, narcissism, and psychopathy. Mental toughness (MT refers to a psychological construct combining confidence, commitment, control, and challenge. High MT is related to greater physical activity (PA and, relative to men, women have lower MT scores. The aims of the present study were 1 to investigate the association between DT, MT, and PA, and 2 to compare the DT, MT, and PA scores of men and women.Methods: A total of 341 adults (M=29 years; 51.6% women; range: 18–37 years took part in the study. Participants completed a series of questionnaires assessing DT, MT, and PA.Results: Machiavellianism, narcissism, and psychopathy were all significantly associated with higher MT scores (rs =0.45, 0.50, and 0.20, respectively. DT traits and MT were associated with more vigorous PA. Compared to men, women participants had lower scores for DT traits (overall score and psychopathy, while no differences were found for MT or PA in both sexes.Conclusion: DT traits, high MT, and vigorous PA are interrelated. This pattern of results might explain why, for instance, successful professional athletes can at the same time be tough and ruthless. Keywords: dark triad, mental toughness, physical activity, young adults, sex
-
Economic values for dairy production traits under different milk ...
African Journals Online (AJOL)
Cuthbert
A well-defined breeding objective forms the basis of a sound breeding programme. .... (ZAR per unit) by breed under different milk payment systems. Milk Buyer. Breed. Trait. A. B. C .... Veerkamp, R.F., Dillon, P., Kelly, A.R. & Groen, A.F., 2002.
-
Associations between animal traits, carcass traits and carcass ...
African Journals Online (AJOL)
In this study the associations between animal traits, carcass traits and carcass classification within cattle, sheep and pigs slaughtered in a high throughput abattoir were determined. Classes of carcasses from cattle, sheep and pigs delivered for slaughter at this abattoir were recorded and analysed. Significant associations ...
-
The superfamily of C3b/C4b-binding proteins
DEFF Research Database (Denmark)
Kristensen, Torsten; D'Eustachio, P; Ogata, R T
1987-01-01
The determination of primary structures by amino acid and nucleotide sequencing for the C3b-and/or C4b-binding proteins H, C4BP, CR1, B, and C2 has revealed the presence of a common structural element. This element is approximately 60 amino acids long and is repeated in a tandem fashion, commencing...... at the amino-terminal end of each molecule. Two other complement components, C1r and C1s, have two of these repeating units in the carboxy-terminal region of their noncatalytic A chains. Three noncomplement proteins, beta 2-glycoprotein I (beta 2I), the interleukin 2 receptor (IL 2 receptor), and the b chain...... of factor XIII, have 4, 2 and 10 of these repeating units, respectively. These proteins obviously belong to the above family, although there is no evidence that they interact with C3b and/or C4b. Human haptoglobin and rat leukocyte common antigen also contain two and three repeating units, respectively...
-
interrelationships between grain yield and other physiological traits
African Journals Online (AJOL)
Prof. Adipala Ekwamu
Combined analysis of variance, cluster analysis and genotype-by- ... all phenological and morphological traits, except grain yield and associated yield components. ... egg, and other protein-rich foods (Alghali, 1991). ... systematic modelling approach. ... MD IT98 K -132 – 3 .... traits based on Principal Component axes (PC)1.
-
Genomic Regions Influencing Seminal Root Traits in Barley
Directory of Open Access Journals (Sweden)
Hannah Robinson
2016-03-01
Full Text Available Water availability is a major limiting factor for crop production, making drought adaptation and its many component traits a desirable attribute of plant cultivars. Previous studies in cereal crops indicate that root traits expressed at early plant developmental stages, such as seminal root angle and root number, are associated with water extraction at different depths. Here, we conducted the first study to map seminal root traits in barley ( L.. Using a recently developed high-throughput phenotyping method, a panel of 30 barley genotypes and a doubled-haploid (DH population (ND24260 × ‘Flagship’ comprising 330 lines genotyped with diversity array technology (DArT markers were evaluated for seminal root angle (deviation from vertical and root number under controlled environmental conditions. A high degree of phenotypic variation was observed in the panel of 30 genotypes: 13.5 to 82.2 and 3.6 to 6.9° for root angle and root number, respectively. A similar range was observed in the DH population: 16.4 to 70.5 and 3.6 to 6.5° for root angle and number, respectively. Seven quantitative trait loci (QTL for seminal root traits (root angle, two QTL; root number, five QTL were detected in the DH population. A major QTL influencing both root angle and root number (/ was positioned on chromosome 5HL. Across-species analysis identified 10 common genes underlying root trait QTL in barley, wheat ( L., and sorghum [ (L. Moench]. Here, we provide insight into seminal root phenotypes and provide a first look at the genetics controlling these traits in barley.
-
Carthy, T R; Ryan, D P; Fitzgerald, A M; Evans, R D; Berry, D P
2016-02-01
The objective of the study was to estimate the genetic relationships between detailed reproductive traits derived from ultrasound examination of the reproductive tract and a range of performance traits in Holstein-Friesian dairy cows. The performance traits investigated included calving performance, milk production, somatic cell score (i.e., logarithm transformation of somatic cell count), carcass traits, and body-related linear type traits. Detailed reproductive traits included (1) resumed cyclicity at the time of examination, (2) multiple ovulations, (3) early ovulation, (4) heat detection, (5) ovarian cystic structures, (6) embryo loss, and (7) uterine score, measured on a 1 (little or no fluid with normal tone) to 4 (large quantity of fluid with a flaccid tone) scale, based on the tone of the uterine wall and the quantity of fluid present in the uterus. (Co)variance components were estimated using a repeatability animal linear mixed model. Genetic merit for greater milk, fat, and protein yield was associated with a reduced ability to resume cyclicity postpartum (genetic correlations ranged from -0.25 to -0.15). Higher genetic merit for milk yield was also associated with a greater genetic susceptibility to multiple ovulations. Genetic predisposition to elevated somatic cell score was associated with a decreased likelihood of cyclicity postpartum (genetic correlation of -0.32) and a greater risk of both multiple ovulations (genetic correlation of 0.25) and embryo loss (genetic correlation of 0.32). Greater body condition score was genetically associated with an increased likelihood of resumption of cyclicity postpartum (genetic correlation of 0.52). Genetically heavier, fatter carcasses with better conformation were also associated with an increased likelihood of resumed cyclicity by the time of examination (genetic correlations ranged from 0.24 to 0.41). Genetically heavier carcasses were associated with an inferior uterine score as well as a greater
-
Raynal, Patrick; Goutaudier, Nelly; Nidetch, Victoria; Chabrol, Henri
2016-12-30
Few typological studies address schizotypy in young adults. Schizotypal traits were assessed on 466 college students using the Schizotypal Personality Questionnaire-Brief (SPQ-B). Other measures evaluated personality traits previously associated with schizotypy (borderline, obsessionnal, and autistic traits), psychopathological symptoms (suicidal ideations, depressive and obsessive-compulsive symptoms) and psychosocial functioning. A factor analysis was first performed on SPQ-B results, leading to four factors: negative schizotypy, positive schizotypy, social anxiety, and reference ideas. Based on these factors, a cluster analysis was conducted, which yielded four clearly distinct groups characterized by "Low" (non schizotypy), "High schizotypy" (mixed positive and negative), "Positive schizotypy", and "Social impairment". Regarding personality disorder traits and psychopathological symptoms, the "High schizotypy" cluster scored higher than the "Positive" and the "Social impairment" groups, which scored higher than the "Low" cluster. The "Positive" group had higher levels of interpersonal relationships than in the "High" and the "Social impairment" clusters, suggesting that positive schizotypy was associated to benefits such as perceived social relationships. Nevertheless the "Positive" cluster was also linked to high levels of personality disorder traits and psychopathological symptoms, and to low academic achievement, at levels similar those observed in the "Social impairment" cluster, confirming an unhealthy side to positive schizotypy. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.
-
1994-06-03
wft*:¥A:ft:i:ft& OFFICE OF THE INSPECTOR GENERAL AV-8B REMANUFACTURE PROGRAM AS PART OF THE AUDIT OF THE DEFENSE ACQUISITION BOARD...Part of the Audit of the Defense Acquisition Board Review Process - FY 1994 B. DATE Report Downloaded From the Internet: 03/23/99 C. Report’s Point...NAVY FOR RESEARCH DEVELOPMENT AND ACQUISITION SUBJECT: Audit Report on the AV-8B Remanufacture Program as Part of the Audit of the Defense
-
Functional traits of urban trees: Air pollution mitigation potential
DEFF Research Database (Denmark)
Grote, Rüdiger; Samson, Roeland; Alonso, Rocío
2016-01-01
In an increasingly urbanized world, air pollution mitigation is considered one of most important issues in city planning. Urban trees help to improve air quality by facilitating widespread deposition of various gases and particles through the provision of large surface areas as well as through...... are manifested depends on species-specific tree properties: that is, their "traits". We summarize and discuss the current knowledge on how such traits affect urban air pollution. We also present aggregated traits of some of the most common tree species in Europe, which can be used as a decision-support tool...... their influence on microclimate and air turbulence. However, many of these trees produce wind-dispersed pollen (a known allergen) and emit a range of gaseous substances that take part in photochemical reactions - all of which can negatively affect air quality. The degree to which these air-quality impacts...
-
Directory of Open Access Journals (Sweden)
Pham Anh-Tung
2010-09-01
Full Text Available Abstract Background The alteration of fatty acid profiles in soybean [Glycine max (L. Merr.] to improve soybean oil quality is an important and evolving theme in soybean research to meet nutritional needs and industrial criteria in the modern market. Soybean oil with elevated oleic acid is desirable because this monounsaturated fatty acid improves the nutrition and oxidative stability of the oil. Commodity soybean oil typically contains 20% oleic acid and the target for high oleic acid soybean oil is approximately 80% of the oil; previous conventional plant breeding research to raise the oleic acid level to just 50-60% of the oil was hindered by the genetic complexity and environmental instability of the trait. The objective of this work was to create the high oleic acid trait in soybeans by identifying and combining mutations in two delta-twelve fatty acid desaturase genes, FAD2-1A and FAD2-1B. Results Three polymorphisms found in the FAD2-1B alleles of two soybean lines resulted in missense mutations. For each of the two soybean lines, there was one unique amino acid change within a highly conserved region of the protein. The mutant FAD2-1B alleles were associated with an increase in oleic acid levels, although the FAD2-1B mutant alleles alone were not capable of producing a high oleic acid phenotype. When existing FAD2-1A mutations were combined with the novel mutant FAD2-1B alleles, a high oleic acid phenotype was recovered only for those lines which were homozygous for both of the mutant alleles. Conclusions We were able to produce conventional soybean lines with 80% oleic acid in the oil in two different ways, each requiring the contribution of only two genes. The high oleic acid soybean germplasm developed contained a desirable fatty acid profile, and it was stable in two production environments. The presumed causative sequence polymorphisms in the FAD2-1B alleles were developed into highly efficient molecular markers for tracking the
-
Pham, Anh-Tung; Lee, Jeong-Dong; Shannon, J Grover; Bilyeu, Kristin D
2010-09-09
The alteration of fatty acid profiles in soybean [Glycine max (L.) Merr.] to improve soybean oil quality is an important and evolving theme in soybean research to meet nutritional needs and industrial criteria in the modern market. Soybean oil with elevated oleic acid is desirable because this monounsaturated fatty acid improves the nutrition and oxidative stability of the oil. Commodity soybean oil typically contains 20% oleic acid and the target for high oleic acid soybean oil is approximately 80% of the oil; previous conventional plant breeding research to raise the oleic acid level to just 50-60% of the oil was hindered by the genetic complexity and environmental instability of the trait. The objective of this work was to create the high oleic acid trait in soybeans by identifying and combining mutations in two delta-twelve fatty acid desaturase genes, FAD2-1A and FAD2-1B. Three polymorphisms found in the FAD2-1B alleles of two soybean lines resulted in missense mutations. For each of the two soybean lines, there was one unique amino acid change within a highly conserved region of the protein. The mutant FAD2-1B alleles were associated with an increase in oleic acid levels, although the FAD2-1B mutant alleles alone were not capable of producing a high oleic acid phenotype. When existing FAD2-1A mutations were combined with the novel mutant FAD2-1B alleles, a high oleic acid phenotype was recovered only for those lines which were homozygous for both of the mutant alleles. We were able to produce conventional soybean lines with 80% oleic acid in the oil in two different ways, each requiring the contribution of only two genes. The high oleic acid soybean germplasm developed contained a desirable fatty acid profile, and it was stable in two production environments. The presumed causative sequence polymorphisms in the FAD2-1B alleles were developed into highly efficient molecular markers for tracking the mutant alleles. The resources described here for the creation
-
The Relations of Motivational Traits with Workplace Deviance
Diefendorff, James M.; Mehta, Kajal
2007-01-01
The authors developed and tested new theoretical relations between approach and avoidance motivational traits and deviant work behaviors. Approach motivation was divided into 3 traits: personal mastery (i.e., desire to achieve), competitive excellence (i.e., desire to perform better than others), and behavioral activation system (BAS) sensitivity…
-
The effect of shovel trait on Carabelli's trait in Taiwan Chinese and Aboriginal populations.
Hsu, J W; Tsai, P L; Hsiao, T H; Chang, H P; Lin, L M; Liu, K M; Yu, H S; Ferguson, D
1997-09-01
Chinese and other Mongoloid populations differ from Caucasoids by having a high prevalence of shovel trait and a low prevalence of Carabelli's trait. This study was conducted to compare the association between the shovel and the Carabelli's traits between Chinese and aboriginal Mongoloid populations. The research is designed to sample randomly a Chinese population and an aboriginal population having low admixture with neighboring populations. The Mongoloid aboriginal group was from the Bunun tribe who resides in an isolated alpine area in Taiwan. The effects of sex and age on Carabelli's trait were controlled in this study, as was the association between tooth size and Carabelli's trait. Our results show that males had more Carabelli's trait expressed on teeth than females in both of these two Mongoloid populations. The buccolingual diameter of Carabelli's trait teeth was larger than that of teeth without the trait. After controlling for sex, age, and tooth size, the existence of the shovel trait significantly increased the likelihood of having Carabelli's trait, especially in Chinese, which implies another significant ethnic feature for Mongoloid identification.
-
2011-07-15
... Airworthiness Directives; B/E Aerospace, Continuous Flow Passenger Oxygen Mask Assembly, Part Numbers 174006... manufacturer and part number of the oxygen mask assemblies installed, an inspection to determine the manufacturing date and modification status if certain oxygen mask assemblies are installed, and corrective...
-
Do gender and personality traits (BFI-10) influence self-perceived opinion leadership?
DEFF Research Database (Denmark)
Sudzina, Frantisek
2016-01-01
. This approach would require to identify opinion leaders. This paper investigates whether gender and personality traits can predict opinion leadership. Methodology/methods: The paper can be perceived as a replication in a loose sense of the term, since it replicates only a part of a previously published model...... and in one's own opinion (two variables). Generalized linear models (GLM) and Pearson product-moment correlation coefficient are used to analyze data. Scientific aim: The aim of the paper is to estimate impact of gender and personality traits on opinion leadership. Findings: Extraversion is the personality...... trait closest related to opinion leadership regardless whether it is self-perceived in the eyes of others or in one's own opinion. Opinion leadership in one's own opinion can be predicted even using neuroticism, and conscientiousness. The three traits are consistent with previous findings. Unlike...
-
Logistic analysis of the effects of shovel trait on Carabelli's trait in a Mongoloid population.
Tsai, P L; Hsu, J W; Lin, L M; Liu, K M
1996-08-01
Mongoloid populations differ from Caucasoids by having a high prevalence of shovel trait and a low prevalence of Carabelli's trait. This study was conducted to investigate the effects of the shovel trait on Carabelli's trait in a Mongoloid population. The research design sought a population that resides in an isolated area and exhibits low admixture with neighboring populations. The Mongoloid group selected for study was the Bunun tribe of aborigines who inhabit an alpine area in Taiwan. The effects of sex and age on Carabelli's trait were controlled in this investigation, as was the association between tooth size and Carabelli's trait. Results show that males were more likely to have Carabelli's trait expressed on teeth than females. The buccolingual diameter of Carabelli's trait teeth was larger than that of teeth without the trait. After adjusting for sex, age, and tooth size, the existence of the shovel trait increased the likelihood of having Carabelli's trait by a factor of three, an effect that is significant.
-
Exploiting wild relatives of S. lycopersicum for quality traits
Víquez Zamora, A.M.
2015-01-01
Exploiting wild relatives of S. lycopersicum for quality traits Ana Marcela Víquez Zamora Tomatoes are consumed worldwide and became a model for crop plant research. A part of the research aims at expanding genetic diversity in tomato; this can be done by incorporating
-
Yield Stress Model for Molten Composition B-3
Davis, Stephen; Zerkle, David
2017-06-01
Composition B-3 (Comp B-3) is a melt-castable explosive composed of 60/40 wt% RDX/TNT (hexahydro-1,3,5-trinitro-1,3,5-triazine/2,4,6-trinitrotoluene). During casting operations thermal conditions are controlled which along with the low melting point of TNT and the insensitivity of the mixture to external stimuli leading to safe use. Outside these standard operating conditions a more rigorous model of Comp B-3 rheological properties is necessary to model thermal transport as Comp B-3 evolves from quiescent solid through vaporization/decomposition upon heating. One particular rheological phenomena of interest is Bingham plasticity, where a material behaves as a quiescent solid unless a sufficient load is applied, resulting in fluid flow. In this study falling ball viscometer data is used to model the change in Bingham plastic yield stresses as a function of RDX particle volume fraction; a function of temperature. Results show the yield stress of Comp B-3 (τy) follows the expression τy = B ϕ -ϕc N , where Φ and Φc are the volume fraction of RDX and a critical volume fraction, respectively and B and N are experimentally evaluated constants.
-
Lipids: Part of the tangled web
Energy Technology Data Exchange (ETDEWEB)
Krauss, R.M.
1992-08-01
Analysis of LDL subclasses by non-denaturing gradient gel electrophoresis has led to the identification of a subclass pattern characterized by predominance of small LDL, designated LDL subclass pattern B. The prevalence of pattern B in the general population is approximately 25%, but varies as a function of age and gender, being relatively uncommon in children and in premenopausal women. The remainder of the population has a predominance of larger LDL (pattern A) or an intermediate pattern. Our findings indicate that LDL subclass pattern B is an integral part of the ``tangled web`` of interrelated coronary disease risk factors associated with insulin resistance. It may be that the pathologic features of this lipoprotein profile, including the relative atherogenicity of small, dense LDL and IDL, contribute importantly to the increased risk of cardiovascular disease in subjects with insulin resistance and hypertension. Furthermore, pattern B serves as a marker for a common genetic trait which may underlie a substantial portion of the familial predisposition to coronary artery disease in the general population. Studies of hormonal, dietary, and pharmacologic influences on expression of this atherogenic phenotype should lead to more effective identification and management of high-risk individuals, and improved approaches to disease prevention in high-risk families.
-
Lipids: Part of the tangled web
Energy Technology Data Exchange (ETDEWEB)
Krauss, R.M.
1992-08-01
Analysis of LDL subclasses by non-denaturing gradient gel electrophoresis has led to the identification of a subclass pattern characterized by predominance of small LDL, designated LDL subclass pattern B. The prevalence of pattern B in the general population is approximately 25%, but varies as a function of age and gender, being relatively uncommon in children and in premenopausal women. The remainder of the population has a predominance of larger LDL (pattern A) or an intermediate pattern. Our findings indicate that LDL subclass pattern B is an integral part of the tangled web'' of interrelated coronary disease risk factors associated with insulin resistance. It may be that the pathologic features of this lipoprotein profile, including the relative atherogenicity of small, dense LDL and IDL, contribute importantly to the increased risk of cardiovascular disease in subjects with insulin resistance and hypertension. Furthermore, pattern B serves as a marker for a common genetic trait which may underlie a substantial portion of the familial predisposition to coronary artery disease in the general population. Studies of hormonal, dietary, and pharmacologic influences on expression of this atherogenic phenotype should lead to more effective identification and management of high-risk individuals, and improved approaches to disease prevention in high-risk families.
-
González-Peña, D; Knox, R V; MacNeil, M D; Rodriguez-Zas, S L
2015-03-01
Four semen traits: volume (VOL), concentration (CON), progressive motility of spermatozoa (MOT), and abnormal spermatozoa (ABN) provide complementary information on boar fertility. Assessment of the impact of selection for semen traits is hindered by limited information on economic parameters. Objectives of this study were to estimate economic values for semen traits and to evaluate the genetic gain when these traits are incorporated into traditional selection strategies in a 3-tier system of swine production. Three-way (maternal nucleus lines A and B and paternal nucleus line C) and 4-way (additional paternal nucleus line D) crossbreeding schemes were compared. A novel population structure that accommodated selection for semen traits was developed. Three selection strategies were simulated. Selection Strategy I (baseline) encompassed selection for maternal traits: number of pigs born alive (NBA), litter birth weight (LBW), adjusted 21-d litter weight (A21), and number of pigs at 21 d (N21); and paternal traits: number of days to 113.5 kg (D113), backfat (BF), ADG, feed efficiency (FE), and carcass lean % (LEAN). Selection Strategy II included Strategy I and the number of usable semen doses per collection (DOSES), a function of the 4 semen traits. Selection Strategy III included Strategy I and the 4 semen traits individually. The estimated economic values of VOL, CON, MOT, ABN, and DOSES for 7 to 1 collections/wk ranged from $0.21 to $1.44/mL, $0.12 to $0.83/10 spermatozoa/mm, $0.61 to $12.66/%, -$0.53 to -$10.88/%, and $2.01 to $41.43/%, respectively. The decrease in the relative economic values of semen traits and DOSES with higher number of collections per wk was sharper between 1 and 2.33 collections/wk than between 2.33 and 7 collections/wk. The higher economic value of MOT and ABN relative to VOL and CON could be linked to the genetic variances and covariances of these traits. Average genetic gains for the maternal traits were comparable across strategies
-
Personality traits and eating habits in a large sample of Estonians.
Mõttus, René; Realo, Anu; Allik, Jüri; Deary, Ian J; Esko, Tõnu; Metspalu, Andres
2012-11-01
Diet has health consequences, which makes knowing the psychological correlates of dietary habits important. Associations between dietary habits and personality traits were examined in a large sample of Estonians (N = 1,691) aged between 18 and 89 years. Dietary habits were measured using 11 items, which grouped into two factors reflecting (a) health aware and (b) traditional dietary patterns. The health aware diet factor was defined by eating more cereal and dairy products, fish, vegetables and fruits. The traditional diet factor was defined by eating more potatoes, meat and meat products, and bread. Personality was assessed by participants themselves and by people who knew them well. The questionnaire used was the NEO Personality Inventory-3, which measures the Five-Factor Model personality broad traits of Neuroticism, Extraversion, Openness, Agreeableness, and Conscientiousness, along with six facets for each trait. Gender, age and educational level were controlled for. Higher scores on the health aware diet factor were associated with lower Neuroticism, and higher Extraversion, Openness and Conscientiousness (effect sizes were modest: r = .11 to 0.17 in self-ratings, and r = .08 to 0.11 in informant-ratings, ps < 0.01 or lower). Higher scores on the traditional diet factor were related to lower levels of Openness (r = -0.14 and -0.13, p < .001, self- and informant-ratings, respectively). Endorsement of healthy and avoidance of traditional dietary items are associated with people's personality trait levels, especially higher Openness. The results may inform dietary interventions with respect to possible barriers to diet change.
-
Coping skills: role of trait sport confidence and trait anxiety.
Cresswell, Scott; Hodge, Ken
2004-04-01
The current research assesses relationships among coping skills, trait sport confidence, and trait anxiety. Two samples (n=47 and n=77) of international competitors from surf life saving (M=23.7 yr.) and touch rugby (M=26.2 yr.) completed the Athletic Coping Skills Inventory, Trait Sport Confidence Inventory, and Sport Anxiety Scale. Analysis yielded significant correlations amongst trait anxiety, sport confidence, and coping. Specifically confidence scores were positively associated with coping with adversity scores and anxiety scores were negatively associated. These findings support the inclusion of the personality characteristics of confidence and anxiety within the coping model presented by Hardy, Jones, and Gould, Researchers should be aware that confidence and anxiety may influence the coping processes of athletes.
-
2010-04-01
...' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR FEDERAL COAL MINE HEALTH AND SAFETY ACT... the entire maximum inspiration and the entire maximum forced expiration. The instrument shall, in... unacceptable when the patient: (A) Has not reached full inspiration preceding the forced expiration; or (B) Has...
-
DNA (cytosine-5-methyltransferase 3B (DNMT 3B polymorphism and risk of Down syndrome offspring
Directory of Open Access Journals (Sweden)
Cláudia Melo de Moura
2018-01-01
Full Text Available Down syndrome (DS is the most common form of human genetic mental retardation. Several polymorphisms in genes coding folic acid cycle enzymes have been associated to the risk of bearing a DS child; however, the results are controversial. S-adenosyl-l-methionine (SAM is an important intermediate of folic acid pathway and acts as methyl donor and substrate for DNA (cytosine-5-methyltransferase 3B (DNMT3B – EC 2.1.1.37 de novo methylation processes during embryogenesis. Recent studies suggest that a functional polymorphism of DNMT 3B in maternal genotype may be associated with a decreased risk of having a DS child. We herein investigate the association of this polymorphism with the occurrence of DS in a Brazilian population. We have genotyped 111 mothers of DS infants (MDS and 212 control mothers (CM through PCR-RFLP. The observed genotypic frequencies were CC = 0.22; CT = 0.49 and TT = 0.29 in CM, and CC = 0.30; CT = 0.52 and TT = 0.18 in MDS. Allelic frequencies were C = 0.47 and T = 0.53 in CM and C = 0.56 and T = 0.44 in MDS. No deviation of HWE was observed, and both DNMT 3B rs2424913 genotype (χ2 = 4.53; DF = 1; P = 0.03 and allelic (χ2 = 4.90; DF = 1; P = 0.03 frequencies show significant differences between MDS and CM. The presence of the mutant DNMT 3B T allele decreases 30% the risk of bearing a DS child (OR = 0.69; 95% CI: 0.50–0.96; P = 0.03, and the risk is diminished up to 45% in association with the homozygous genotype (OR = 0.54; 95% CI: 0.31–0.96; P = 0.04. Our results suggest that women harboring the single nucleotide polymorphism DNMT 3B rs2424913 have a decreased risk of a DS pregnancy, and further studies are necessary to confirm this protective effect.
-
Textbook Evaluation: An Analysis of Listening Comprehension Parts in Top Notch 2A & 2B
Directory of Open Access Journals (Sweden)
Afshin Soori
2015-10-01
Full Text Available Textbooks are the instruments that assist both teachers and learners in process of second language learning. With respect to the importance of textbooks in a language course, evaluation of course books is a significant issue for most researchers. The present study investigated and analyzed Listening Comprehension parts in Top Notch 2A & 2B 2nd edition. Top Notch 2A & 2B have 10 Units. The number of listening comprehension parts is in the range of 2 to 4 parts in each unit through the book. So the number of listening comprehension parts is not equally distributed. The participants of this study are 10 EFL teachers of two English language Institutes in Jahrom. Strong and weak aspects of Listening Comprehension parts have indicated in this research. The weaknesses involve the pictures and visuals are not clear enough to enhance students' motivation and interest, the audio is not completely suitable for students' English level, and Discussion parts are not stimulating students' talking. Furthermore this study revealed the crucial function of teachers in listening achievement of students. Keywords: textbook evaluation, listening comprehension, ELT
-
WARM SPITZER PHOTOMETRY OF THREE HOT JUPITERS: HAT-P-3b, HAT-P-4b AND HAT-P-12b
Energy Technology Data Exchange (ETDEWEB)
Todorov, Kamen O. [Department of Astronomy and Astrophysics, Pennsylvania State University, University Park, PA 16802 (United States); Deming, Drake [Department of Astronomy, University of Maryland at College Park, College Park, MD 20742 (United States); Knutson, Heather A. [Division of Geological and Planetary Sciences, California Institute of Technology, Pasadena, CA 91125 (United States); Burrows, Adam [Department of Astrophysical Sciences, Princeton University, Princeton, NJ 08544 (United States); Fortney, Jonathan J.; Laughlin, Gregory [Department of Astronomy and Astrophysics, University of California at Santa Cruz, Santa Cruz, CA 95064 (United States); Lewis, Nikole K. [Department of Earth, Atmospheric, and Planetary Sciences, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Cowan, Nicolas B. [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States); Agol, Eric [Department of Astronomy, University of Washington, Box 351580, Seattle, WA 98195 (United States); Desert, Jean-Michel [Astronomy Department, California Institute of Technology, Pasadena, CA 91125 (United States); Sada, Pedro V. [Department of Physics and Mathematics, University of Monterrey, Monterrey (Mexico); Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, Cambridge, MA 02138 (United States); Langton, Jonathan [Department of Physics, Principia College, Elsah, IL 62028 (United States); Showman, Adam P. [Lunar and Planetary Laboratory, University of Arizona, Tucson, AZ 85721 (United States)
2013-06-20
We present Warm Spitzer/IRAC secondary eclipse time series photometry of three short-period transiting exoplanets, HAT-P-3b, HAT-P-4b and HAT-P-12b, in both the available 3.6 and 4.5 {mu}m bands. HAT-P-3b and HAT-P-4b are Jupiter-mass objects orbiting an early K and an early G dwarf star, respectively. For HAT-P-3b we find eclipse depths of 0.112%+0.015%-0.030% (3.6 micron) and 0.094%+0.016%-0.009% (4.5 {mu}m). The HAT-P-4b values are 0.142%+0.014%-0.016% (3.6 micron) and 0.122%+0.012%-0.014% 4.5 {mu}m). The two planets' photometry is consistent with inefficient heat redistribution from their day to night sides (and low albedos), but it is inconclusive about possible temperature inversions in their atmospheres. HAT-P-12b is a Saturn-mass planet and is one of the coolest planets ever observed during secondary eclipse, along with the hot Neptune GJ 436b and the hot Saturn WASP-29b. We are able to place 3{sigma} upper limits on the secondary eclipse depth of HAT-P-12b in both wavelengths: <0.042% (3.6 {mu}m) and <0.085% (4.5 {mu}m). We discuss these results in the context of the Spitzer secondary eclipse measurements of GJ 436b and WASP-29b. It is possible that we do not detect the eclipses of HAT-P-12b due to high eccentricity, but find that weak planetary emission in these wavelengths is a more likely explanation. We place 3{sigma} upper limits on the |e cos {omega}| quantity (where e is eccentricity and {omega} is the argument of periapsis) for HAT-P-3b (<0.0081) and HAT-P-4b (<0.0042), based on the secondary eclipse timings.
-
Ferrando, Mercedes; Prieto, Maria Dolores; Almeida, Leandro S.; Ferrandiz, Carmen; Bermejo, Rosario; Lopez-Pina, Jose Antonio; Hernandez, Daniel; Sainz, Marta; Fernandez, Mari-Carmen
2011-01-01
This article analyses the relationship between trait emotional intelligence and academic performance, controlling for the effects of IQ, personality, and self-concept dimensions. A sample of 290 preadolescents (11-12 years old) took part in the study. The instruments used were (a) Trait Emotional Intelligence Questionnaire-Adolescents Short Form…
-
2011-01-05
... Airworthiness Directives; B/E Aerospace Protective Breathing Equipment (PBE) Part Number 119003-11 Installed on... February 9, 2011. ADDRESSES: For service information identified in this AD, contact B/E Aerospace, Inc... Jersey Avenue, SE., Washington, DC 20590. FOR FURTHER INFORMATION CONTACT: David Fairback, Aerospace...
-
Correlation between agronomic and stem borer resistant traits in ...
African Journals Online (AJOL)
SARAH
2015-06-30
Jun 30, 2015 ... Resistant traits had negative correlations with most agronomic traits including grain yield. (GY). .... on a scale of 1-9 with 1 = clean plant without leaf defoliation and 9 .... Negative signs indicate direction of relationship. Table 3 ...
-
Genomic Regions Influencing Seminal Root Traits in Barley.
Robinson, Hannah; Hickey, Lee; Richard, Cecile; Mace, Emma; Kelly, Alison; Borrell, Andrew; Franckowiak, Jerome; Fox, Glen
2016-03-01
Water availability is a major limiting factor for crop production, making drought adaptation and its many component traits a desirable attribute of plant cultivars. Previous studies in cereal crops indicate that root traits expressed at early plant developmental stages, such as seminal root angle and root number, are associated with water extraction at different depths. Here, we conducted the first study to map seminal root traits in barley ( L.). Using a recently developed high-throughput phenotyping method, a panel of 30 barley genotypes and a doubled-haploid (DH) population (ND24260 × 'Flagship') comprising 330 lines genotyped with diversity array technology (DArT) markers were evaluated for seminal root angle (deviation from vertical) and root number under controlled environmental conditions. A high degree of phenotypic variation was observed in the panel of 30 genotypes: 13.5 to 82.2 and 3.6 to 6.9° for root angle and root number, respectively. A similar range was observed in the DH population: 16.4 to 70.5 and 3.6 to 6.5° for root angle and number, respectively. Seven quantitative trait loci (QTL) for seminal root traits (root angle, two QTL; root number, five QTL) were detected in the DH population. A major QTL influencing both root angle and root number (/) was positioned on chromosome 5HL. Across-species analysis identified 10 common genes underlying root trait QTL in barley, wheat ( L.), and sorghum [ (L.) Moench]. Here, we provide insight into seminal root phenotypes and provide a first look at the genetics controlling these traits in barley. Copyright © 2016 Crop Science Society of America.
-
Trait-based modelling of bioaccumulation by freshwater benthic invertebrates.
Sidney, Livia Alvarenga; Diepens, Noël J; Guo, Xiaoying; Koelmans, Albert A
2016-07-01
Understanding the role of species traits in chemical exposure is crucial for bioaccumulation and toxicity assessment of chemicals. We measured and modelled bioaccumulation of polychlorinated biphenyls (PCBs) in Chironomus riparius, Hyalella azteca, Lumbriculus variegatus and Sphaerium corneum. We used a battery test procedure with multiple enclosures in one aquarium, which maximized uniformity of exposure for the different species, such that the remaining variability was due mostly to species traits. The relative importance of uptake from either pore water or sediment ingestion was manipulated by using 28 d aged standard OECD sediment with low (1%) and medium (5%) OM content and 13 months aged sediment with medium OM (5%) content. Survival was ≥76% and wet weight increased for all species. Reproduction of H. azteca and weight gain of H. azteca and S. corneum were significantly higher in the medium OM aged sediments than in other sediments, perhaps due to a more developed microbial community (i.e., increase in food resources). Biota-sediment accumulation factors (BSAF) ranged from 3 to 114, depending on species and PCB congener, with C. riparius (3-10)
traits. Enclosure-based battery tests and mechanistic BSAF models are expected to improve the quality of the exposure assessment in whole sediment toxicity tests. Copyright © 2016 Elsevier B.V. All rights reserved. -
RP-HPLC Determination of vitamins B1, B3, B6, folic acid and B12 in multivitamin tablets
Directory of Open Access Journals (Sweden)
SOTE VLADIMIROV
2005-10-01
Full Text Available Abstract:Asimple and sensitive reversed-phase, ion-pair HPLC method was developed and validated for the simultaneous determination of B-group vitamins, thiamine chloride hydrochloride (B1, nicotinamide (B3, pyridoxine hydrochloride (B6 and folic acid in Pentovit® coated tablets. The cyanocobalamine (B12 was determined separately, because of its low concentration in the investigated multivitamin preparation. RP-HPLC analysis was performed with a LKB 2150 HPLC system, equipped with a UV/VIS Waters M484 detector. The procedures for the determination of B1, B2, B6 and folic acid were carried out on a Supelcosil ABZ+ (15 cm 4.6 mm; 5 µm column with methanol-5mM heptanesulphonic acid sodium salt 0.1%triethylamine TEA(25:75 V/V; pH 2.8 as themobile phase. For the determination of B12 a Suplex pKb-100 (15 cm 4.6 mm; 5 µm column andmethanolâwater (22:78 V/V as themobile phase were used. The column effluentsweremonitored at 290 nm for B 1, B3, B6 and folic acid, and at 550 nm for B12. The obtained results and statistical parameters for all the investigated vitamins of the B-group in Pentovit® coated tablets were satisfactory and ranged from 90.4 % to 108.5 % (RSD. from 0.5% to 4.1 %. The parameters for the validation of the methods are given.
-
Peculiar alexithymic traits in burning mouth syndrome: case-control study.
Marino, Roberto; Picci, Rocco Luigi; Ferro, Giovanni; Carezana, Claudio; Gandolfo, Sergio; Pentenero, Monica
2015-11-01
The present case-control study aims to assess the occurrence of alexithymic traits in burning mouth syndrome (BMS) subjects and to correlate alexithymic traits to anxious and depressive traits in BMS subjects. Prospectively enrolled BMS and control subjects were administered the 20-item Toronto Alexithymia Scale (TAS-20). Anxiety and depressive traits were assessed using the Hamilton Anxiety Rating Scale and the Montgomery and Asberg Depression Rating Scale. Occurrence of alexithymic traits was compared between BMS and control subjects. Correlation tests were used to measure the importance of alexithymic traits related to demographic characteristics, pain intensity (VAS score), and to the other psychometric scores. Fifty-eight BMS subjects (46 females and 12 males) had a mean TAS-20 score significantly higher when compared to controls (p < 0.001; r = 0.72), corresponding to an occurrence rate of alexithymic traits of 79.3 versus 6.9%. Alexithymic traits in BMS subjects were just related to depressive traits (p = 0.02; ρ = 0.31). The high occurrence of alexithymia in BMS is an adjunctive issue in favor of its multifactorial pathogenesis, with a not negligible role for somatization. Clinicians should be aware of the high occurrence of alexithymic traits among BMS subjects as such traits may affect the doctor-patient relationship.
-
International Nuclear Information System (INIS)
Pickett, J.S.; Frank, L.A.; Kurth, W.S.
1988-06-01
This volume (2), which consists of two parts (A and B), of the Plasma Diagnostics Package (PDP) Final Science Report contains a summary of all of the data reduction and scientific analyses which were performed using PDP data obtained on STS-51F as a part of the Spacelab 2 (SL-2) payload. This work was performed during the period of launch, July 29, 1985, through June 30, 1988. During this period the primary data reduction effort consisted of processing summary plots of the data received by 12 of the 14 instruments located on the PDP and submitting these data to the National Space Science Data Center (NSSDC). Three Master's and three Ph.D. theses were written using PDP instrumentation data. These theses are listed in Volume 2, Part B
-
Carcass and meat quality traits of rabbits under heat stress.
Zeferino, C P; Komiyama, C M; Fernandes, S; Sartori, J R; Teixeira, P S S; Moura, A S A M T
2013-03-01
Rabbits are very sensitive to heat stress because they have difficulty eliminating excess body heat. The objective of the current study was to evaluate the effects of heat stress on slaughter weight, dressing percentage and carcass and meat quality traits of rabbits from two genetic groups. Ninety-six weaned rabbits were used: half were from the Botucatu genetic group and half were crossbreds between New Zealand White sires and Botucatu does. They were assigned to a completely randomized design in a 2 × 3 factorial arrangement (two genetic groups and three ambient temperatures: 18°C, 25°C and 30°C) and kept under controlled conditions in three environmental chambers from 5 to 10 weeks of age. Slaughter took place at 10 weeks, on 2 consecutive days. Meat quality measurements were made in the longissimus muscle. Actual average ambient temperature and relative humidity in the three chambers were 18.4°C and 63.9%, 24.4°C and 80.2% and 29.6°C and 75.9%, respectively. Purebred rabbits were heavier at slaughter and had heavier commercial and reference carcasses than crossbreds at 30°C; however, no differences between genetic groups for these traits were found at lower temperatures. No genetic group × ambient temperature interaction was detected for any other carcass or meat quality traits. The percentages of distal parts of legs, skin and carcass forepart were higher in crossbred rabbits, indicating a lower degree of maturity at slaughter in this group. The percentage of thoracic viscera was higher in the purebreds. Lightness of the longissimus muscle was higher in the purebreds, whereas redness was higher in the crossbreds. Slaughter, commercial and reference carcass weights and the percentages of thoracic viscera, liver and kidneys were negatively related with ambient temperature. Commercial and reference carcass yields, and the percentage of distal parts of legs, on the other hand, had a positive linear relationship with ambient temperature. Meat redness and
-
Photometric investigation of hot exoplanets: TrES-3b and Qatar-1b
Püsküllü, Ç.; Soydugan, F.; Erdem, A.; Budding, E.
2017-08-01
New photometric follow-up observations of transitting 'hot Jupiters' TrES-3b and Qatar-1b are presented. Weighted mean values of the solutions of light curves in R-filter for both planetary systems are reported and compared with the previous results. The transit light curves were analysed using the WINFITTER code. The physical properties of the planets were estimated. The planet radii are found to be Rp = 1.381 ± 0.033RJ for TrES-3b and Rp = 1.142 ± 0.025RJ for Qatar-1b. Transit times and their uncertainties were also determined and a new linear ephemeris was computed for both systems. Analysis of transit times showed that a significant signal could not be determined for TrES-3b, while weak evidence was found for Qatar-1b, which might be tested using more precise future transit times.
-
GlobAl Distribution of GEnetic Traits (GADGET) web server: polygenic trait scores worldwide.
Chande, Aroon T; Wang, Lu; Rishishwar, Lavanya; Conley, Andrew B; Norris, Emily T; Valderrama-Aguirre, Augusto; Jordan, I King
2018-05-18
Human populations from around the world show striking phenotypic variation across a wide variety of traits. Genome-wide association studies (GWAS) are used to uncover genetic variants that influence the expression of heritable human traits; accordingly, population-specific distributions of GWAS-implicated variants may shed light on the genetic basis of human phenotypic diversity. With this in mind, we developed the GlobAl Distribution of GEnetic Traits web server (GADGET http://gadget.biosci.gatech.edu). The GADGET web server provides users with a dynamic visual platform for exploring the relationship between worldwide genetic diversity and the genetic architecture underlying numerous human phenotypes. GADGET integrates trait-implicated single nucleotide polymorphisms (SNPs) from GWAS, with population genetic data from the 1000 Genomes Project, to calculate genome-wide polygenic trait scores (PTS) for 818 phenotypes in 2504 individual genomes. Population-specific distributions of PTS are shown for 26 human populations across 5 continental population groups, with traits ordered based on the extent of variation observed among populations. Users of GADGET can also upload custom trait SNP sets to visualize global PTS distributions for their own traits of interest.
-
45 CFR 73b.3 - Reports of violations.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Reports of violations. 73b.3 Section 73b.3 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES GENERAL ADMINISTRATION DEBARMENT OR SUSPENSION OF FORMER EMPLOYEES § 73b.3 Reports of violations. (a) If an officer or employee of the Department has reason to...
-
Parameters in dynamic models of complex traits are containers of missing heritability.
Directory of Open Access Journals (Sweden)
Yunpeng Wang
Full Text Available Polymorphisms identified in genome-wide association studies of human traits rarely explain more than a small proportion of the heritable variation, and improving this situation within the current paradigm appears daunting. Given a well-validated dynamic model of a complex physiological trait, a substantial part of the underlying genetic variation must manifest as variation in model parameters. These parameters are themselves phenotypic traits. By linking whole-cell phenotypic variation to genetic variation in a computational model of a single heart cell, incorporating genotype-to-parameter maps, we show that genome-wide association studies on parameters reveal much more genetic variation than when using higher-level cellular phenotypes. The results suggest that letting such studies be guided by computational physiology may facilitate a causal understanding of the genotype-to-phenotype map of complex traits, with strong implications for the development of phenomics technology.
-
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Exchange Visitor Program Services, Exchange-Visitor Program Application B Appendix B to Part 62 Foreign Relations DEPARTMENT OF STATE PUBLIC DIPLOMACY... Media and Communications; 03—Education; 04—Business and Commercial; 05—Banking and Financial; 06...
-
Directory of Open Access Journals (Sweden)
Prakit Somta
2014-06-01
Full Text Available Calcareous soil is prevalent in many areas of the world agricultural land causing substantial yield loss of crops. We previously identified two quantitative trait locus (QTL qIDC3.1 and qIDC2.1 controlling leaf chlorosis in mungbean grown in calcareous soil in two years (2010 and 2011 using visual score and SPAD measurement in a RIL population derived from KPS2 (susceptible and NM10-12-1 (resistant. The two QTLs together accounted for 50% of the total leaf chlorosis variation and only qIDC3.1 was confirmed, although heritability estimated for the traits was as high as 91.96%. In this study, we detected QTLs associated with days to flowering , plant height, number of pods per plants, number of seeds per pods, and seed yield per plants in the same population grown under the same environment with the aim to identify additional QTLs controlling resistance to calcareous soil in mungbean. Single marker analysis revealed 18 simple sequence repeat markers, while composite interval mapping identified 33 QTLs on six linkage groups (1A, 2, 3, 4, 5 and 9 controlling the five agronomic traits. QTL cluster on LG 3 coincided with the position of qIDC3.1, while QTL cluster on LG 2 was not far from qIDC2.1. The results confirmed the importance of qIDC3.1 and qIDC2.1 and revealed four new QTLs for the resistance to calcareous soil.
-
Directory of Open Access Journals (Sweden)
A. Robina
2013-11-01
Full Text Available A total of 144 pigs were used to study the effects of sex (barrows or gilts and terminal sire line (Iberian or three genetic lines of Duroc: Duroc 1, Duroc 2 and Duroc 3 on performance and carcass and meat quality traits. Gilts showed slightly lower average daily gain, shoulder weight and trimming losses, but slightly better primal cuts yields and higher loin weight, while there was no significant effect of sex on meat quality traits or on the fatty acid composition of lard and muscle. There were important differences in performance and in carcass and primal cuts quality traits between pure Iberian pigs and all Iberian × Duroc crossbreeds evaluated, partly due to the lower slaughter weights reached by the formers. The different sire lines showed differences in several traits; Duroc 1 group showed lower backfat thickness and ham and shoulder trimming losses, and higher primal cut yields than Duroc 2 and Duroc 3 groups. Intramuscular fat (IMF content remained unaffected by crossbreeding, but meat color resulted more intense and redder in crosses from the Duroc 1 sire line. The accumulation of fatty acids in lard was not affected by Duroc sire line, while animals of the group Duroc 2 showed higher levels of monounsaturated fatty acid and lower of polyunsaturated ones in IMF. These results highlight the importance of considering not only performance, but also carcass and meat quality traits when deciding the Duroc sire line for crossbreeding in Iberian pig production.
-
Do Childhood Callous-Unemotional Traits Drive Change in Parenting Practices?
Hawes, David J.; Dadds, Mark R.; Frost, Aaron D. J.; Hasking, Penelope A.
2011-01-01
This study examined the relationship between callous-unemotional (CU) traits and parenting practices over time in a mixed-sex community cohort (N = 1,008; 52.6% boys), aged 3 to 10 years (M = 6.5, SD = 1.3). Measures of CU traits, externalizing psychopathology, parenting practices, and socioeconomic risk factors were collected at baseline, and…
-
Nolte, Ilja M.; van der Most, Peter J.; Alizadeh, Behrooz Z.; de Bakker, Paul I. W.; Boezen, H. Marike; Bruinenberg, Marcel; Franke, Lude; van der Harst, Pim; Navis, Gerjan; Postma, Dirkje S.; Rots, Marianne G.; Stolk, Ronald P.; Swertz, Morris A.; Wolffenbuttel, Bruce H. R.; Wijmenga, Cisca; Snieder, Harold
Despite the recent explosive rise in number of genetic markers for complex disease traits identified in genome-wide association studies, there is still a large gap between the known heritability of these traits and the part explained by these markers. To gauge whether this 'heritability gap' is
-
International Nuclear Information System (INIS)
Latli, Bachir; Casida, J.E.
1996-01-01
NaB 3 H 4 and LiB 3 H 4 at 78% and 97% isotopic enrichments, respectively, were used in the synthesis of 3 H-labeled 1-(6-chloro-3-pyridyl)-methyl-2-nitromethyleneimidazolidine (CH-IMI) and N'-[(6-chloro-3-pyridyl)methyl]-n''-cyano-n'-methylacetamidine (acetamiprid) (two very potent insecticides) and of 1-(6-chloro-3-pyridyl)methyl-2-iminoimidazolidine (desnitro-IMI) (a metabolite of the commercial insecticides imidacloprid). 6-Chloronicotinoyl chloride was treated with either NaB 3 H 4 in methanol or LiB 3 H 4 in tetrahydrofuran and the resulting alcohol transformed to 2-chloro-5-chloromethylpyridine, which was then coupled to N-cyano-N'-methylacetamidine to give [ 3 H] acetamiprid (45 Ci/mmol). 2-Chloro-5-chloro[ 3 H]methylpyridine was also reacted with ethylenediamine and the product was either refluxed in absolute ethanol with 1,1-bis(methylthio)-2-nitro-ethylene to provide [ 3 H]CH-IMI or reacted in toluene with a solution of cyanogen bromide to produce [ 3 H] desnitro-IMI (each 55 Ci/mmol. (author)
-
Autistic Traits Moderate the Impact of Reward Learning on Social Behaviour.
Panasiti, Maria Serena; Puzzo, Ignazio; Chakrabarti, Bhismadev
2016-04-01
A deficit in empathy has been suggested to underlie social behavioural atypicalities in autism. A parallel theoretical account proposes that reduced social motivation (i.e., low responsivity to social rewards) can account for the said atypicalities. Recent evidence suggests that autistic traits modulate the link between reward and proxy metrics related to empathy. Using an evaluative conditioning paradigm to associate high and low rewards with faces, a previous study has shown that individuals high in autistic traits show reduced spontaneous facial mimicry of faces associated with high vs. low reward. This observation raises the possibility that autistic traits modulate the magnitude of evaluative conditioning. To test this, we investigated (a) if autistic traits could modulate the ability to implicitly associate a reward value to a social stimulus (reward learning/conditioning, using the Implicit Association Task, IAT); (b) if the learned association could modulate participants' prosocial behaviour (i.e., social reciprocity, measured using the cyberball task); (c) if the strength of this modulation was influenced by autistic traits. In 43 neurotypical participants, we found that autistic traits moderated the relationship of social reward learning on prosocial behaviour but not reward learning itself. This evidence suggests that while autistic traits do not directly influence social reward learning, they modulate the relationship of social rewards with prosocial behaviour. © 2015 The Authors Autism Research published by Wiley Periodicals, Inc. on behalf of International Society for Autism Research.
-
Verna, Emeline; Piercecchi-Marti, Marie-Dominique; Chaumoitre, Kathia; Adalian, Pascal
2015-08-01
In forensic anthropology, identification begins by determining the sex, age, ancestry and stature of the individuals. Asymptomatic variations present on the skeleton, known as discrete traits, can be useful to identify individuals, or at least contribute to complete their biological profile. We decided to focus our work on the upper part of the skeleton, from the first vertebra to the pelvic girdle, and we chose to present 8 discrete traits (spina bifida occulta, butterfly vertebra, supraclavicular nerve foramen, coracoclavicular joint, os acromiale, suprascapular foramen, manubrium foramen and pubic spine), because they show a frequency lower than 10%. We examined 502 anonymous CT scans from polytraumatized individuals, aged 15 to 65 years, in order to detect the selected discrete traits. Age and sex were known for each subject. Thin sections in the axial, coronal and sagittal planes and 3D volume rendering images were created and examined for the visualization of the selected discrete traits. Supraclavicular foramina were found only in males and only on the left clavicle. Coracoclavicular joints were observed only in males. The majority of individuals with a suprascapular foramen were older than 50 years of age. Pubic spines were observed mostly in females. Other traits did not present significant association with sex, age and laterality. No association between traits was highlighted. Better knowledge of human skeletal variations will help anthropologists come closer to a positive identification, especially if these variations are rare, therefore making them more discriminant. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.
-
Associations between autistic traits and emotion recognition ability in non-clinical young adults
Lindahl, Christina
2013-01-01
This study investigated the associations between emotion recognition ability and autistic traits in a sample of non-clinical young adults. Two hundred and forty nine individuals took part in an emotion recognition test, which assessed recognition of 12 emotions portrayed by actors. Emotion portrayals were presented as short video clips, both with and without sound, and as sound only. Autistic traits were assessed using the Autism Spectrum Quotient (ASQ) questionnaire. Results showed that men ...
-
Hietala, P; Wolfová, M; Wolf, J; Kantanen, J; Juga, J
2014-02-01
Improving the feed efficiency of dairy cattle has a substantial effect on the economic efficiency and on the reduction of harmful environmental effects of dairy production through lower feeding costs and emissions from dairy farming. To assess the economic importance of feed efficiency in the breeding goal for dairy cattle, the economic values for the current breeding goal traits and the additional feed efficiency traits for Finnish Ayrshire cattle under production circumstances in 2011 were determined. The derivation of economic values was based on a bioeconomic model in which the profit of the production system was calculated, using the generated steady state herd structure. Considering beef production from dairy farms, 2 marketing strategies for surplus calves were investigated: (A) surplus calves were sold at a young age and (B) surplus calves were fattened on dairy farms. Both marketing strategies were unprofitable when subsidies were not included in the revenues. When subsidies were taken into account, a positive profitability was observed in both marketing strategies. The marginal economic values for residual feed intake (RFI) of breeding heifers and cows were -25.5 and -55.8 €/kg of dry matter per day per cow and year, respectively. The marginal economic value for RFI of animals in fattening was -29.5 €/kg of dry matter per day per cow and year. To compare the economic importance among traits, the standardized economic weight of each trait was calculated as the product of the marginal economic value and the genetic standard deviation; the standardized economic weight expressed as a percentage of the sum of all standardized economic weights was called relative economic weight. When not accounting for subsidies, the highest relative economic weight was found for 305-d milk yield (34% in strategy A and 29% in strategy B), which was followed by protein percentage (13% in strategy A and 11% in strategy B). The third most important traits were calving
-
2010-01-01
... Ethnicity, Race, and Sex B Appendix B to Part 203 Banks and Banking FEDERAL RESERVE SYSTEM BOARD OF... to Part 203—Form and Instructions for Data Collection on Ethnicity, Race, and Sex I. Instructions on Collection of Data on Ethnicity, Race, and Sex You may list questions regarding the ethnicity, race, and sex...
-
Personality Traits of Substance Users in Bangladesh
Directory of Open Access Journals (Sweden)
Jotirmoy Roy
2011-02-01
Full Text Available Background: Drug taking behavior and drug dependence is a multi-factorial disorder. Personality is a very important determining factor of drug dependence. Objectives: To find out the possible relationship between personality traits and substance use disorders. Methods: This was a descriptive, cross-sectional and case-control study conducted in the department of Psychiatry of Bangabandhu Sheikh Mujib Medical University and Central Drug Addiction Treatment Center, Dhaka for a period of one year (January 2005 to December 2005. From five hundred respondents, 250 had the history of substance use disorders selected as case, and equal number were age, sex, habitat and economic background matched controls were taken. Personality traits of both cases and control were measured by applying Eysenck Personality Questionnaire. Results: Mean ± SD psychoticism (8.42±3 vs 4.33±1.8, Neuroticism (11.89±2.3 vs 9.83±2 were significantly higher (P<0.01 in cases than controls. It was found that psychoticism was 2.3 times and neurticism was 1.7 times higher in substance users than that of controls. There were no significant differences of mean distribution of extroversion and lie scales among the cases & controls. This study also revealed that, there was no significant relationship between personality traits and different variables related to substance use except that psychoticism was significantly higher in those substance users who had have positive history of troubles with law than those having no history of trouble with law (8.82±3.2 & 7.95±2.7 respectively. Conclusion: Personality traits may have an influence on persons with substance use disorder which detoriates quality of life. Key words: Drug dependence; Personality; Psychoticism; Neuroticism; Extraversion; Lie scale. DOI: 10.3329/bsmmuj.v3i2.7056BSMMU J 2010; 3(2: 76-81
-
Wright, Aidan G.C.; Hopwood, Christopher J.; Zanarini, Mary C.
2014-01-01
There has been significant movement toward conceptualizing borderline personality disorder (BPD) with normal personality traits. However one critical assumption underlying this transition, that longitudinal trajectories of BPD symptoms and normal traits track together, has not been tested. We evaluated the prospective longitudinal associations of changes in five-factor model traits and BPD symptoms over the course of 16 years using parallel process latent growth curve models in 362 patients with BPD (N=290) or other PDs (N=72). Moderate to strong cross-sectional and longitudinal associations were observed between BPD symptoms and Neuroticism, Extraversion, Agreeableness, and Conscientiousness. This study is the first to demonstrate a longitudinal link between changes in BPD symptoms and changes in traits over an extended interval in a clinical sample. These findings imply that changes in BPD symptoms occur in concert with changes in normal traits, and support the proposed transition to conceptualizing BPD, at least in part, with trait dimensions. PMID:25364942
-
2000-01-01
Welsch SCHRIFTENREIHE UNIVERSITAT DER BUNDESWEHR MONCHEN 20080707 028 A %°(w Der Druck dieses Heftes wurde aus Haushaltsmitteln der Universitdt der...Verwendung hi prliziser Ephemeriden. Espe Das Ergebnis der Be- Sali ferr ktal echnungen waren 3d - @ Koordinaten sowie geo- s1fr graphische Koordinaten...1982, Aalborg Un- B. Eissfeller, G. W. Hein: A Contribution to 3d - versity Centre, Denmark. 431 S. Operational Geodesy. Part 4: The Observation Heft 8
-
Perkins, Emily R; Yancey, James R; Drislane, Laura E; Venables, Noah C; Balsis, Steve; Patrick, Christopher J
2017-01-01
Recent research initiatives have called for an increased use of biological concepts and measures in defining and studying mental health problems, but important measurement-related challenges confront efforts in this direction. This article highlights some of these challenges with reference to an intriguing measure of neural reactivity: the probe P3 response, a mid-latency brain potential evoked by an intense, unexpected acoustic-probe stimulus. Using data for a large adult sample (N=418), we report evidence that amplitude of probe P3 response to unwarned noise bursts occurring in a picture-viewing task exhibits robust, independent associations with two distinct trait constructs: weak inhibitory control (or disinhibition; DIS) and threat sensitivity (THT). Additionally, we report a selective association for THT with attentional suppression of probe P3 response during viewing of aversive pictures compared to neutral. These results point to separable elements of variance underlying the probe P3 response, including one element reflecting DIS-related variations in cognitive-elaborative processing, and others reflecting THT-related variations in aversive foreground engagement and abrupt defensive reorientation. Key measurement issues are considered in relation to these specific findings, and methodological and statistical approaches for addressing these issues are discussed in relation to advancement of a quantitatively sound, biologically informed science of psychopathology. Copyright © 2016 Elsevier B.V. All rights reserved.
-
Henry, Jeffrey; Dionne, Ginette; Viding, Essi; Vitaro, Frank; Brendgen, Mara; Tremblay, Richard E; Boivin, Michel
2018-04-23
Previous gene-environment interaction studies of CU traits have relied on the candidate gene approach, which does not account for the entire genetic load of complex phenotypes. Moreover, these studies have not examined the role of positive environmental factors such as warm/rewarding parenting. The aim of the present study was to determine whether early warm/rewarding parenting moderates the genetic contributions (i.e., heritability) to callous-unemotional (CU) traits at school age. Data were collected in a population sample of 662 twin pairs (Quebec Newborn Twin Study - QNTS). Mothers reported on their warm/rewarding parenting. Teachers assessed children's CU traits. These reports were subjected to twin modeling. Callous-unemotional traits were highly heritable, with the remaining variance accounted for by nonshared environmental factors. Warm/rewarding parenting significantly moderated the role of genes in CU traits; heritability was lower when children received high warm/rewarding parenting than when they were exposed to low warm/rewarding parenting. High warm/rewarding parenting may partly impede the genetic expression of CU traits. Developmental models of CU traits need to account for such gene-environment processes. © 2018 Association for Child and Adolescent Mental Health.
-
75 FR 31810 - Information Collection for IDEIA Part B and C Child Counts; Comment Request
2010-06-04
... education and related services for American Indian children aged 0 to 5 with disabilities on reservations... for special education and related services for Indian children aged 0 to 5 with disabilities on... children aged 0 to 2 covered by IDEIA Part C. In IDEIA Part B--Assistance for Education of All Children...
-
Wang, Yu-Jie; Dou, Kai; Tang, Zhi-Wen
2017-01-01
Organizational citizenship behavior (OCB) is important to the development of an organization. Research into factors that foster OCB and the underlying processes are therefore substantially crucial. The current study aimed to test the association between trait self-control and OCB and the mediating role of consideration for future consequence. Four hundred and ninety-four Chinese employees (275 men, 219 women) took part in the study. Participants completed a battery of self-report measures online that assessed trait self-control, tendencies of consideration of future consequence, and organizational citizenship behavior. Path analysis was conducted and bootstrapping technique (N = 5000), a resampling method that is asymptotically more accurate than the standard intervals using sample variance and assumptions of normality, was used to judge the significance of the mediation. Results of path analysis showed that trait self-control was positively related to OCB. More importantly, the "trait self-control-OCB" link was mediated by consideration of future consequence-future, but not by consideration of future consequence-immediate. Employees with high trait self-control engage in more organizational citizenship behavior and this link can be partly explained by consideration of future consequence-future.
-
22 CFR 506.3 - Establishing and converting part-time positions.
2010-04-01
... 22 Foreign Relations 2 2010-04-01 2010-04-01 true Establishing and converting part-time positions. 506.3 Section 506.3 Foreign Relations BROADCASTING BOARD OF GOVERNORS PART-TIME CAREER EMPLOYMENT PROGRAM § 506.3 Establishing and converting part-time positions. Position management and other internal...
-
Berghuis, Han; Ingenhoven, Theo J M; van der Heijden, Paul T; Rossi, Gina M P; Schotte, Chris K W
2017-11-09
The six personality disorder (PD) types in DSM-5 section III are intended to resemble their DSM-IV/DSM-5 section II PD counterparts, but are now described by the level of personality functioning (criterion A) and an assigned trait profile (criterion B). However, concerns have been raised about the validity of these PD types. The present study examined the continuity between the DSM-IV/DSM-5 section II PDs and the corresponding trait profiles of the six DSM-5 section III PDs in a sample of 350 Dutch psychiatric patients. Facets of the Dimensional Assessment of Personality Pathology-Basic Questionnaire (DAPP-BQ) were presumed as representations (proxies) of the DSM-5 section III traits. Correlational patterns between the DAPP-BQ and the six PDs were consistent with previous research between DAPP-BQ and DSM-IV PDs. Moreover, DAPP-BQ proxies were able to predict the six selected PDs. However, the assigned trait profile for each PD didn't fully match the corresponding PD.
-
Briquet, M.; Hubrig, S.; Cat, P. de; Aerts, C.C.; North, P.; Schöller, M.
2007-01-01
Aims. In order to better model massive B-type stars, we need to understand the physical processes taking place in slowly pulsating B (SPB) stars, chemically peculiar Bp stars, and non-pulsating normal B stars co-existing in the same part of the H-R diagram. Methods: We carry out a comparative study
-
Directory of Open Access Journals (Sweden)
Olfa Frikha-Gargouri
2017-08-01
Full Text Available This study aimed to improve the screening method for the selection of Bacillus biocontrol agents against crown gall disease. The relationship between the strain biocontrol ability and their in vitro studied traits was investigated to identify the most important factors to be considered for the selection of effective biocontrol agents. In fact, previous selection procedure relying only on in vitro antibacterial activity was shown to be not suitable in some cases. A direct plant-protection strategy was performed to screen the 32 Bacillus biocontrol agent candidates. Moreover, potential in vitro biocontrol traits were investigated including biofilm formation, motility, hemolytic activity, detection of lipopeptide biosynthetic genes (sfp, ituC and bmyB and production of antibacterial compounds. The obtained results indicated high correlations of the efficiency of the biocontrol with the reduction of gall weight (p = 0.000 and the antibacterial activity in vitro (p = 0.000. Moreover, there was strong correlations of the efficiency of the biocontrol (p = 0.004 and the reduction in gall weight (p = 0.000 with the presence of the bmyB gene. This gene directs the synthesis of the lipopeptide bacillomycin belonging to the iturinic family of lipopeptides. These results were also confirmed by the two-way hierarchical cluster analysis and the correspondence analysis showing the relatedness of these four variables. According to the obtained results a new screening procedure of Bacillus biocontrol agents against crown gall disease could be advanced consisting on two step selection procedure. The first consists on selecting strains with high antibacterial activity in vitro or those harbouring the bmyB gene. Further selection has to be performed on tomato plants in vivo. Moreover, based on the results of the biocontrol assay, five potent strains exhibiting high biocontrol abilities were selected. They were identified as Bacillus subtilis or Bacillus
-
Quantitative Trait Loci for Fertility Traits in Finnish Ayrshire Cattle
DEFF Research Database (Denmark)
Schulman, Nina F; Sahana, Goutam; Lund, Mogens S
2008-01-01
A whole genome scan was carried out to detect quantitative trait loci (QTL) for fertility traits in Finnish Ayrshire cattle. The mapping population consisted of 12 bulls and 493 sons. Estimated breeding values for days open, fertility treatments, maternal calf mortality and paternal non-return rate...... combinations, which were observed significant in the regression method. Twenty-two chromosome-wise significant QTL were detected. Several of the detected QTL areas were overlapping with milk production QTL previously identified in the same population. Multi-trait QTL analyses were carried out to test...... if these effects were due to a pleiotropic QTL affecting fertility and milk yield traits or to linked QTL causing the effects. This distinction could only be made with confidence on BTA1 where a QTL affecting milk yield is linked to a pleiotropic QTL affecting days open and fertility treatments...
-
Mõttus, René; Realo, Anu; Allik, Jüri; Esko, Tõnu; Metspalu, Andres; Johnson, Wendy
2015-01-01
The study investigated differences in the Five-Factor Model (FFM) domains and facets across adulthood. The main questions were whether personality scales reflected coherent units of trait development and thereby coherent personality traits more generally. These questions were addressed by testing if the components of the trait scales (items for facet scales and facets for domain scales) showed consistent age group differences. For this, measurement invariance (MI) framework was used. In a sample of 2,711 Estonians who had completed the NEO Personality Inventory 3 (NEO PI-3), more than half of the facet scales and one domain scale did not meet the criterion for weak MI (factor loading equality) across 12 age groups spanning ages from 18 to 91 years. Furthermore, none of the facet and domain scales met the criterion for strong MI (intercept equality), suggesting that items of the same facets and facets of the same domains varied in age group differences. When items were residualized for their respective facets, 46% of them had significant (p < 0.0002) residual age-correlations. When facets were residualized for their domain scores, a majority had significant (p < 0.002) residual age-correlations. For each domain, a series of latent factors were specified using random quarters of their items: scores of such latent factors varied notably (within domains) in correlations with age. We argue that manifestations of aetiologically coherent traits should show similar age group differences. Given this, the FFM domains and facets as embodied in the NEO PI-3 do not reflect aetiologically coherent traits.
-
DEFF Research Database (Denmark)
da Cunha-Bang, Sofi; Hjordt, Liv Vadskjaer; Perfalk, Erik
2017-01-01
anger (difference in slopes, pcorrected = .04). In the violent offender group, striatal 5-HT1BR binding was positively correlated with self-reported trait anger (p = .0004), trait psychopathy (p = .008), and level of psychopathy according to the Psychopathy Checklist-Revised (p = .02). We found no group...... differences in 5-HT1BR binding. CONCLUSIONS: Our data demonstrate for the first time in humans a specific involvement of 5-HT1BR binding in anger and psychopathy. 5-HT1BRs putatively represent a molecular target for development of pharmacologic antiaggressive treatments....
-
Tomkins, Joseph L; Kotiaho, Janne S; Lebas, Natasha R
2005-03-07
Trait exaggeration through sexual selection will tale place alongside other changes in phenotype. Exaggerated morphology might be compensated by parallel changes in traits that support, enhance or facilitate exaggeration: 'secondary sexual trait compensation' (SSTC). Alternatively, exaggeration might be realized at the expense of other traits through morphological trade-offs. For the most part, SSTC has only been examined interspecifically. For these phenomena to be important intraspecifically, the sexual trait must be developmentally integrated with the compensatory or competing trait. We studied developmental integration in two species with different development: the holometabolous beetle Onthophagus taurus and the hemimetabolous earwig Forficula auricularia. Male-dimorphic variation in trait exaggeration was exploited to expose both trade-offs and SSTC. We found evidence for morphological trade-offs in O. taurus, but no F. auricularia, supporting the notion that trade-offs are more likely in closed developmetal systems. However, we found these trade-offs were not limited solely to traits growing close together. Developmental integration of structures involved in SSTC were detected in both species. The developmental integration of SSTC was phenotypically plastic, such that the compensation for relatively larger sexual traits was greater in the exasperated male morphs. Evidence of intraspecific SSTC demands studies of the selective, genetic and developmental architecture of phenotypic integration.
-
Zhang, Jie; Gao, Qi
2012-01-01
This study evaluated the validation of STAI Trait-Anxiety Scale in suicide cases and community living controls in rural China. The participants were 392 suicides and 416 controls. Cronbach's Alpha was computed to evaluate the internal consistency. The Spearman Correlation Coefficient between Trait-Anxiety Scale and other instrument was calculated to evaluate the external validity, and the Exploratory Factor Analysis was used to evaluate the construct validity. The results showed the Cronbach's Alpha was .891 and .787 respectively in case and control groups. Most of the correlations between instruments were significant. We found 2 factors in cases and 3 factors in controls. We could cautiously infer that the Trait Anxiety Scale was an adequate tool to measure trait anxiety through proxy data in suicide victims and living controls in rural China.
-
Directory of Open Access Journals (Sweden)
Ali Eryılmaz
2017-01-01
Full Text Available The aim of the study is to compare teachers and pre-service teachers in terms of personality traits and career adaptability. The relationships between personality traits and career adaptability are also investigated. A total of 176 pre-service teachers took part in the study, including 90 men and 76 women, and a total of 204 teachers took part in the study, including 98 men and 106 women. The data collected included items from the Big Five Inventory and the Scale of Career Adaptability. The relationship between variables was examined by using independent t-tests for gender differences and multiple regression analysis techniques. According to the results, the level of career adaptability is higher in teachers than in pre-service teachers. Additionally, career exploration and plans were related to certain personality traits. The results of the present study might be used in career counselling, and also teacher profession development.
-
Spontaneous trait transference to familiar communicators: is a little knowledge a dangerous thing?
Mae, L; Carlston, D E; Skowronski, J J
1999-08-01
In most social cognition research participants are presented with unattributed information about unfamiliar stimulus persons. However, in the real world it is more common for people to learn about others through social communication and to know something about those with whom they communicate. Such issues are explored in relation to spontaneous trait transference, a phenomenon in which communicators are perceived as having traits that they merely describe in others. Three studies show that even familiar communicators became associated with, and attributed, the traits implied by their remarks. Surprisingly, these effects occurred even when the implied traits were incongruent with participants' prior knowledge about these communicators. The results are discussed in terms of (a) the generalizability of social cognition research, (b) the automaticity of simple associative phenomena, and (c) the interplay of simple associative and higher level processes.
-
Gevarter, W. B.
1983-01-01
Artificial Intelligence (AI) is an emerging technology that has recently attracted considerable attention. Many applications are now under development. This report, Part B of a three part report on AI, presents overviews of the key application areas: Expert Systems, Computer Vision, Natural Language Processing, Speech Interfaces, and Problem Solving and Planning. The basic approaches to such systems, the state-of-the-art, existing systems and future trends and expectations are covered.
-
20 CFR 222.3 - Other regulations related to this part.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 222.3 Section 222.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT FAMILY RELATIONSHIPS General § 222.3 Other regulations related to this part. This part is related to a...
-
Directory of Open Access Journals (Sweden)
Valdecy Aparecida Rocha da Cruz
Full Text Available Apolipoprotein B (APOB and Adiponectin Receptor 1 (ADIPOR1 are related to the regulation of feed intake, fat metabolism and protein deposition and are candidate genes for genomic studies in birds. In this study, associations of two single nucleotide polymorphisms (SNPs g.102A>T (APOB and g.729C>T (ADIPOR1 with carcass, bone integrity and performance traits in broilers were investigated. Genotyping was performed on a paternal line of 1,454 broilers. The SNP detection was carried out by PCR-RFLP technique using the restriction enzymes HhaI for the SNP g.729C>T and MslI for the SNP g.102A>T. The association analyses of the two SNPs with 85 traits were performed using the restricted maximum likelihood (REML and Generalized Quasi-Likelihood Score (GQLS methods. For REML the model included the random additive genetic effect of animal and fixed effects of sex, hatch and SNP genotypes. In the GQLS method, a logistic regression was used to associate the genotypes with phenotypes adjusted for fixed effects of sex and hatch. The SNP g.729C>T in the ADIPOR1 gene was associated with thickness of the femur and breast skin yield. Thus, the ADIPOR1 gene seems implicated in the metabolism and/or fat deposition and bone integrity in broilers.
-
Same Traits, Different Variance
Directory of Open Access Journals (Sweden)
Jamie S. Churchyard
2014-02-01
Full Text Available Personality trait questionnaires are regularly used in individual differences research to examine personality scores between participants, although trait researchers tend to place little value on intra-individual variation in item ratings within a measured trait. The few studies that examine variability indices have not considered how they are related to a selection of psychological outcomes, so we recruited 160 participants (age M = 24.16, SD = 9.54 who completed the IPIP-HEXACO personality questionnaire and several outcome measures. Heterogenous within-subject differences in item ratings were found for every trait/facet measured, with measurement error that remained stable across the questionnaire. Within-subject standard deviations, calculated as measures of individual variation in specific item ratings within a trait/facet, were related to outcomes including life satisfaction and depression. This suggests these indices represent valid constructs of variability, and that researchers administering behavior statement trait questionnaires with outcome measures should also apply item-level variability indices.
-
Personality traits and chronic disease: implications for adult personality development.
Sutin, Angelina R; Zonderman, Alan B; Ferrucci, Luigi; Terracciano, Antonio
2013-11-01
Personality traits have been associated with chronic disease. Less is known about the longitudinal relation between personality and disease and whether chronic disease is associated with changes in personality. Method. Participants from the Baltimore Longitudinal Study of Aging (N = 2,008) completed the Revised NEO Personality Inventory and a standard medical interview at regularly scheduled visits; the Charlson Comorbidity Index, a weighted sum of 19 serious diseases, was derived from this interview. Using data from 6,685 visits, we tested whether personality increased risk of disease and whether disease was associated with personality change. Measured concurrently, neuroticism and conscientiousness were associated with greater disease burden. The impulsiveness facet of neuroticism was the strongest predictor of developing disease across the follow-up period: For every standard deviation increase in impulsiveness, there was a 26% increased risk of developing disease and a 36% increased risk of getting more ill. Personality traits changed only modestly with disease: As participants developed chronic illnesses, they became more conservative (decreased openness). Discussion. This research indicates that personality traits confer risk for disease, in part, through health-risk behaviors. These traits, however, were relatively resistant to the effect of serious disease.
-
Theoretical study of B3-to-B1 phase transition in ZnS
International Nuclear Information System (INIS)
Li, Qiang; Zhang, Rui; Lv, Tianquan; Cao, Qilong
2016-01-01
The pressure-induced phase transformation from B3 to B1 structures in ZnS using first-principle projector-augmented wave method is studied. To understand the nature and driving force behind the transition, the interesting properties in both phases, including enthalpy, phonon dispersion curves and elastic constants, are systematically investigated. The results show that the calculated transition pressure is within the range of 16.33 GPa to 19.04 GPa, which is in good agreement with the available experimental and theoretical data. The transition process can be viewed as the appearance and disappearance of very slight lattice distortion accompanied by the movement of Zn and S atoms along the [111] crystallographic axis. The physical driving force of the B3–B1 phase transition is confirmed to be a coupling effect between the mechanical instability of B3 phase under pressure and the softening acoustic phonon mode resulting from the pressure-induced lattice deformation. For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa. - Highlights: • The phase transformation from B3 to B1 structures in ZnS is studied using first-principle method. • The predicted transition pressure is within the range of 16.33 to 19.04 GPa. • The transition process can be viewed as the appearance and disappearance of very slight lattice distortion. • Physical driving force of the transition is a coupling effect between the mechanical instability and softening phonon. • For B1 phase, it is further predicted that a new phase transition takes place at about 59.9 GPa.
-
Directory of Open Access Journals (Sweden)
Xiaonan eLi
2015-06-01
Full Text Available Chromosome segment substitution lines (CSSLs represent a powerful method for precise quantitative trait loci (QTL detection of complex agronomical traits in plants. In this study, we used a marker-assisted backcrossing strategy to develop a population consisting of 63 CSSLs, derived from backcrossing of the F1 generated from a cross between two Brassica rapa subspecies: ‘Chiifu’ (ssp. pekinensis, the Brassica A genome-represented line used as the donor, and ‘49caixin’ (ssp. parachinensis, a non-heading cultivar used as the recipient. The 63 CSSLs covered 87.95% of the B. rapa genome. Among them, 39 lines carried a single segment; 15 lines, two segments; and nine lines, three or more segments of the donor parent chromosomes. To verify the potential advantage of these CSSL lines, we used them to locate QTL for six morphology-related traits. A total of 58 QTL were located on eight chromosomes for all six traits: 17 for flowering time, 14 each for bolting time and plant height, 6 for plant diameter, 2 for leaf width, and 5 for flowering stalk diameter. Co-localized QTL were mainly distributed on eight genomic regions in A01, A02, A05, A06, A08, A09, and A10, present in the corresponding CSSLs. Moreover, new chromosomal fragments that harbored QTL were identified using the findings of previous studies. The CSSL population constructed in our study paves the way for fine mapping and cloning of candidate genes involved in late bolting, flowering, and plant architecture-related traits in B. rapa. Furthermore, it has great potential for future marker-aided gene/QTL pyramiding of other interesting traits in B. rapa breeding.
-
2010-07-01
... 32 National Defense 1 2010-07-01 2010-07-01 false What Type of Instrument Is a TIA and What Statutory Authorities Does It Use? B Appendix B to Part 37 National Defense Department of Defense OFFICE OF..., App. B Appendix B to Part 37—What Type of Instrument Is a TIA and What Statutory Authorities Does It...
-
Training manual for precision hand deburring, Part 3
Energy Technology Data Exchange (ETDEWEB)
Gillespie, L.K.
1981-03-01
This publication is Part 3 of a 4 part training manual to be used by machinist trainees, production workers, and others removing burrs from precision miniature parts. The manuals are written to be self-teaching and are intended to be used with two hours of training each day along with six additional hours of bench work in deburring. This part describes mounted stones, scrapers, hand stones, abrasive filled rubber and cotton tools, abrasive paper products, felt bobs and lapping compounds, mandrels and arbors, miscellaneous tools, personal techniques for assuring quality, cleaning parts, and deburring gears and plastic parts.
-
A complex relationship between TRAF3 and non-canonical NF-κB2 activation in B lymphocytes
Directory of Open Access Journals (Sweden)
Wai Wai Lin
2013-12-01
Full Text Available The adaptor protein TRAF3 restrains BAFF receptor (BAFFR and CD40-mediated activation of the NF-κB2 pathway in B cells. Mice lacking TRAF3 specifically in B cells revealed the critical role of TRAF3 in restraining homeostatic B cell survival. Furthermore, loss- of-function mutations of the traf3 gene have been associated with human B cell malignancies, especially multiple myeloma (MM. It has been proposed that receptor-induced TRAF3 degradation leads to stabilization of the NF-B inducing kinase NIK, and subsequent NF-κB2 activation. However, it is unclear how receptor-mediated TRAF3 degradation or loss of function contributes to B cell-specific NF-κB2 activation. In the current study, we employed two complementary models to address this question. One utilized a mutant traf3 gene found in a human MM-derived cell line called LP1. The LP1 mutant TRAF3 protein lacks the TRAF-N and TRAF-C domains. Consistent with the paradigm described, expression of LP1 TRAF3 in B cells promoted higher basal levels of NF-κB2 activation compared to Wt TRAF3. However, LP1 did not associate with TRAF2, CD40, or BAFFR, and no LP1 degradation was observed following receptor engagement. Interestingly, LP1 showed enhanced NIK association. Thus, TRAF3 degradation becomes dispensable to activate NF-κB2 when it is unable to associate with TRAF2. In a second model, we examined several mutant forms of BAFFR that are unable to induce NF-κB2 activation in B cells. Signaling to B cells by each of these BAFFR mutants, however, induced levels of TRAF3 degradation similar to those induced by Wt BAFFR. Thus, in B cells, receptor-mediated TRAF3 degradation is not sufficient to promote NF-B2 activation. We thus conclude that there is not a simple linear relationship in B lymphocytes between relative levels of cellular TRAF3, induced TRAF3 degradation, NIK activation and NF-B2 activation.
-
50 CFR Figure 3 to Part 223 - Matagorda TED
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Matagorda TED 3 Figure 3 to Part 223 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Pt. 223, Fig. 3 Figure 3 to Part 223—Matagorda TED EC01JY91.047 [52...
-
Li, Yongjun; Dungey, Heidi; Yanchuk, Alvin; Apiolaza, Luis A
2017-01-01
Diameter at breast height (DBH), wood density (DEN) and predicted modulus of elasticity (PME) are considered as 'key traits' (KT) in the improvement in radiata pine breeding programmes in New Zealand. Any other traits which are also of interest to radiata pine breeders and forest growers are called 'non-key traits' (NKTs). External resin bleeding (ERB), internal checking (IC), number of heartwood rings (NHR) are three such non-key traits which affect wood quality of radiata pine timber. Economic importance of the KTs and NKTs is hard to define in radiata pine breeding programmes due to long rotation period. Desired-gain index (DGIs) and robust selection were proposed to incorporate NKTs into radiata pine breeding programme in order to deal with the uncertainty of economic importance. Four desired-gain indices A-D were proposed in this study. The desired-gain index A (DGI-A) emphasized growth and led to small decrease in ERB and small increase in IC and NHR. The expected genetic gains of all traits in the desired-gain index B (DGI-B) were in the favourable directions (positive genetic gains in the key traits and negative genetic gains in the non-key traits). The desired-gain index C (DGI-C) placed emphasis on wood density, leading to favourable genetic gain in the NKTs but reduced genetic gains for DBH and PME. The desired-gain index D (DGI-D) exerted a bit more emphasis on the non-key traits, leading large favourable reduction in the non-key traits and lower increase in the key traits compared with the other DGIs. When selecting both the key traits and the non-key traits, the average EBVs of six traits were all in the same directions as the expected genetic gains except for DBH in the DGI-D. When the key traits were measured and selected, internal checking always had a negative (favourable) genetic gain but ERB and NHR had unfavourable genetic gain in the most of time. After removing some individuals with high sensitivity to the change of economic weights, robust
-
Directory of Open Access Journals (Sweden)
Yongjun Li
Full Text Available Diameter at breast height (DBH, wood density (DEN and predicted modulus of elasticity (PME are considered as 'key traits' (KT in the improvement in radiata pine breeding programmes in New Zealand. Any other traits which are also of interest to radiata pine breeders and forest growers are called 'non-key traits' (NKTs. External resin bleeding (ERB, internal checking (IC, number of heartwood rings (NHR are three such non-key traits which affect wood quality of radiata pine timber. Economic importance of the KTs and NKTs is hard to define in radiata pine breeding programmes due to long rotation period. Desired-gain index (DGIs and robust selection were proposed to incorporate NKTs into radiata pine breeding programme in order to deal with the uncertainty of economic importance. Four desired-gain indices A-D were proposed in this study. The desired-gain index A (DGI-A emphasized growth and led to small decrease in ERB and small increase in IC and NHR. The expected genetic gains of all traits in the desired-gain index B (DGI-B were in the favourable directions (positive genetic gains in the key traits and negative genetic gains in the non-key traits. The desired-gain index C (DGI-C placed emphasis on wood density, leading to favourable genetic gain in the NKTs but reduced genetic gains for DBH and PME. The desired-gain index D (DGI-D exerted a bit more emphasis on the non-key traits, leading large favourable reduction in the non-key traits and lower increase in the key traits compared with the other DGIs. When selecting both the key traits and the non-key traits, the average EBVs of six traits were all in the same directions as the expected genetic gains except for DBH in the DGI-D. When the key traits were measured and selected, internal checking always had a negative (favourable genetic gain but ERB and NHR had unfavourable genetic gain in the most of time. After removing some individuals with high sensitivity to the change of economic weights
-
Energy map of southwestern Wyoming, Part B: oil and gas, oil shale, uranium, and solar
Biewick, Laura R.H.; Wilson, Anna B.
2014-01-01
The U.S. Geological Survey (USGS) has compiled Part B of the Energy Map of Southwestern Wyoming for the Wyoming Landscape Conservation Initiative (WLCI). Part B consists of oil and gas, oil shale, uranium, and solar energy resource information in support of the WLCI. The WLCI represents the USGS partnership with other Department of the Interior Bureaus, State and local agencies, industry, academia, and private landowners, all of whom collaborate to maintain healthy landscapes, sustain wildlife, and preserve recreational and grazing uses while developing energy resources in southwestern Wyoming. This product is the second and final part of the Energy Map of Southwestern Wyoming series (also see USGS Data Series 683, http://pubs.usgs.gov/ds/683/), and encompasses all of Carbon, Lincoln, Sublette, Sweetwater, and Uinta Counties, as well as areas in Fremont County that are in the Great Divide and Green River Basins.
-
Quantitative trait loci for udder conformation and other udder traits in Finnish Ayrshire cattle
Directory of Open Access Journals (Sweden)
N.F. SCHULMAN
2008-12-01
Full Text Available Udder traits are important due to their correlation with clinical mastitis which causes major economic losses to the dairy farms. Chromosomal areas associated with udder conformation traits, milking speed and leakage could be used in breeding programs to improve both udder traits and mastitis resistance. Quantitative trait loci (QTL mapping for udder traits was carried out on bovine chromosomes (BTA 9, 11, 14, 18, 20, 23, and 29, where earlier studies have indicated QTL for mastitis. A granddaughter design with 12 Ayrshire sire families and 360 sons was used. The sires and sons were typed for 35 markers. The traits analysed were udder depth, fore udder attachment, central ligament, distance from udder to floor, body stature, fore teat length, udder balance, rear udder height, milking speed, and leakage. Associations between markers and traits were analysed with multiple marker regression. Five genome-wise significant QTL were detected: stature on BTA14 and 23, udder balance on BTA23, rear udder height on BTA11, and central ligament on BTA23. On BTA11 and 14 the suggested QTL positions for udder traits are at the same position as previously detected QTL for mastitis and somatic cell count.;
-
49 CFR Appendix B to Part 179 - Procedures for Simulated Pool and Torch-Fire Testing
2010-10-01
... the plate. (4) The bare plate holder must be constructed in such a manner that the only heat transfer...) The bare plate holder must be constructed in such a manner that the only heat transfer to the back... SPECIFICATIONS FOR TANK CARS Pt. 179, App. B Appendix B to Part 179—Procedures for Simulated Pool and Torch-Fire...
-
Safety of Pegfilgrastim (Neulasta in Patients with Sickle Cell Trait/Anemia
Directory of Open Access Journals (Sweden)
Pashtoon Murtaza Kasi
2013-01-01
Full Text Available Pegfilgrastim (Neulasta is a recombinant filgrastim (human granulocyte colony-stimulating factor (G-CSF attached to a polyethylene glycol (PEG molecule and is given as part of chemotherapy regimens that are associated with significant myelosuppression and risk for febrile neutropenia. Prescribing information available on manufacturer’s website for the drug warns us about possible severe sickle cell crises related to the medication but does not report the actual incidence or the use in patients with sickle cell trait. Caution is advised when using it in patients with sickle cell disease. Here we present a case of a Caucasian female with known sickle cell trait (SCT with no prior complications who developed a presumed sickle cell crisis after getting Neulasta, as a part of the chemotherapy regimen used to treat her breast cancer. Based on our literature review, this appears to be the first case report of a patient with SCT developing a sickle cell crisis with the pegylated form of recombinant filgrastim. Given the dearth of literature regarding the use of G-CSF and its related pegylated forms in patients with sickle cell anemia and sickle cell trait, a discussion of potential mechanisms and review of current literature and guidelines is also presented.
-
Surface morphology of amygdala is associated with trait anxiety.
Directory of Open Access Journals (Sweden)
Shuyu Li
Full Text Available Previous neuroimaging studies have suggested a role of amygdala in trait anxiety level, in which amygdala was typically treated as a whole. To date, it remains unknown whether the morphology of specific subregions of amygdala are associated with trait anxiety. Here, we employed a shape analysis approach to locate the association between its morphology and trait anxiety on the surface of amygdala. 24 healthy young participants were included. The boundary of amygdala for each subject was first manually outlined using high-resolution magnetic resonance (MR image, followed by 3D surface reconstruction and parameterization using spherical harmonic description. Two point-wise metrics, direct displacement between the individual surface and atlas surface and its normal projection, were used to quantify the surface morphology of amygdala. Statistical analysis revealed significant correlations between the two surface metrics and trait anxiety levels, which were located around the lateral and central nucleus of right amygdala. Our results provided localized information for the association between amygdala and trait anxiety, and suggested a central role of the lateral and central nucleus of right amygdala on trait anxiety.
-
Reciprocal influences between negative life events and callous-unemotional traits.
Kimonis, Eva R; Centifanti, Luna C M; Allen, Jennifer L; Frick, Paul J
2014-11-01
Children with conduct problems and co-occurring callous-unemotional (CU) traits show more severe, stable, and aggressive antisocial behaviors than those without CU traits. Exposure to negative life events has been identified as an important contributing factor to the expression of CU traits across time, although the directionality of this effect has remained unknown due to a lack of longitudinal study. The present longitudinal study examined potential bidirectional effects of CU traits leading to experiencing more negative life events and negative life events leading to increases in CU traits across 3 years among a sample of community-based school-aged (M = 10.9, SD = 1.71 years) boys and girls (N = 98). Repeated rating measures of CU traits, negative life events and conduct problems completed by children and parents during annual assessments were moderately to highly stable across time. Cross-lagged models supported a reciprocal relationship of moderate magnitude between child-reported CU traits and "controllable" negative life events. Parent-reported CU traits predicted "uncontrollable" life events at the earlier time point and controllable life events at the later time point, but no reciprocal effect was evident. These findings have important implications for understanding developmental processes that contribute to the stability of CU traits in youth.
-
B7-H3 is a potent inhibitor of human T cell activation: No evidence for B7-H3 and TREML2 interaction
Leitner, Judith; Klauser, Christoph; Pickl, Winfried F.; Stöckl, Johannes; Majdic, Otto; Bardet, Anaïs F.; Kreil, David P.; Dong, Chen; Yamazaki, Tomohide; Zlabinger, Gerhard; Pfistershammer, Katharina; Steinberger, Peter
2010-01-01
B7-H3 belongs to the B7 superfamily, a group of molecules that costimulate or down-modulate T cell responses. Although it was shown that B7-H3 can inhibit T cell responses, several studies - most of them performed in murine systems - found B7-H3 to act in a costimulatory manner. In this study we have specifically addressed a potential functional dualism of human B7-H3 by assessing the effect of this molecule under varying experimental conditions as well as on different T cell subsets. We show that B7-H3 does not costimulate human T cells. In presence of strong activating signals, B7-H3 potently and consistently down-modulated human T cell responses. This inhibitory effect was evident when analyzing proliferation and cytokine production and affected naïve as well as pre-activated T cells. We furthermore demonstrate that B7-H3 - T cell interaction is characterized by an early suppression of IL-2 and that T cell inhibition can be reverted by exogenous IL-2. Since TREML2 has been recently described as costimulatory receptor of murine B7-H3 we have extensively analysed interaction of human B7-H3 with TREML2 (TLT2). In these experiments we found no evidence for such an interaction. Furthermore our data do not point to a role for murine TREML2 as a receptor for murine B7-H3. PMID:19544488
-
A metastructural model of mental disorders and pathological personality traits.
Wright, A G C; Simms, L J
2015-08-01
Psychiatric co-morbidity is extensive in both psychiatric settings and the general population. Such co-morbidity challenges whether DSM-based mental disorders serve to effectively carve nature at its joints. In response, a substantial literature has emerged showing that a small number of broad dimensions - internalizing, externalizing and psychoticism - can account for much of the observed covariation among common mental disorders. However, the location of personality disorders within this emerging metastructure has only recently been studied, and no studies have yet examined where pathological personality traits fit within such a broad metastructural framework. We conducted joint structural analyses of common mental disorders, personality disorders and pathological personality traits in a sample of 628 current or recent psychiatric out-patients. Bridging across the psychopathology and personality trait literatures, the results provide evidence for a robust five-factor metastructure of psychopathology, including broad domains of symptoms and features related to internalizing, disinhibition, psychoticism, antagonism and detachment. These results reveal evidence for a psychopathology metastructure that (a) parsimoniously accounts for much of the observed covariation among common mental disorders, personality disorders and related personality traits, and (b) provides an empirical basis for the organization and classification of mental disorder.
-
Relationships of Reproductive Traits with the Phylogeny of the African Noctuid Stem Borers
Directory of Open Access Journals (Sweden)
Paul-André Calatayud
2016-01-01
Full Text Available The display of the reproductive behavior in most noctuid Lepidoptera follows a diel periodicity and is limited to a precise period of either the day or the night. These behavioral traits and the sex pheromone chemistry can be species specific and thus might be linked to the phylogeny. The objective of this study was to test the relationship of these reproductive traits with phylogeny. The study was undertaken using eight closely related species of noctuid stem borers, which are easy to rear under artificial conditions, namely, Busseola fusca, B. nairobica, B . sp. nr. segeta, Manga melanodonta, M . sp. nr. nubifera, Pirateolea piscator, Sesamia calamistis , and S. nonagrioides . For each species, the adult emergence period, the mating time, and the oviposition period were estimated, referred as biological traits. The components of the sex pheromones emitted by the females of each species were also analyzed by gas chromatography–mass spectrometry. Among the biological traits measured, only those linked to the oviposition pattern (timing and egg loads per night were significantly correlated with the phylogeny of these species. For the sex pheromone components, among the 13 components identified in all species, only four, namely, Z9-tetradecenyl acetate (Z9-TDA, Z11-TDA, E11-TDA, and Z11-hexadecenyl acetate (Z11-HDA, showed the highest significant correlations with the phylogeny. These results suggest that among the different reproductive traits evaluated, only few are phylogenetically constrained. Their involvement in the reinforcement of ecological speciation in noctuid stem borers is discussed.
-
Directory of Open Access Journals (Sweden)
Yi Yang
2017-09-01
Full Text Available Seeds per silique (SS, seed weight (SW, and silique length (SL are important determinant traits of seed yield potential in rapeseed (Brassica napus L., and are controlled by naturally occurring quantitative trait loci (QTLs. Mapping QTLs to narrow chromosomal regions provides an effective means of characterizing the genetic basis of these complex traits. Orychophragmus violaceus is a crucifer with long siliques, many SS, and heavy seeds. A novel B. napus introgression line with many SS was previously selected from multiple crosses (B. rapa ssp. chinesis × O. violaceus × B. napus. In present study, a doubled haploid (DH population with 167 lines was established from a cross between the introgression line and a line with far fewer SS, in order to detect QTLs for silique-related traits. By screening with a Brassica 60K single nucleotide polymorphism (SNP array, a high-density linkage map consisting of 1,153 bins and spanning a cumulative length of 2,209.1 cM was constructed, using 12,602 high-quality polymorphic SNPs in the DH population. The average recombination bin densities of the A and C subgenomes were 1.7 and 2.4 cM, respectively. 45 QTLs were identified for the three traits in all, which explained 4.0–34.4% of the total phenotypic variation; 20 of them were integrated into three unique QTLs by meta-analysis. These unique QTLs revealed a significant positive correlation between SS and SL and a significant negative correlation between SW and SS, and were mapped onto the linkage groups A05, C08, and C09. A trait-by-trait meta-analysis revealed eight, four, and seven consensus QTLs for SS, SW, and SL, respectively, and five major QTLs (cqSS.A09b, cqSS.C09, cqSW.A05, cqSW.C09, and cqSL.C09 were identified. Five, three, and four QTLs for SS, SW, and SL, respectively, might be novel QTLs because of the existence of alien genetic loci for these traits in the alien introgression. Thirty-eight candidate genes underlying nine QTLs for silique
-
Trait emotional intelligence influences on academic achievement and school behaviour.
Mavroveli, Stella; Sánchez-Ruiz, María José
2011-03-01
BACKGROUND. Trait emotional intelligence (trait EI or trait emotional self-efficacy) refers to individuals' emotion-related self-perceptions (Petrides, Furnham, & Mavroveli, 2007). The children's trait EI sampling domain provides comprehensive coverage of their affective personality. Preliminary evidence shows that the construct has important implications for children's psychological and behavioural adjustment. AIMS. This study investigates the associations between trait EI and school outcomes, such as performance in reading, writing, and maths, peer-rated behaviour and social competence, and self-reported bullying behaviours in a sample of primary school children. It also examines whether trait EI scores differentiate between children with and without special educational needs (SEN). SAMPLE. The sample comprised 565 children (274 boys and 286 girls) between the ages of 7 and 12 (M((age)) = 9.12 years, SD= 1.27 years) attending three English state primary schools. METHOD. Pupils completed the Trait Emotional Intelligence Questionnaire-Child Form (TEIQue-CF), the Guess Who peer assessment, the Peer-Victimization Scale, and the Bullying Behaviour Scale. Additional data on achievement and SEN were collected from the school archives. RESULTS. As predicted by trait EI theory, associations between trait EI and academic achievement were modest and limited to Year 3 children. Higher trait EI scores were related to more nominations from peers for prosocial behaviours and fewer nominations for antisocial behaviour as well as lower scores on self-reported bulling behaviours. Furthermore, SEN students scored lower on trait EI compared to students without SEN. CONCLUSIONS. Trait EI holds important and multifaceted implications for the socialization of primary schoolchildren. ©2010 The British Psychological Society.
-
Directory of Open Access Journals (Sweden)
Edward E Large
2016-07-01
Full Text Available Evolutionary life history theory seeks to explain how reproductive and survival traits are shaped by selection through allocations of an individual's resources to competing life functions. Although life-history traits evolve rapidly, little is known about the genetic and cellular mechanisms that control and couple these tradeoffs. Here, we find that two laboratory-adapted strains of C. elegans descended from a single common ancestor that lived in the 1950s have differences in a number of life-history traits, including reproductive timing, lifespan, dauer formation, growth rate, and offspring number. We identified a quantitative trait locus (QTL of large effect that controls 24%-75% of the total trait variance in reproductive timing at various timepoints. Using CRISPR/Cas9-induced genome editing, we show this QTL is due in part to a 60 bp deletion in the 3' end of the nurf-1 gene, which is orthologous to the human gene encoding the BPTF component of the NURF chromatin remodeling complex. Besides reproduction, nurf-1 also regulates growth rate, lifespan, and dauer formation. The fitness consequences of this deletion are environment specific-it increases fitness in the growth conditions where it was fixed but decreases fitness in alternative laboratory growth conditions. We propose that chromatin remodeling, acting through nurf-1, is a pleiotropic regulator of life history trade-offs underlying the evolution of multiple traits across different species.
-
2010-04-01
... Market Maker, Qualified Third Market Makerâ and âQualified Block Positionerâ. 240.3b-8 Section 240.3b-8... “Qualified Block Positioner”. For the purposes of Regulation U under the Act (12 CFR part 221): (a) The term... inventory turnover in such security. (c) The term Qualified Block Positioner means a dealer who (1) is a...
-
Trait-based approaches in the analysis of stream fish communities
Frimpong, Emmanuel; Angermeier, Paul
2010-01-01
Species traits are used to study the functional organization of fish communities for a range of reasons, from simply reducing data dimensionality to providing mechanistic explanations for observed variation in communities. Ecological and life history traits have been used to understand the basic ecology of fishes and predict (1) species and community responses to habitat and climate alteration, and (2) species extinction, species invasion, and community homogenization. Many approaches in this arena have been developed during the past three decades, but they often have not been integrated with related ecological concepts or subdisciplines, which has led to confusion in terminology. We review 102 studies of species traits and then summarize patterns in traits being used and questions being addressed with trait-based approaches. Overall, studies of fish–habitat relationships that apply habitat templates and hierarchical filters dominate our sample; the most frequently used traits are related to feeding. We define and show the relationships among key terms such as fundamental and realized niches; functional traits, performance, and fitness; tactic, trait-state, syndromes, and strategies; and guilds and functional groups. We propose accelerating research to (1) quantify trait plasticity, (2) identify traits useful for testing ecological hypotheses, (3) model habitat and biotic interactions in communities while explicitly accounting for phylogenetic relationships, (4) explore how traits control community assembly, and (5) document the importance of traits in fish– community responses to anthropogenic change and in delivering ecosystem services. Further synthesis of these topics is still needed to develop concepts, models, and principles that can unify the disparate approaches taken in trait-based analysis of fish communities, link fish community ecology to general community ecology, and inform sustainable management of ecosystems.
-
Overskeid, Geir
2016-01-01
Autistic traits can help people gain and sustain power, and has probably done so throughout history, says the present paper. A number of testable claims follow from this assumption. First, the powerful should have more autistic traits than others – which they do appear to have. Among other things, powerful people, and those with many autistic traits, tend to prefer solitary activities and are often aloof. Moreover, they are often rigid and socially insensitive, low on empathy and with low scores on the trait of agreeableness – and as a rule they do not have many friends. Both groups are also more self-centered than others, more honest, less submissive, more sensitive to slights, and with a stronger tendency to engage in abstract thinking. They tend to behave in bossy or dominant ways, and their moral judgment is more based on rules than on feelings. In addition to experimental evidence, I cite biographies showing that a surprising number of presidents, prime ministers and other powerful people seem to have had traits like those in question – and interestingly, in animals, leaders are often rigid and insensitive to group members’ needs and feelings, mostly acting the way they are themselves inclined to, not responding much to others. Problem solving is important in leadership, and people with many autistic traits appear often to be better thinkers than typical subjects with similar IQs. However, these and other congruities could be coincidences. Hence the question of whether traits the two groups have in common also have a common cause constitutes a strong test of the paper’s thesis – and a common cause does appear to exist, in the form of testosterone’s effects on the central nervous system. Finally, there is evidence that, other things equal, powerful men have more reproductive success than others. If men wielding power do indeed have more autistic traits than those less powerful, this will lead to, other things equal, such traits becoming more
-
Directory of Open Access Journals (Sweden)
Geir Overskeid
2016-08-01
Full Text Available Autistic traits can help people gain and sustain power, and has probably done so throughout history, says the present paper. A number of testable claims follow from this assumption. First, the powerful should have more autistic traits than others – which they do appear to have. Among other things, powerful people, and those with many autistic traits, tend to prefer solitary activities and are often aloof. Moreover, they are often rigid and socially insensitive, low on empathy and with low scores on the trait of agreeableness -- and as a rule they do not have many friends. Both groups are also more self-centered than others, more honest, less submissive, more sensitive to slights, and with a stronger tendency to engage in abstract thinking. They tend to behave in bossy or dominant ways, and their moral judgment is more based on rules than on feelings. In addition to experimental evidence, I cite biographies showing that a surprising number of presidents, prime ministers and other powerful people seem to have had traits like those in question – and interestingly, in animals, leaders are often rigid and insensitive to group members’ needs and feelings, mostly acting the way they are themselves inclined to, not responding much to others. Problem solving is important in leadership, and people with many autistic traits appear often to be better thinkers than typical subjects with similar IQs. However, these and other congruities could be coincidences. Hence the question of whether traits the two groups have in common also have a common cause constitutes a strong test of the paper’s thesis – and a common cause does appear to exist, in the form of testosterone’s effects on the central nervous system. Finally, there is evidence that, other things equal, powerful men have more reproductive success than others. If men wielding power do indeed have more autistic traits than those less powerful, this will lead to, other things equal, such traits
-
Synthesis of pyrano[2,3-c]carbazoles, pyrano[3,2-b]carbazoles and ...
Indian Academy of Sciences (India)
2,3-c]carbazoles, pyrano[3,2-b]carbazoles and furo[3,2-b]carbazole derivatives via iodocyclization. KRISHNA CHAITANYA TALLURI and RAJAGOPAL NAGARAJAN. ∗. School of Chemistry, University of Hyderabad, Hyderabad 500046, India.
-
A trait based approach to defining valued mentoring qualities
Pendall, E.
2012-12-01
Graduate training in the sciences requires strong personal interactions among faculty, senior lab members and more junior members. Within the lab-group setting we learn to frame problems, to conduct research and to communicate findings. The result is that individual scientists are partly shaped by a few influential mentors. We have all been influenced by special relationships with mentors, and on reflection we may find that certain qualities have been especially influential in our career choices. In this presentation I will discuss favorable mentoring traits as determined from an informal survey of scientists in varying stages of careers and from diverse backgrounds. Respondents addressed questions about traits they value in their mentors in several categories: 1) personal qualities such as approachability, humor and encouragement; background including gender, ethnicity, and family status; 2) scientific qualities including discipline or specialization, perceived stature in discipline, seniority, breadth of perspective, and level of expectations; and 3) community-oriented qualities promoted by mentors, such as encouraging service contributions and peer-mentoring within the lab group. The results will be compared among respondents by gender, ethnicity, stage of career, type of work, and subdiscipline within the broadly defined Biogeoscience community. We hope to contribute to the growing discussion on building a diverse and balanced scientific workforce.
-
Directory of Open Access Journals (Sweden)
Calderoni S
2015-01-01
Full Text Available Sara Calderoni,1,* Pamela Fantozzi,1,* Giulia Balboni,2 Veronica Pagni,1 Emilio Franzoni,3 Fabio Apicella,1 Antonio Narzisi,1 Sandra Maestro,1 Filippo Muratori1,4 1IRCCS Stella Maris Foundation, 2Department of Surgery, Medical, Molecular and Critical Area Pathology, University of Pisa, Pisa, Italy; 3Child Neuropsychiatric Unit, Women, Children and Adolescents Health Department, University Hospital S Orsola-Malpighi, Bologna, Italy; 4Department of Clinical and Experimental Medicine, University of Pisa, Pisa, Italy *These authors contributed equally to this work Background: Although previous studies indicated a positive association between restrictive anorexia-nervosa (AN-R and autistic traits, the potential interference of psychiatric internalizing comorbidity on this association is not yet fully investigated.Materials and methods: The aim of this study was to explore autistic traits and internalizing psychopathology in adolescents (age range: 11.7–17.2 years with AN-R. Twenty-five patients referred to two tertiary-care hospitals were compared to a large control group (N=170 with no differences in age and sex. AN-R patients and controls filled out instruments assessing autistic traits (autism spectrum quotient [AQ], psychopathology (youth self-report [YSR] 11–18, and eating patterns (eating attitude test [EAT]. In order to disentangle the possible mediating role of internalizing symptoms on autistic traits, two separate control groups (called True and False healthy control, both composed of 25 eating-problem-free participants were derived from the whole control group on the basis of the presence or absence of internalizing problems in the YSR.Results: AN-R patients scored significantly higher on AQ compared to the whole control group and to controls without internalizing problems (True HC, but these differences disappeared when only controls with internalizing problems (False HC were considered.Conclusion: Autistic traits in AN
-
14 CFR Appendix B to Part 29 - Airworthiness Criteria for Helicopter Instrument Flight
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airworthiness Criteria for Helicopter... Appendix B to Part 29—Airworthiness Criteria for Helicopter Instrument Flight I. General. A transport category helicopter may not be type certificated for operation under the instrument flight rules (IFR) of...
-
Directory of Open Access Journals (Sweden)
M Dorrani-Nejad
2017-10-01
Full Text Available Introduction Wheat is the oldest and most important cultivated crop in the world and has fundamental role in human food security. Drought is one of the most common environmental stresses that affect growth and development of plants. Most parts of Iran’s cultivation land are located in arid and semiarid regions and because of water deficiency, plant stress appear and wheat performance reduces severely in these regions. In such circumstances, the production of drought tolerant varieties has special importance. Understand the genetic basis of yield and yield related traits is necessary in breeding programs. One of the best approaches to determine genetic parameters is generation means analysis method, due to it allows breeders to predict epistasis. In order to estimate genetic parameters and evaluation of gene action controlling agronomic traits in bread wheat under moisture stress, F4 families derived from cross between Roushan and Kavir along with F2, F3 and parents, were evaluated under moisture stress. Materials and Methods Field experiment was carried out in research field of Shahid Bahonar University of Kerman, during growing season of year 2013-2014 using Augmented design with 5 known check cultivars (Roushan, Falat, Mahdavi, Karchia and Shahpasand. Stress treatment was cut off irrigation at heading stage. Grain yield and some agronomic traits were measured. Generation means analysis method was used to determine genetic parameters including additive effect (d, dominance effect (h, additive × additive [i], and dominance × dominance effect [l] were evaluated for different traits. Generation means analysis was carried out using equation 1. Y= m+α[d]+β[h]+α2[i]+2αβ[j]+β2[l] (1 Broad and narrow sense heritability of evaluated traits were estimated according to equation 2 and 3. Results and Discussion The study revealed a complex genetic control for studied traits. Genetic variation in F2, F3 and F4 was more than parents. Five
-
Pos, Karin; Boyette, Lindy Lou; Meijer, Carin J; Koeter, Maarten; Krabbendam, Lydia; de Haan, Lieuwe; For Group
2016-11-01
Recent life events are associated with transition to and outcome in psychosis. Childhood trauma and personality characteristics play a role in proneness to adult life events. However, little is known about the relative contribution and interrelatedness of these characteristics in psychotic disorders. Therefore, we investigated whether Five-Factor Model (FFM) personality traits and childhood trauma (abuse and neglect) predict adult life events, and whether the effect of childhood trauma on life events is mediated by personality traits. One hundred and sixty-three patients with psychotic disorders were assessed at baseline on history of childhood maltreatment and FFM personality traits, and on recent life events at 3-year follow-up. Childhood abuse is associated with negative life events, and part of the effect of childhood abuse on negative life events is mediated by openness to experience. Openness to experience and extraversion are associated with more positive and negative life events. Childhood neglect and lower extraversion are related to experiencing less positive events. The association between childhood trauma and recent life events is partly mediated by personality. Future research could focus on mechanisms leading to positive life events, as positive life events may buffer against development of mental health problems.
-
Nonparametric functional mapping of quantitative trait loci.
Yang, Jie; Wu, Rongling; Casella, George
2009-03-01
Functional mapping is a useful tool for mapping quantitative trait loci (QTL) that control dynamic traits. It incorporates mathematical aspects of biological processes into the mixture model-based likelihood setting for QTL mapping, thus increasing the power of QTL detection and the precision of parameter estimation. However, in many situations there is no obvious functional form and, in such cases, this strategy will not be optimal. Here we propose to use nonparametric function estimation, typically implemented with B-splines, to estimate the underlying functional form of phenotypic trajectories, and then construct a nonparametric test to find evidence of existing QTL. Using the representation of a nonparametric regression as a mixed model, the final test statistic is a likelihood ratio test. We consider two types of genetic maps: dense maps and general maps, and the power of nonparametric functional mapping is investigated through simulation studies and demonstrated by examples.
-
Aleksandrov, L.; Komatsu, T.; Nagamine, K.; Oishi, K.
2011-03-01
In this study, we focus on the structure and crystallization behavior of MoO3-La2O3-B2O3 and MoO3-ZnO-B2O3 glasses. Glasses of both systems were prepared by a melt-quenching method. The thermal stability of the glasses was examined using differential thermal anaysis (DTA) measurements, and the crystalline phases formed by heat treatments were identified by X-ray diffraction (XRD) analysis. Raman scattering spectra at room temperature for the glasses and crystallized samples were measured with a laser microscope operated with an Ar+ (wavelength: 488 nm) laser. DTA measurements indicated that the thermal stability against crystallization of the glasses decreases drastically with increasing MoO3 content. XRD analysis confirmed that crystallization at 600°C for 3 h of glass with the nominal composition of 50MoO3-25La2O3-25B2O3 resulted in the formation of monoclinic LaMoBO6. Crystallization of 50ZnO-xMoO3-(50-x)B2O3 glasses formed triclinic α-ZnMoO4 as an initial crystalline phase. Moreover, for 30 mol% MoO3 glass, transmission electron microscopy observations showed the formation of α-ZnMoO4 nanocrystals with a diameter of ~ 5 nm. Raman bands at 860, 930 and 950 cm-1 suggested that the coordination state of Mo6+ ions in the glasses were mainly (MoO4)2- tetrahedral units. Therefore, MoO3-containing glasses have good potential for optical applications.
-
Misexpression of cyclin B3 leads to aberrant spermatogenesis.
Refik-Rogers, Jale; Manova, Katia; Koff, Andrew
2006-09-01
Mus musculus cyclin B3 is an early meiotic cyclin that is expressed in leptotene and zygotene phases during gametogenesis. In order to determine whether downregulation of cyclin B3 at zygotene-pachytene transition was important for normal spermatogenesis, we investigated the consequences of expressing H. sapiens cyclin B3 after zygotene in mouse testes. Prolonging expression of cyclin B3 until the end of meiosis led to a reduction in sperm counts and disruption of spermatogenesis in four independent lines of transgenic mice. There were three distinct morphological defects associated with the ectopic expression of cyclin B3. Seminiferous tubules were either depleted of germ cells, had an abnormal cell mass in the lumen, or were characterized by the presence of abnormal round spermatids. These defects were associated with increased apoptosis in the testes. These results suggest that downregulation of cyclin B3 at the zygotene-pachytene transition is required to ensure normal spermatogenesis.
-
Energy Technology Data Exchange (ETDEWEB)
NONE
1999-01-01
Described herein are the results of the comprehensive analysis of the No.B-3 Kumaishi Area, investigated in the FY 1995 to 1997 period as part of the geothermal development promotion investigation project. The ground investigation project covers geological and altered band, geochemical, gravitational and electromagnetic investigations. The drilling investigation project covers the test drilling for the structural investigation, temperature logging, water injection and temperature recovery tests at the N7-KI-1, N7-KI-2, N8-KI-3, N8-KI-4 and N9-KI-5; core cutting investigation; hot water investigation at the 4 wells; environmental impact investigation; and supplementary investigations for determination of ages of rocks and alteration, and analysis of the substances contained in the fluid. The following conclusions are derived from the findings by the comprehensive analysis. The geothermal hot water in the test area came from seawater (fossil seawater) locally captured by the highly water-permeable strata (e.g., interfaces in the strata, and fractured strata) and underground water from rain water, heated by the conducted heat to around 200 degrees C at the highest. It is estimated that the center of the conducted heat is located in the eastern part of the Yagumo Area. (NEDO)
-
Trait Emotional Intelligence and Personality
Furnham, Adrian; Petrides, K. V.
2015-01-01
This study investigated if the linkages between trait emotional intelligence (trait EI) and the Five-Factor Model of personality were invariant between men and women. Five English-speaking samples (N = 307-685) of mostly undergraduate students each completed a different measure of the Big Five personality traits and either the full form or short form of the Trait Emotional Intelligence Questionnaire (TEIQue). Across samples, models predicting global TEIQue scores from the Big Five were invariant between genders, with Neuroticism and Extraversion being the strongest trait EI correlates, followed by Conscientiousness, Agreeableness, and Openness. However, there was some evidence indicating that the gender-specific contributions of the Big Five to trait EI vary depending on the personality measure used, being more consistent for women. Discussion focuses on the validity of the TEIQue as a measure of trait EI and its psychometric properties, more generally. PMID:25866439
-
Multi-view and 3D deformable part models.
Pepik, Bojan; Stark, Michael; Gehler, Peter; Schiele, Bernt
2015-11-01
As objects are inherently 3D, they have been modeled in 3D in the early days of computer vision. Due to the ambiguities arising from mapping 2D features to 3D models, 3D object representations have been neglected and 2D feature-based models are the predominant paradigm in object detection nowadays. While such models have achieved outstanding bounding box detection performance, they come with limited expressiveness, as they are clearly limited in their capability of reasoning about 3D shape or viewpoints. In this work, we bring the worlds of 3D and 2D object representations closer, by building an object detector which leverages the expressive power of 3D object representations while at the same time can be robustly matched to image evidence. To that end, we gradually extend the successful deformable part model [1] to include viewpoint information and part-level 3D geometry information, resulting in several different models with different level of expressiveness. We end up with a 3D object model, consisting of multiple object parts represented in 3D and a continuous appearance model. We experimentally verify that our models, while providing richer object hypotheses than the 2D object models, provide consistently better joint object localization and viewpoint estimation than the state-of-the-art multi-view and 3D object detectors on various benchmarks (KITTI [2] , 3D object classes [3] , Pascal3D+ [4] , Pascal VOC 2007 [5] , EPFL multi-view cars[6] ).
-
Vecchione, Michele; Alessandri, Guido; Roccas, Sonia; Caprara, Gian Vittorio
2018-05-27
The present study examines the longitudinal association between basic personal values and the Big Five personality traits. A sample of 546 young adults (57% females) with a mean age of 21.68 years (SD = 1.60) completed the Portrait Values Questionnaire and the Big Five Questionnaire at three-time points, each separated by an interval of four years. Cross-lagged models were used to investigate the possible reciprocal relations between traits and values, after the stability of the variables was taken into account. We found that values did not affect trait development. Traits, by contrast, have some effects on how values change. Specifically, high levels of agreeableness predict an increase over time in the importance assigned to benevolence values. Similarly, high levels of openness predict a later increase in the importance assigned to self-direction values. The same effect was not found for the other traits. Additionally, except for in the case of emotional stability, traits showed synchronous (i.e., within wave) correlations with values, suggesting that part of this relationship is due to common antecedents. Mechanisms underlying the associations between traits and values are discussed. This article is protected by copyright. All rights reserved. © 2018 Wiley Periodicals, Inc.
-
Effects of NR1 splicing on NR1/NR3B-type excitatory glycine receptors
Directory of Open Access Journals (Sweden)
Orth Angela
2009-04-01
Full Text Available Abstract Background N-methyl-D-aspartate receptors (NMDARs are the most complex of ionotropic glutamate receptors (iGluRs. Subunits of this subfamily assemble into heteromers, which – depending on the subunit combination – may display very different pharmacological and electrophysiological properties. The least studied members of the NMDAR family, the NR3 subunits, have been reported to assemble with NR1 to form excitatory glycine receptors in heterologous expression systems. The heterogeneity of NMDARs in vivo is in part conferred to the receptors by splicing of the NR1 subunit, especially with regard to proton sensitivity. Results Here, we have investigated whether the NR3B subunit is capable of assembly with each of the eight functional NR1 splice variants, and whether the resulting receptors share the unique functional properties described for NR1-1a/NR3. We provide evidence that functional excitatory glycine receptors formed regardless of the NR1 isoform, and their pharmacological profile matched the one reported for NR1-1a/NR3: glycine alone fully activated the receptors, which were insensitive to glutamate and block by Mg2+. Surprisingly, amplitudes of agonist-induced currents showed little dependency on the C-terminally spliced NR1 variants in NR1/NR3B diheteromers. Even more strikingly, NR3B conferred proton sensitivity also to receptors containing NR1b variants – possibly via disturbing the "proton shield" of NR1b splice variants. Conclusion While functional assembly could be demonstrated for all combinations, not all of the specific interactions seen for NR1 isoforms with coexpressed NR2 subunits could be corroborated for NR1 assembly with NR3. Rather, NR3 abates trafficking effects mediated by the NR1 C terminus as well as the N-terminally mediated proton insensitivity. Thus, this study establishes that NR3B overrides important NR1 splice variant-specific receptor properties in NR1/NR3B excitatory glycine receptors.
-
DEFF Research Database (Denmark)
Bæk, Kristoffer Torbjørn; Thøgersen, Louise; Mogensen, René G.
2015-01-01
, reduced expression of virulence traits, induced expression of the stress-associated transcriptional regulator, Spx, and slow growth. A subsequent acquired loss-of-function mutation in clpX partly alleviated the growth defect conferred by the rpoB mutation without changing antibiotic susceptibility...
-
Gow, Rachel V; Vallee-Tourangeau, Frederic; Crawford, Michael Angus; Taylor, Eric; Ghebremeskel, Kebreab; Bueno, Allain A; Hibbeln, Joseph R; Sumich, Alexander; Rubia, Katya
2013-06-01
A number of research studies have reported abnormal plasma fatty acid profiles in children with ADHD along with some benefit of n-3 to symptoms of ADHD. However, it is currently unclear whether (lower) long chain-polyunsaturated fatty acids (LC-PUFAs) are related to ADHD pathology or to associated behaviours. The aim of this study was to test whether (1) ADHD children have abnormal plasma LC-PUFA levels and (2) ADHD symptoms and associated behaviours are correlated with LC-PUFA levels. Seventy-two, male children with (n=29) and without a clinical diagnosis of ADHD (n=43) were compared in their plasma levels of LC-PUFA. Plasma DHA was higher in the control group prior to statistical correction. Callous-unemotional (CU) traits were found to be significantly negatively related to both eicosapentaenoic acid (EPA), and total omega-3 in the ADHD group. The findings unveil for the first time that CU and anti-social traits in ADHD are associated with lower omega-3 levels. Copyright © 2013 Elsevier Ltd. All rights reserved.
-
Association between the ABO locus and hematological traits in Korean
Directory of Open Access Journals (Sweden)
Hong Kyung-Won
2012-09-01
Full Text Available Abstract Background Recently, genome-wide association studies identified a pleiotropic gene locus, ABO, as being significantly associated with hematological traits. To confirm the effects of ABO on hematological traits, we examined the link between the ABO locus and hematological traits in Korean population-based cohorts. Results Six tagging SNPs for ABO were analyzed with regard to their effects on hematological traits [white blood cell count (WBC, red blood cell count (RBC, platelet (Plat, mean corpuscular volume (MCV, and mean corpuscular haemoglobin concentration (MCHC]. Linear regression analyses were performed, controlling for recruitment center, sex, and age as covariates. Of the 6 tagging SNPs, 3 (rs2073823, rs8176720, and rs495828 and 3 (rs2073823, rs8176717, and rs687289 were significantly associated with RBC and MCV, respectively (Bonferroni correction p-value criteria r2s = 0.99. Of the remaining 3 SNPs (rs8176720, rs8176717 and rs687289, rs8176717 generated an independent signal with moderate p-value (= 0.045 when it was adjusted for by rs2073823 (the most significant SNP. We also identified a copy number variation (CNV that was tagged by the SNP rs8176717, the minor allele of which correlated with the deletion allele of CNV. Our haplotype analysis indicated that the haplotype that contained the CNV deletion was significantly associated with MCV (β ± se = 0.363 ± 0.118, p =2.09 × 10-3. Conclusions Our findings confirm that ABO is one of the genetic factors that are associated with hematological traits in the Korean population. This result is notable, because GWASs fail to evaluate the link between a CNV and phenotype traits.
-
THE ESTIMATION OF CARCASS TRAITS OF BALI BULLS USING ULTRASOUND
Directory of Open Access Journals (Sweden)
A.B. Sri Rachma
2014-10-01
Full Text Available A study was conducted to collect information on Bali bulls carcass traits estimation as one of theselection criteria using ultrasound. Ultrasonic estimation of carcass traits such as M. longissimusthoracis area (MLTA, Subcutaneous Fat Thickness (SFT, Inter Muscular Fat Thickness (IMFT, RibThickness (RT and Beef Marbling Score (BMS were obtained from 92 head of bulls at Barru districtand 74 head of bulls at Bone district, South Sulawesi, Indonesia. The carcass traits estimation werescanned between the 6th - 7th ribs using ultrasound. The ultrasound is made of Fujihira Super-Eye FHK,Co. Meat. Ltd. with B-Mode and electronic linear probe, which used frequency of 2 MHz. The carcasstraits estimation photos were printed by video-copy machine (Aloka Co. Ltd., SSZ-300S. The dataobtained were analyzed using basic statistic and was discussed descriptively. The averages of all carcasstraits estimation of the Bali bull at Bone district at 12, 18 and 24 months of ages were higher than thoseat Barru district. The MLTA estimation of Bali bulls at Bone and Barru districts were 18.0 cm2, 24.3cm2, 23.8 cm2 Vs 16.6 cm2, 18.5 cm2, 23.3 cm2, respectively; the BMS estimated were 0.14, 0.24 and0.20 Vs 0.00, 0.15 and 0.17, respectively; the SFT estimation were 0.26 mm, 0.33 mm, 0.34 mm Vs0.28 mm, 0.26 mm, 0.34 mm, respectively; the IMFT estimation were 1.13 mm, 1.24 mm, 1.31 mm Vs0.97 mm, 1.06 mm, 1.14 mm, respectively; the RT estimation were 2.04 mm, 2.52 mm, 2.72 mm Vs1.19 mm, 2.12 mm, 2.30 mm, respectively. The growth of MLTA, SFT, IMFT, RT and BMS of thebulls of Bali cattle at the 12, 18 and 24 months of age were not reaching the optimally performances,yet. Therefore the selection process of the bulls of Bali cattle to be candidate of sire based on theestimation of carcass traits should be done after since 4 years of age.
-
Andreeva, Valentina A; Touvier, Mathilde; Kesse-Guyot, Emmanuelle; Julia, Chantal; Galan, Pilar; Hercberg, Serge
2012-04-09
To advance knowledge about the cancer-chemopreventive potential of individual nutrients, we investigated the effects of B vitamin and/or ω-3 fatty acid supplements on cancer outcomes among survivors of cardiovascular disease. This was an ancillary study of the Supplementation With Folate, Vitamins B(6) and B(12) and/or Omega-3 Fatty Acids (SU.FOL.OM3) secondary prevention trial (2003-2009). In all, 2501 individuals aged 45 to 80 years were randomized in a 2 × 2 factorial design to one of the following 4 daily supplementation groups: (1) 5-methyltetrahydrofolate (0.56 mg), pyridoxine hydrochloride (vitamin B(6); 3 mg) and cyanocobalamin (vitamin B(12); 0.02 mg); (2) eicosapentaenoic and docosahexaenoic acid (600 mg) in a 2:1 ratio; (3) B vitamins and ω-3 fatty acids; or (4) placebo. Overall and sex-specific hazard ratios (HRs) and 95% CIs regarding the cancer outcomes were estimated with Cox proportional hazards models. After 5 years of supplementation, incident cancer was validated in 7.0% of the sample (145 events in men and 29 in women), and death from cancer occurred in 2.3% of the sample. There was no association between cancer outcomes and supplementation with B vitamins (HR, 1.15 [95% CI, 0.85-1.55]) and/or ω-3 fatty acids (HR, 1.17 [95% CI, 0.87-1.58]). There was a statistically significant interaction of treatment by sex, with no effect of treatment on cancer risk among men and increased cancer risk among women for ω-3 fatty acid supplementation (HR, 3.02 [95% CI, 1.33-6.89]). We found no beneficial effects of supplementation with relatively low doses of B vitamins and/or ω-3 fatty acids on cancer outcomes in individuals with prior cardiovascular disease. Trial Registration isrctn.org Identifier: ISRCTN41926726.
-
14 CFR Appendix B to Part 27 - Airworthiness Criteria for Helicopter Instrument Flight
2010-01-01
... 14 Aeronautics and Space 1 2010-01-01 2010-01-01 false Airworthiness Criteria for Helicopter... Appendix B to Part 27—Airworthiness Criteria for Helicopter Instrument Flight I. General. A normal category helicopter may not be type certificated for operation under the instrument flight rules (IFR) of this chapter...
-
Directory of Open Access Journals (Sweden)
Md Moshiur Rahman
Full Text Available Environmental and ecological conditions can shape the evolution of life history traits in many animals. Among such factors, food or nutrition availability can play an important evolutionary role in moderating an animal's life history traits, particularly sexually selected traits. Here, we test whether diet quantity and/or composition in the form of omega-3 long chain polyunsaturated fatty acids (here termed 'n3LC' influence the expression of pre- and postcopulatory traits in the guppy (Poecilia reticulata, a livebearing poeciliid fish. We assigned males haphazardly to one of two experimental diets supplemented with n3LC, and each of these diet treatments was further divided into two diet 'quantity' treatments. Our experimental design therefore explored the main and interacting effects of two factors (n3LC content and diet quantity on the expression of precopulatory (sexual behaviour and sexual ornamentation, including the size, number and spectral properties of colour spots and postcopulatory (the velocity, viability, number and length of sperm sexually selected traits. Our study revealed that diet quantity had significant effects on most of the pre- and postcopulatory traits, while n3LC manipulation had a significant effect on sperm traits and in particular on sperm viability. Our analyses also revealed interacting effects of diet quantity and n3LC levels on courtship displays, and the area of orange and iridescent colour spots in the males' colour patterns. We also confirmed that our dietary manipulations of n3LC resulted in the differential uptake of n3LC in body and testes tissues in the different n3LC groups. This study reveals the effects of diet quantity and n3LC on behavioural, ornamental and ejaculate traits in P. reticulata and underscores the likely role that diet plays in maintaining the high variability in these condition-dependent sexual traits.
-
Isolating Trait and Method Variance in the Measurement of Callous and Unemotional Traits.
Paiva-Salisbury, Melissa L; Gill, Andrew D; Stickle, Timothy R
2017-09-01
To examine hypothesized influence of method variance from negatively keyed items in measurement of callous-unemotional (CU) traits, nine a priori confirmatory factor analysis model comparisons of the Inventory of Callous-Unemotional Traits were evaluated on multiple fit indices and theoretical coherence. Tested models included a unidimensional model, a three-factor model, a three-bifactor model, an item response theory-shortened model, two item-parceled models, and three correlated trait-correlated method minus one models (unidimensional, correlated three-factor, and bifactor). Data were self-reports of 234 adolescents (191 juvenile offenders, 43 high school students; 63% male; ages 11-17 years). Consistent with hypotheses, models accounting for method variance substantially improved fit to the data. Additionally, bifactor models with a general CU factor better fit the data compared with correlated factor models, suggesting a general CU factor is important to understanding the construct of CU traits. Future Inventory of Callous-Unemotional Traits analyses should account for method variance from item keying and response bias to isolate trait variance.
-
26 CFR 48.4161(a)-3 - Parts and accessories.
2010-04-01
....4161(a)-3 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) MISCELLANEOUS EXCISE TAXES MANUFACTURERS AND RETAILERS EXCISE TAXES Sporting Goods § 48.4161(a)-3 Parts and accessories. (a) In general. The tax attaches with respect to parts and accessories for articles specified in...
-
Geological studies of the COST No. B-3 Well, United States Mid-Atlantic continental slope area
Scholle, Peter A.
1980-01-01
The COST No. B-3 well is the first deep stratigraphic test to be drilled on the Continental Slope off the Eastern United States. The well was drilled in 2,686 ft (819 m) of water in the Baltimore Canyon trough area to a total depth of 15,820 ft (4,844 m) below the drill platform. It penetrated a section composed of mudstones, calcareous mudstones, and limestones of generally deep water origin to a depth of about 8.200 ft (2,500 m) below the drill floor. Light-colored, medium- to coarse-grained sandstones with intercalated gray and brown shales, micritic limestones, and minor coal and dolomite predominate from about 8,200 to 12,300 ft (2,500 to 3,750 m). From about 12,300 ft (3,750 m) to the bottom, the section consists of limestones (including oolitic and intraclastic grainstones) with interbedded fine-to medium-grained sandstones, dark-colored fissile shales, and numerous coal seams. Biostratigraphic examination has shown that the section down to approximately 6,000 ft (1,830 m) is Tertiary. The boundary between the Lower and Upper Cretaceous sections is placed between 8,600 and 9,200 ft (2,620 and 2,800 m) by various workers. Placement of the Jurassic-Cretaceous boundary shows an even greater range based on different organisms; it is placed variously between 12,250 and 13,450 ft (3,730 and 5,000 m). The oldest unit penetrated in the well is considered to be Upper Jurassic (Kimmeridgian) by some workers and Middle Jurassic (Callovian) by others. The Lower Cretaceous and Jurassic parts of the section represent nonmarine to shallow-marine shelf sedimentation. Upper Cretaceous and Tertiary units reflect generally deeper water conditions at the B-3 well site and show a general transition from deposition at shelf to slope water depths. Examination of cores, well cuttings, and electric logs indicates that potential hydrocarbon-reservoir units are present throughout the Jurassic and Cretaceous section. Porous and moderately permeable limestones and sandstones have been
-
Hornoy, Benjamin; Tarayre, Michèle; Hervé, Maxime; Gigord, Luc; Atlan, Anne
2011-01-01
Several hypotheses that attempt to explain invasive processes are based on the fact that plants have been introduced without their natural enemies. Among them, the EICA (Evolution of Increased Competitive Ability) hypothesis is the most influential. It states that, due to enemy release, exotic plants evolve a shift in resource allocation from defence to reproduction or growth. In the native range of the invasive species Ulex europaeus, traits involved in reproduction and growth have been shown to be highly variable and genetically correlated. Thus, in order to explore the joint evolution of life history traits and susceptibility to seed predation in this species, we investigated changes in both trait means and trait correlations. To do so, we compared plants from native and invaded regions grown in a common garden. According to the expectations of the EICA hypothesis, we observed an increase in seedling height. However, there was little change in other trait means. By contrast, correlations exhibited a clear pattern: the correlations between life history traits and infestation rate by seed predators were always weaker in the invaded range than in the native range. In U. europaeus, the role of enemy release in shaping life history traits thus appeared to imply trait correlations rather than trait means. In the invaded regions studied, the correlations involving infestation rates and key life history traits such as flowering phenology, growth and pod density were reduced, enabling more independent evolution of these key traits and potentially facilitating local adaptation to a wide range of environments. These results led us to hypothesise that a relaxation of genetic correlations may be implied in the expansion of invasive species.
-
Directory of Open Access Journals (Sweden)
Benjamin Hornoy
Full Text Available Several hypotheses that attempt to explain invasive processes are based on the fact that plants have been introduced without their natural enemies. Among them, the EICA (Evolution of Increased Competitive Ability hypothesis is the most influential. It states that, due to enemy release, exotic plants evolve a shift in resource allocation from defence to reproduction or growth. In the native range of the invasive species Ulex europaeus, traits involved in reproduction and growth have been shown to be highly variable and genetically correlated. Thus, in order to explore the joint evolution of life history traits and susceptibility to seed predation in this species, we investigated changes in both trait means and trait correlations. To do so, we compared plants from native and invaded regions grown in a common garden. According to the expectations of the EICA hypothesis, we observed an increase in seedling height. However, there was little change in other trait means. By contrast, correlations exhibited a clear pattern: the correlations between life history traits and infestation rate by seed predators were always weaker in the invaded range than in the native range. In U. europaeus, the role of enemy release in shaping life history traits thus appeared to imply trait correlations rather than trait means. In the invaded regions studied, the correlations involving infestation rates and key life history traits such as flowering phenology, growth and pod density were reduced, enabling more independent evolution of these key traits and potentially facilitating local adaptation to a wide range of environments. These results led us to hypothesise that a relaxation of genetic correlations may be implied in the expansion of invasive species.
-
Genetic correlations between ewe reproduction and carcass and meat quality traits in Merino sheep.
Safari, E; Fogarty, N M; Hopkins, D L; Greeff, J C; Brien, F D; Atkins, K D; Mortimer, S I; Taylor, P J; van der Werf, J H J
2008-12-01
Genetic correlations between reproduction traits in ewes and carcass and meat quality traits in Merino rams were obtained using restricted maximum likelihood procedures. The carcass data were from 5870 Merino rams slaughtered at approximately 18 months of age that were the progeny of 543 sires from three research resource flocks over 7 years. The carcass traits included ultrasound scan fat and eye muscle depth (EMDUS) measured on live animals, dressing percentage and carcass tissue depth (at the GR site FATGR and C site FATC), eye muscle depth, width and area and the meat quality indicator traits of muscle final pH and colour (L*, a*, b*). The reproduction data consisted of 13 464 ewe joining records for number of lambs born and weaned and 9015 records for LS. The genetic correlations between reproduction and fat measurements were negative (range -0.06 +/- 0.12 to -0.37 +/- 0.12), with smaller correlations for live measurement than carcass traits. There were small favourable genetic correlations between reproduction traits and muscle depth in live rams (EMDUS, 0.10 +/- 0.12 to 0.20 +/- 0.12), although those with carcass muscle traits were close to zero. The reproduction traits were independent of meat colour L* (relative brightness), but tended to be favourably correlated with meat colour a* (relative redness, 0.12 +/- 0.17 to 0.19 +/- 0.16). There was a tendency for meat final pH to have small negative favourable genetic correlations with reproduction traits (0.05 +/- 0.11 to -0.17 +/- 0.12). This study indicates that there is no antagonism between reproduction traits and carcass and meat quality indicator traits, with scope for joint improvement of reproduction, carcass and meat quality traits in Merino sheep.
-
Sexual selection and magic traits in speciation with gene flow
Directory of Open Access Journals (Sweden)
Maria R. SERVEDIO, Michael KOPP
2012-06-01
Full Text Available The extent to which sexual selection is involved in speciation with gene flow remains an open question and the subject of much research. Here, we propose that some insight can be gained from considering the concept of magic traits (i.e., traits involved in both reproductive isolation and ecological divergence. Both magic traits and other, “non-magic”, traits can contribute to speciation via a number of specific mechanisms. We argue that many of these mechanisms are likely to differ widely in the extent to which they involve sexual selection. Furthermore, in some cases where sexual selection is present, it may be prone to inhibit rather than drive speciation. Finally, there are a priori reasons to believe that certain categories of traits are much more effective than others in driving speciation. The combination of these points suggests a classification of traits that may shed light on the broader role of sexual selection in speciation with gene flow. In particular, we suggest that sexual selection can act as a driver of speciation in some scenarios, but may play a negligible role in potentially common categories of magic traits, and may be likely to inhibit speciation in common categories of non-magic traits [Current Zoology 58 (3: 507–513, 2012].
-
Quantitative trait loci (QTL) mapping for inflorescence length traits in ...
African Journals Online (AJOL)
Lablab purpureus (L.) sweet is an ancient legume species whose immature pods serve as a vegetable in south and south-east Asia. The objective of this study is to identify quantitative trait loci (QTLs) associated with quantitative traits such as inflorescence length, peduncle length from branch to axil, peduncle length from ...
-
Low trait self-control predicts self-handicapping.
Uysal, Ahmet; Knee, C Raymond
2012-02-01
Past research has shown that self-handicapping stems from uncertainty about one's ability and self-presentational concerns. The present studies suggest that low dispositional self-control is also associated with self-handicapping. In 3 studies (N = 289), the association between self-control and self-handicapping was tested. Self-control was operationalized as trait self-control, whereas self-handicapping was operationalized as trait self-handicapping in Study 1 (N = 160), self-reported self-handicapping in Study 2 (N = 74), and behavioral self-handicapping in Study 3 (N = 55). In all 3 studies, hierarchical regression analyses revealed that low self-control predicts self-handicapping, independent of self-esteem, self-doubt, social desirability, and gender. © 2012 The Authors. Journal of Personality © 2012, Wiley Periodicals, Inc.
-
Directory of Open Access Journals (Sweden)
Zhiying Deng
2017-12-01
Full Text Available Spike-related traits such as spike length (Sl, fertile spikelet number (Fsn, sterile spikelet number (Ssn, grain number per spike (Gns, and thousand-kernel weight (Tkw are important factors influencing wheat yield. However, reliably stable markers that can be used for molecular breeding in different environments have not yet been identified. In this study, a double haploid (DH population was used for quantitative trait locus (QTL mapping of five spike-related traits under four different nitrogen (N supply dates in two locations and years. Seventy additive QTLs with phenotypic variation ranging from 4.12 to 34.74% and 10 major epistatic QTLs were identified. Eight important chromosomal regions on five chromosomes (1B, 2B, 2D, 5D, and 6A were found. Sixteen stable QTLs were detected for which N application had little effect. Among those stable QTLs, QSl.sdau-2D-1, and QSl.sdau-2D-2, with phenotypic variation explained (PVE of 10.4 and 24.2%, respectively, were flanked by markers Xwmc112 and Xcfd53 in the same order. The QTLs QSsn.sdau-2B-1, QFsn.sdau-2B-1, and QGns.sdau-2B, with PVE ranging from 4.37 to 28.43%, collocated in the Xwmc179-Xbarc373 marker interval. The consistent kernel wheat QTL (QTkw.sdau-6A on the long arm of chromosome 6A, flanked by SSR markers Xbarc1055 and Xwmc553, showed PVE of 5.87–15.18%. Among these stable QTLs, the two flanking markers Xwmc112 and Xcfd53 have been validated using different varieties and populations for selecting Sl. Therefore, these results will be of great value for marker-assisted selection (MAS in breeding programs and will accelerate the understanding of the genetic relationships among spike-related traits at the molecular level.
-
Deng, Zhiying; Cui, Yong; Han, Qingdian; Fang, Wenqi; Li, Jifa; Tian, Jichun
2017-01-01
Spike-related traits such as spike length (Sl), fertile spikelet number (Fsn), sterile spikelet number (Ssn), grain number per spike (Gns), and thousand-kernel weight (Tkw) are important factors influencing wheat yield. However, reliably stable markers that can be used for molecular breeding in different environments have not yet been identified. In this study, a double haploid (DH) population was used for quantitative trait locus (QTL) mapping of five spike-related traits under four different nitrogen (N) supply dates in two locations and years. Seventy additive QTLs with phenotypic variation ranging from 4.12 to 34.74% and 10 major epistatic QTLs were identified. Eight important chromosomal regions on five chromosomes (1B, 2B, 2D, 5D, and 6A) were found. Sixteen stable QTLs were detected for which N application had little effect. Among those stable QTLs, QSl.sdau-2D-1 , and QSl.sdau-2D-2 , with phenotypic variation explained (PVE) of 10.4 and 24.2%, respectively, were flanked by markers Xwmc112 and Xcfd53 in the same order. The QTLs QSsn.sdau-2B-1, QFsn.sdau-2B-1 , and QGns.sdau-2B , with PVE ranging from 4.37 to 28.43%, collocated in the Xwmc179 - Xbarc373 marker interval. The consistent kernel wheat QTL ( QTkw.sdau-6A ) on the long arm of chromosome 6A, flanked by SSR markers Xbarc1055 and Xwmc553 , showed PVE of 5.87-15.18%. Among these stable QTLs, the two flanking markers Xwmc112 and Xcfd53 have been validated using different varieties and populations for selecting Sl. Therefore, these results will be of great value for marker-assisted selection (MAS) in breeding programs and will accelerate the understanding of the genetic relationships among spike-related traits at the molecular level.
-
Personality traits and psychotic symptoms in recent onset of psychosis patients.
Sevilla-Llewellyn-Jones, Julia; Cano-Domínguez, Pablo; de-Luis-Matilla, Antonia; Peñuelas-Calvo, Inmaculada; Espina-Eizaguirre, Alberto; Moreno-Kustner, Berta; Ochoa, Susana
2017-04-01
Personality in patients with psychosis, and particularly its relation to psychotic symptoms in recent onset of psychosis (ROP) patients, is understudied. The aims of this research were to study the relation between dimensional and categorical clinical personality traits and symptoms, as well as the effects that symptoms, sex and age have on clinically significant personality traits. Data for these analyses were obtained from 94 ROP patients. The Millon Clinical Multiaxial Inventory and the Positive and Negative Syndrome Scale were used to assess personality and symptoms. Correlational Analysis, Mann-Whitney test, and, finally, logistic regression were carried out. The negative dimension was higher in patients with schizoid traits. The excited dimension was lower for those with avoidant and depressive traits. The anxiety and depression dimension was higher for patients with dependent traits. The positive dimension was lower for patients with histrionic and higher for patients with compulsive traits. Logistic regression demonstrated that gender and the positive and negative dimensions explained 35.9% of the variance of the schizoid trait. The excited dimension explained 9.1% of the variance of avoidant trait. The anxiety and depression dimension and age explained 31.3% of the dependent trait. Gender explained 11.6% of the histrionic trait, 14.5% of the narcissistic trait and 11.6% of the paranoid trait. Finally gender and positive dimension explained 16.1% of the compulsive trait. The study highlights the importance of studying personality in patients with psychosis as it broadens understating of the patients themselves and the symptoms suffered. Copyright © 2017 Elsevier Inc. All rights reserved.
-
20 CFR 229.3 - Other regulations related to this part.
2010-04-01
... family relationships which may cause an annuity to be increased under this part. Part 225 explains how... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Other regulations related to this part. 229.3 Section 229.3 Employees' Benefits RAILROAD RETIREMENT BOARD REGULATIONS UNDER THE RAILROAD RETIREMENT ACT...
-
Do personality traits predict work outcomes of certified nursing assistants?
Kovach, Christine R; Simpson, Michelle R; Reitmaier, Amy B; Johnson, Addie; Kelber, Sheryl T
2010-10-01
The purposes of this study were to describe personality traits of certified nursing assistants (CNAs) employed at nursing homes and explore relationships between personality traits, job satisfaction, and job performance. The sample included 177 CNAs providing direct care to residents in three nursing homes. CNAs with high and low job performance skills were distinguished by the cluster of traits associated with teamwork skills. Overall, 21.3% of the variance in job satisfaction was explained by the personality traits of Adjustment, Prudence, Likeability, Excitable, and Dutiful, F(8, 145) = 4.899, p personality, job satisfaction, and job performance provide important information about the personality traits of nursing staff who are most likely to enjoy and perform well in the nursing home setting. Knowledge of these links may be useful for hiring the appropriate person for direct care nursing home positions. Copyright 2010, SLACK Incorporated.
-
Directory of Open Access Journals (Sweden)
Yanshi Xia
Full Text Available Light-harvesting chlorophyll a/b-binding protein (LHCP is one of the most abundant chloroplast proteins in plants. Its main function is to collect and transfer light energy to photosynthetic reaction centers. However, the roles of different LHCPs in light-harvesting antenna systems remain obscure. Exploration of nucleotide variation in the genes encoding LHCP can facilitate a better understanding of the functions of LHCP. In this study, nucleotide variations in Lhcb1, a LHCP gene in barley, were investigated across 292 barley accessions collected from 35 different countries using EcoTILLING technology, a variation of the Targeting Induced Local Lesions In Genomes (TILLING. A total of 23 nucleotide variations were detected including three insert/deletions (indels and 20 single nucleotide polymorphisms (SNPs. Among them, 17 SNPs were in the coding region with nine missense changes. Two SNPs with missense changes are predicted to be deleterious to protein function. Seventeen SNP formed 31 distinguishable haplotypes in the barley collection. The levels of nucleotide diversity in the Lhcb1 locus differed markedly with geographic origins and species of accessions. The accessions from Middle East Asia exhibited the highest nucleotide and haplotype diversity. H. spontaneum showed greater nucleotide diversity than H. vulgare. Five SNPs in Lhcb1 were significantly associated with at least one of the six agronomic traits evaluated, namely plant height, spike length, number of grains per spike, thousand grain weight, flag leaf area and leaf color, and these SNPs may be used as potential markers for improvement of these barley traits.
-
Metallic superconductors. 3. Na3Sn and V3Ga wires (Part one)
International Nuclear Information System (INIS)
Tachikawa, Kyoji
2010-01-01
Nowadays Nb 3 Sn wires are being widely used as one of the key materials in advanced science and technology, with various applications such as NMR, fusion and cryogen-free superconducting magnets. In this article, at first microstructures and fundamental aspects as well as the effect of additional elements in Nb 3 Sn are outlined. Intrinsic superconducting performances, e.g. T c and B c2 , are quite sensitive to the stoichiometry of the Sn concentration. A small amount of Ti and Ta doping is much effective for the increase of B c2 in Nb 3 Sn. The effect of Cu on the enhancement of Nb 3 Sn synthesis has yielded a significant breakthrough for the industrial production of the wires. At present the bronze process and internal Sn process are the twin major fabrication techniques of Nb 3 Sn wires. The recent status of both processes is reviewed in this article. Pronounced progress has been achieved in the performance of Nb 3 Sn wires fabricated through both techniques. Although just half a century has passed since the first fabrication of Nb 3 Sn wire, further progress in Nb 3 Sn technology may be expected like the proverb saying 'Fresh water still comes out from an old spring'. (author)
-
Quantitative trait loci analysis of osteocondrosis traits in the elbow joint of pigs
DEFF Research Database (Denmark)
Christensen, O F; Busch, M E; Gregersen, V R
2010-01-01
Osteochondrosis is a growth disorder in the cartilage of young animals and is characterised by lesions found in the cartilage and bone. This study identified quantitative trait loci (QTLs) associated with six osteochondrosis lesion traits in the elbow joint of finishing pigs. The traits were: thi...
-
The bipolar II disorder personality traits, a true syndrome?
Gudmundsson, Einar
2015-06-01
The author was struck by the similarities and commonality of complaints, aside from mood swings, made by Bipolar II patients and started registrating these complaints. This registrational work eventually led to the development of The Bipolar II Syndome Checklist. The aim of this work was to understand how widely the Bipolar II disorder affects the personality, and what disturbing personality traits are the most common? Deliberately, no attempt was made to diagnose psychiatric comorbidities, in the hope that one would get a clearer view of what symptoms, if any, could be considered a natural part of the Bipolar II Disorder. As far as the author knows this is a novel approach. 105 Bipolar II patients completed the Bipolar II Syndrome Checklist. The answers to the 44 questions on the list are presented in tables. Symptoms like anxiety, low self esteem, paranoia, extreme hurtfulness, migraine, Post Partum Depression, obsessive traits, alcoholism in the family are amongst the findings which will be presented in greater detail. No control group. Bipolar I patients excluded. The Bipolar II Syndrome Checklist has not been systematically validated. The results show that Bipolar II Disorder causes multiple symptoms so commonly that it may be justified to describe it as a syndrome, The Bipolar II Syndrome. Also these disturbances commonly lie in families of Bipolar II patients and are in all likelihood, greatly underdiagnosed. The clinical relevance of this study lies in increasing our knowledge and understanding of the nature of the Bipolar II Disorder, which in all probability will increase the diagnostic and treatment accuracy, since clinicians are more likely to scan for other symptoms needing treatment. Copyright © 2015 Elsevier B.V. All rights reserved.
-
The effect of weather on morphometric traits of juvenile cliff swallows
Roche, Erin A.; Brown, Mary Bomberger; Brown, Charles R.
2015-01-01
Episodes of food deprivation may change how nestling birds allocate energy to the growth of skeletal and feather morphological traits during development. Cliff swallows (Petrochelidon pyrrhonota) are colonial, insectivorous birds that regularly experience brief periods of severe weather-induced food deprivation during the nesting season which may affect offspring development. We investigated how annual variation in timing of rearing and weather were associated with length of wing and tail, skeletal traits, and body mass in juvenile cliff swallows reared in southwestern Nebraska during 2001–2006. As predicted under conditions of food deprivation, nestling skeletal and feather measurements were generally smaller in cooler years. However, variability explained by weather was small, suggesting that morphometric traits of juvenile cliff swallows were not highly sensitive to weather conditions experienced during this study. Measurements of juvenile morphological traits were positively correlated with measurements taken as adults, meaning that any variation among juveniles in response to rearing conditions showed evidence of persisting into a bird’s first breeding season. Our results show that body size in this species is phenotypically plastic and influenced, in part, by weather variables.
-
Valadbeigi, Younes; Farrokhpour, Hossein; Tabrizchi, Mahmoud
2014-05-01
Isomerization and tautomerism of the three water soluble vitamins including B3, B5 and B7 were studied applying density functional theory using B3LYP method in gas and aqueous phases. Activation energies (Ea), Gibbs free energies of activation (ΔG#), and imaginary frequencies of the transition state structures were calculated for all the isomerization and tautomerism reactions. Activation energies of the neutral → zwitterion (amine-enamine) tautomerism in vitamin B3 were 310-360 kJ/mol where these values for the keto-enol tautomerism were 100-130 kJ/mol. It was found that water molecule catalyzes the tautomerism and decreases the activation energies about 90-160 kJ/mol.
-
2010-04-01
..., Ineligibility and Voluntary Exclusion-Lower Tier Covered Transactions B Appendix B to Part 513 Foreign Relations... Debarment, Suspension, Ineligibility and Voluntary Exclusion—Lower Tier Covered Transactions Instructions... is providing the certification set out below. 2. The certification in this clause is a material...
-
Adaptive traits of indigenous cattle breeds: The Mediterranean Baladi as a case study.
Shabtay, Ariel
2015-11-01
Generally taken, breeds of Bos taurus ancestry are considered more productive, in comparison with Bos indicus derived breeds that present enhanced hardiness and disease resistance, low nutritional requirements and higher capability of feed utilization. While breeds of B. taurus have been mostly selected for intensive production systems, indigenous cattle, developed mostly from indicine and African taurines, flourish in extensive habitats. Worldwide demographic and economic processes face animal production with new challenges - the increasing demand for animal food products. Intensification of animal husbandry is thus a desired goal in stricken parts of the world. An introduction of productive traits to indigenous breeds might serve to generate improved biological and economic efficiencies. For this to succeed, the genetic merit of traits like efficiency of feed utilization and product quality should be revealed, encouraging the conservation initiatives of indigenous cattle populations, many of which are already extinct and endangered. Moreover, to overcome potential genetic homogeneity, controlled breeding practices should be undertaken. The Baladi cattle are a native local breed found throughout the Mediterranean basin. Purebred Baladi animals are rapidly vanishing, as more European breeds are being introduced or used for backcrosses leading to improved production. The superiority of Baladi over large-framed cattle, in feedlot and on Mediterranean pasture, with respect to adaptability and efficiency, is highlighted in the current review. Copyright © 2015 Elsevier Ltd. All rights reserved.
-
Energy Technology Data Exchange (ETDEWEB)
Swartz, Carol D. [Department of Environmental Science and Engineering, University of North Carolina, Chapel Hill, NC 27599 (United States); King, Leon C.; Nesnow, Stephen [Environmental Carcinogenesis Division, US Environmental Protection Agency, Research Triangle Park, NC, 27711 (United States); Umbach, David M. [Biostatistics Branch, National Institute of Environmental Health Sciences, National Institutes of Health, DHHS, Research Triangle Park, NC 27709 (United States); Kumar, Subodh [Environmental Toxicology and Chemistry Laboratory, Great Lakes Center, State University of New York College at Buffalo, Buffalo, NY 14222 (United States); DeMarini, David M. [Environmental Carcinogenesis Division, US Environmental Protection Agency, Research Triangle Park, NC, 27711 (United States)], E-mail: demarini.david@epa.gov
2009-02-10
Sulfur-containing polycyclic aromatic hydrocarbons (thia-PAHs or thiaarenes) are common constituents of air pollution and cigarette smoke, but only a few have been studied for health effects. We evaluated the mutagenicity in Salmonella TA98, TA100, and TA104 of two sulfur-containing derivatives of benzo[c]phenanthrene, phenanthro[3,4-b]thiophene (P[3,4-b]T), and phenanthro[4,3-b]thiophene (P[4,3-b]T) as well as their dihydrodiol and sulfone derivatives. In addition, we assessed levels of stable DNA adducts (by {sup 32}P-postlabeling) as well as abasic sites (by an aldehydic-site assay) produced by six of these compounds in TA100. P[3,4-b]T and its 6,7- and 8,9-diols, P[3,4-b]T sulfone, P[4,3-b]T, and its 8,9-diol were mutagenic in TA100. P[3,4-b]T sulfone, the most potent mutagen, was approximately twice as potent as benzo[a]pyrene in both TA98 and TA100. Benzo-ring dihydrodiols were much more potent than K-region dihydrodiols, which had little or no mutagenic activity in any strain. P[3,4-b]T sulfone produced abasic sites and not stable DNA adducts; the other five compounds examined, B[c]P, B[c]P 3,4-diol, P[3,4-b]T, P[3,4-b]T 8,9-diol, and P[4,3-b]T 8,9-diol, produced only stable DNA adducts. P[3,4-b]T sulfone was the only compound that produced significant levels of frameshift mutagenicity and induced mutations primarily at GC sites. In contrast, B[c]P, its 3,4-diol, and the 8,9 diols of the phenanthrothiophenes induced mutations primarily at AT sites. P[3,4-b]T was not mutagenic in TA104, whereas P[3,4-b]T sulfone was. The two isomeric forms (P[3,4-b]T and P[4,3-b]T) are apparently activated differently, with the latter, but not the former, involving a diol pathway. This study is the first illustrating the potential importance of abasic sites in the mutagenicity of thia-PAHs.
-
12 CFR Appendix B to Part 707 - Model Clauses and Sample Forms
2010-01-01
...) B-8—Sample Form (Money Market Share Account Disclosures) B-9—Sample Form (Term Share (Certificate... money market accounts. These are some of the more common limitations applicable. The credit union... will assist members in reviewing and understanding the change. B-3Model Clauses for Pre-Maturity...
-
Jansen, Constantin; Zhang, Yongzhong; Liu, Hongjun; Gonzalez-Portilla, Pedro J; Lauter, Nick; Kumar, Bharath; Trucillo-Silva, Ignacio; Martin, Juan Pablo San; Lee, Michael; Simcox, Kevin; Schussler, Jeff; Dhugga, Kanwarpal; Lübberstedt, Thomas
2015-07-01
Exploring and understanding the genetic basis of cob biomass in relation to grain yield under varying nitrogen management regimes will help breeders to develop dual-purpose maize. With rising energy demands and costs for fossil fuels, alternative energy from renewable sources such as maize cobs will become competitive. Maize cobs have beneficial characteristics for utilization as feedstock including compact tissue, high cellulose content, and low ash and nitrogen content. Nitrogen is quantitatively the most important nutrient for plant growth. However, the influence of nitrogen fertilization on maize cob production is unclear. In this study, quantitative trait loci (QTL) have been analyzed for cob morphological traits such as cob weight, volume, length, diameter and cob tissue density, and grain yield under normal and low nitrogen regimes. 213 doubled-haploid lines of the intermated B73 × Mo17 (IBM) Syn10 population have been resequenced for 8575 bins, based on SNP markers. A total of 138 QTL were found for six traits across six trials using composite interval mapping with ten cofactors and empirical comparison-wise thresholds (P = 0.001). Despite moderate to high repeatabilities across trials, few QTL were consistent across trials and overall levels of explained phenotypic variance were lower than expected some of the cob trait × trial combinations (R (2) = 7.3-43.1 %). Variation for cob traits was less affected by nitrogen conditions than by grain yield. Thus, the economics of cob usage under low nitrogen regimes is promising.
-
Directory of Open Access Journals (Sweden)
Lam Mary K
2009-10-01
Full Text Available Abstract An (Awassi × Merino × Merino backcross family of 172 ewes was used to map quantitative trait loci (QTL for different milk production traits on a framework map of 200 loci across all autosomes. From five previously proposed mathematical models describing lactation curves, the Wood model was considered the most appropriate due to its simplicity and its ability to determine ovine lactation curve characteristics. Derived milk traits for milk, fat, protein and lactose yield, as well as percentage composition and somatic cell score were used for single and two-QTL approaches using maximum likelihood estimation and regression analysis. A total of 15 significant (P P http://crcidp.vetsci.usyd.edu.au/cgi-bin/gbrowse/oaries_genome/. Many of the QTL for milk production traits have been reported on chromosomes 1, 3, 6, 16 and 20. Those on chromosomes 3 and 20 are in strong agreement with the results reported here. In addition, novel QTL were found on chromosomes 7, 8, 9, 14, 22 and 24. In a cross-species comparison, we extended the meta-assembly by comparing QTL regions of sheep and cattle, which provided strong evidence for synteny conservation of QTL regions for milk, fat, protein and somatic cell score data between cattle and sheep.
-
Serum levels of INSL3, AMH, Inhibin B and Testosterone during pubertal transition in healthy boys
DEFF Research Database (Denmark)
Lindhardt Johansen, Marie; Anand-Ivell, Ravinder; Mouritsen, Annette
2014-01-01
to luteinizing hormone (LH), follicle-stimulating hormone (FSH), testosterone, inhibin B, and anti-Müllerian hormone (AMH) during puberty in healthy boys.MethodsTen boys were included from the longitudinal part of the COPENHAGEN Puberty Study. Pubertal evaluation, including testicular volume, was performed...... and blood samples drawn every 6 months for 5 years. Serum concentrations of testosterone were determined by a newly developed LC-MS/MS method, and serum concentrations of INSL3, AMH, inhibin B, FSH and LH, respectively, were determined by validated immunoassays.ResultsSerum INSL3 levels increased...... progressively with increasing age, pubertal onset and testicular volume. In six of ten boys, LH increased prior to the first observed increase in INSL3. In the remaining four boys, the increase in LH and INSL3 was observed at the same examination. The increases in serum concentrations of LH, testosterone...
-
An, Mengting; Zhang, Fengbo; Zhu, Yuejie; Zhao, Xiao; Ding, Jianbing
2018-01-01
Cystic echinococcosis, as a zoonosis, seriously endangers humans and animals, so early diagnosis of this disease is particularly important. Therefore, this study is to predict B-cell epitopes of EgAgB1 and EgAgB3 proteins by bioinformatics software. B-cell epitopes of EgAgB1 and EgAgB3 proteins are predicted using DNAStar and IEDB software. The results suggest that there are two potential B-cell epitopes in EgAgB1, which located in the 8-15 and 31-37 amino acid residue segments. And two potential B-cell epitopes in EgAgB2, located in the 20∼27 and 47∼53 amino acid residue segments. This study predicted the B-cell epitopes of EgAgB1 and EgAgB3 proteins, which laid the foundation for the early diagnosis of Cystic echinococcosis.
-
Field, Zoë C; Field, Andy P
2013-06-01
Cognitive models of vulnerability to anxiety propose that information processing biases such as interpretation bias play a part in the etiology and maintenance of anxiety disorders. However, at present little is known about the role of memory in information processing accounts of child anxiety. The current study investigates the relationships between interpretation biases, memory and fear responses when learning about new stimuli. Children (aged 8-11 years) were presented with ambiguous information regarding a novel animal, and their fear, interpretation bias, and memory for the information was measured. The main findings were: (1) trait anxiety and interpretation bias significantly predicted acquired fear; (2) interpretation bias did not significantly mediate the relationship between trait anxiety and acquired fear; (3) interpretation bias appeared to be a more important predictor of acquired fear than trait anxiety per se; and (4) the relationship between interpretation bias and acquired fear was not mediated by the number of negative memories but was mediated by the number of positive and false-positive memories. The findings suggest that information processing models of child anxiety need to explain the role of positive memory in the formation of fear responses.
-
Ducci, Francesca; Enoch, Mary-Anne; Yuan, Qiaoping; Shen, Pei-Hong; White, Kenneth V; Hodgkinson, Colin; Albaugh, Bernard; Virkkunen, Matti; Goldman, David
2009-02-01
Alcohol use disorders (AUD) with co-morbid antisocial personality disorder (ASPD) have been associated with serotonin (5-HT) dysfunction. 5-HT3 receptors are potentiated by ethanol and appear to modulate reward. 5-HT3 receptor antagonists may be useful in the treatment of early-onset alcoholics with co-morbid ASPD. Low-voltage alpha electroencephalogram (EEG) power, a highly heritable trait, has been associated with both AUD and ASPD. A recent whole genome linkage scan in one of our samples, Plains American Indians (PI), has shown a suggestive linkage peak for alpha power at the 5-HT3R locus. We tested whether genetic variation within the HTR3A and HTR3B genes influences vulnerability to AUD with comorbid ASPD (AUD+ASPD) and moderates alpha power. Our study included three samples: 284 criminal alcoholic Finnish Caucasians and 234 controls; two independent community-ascertained samples with resting EEG recordings: a predominantly Caucasian sample of 191 individuals (Bethesda) and 306 PI. In the Finns, an intronic HTR3B SNP rs3782025 was associated with AUD+ASPD (P=.004). In the Bethesda sample, the same allele predicted lower alpha power (P=7.37e(-5)). Associations between alpha power and two other HTR3B SNPs were also observed among PI (P=.03). One haplotype in the haplotype block at the 3' region of the gene that included rs3782025 was associated with AUD+ASPD in the Finns (P=.02) and with reduced alpha power in the Bethesda population (P=.00009). Another haplotype in this block was associated with alpha power among PI (P=.03). No associations were found for HTR3A. Genetic variation within HTR3B may influence vulnerability to develop AUD with comorbid ASPD. 5-HT3R might contribute to the imbalance between excitation and inhibition that characterize the brain of alcoholics.
-
Effect of terminal drought stress on morpho-physiological traits of wheat genotypes
International Nuclear Information System (INIS)
Baloch, M.J.; Chandio, I.A.
2016-01-01
Development of wheat varieties with low moisture requirements and their ability to withstand moisture stress may cope-up well with the on-coming peril of drought conditions. Ten wheat genotypes including two new strains, PBGST-3, Hero, Bhittai, Marvi, Inqlab, Sarsabz, Abadgar, Kiran, Khirman and PBGST-4 were sown in split plot design with factorial arrangement in four replications at Experimental Field, Department of Plant Breeding and Genetics, Sindh Agricutlure University, Pakistan during 2012-13. The results revealed that water stress caused significant reductions in all morpho-physiological traits. The genotypes differed significantly for all the yield and physiological traits. The interaction of treatments * genotypes were also significant for all the traits except plant height, productive tillers/plant, grains/spike and harvest index, were non-significant which indicated that cultivars responded variably over the stress treatments suggesting that breeders can select the promising genotypes for both stress and non-stress environments. Among the genotypes evaluated Bhittai, Kiran-95, PBGST-3 and Sarsabz showed good performance as minimum reductions occurred under terminal stress conditions for all the traits studied. Hence, above mentioned genotypes were considered as drought tolerant group. The high positive correlations of physiological traits like chlorophyll content and relative water content with almost all yield traits indicated that these physiological traits could serve as reliable criteria for breeding drought tolerance in wheat. The negative correlations of electrolyte leakage with several important yield traits indicated that though this physiological trait has adverse effect on yield attributes, yet it could reliably be used to distinguish between drought tolerant and susceptible wheat genotypes. (author)
-
Personality traits in patients with cluster headache: a comparison with migraine patients.
Muñoz, I; Hernández, M S; Santos, S; Jurado, C; Ruiz, L; Toribio, E; Sotelo, E M; Guerrero, A L; Molina, V; Uribe, F; Cuadrado, M L
2016-01-01
Cluster headache (CH) has been associated with certain personality traits and lifestyle features, but there are few studies assessing personality profiles in CH. We aimed to analyze personality traits in patients with CH, and to compare them with those found in migraine. We included all consecutive patients with CH attending 5 outpatient offices between January and December 2013. Personality traits were evaluated using the Salamanca screening test, a validated inventory assessing 11 personality traits grouped in 3 clusters. We analyzed the test results in this population, and compared them with those of a migraine population previously assessed with the same test. Eighty patients with CH (75 men, 5 women; mean age, 43.2 ± 9.9 years) were recruited. The reference population consisted of 164 migraine patients (30 men, 134 women; mean age 36.4 ± 12.7 years). In CH patients, the most frequent personality traits were anancastic (52.5 %), anxious (47.5 %), histrionic (45 %), schizoid (42.5 %), impulsive (32.5 %) and paranoid (30 %). When compared to migraine patients, paranoid (p traits (p = 0.007; χ2 test) were significantly more prevalent in CH patients. In logistic regression analysis the paranoid trait was significantly associated with CH (p = 0.001; OR: 3.27, 95 % CI [1.66-6.43]). According to the Salamanca screening test, personality traits included in cluster A (odd or eccentric disorders) are more prevalent in CH patients than in a population of migraineurs. Larger studies are needed to determine whether certain personality traits are related to CH.
-
Trait Emotional Intelligence and Personality
Siegling, Alexander B.; Furnham, Adrian; Petrides, K. V.
2015-01-01
This study investigated if the linkages between trait emotional intelligence (trait EI) and the Five-Factor Model of personality were invariant between men and women. Five English-speaking samples (N = 307-685) of mostly undergraduate students each completed a different measure of the Big Five personality traits and either the full form or short form of the Trait Emotional Intelligence Questionnaire (TEIQue). Across samples, models predicting global TEIQue scores from the Big Five were invari...
-
Treatment Response in CP/ADHD Children with Callous/Unemotional Traits
Haas, Sarah M.; Waschbusch, Daniel A.; Pelham, William E.; King, Sara; Andrade, Brendan F.; Carrey, Normand J.
2011-01-01
The current study examines the role of callous/unemotional (CU) traits in response to treatment among children with conduct problems (CP) and attention-deficit/hyperactivity disorder (ADHD). Fifty-four children with CP/ADHD and 16 controls (age = 9.48, SD = 1.58) took part in a summer treatment and research program. Simple correlations showed that…
-
2011-11-01
... section 1839 of the Act, requires that, starting on January 1,2007, the Part B premium a beneficiary pays... private sector costs of this notice fall below this threshold as well. Executive Order 13132 establishes... B premium rate for 2012 is $99.90, which is equal to 50 percent of the monthly actuarial rate for...
-
2010-11-09
... the Act, requires that, starting on January 1, 2007, the Part B premium a beneficiary pays each month... private sector costs of this notice fall below this threshold as well. Executive Order 13132 establishes... B premium rate for 2011 is $115.40, which is equal to 50 percent of the monthly actuarial rate for...
-
2013-10-30
... section 1839 of the Act, requires that, starting on January 1, 2007, the Part B premium a beneficiary pays... governments or on the private sector. Executive Order 13132 establishes certain requirements that an agency... B premium rate for all enrollees for 2014 is $104.90, which is equal to 50 percent of the monthly...
-
Directory of Open Access Journals (Sweden)
Janković Snežana
2010-01-01
Full Text Available Relationships among quantitative traits of wheat were analyzed in parents and their F3, F4 and F5 hybrids. Three female parents (Briscard, Carifen 12 and Rescler were crossed with two male parents (Francuska and PKB-Prelivka. Same crosses were repeated 4 years, from 1996 to 1999. Hybrids were obtained via pedigree and bulk selection. In year 2000 the field experiments were set up with all parental and hybrid material, at the Institute 'PKB INI Agroekonomik', in Padinska Skela, near Belgrade. Six traits were measured: plant height, spike length, number of spikelets per spike, number of grains per spike, 1000 grain weight and grain weight per spike. In parental genotypes, it was found grain mass per spike was in significant and positive correlation with 1000 grain mass and number of grains per spike. As in parents, correlation between grain mass per spike and 1000 grain weight was almost functional in F3, F4 and F5 hybrids. However, correlation between grain mass per spike and number of grains per spike was negative or slight positive in hybrid descendents, what is surprising because it is oppositely to the parents. Similar values of correlation coefficients were found in both applied methods of selection. This fact shows correlations change between generations. Grain mass per spike depends on a 1000 grain mass in both, parental and hybrid generations. Stable relationship between traits could be use for selection of high yielding genotypes.
-
Proceedings of the CTU seminar 94. Pt. B
International Nuclear Information System (INIS)
1994-01-01
The proceedings consist of 3 parts (A, B, C). Part B is divided into the following sections: Biomedical Engineering, Computer Art, Informatics and Cybernetics, Electrical and Power Engineering, Communication Engineering, Architecture and Urbanism. Out of 96 short communications contained in this part of the proceedings, 6 items were inputted to the INIS system. Out of 106 (110) short communications contained in parts A (B), 23 (2) items were inputted to INIS. (Z.S.)
-
Observation of flow dissipation in 3He-B
International Nuclear Information System (INIS)
Eisenstein, J.P.; Packard, R.E.
1982-01-01
Anomalous dissipation is observed in 3 He-B flowing in a U-tube device. The dissipation is of unknown origin and persists to the lowest measured velocity. The position of this result in the framework of other 3 He-B flow experiments is discussed
-
Directory of Open Access Journals (Sweden)
M.A Mu'in
2009-12-01
Full Text Available The research was aimed is to detect Insulin-like growth factor-I (IGF-I gene polymorphism and their effect on growth traits in Indonesia natives chicken. Seventy two Indonesian native chicken are going to be used in this research. The polymorphism of IGF-I gene was detected by PCR-RFLP/Pst-I. Four growth traits (body weight at 1, 2, 3, and 4 months were recorded for analyzing the association between IGF-I gene polymorphism and growth performance.The results showed that allele A (621 bp and allele B (364 and 257 bp were found in this research. It was found that Indonesian native chicken carried high frequencies of allele A (0.82, and frequencies of IGF-I genotypes (AA, AB, BB were 68.0, 27.8, and 4,2%, respectively. When compared to the IGF-I genotypes, the BB genotype had the highest body weight at 1, 2, 3, and 4 month (P<0.05. The results showed that the B allele was positive of associated to a higher growth rate. Therefore, these results suggest that there is a possibility of IGF-I genotypes acting as a molecular marker for growth rate of Indonesia native.
-
Bov-B-mobilized SINEs in vertebrate genomes.
Gogolevsky, Konstantin P; Vassetzky, Nikita S; Kramerov, Dmitri A
2008-01-15
Two new short retroposon families (SINEs) have been found in the genome of springhare Pedetes capensis (Rodentia). One of them, Ped-1, originated from 5S rRNA, while the other one, Ped-2, originated from tRNA-derived SINE ID. In contrast to most currently active mammalian SINEs mobilized by L1 long retrotransposon (LINE), Ped-1 and Ped-2 are mobilized by Bov-B, a LINE family of the widely distributed RTE clade. The 3' part of these SINEs originates from two sequences in the 5' and 3' regions of Bov-B. Such bipartite structure of the LINE-derived part has been revealed in all Bov-B-mobilized SINEs known to date (AfroSINE, Bov-tA, Mar-1, and Ped-1/2), which distinguishes them from other SINEs with only a 3' LINE-derived part. Structural analysis and the distribution of Bov-B LINEs and partner SINEs supports the horizontal transfer of Bov-B, while the SINEs emerged independently in lineages with this LINE.
-
Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes
Energy Technology Data Exchange (ETDEWEB)
Cui, Ju, E-mail: juzi.cui@gmail.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Wang, Zai [Institute of Clinical Medical Sciences, China-Japan Friendship Hospital, Beijing (China); Li, Jian; Cai, Jian-Ping [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China); Huang, Jian-Dong, E-mail: jdhuang@hku.hk [School of Biomedical Sciences and Shenzhen Institute of Research and Innovation, The University of Hong Kong, Pokfulam (Hong Kong); The Centre for Synthetic Biology Engineering Research, Shenzhen Institutes of Advanced Technology, Shenzhen (China); Zhang, Tie-Mei, E-mail: tmzhang126@126.com [The Key Laboratory of Geriatrics, Beijing Hospital and Beijing Institute of Geriatrics, Beijing (China)
2016-08-05
Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.
-
Conventional kinesin KIF5B mediates adiponectin secretion in 3T3-L1 adipocytes
International Nuclear Information System (INIS)
Cui, Ju; Pang, Jing; Lin, Ya-Jun; Jiang, Ping; Gong, Huan; Wang, Zai; Li, Jian; Cai, Jian-Ping; Huang, Jian-Dong; Zhang, Tie-Mei
2016-01-01
Insulin stimulates adiponectin secretion and glucose transporter type 4 (GLUT4) translocation in adipocyte to regulate metabolism homeostasis. Similar to GLUT4 translocation, intracellular trafficking and release of adiponectin in adipocytes relies on the trans-Golgi network and endosomal system. Recent studies show that the heavy chain of conventional kinesin (KIF5B) mediates GLUT4 translocation in murine 3T3-L1 adipocytes, however, the motor machinery involved in mediating intracellular trafficking and release of adiponectin is unknown. Here, we examined the role of KIF5B in the regulation of adiponectin secretion. The KIF5B level was up-regulated during 3T3-L1 adipogenesis. This increase in cytosolic KIF5B was synchronized with the induction of adiponectin. Endogenous KIF5B and adiponectin were partially colocalized at the peri-nuclear and cytosolic regions. In addition, adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. Knockdown of KIF5B resulted in a marked inhibition of adiponectin secretion and overexpression of KIF5B enhanced adiponectin release, whereas leptin secretion was not affected by changes in KIF5B expression. These data suggest that the secretion of adiponectin, but not leptin, is dependent on functional KIF5B. - Highlights: • The KIF5B level was up regulated during 3T3-L1 adipogenesis. • Endogenous KIF5B and adiponectin were partially colicalized. • Adiponectin-containing vesicles were co-immunoprecipitated with KIF5B. • The secretion of adiponectin, but not leptin, is dependent on functional KIF5B.
-
Clinical and personality traits in emotional disorders: Evidence of a common framework.
Mahaffey, Brittain L; Watson, David; Clark, Lee Anna; Kotov, Roman
2016-08-01
Certain clinical traits (e.g., ruminative response style, self-criticism, perfectionism, anxiety sensitivity, fear of negative evaluation, and thought suppression) increase the risk for and chronicity of emotional disorders. Similar to traditional personality traits, they are considered dispositional and typically show high temporal stability. Because the personality and clinical-traits literatures evolved largely independently, connections between them are not fully understood. We sought to map the interface between a widely studied set of clinical and personality traits. Two samples (N = 385 undergraduates; N = 188 psychiatric outpatients) completed measures of personality traits, clinical traits, and an interview-based assessment of emotional-disorder symptoms. First, the joint factor structure of these traits was examined in each sample. Second, structural equation modeling was used to clarify the effects of clinical traits in the prediction of clinical symptoms beyond negative temperament. Third, the incremental validity of clinical traits beyond a more comprehensive set of higher-order and lower-order personality traits was examined using hierarchical regression. Clinical and personality traits were highly correlated and jointly defined a 3-factor structure-Negative Temperament, Positive Temperament, and Disinhibition-in both samples, with all clinical traits loading on the Negative Temperament factor. Clinical traits showed modest but significant incremental validity in explaining symptoms after accounting for personality traits. These data indicate that clinical traits relevant to emotional disorders fit well within the traditional personality framework and offer some unique contributions to the prediction of psychopathology, but it is important to distinguish their effects from negative temperament/neuroticism. (PsycINFO Database Record (c) 2016 APA, all rights reserved).
-
Genetic diversity of Iranian rice germplasm based on morphological traits
Directory of Open Access Journals (Sweden)
nade ali bagheri
2009-06-01
Full Text Available Study of genetic diversity of rice is very important for rice breeders. In this study 64 genotypes for 14 agronomic traits were evaluated. Phenotypic variation coefficients of some of traits were high which showed essential variation in this traits. Principal component analysis detected 6 components which explained 74.66 percent of the total variations. The first component was related to generative traits such as number of spiklet per panicle, number of full grain per panicle, date of 50% flowering and length of panicle. In the third component, the date of complete maturity with -0.730 has negative effects on yield. Correlation analysis of morphological traits indicated a negative and significant relationship between early maturity and plant height, which showed early maturity cultivars had higher plant type. Results of stepwise regression analysis for early maturity, indicated that three traits such as date of 50% flowering, number of full grain per panicle and plant height showed higher variation and explained 54.3 percent of total early maturity variations. All traits were classified into 2 groups, by cluster analysis and traits belonged to early maturity classified as a sub-group. Genotypes were classified into 4 groups by using method of Ward,s minimum variance and squared Euclidean distance. Native cultivars from the view point of early maturity and yield components had useful information for rice breeding. Key words: Genetic diversity, rice, morphological traits.
-
Hershberger, Alexandra R; Um, Miji; Cyders, Melissa A
2017-09-01
Although impulsive personality traits have been well implicated in substance use disorder (SUD) risk, little work has established how specific impulsive personality traits influence and are influenced by SUD psychotherapy outcomes. The purpose of this meta-analysis was to quantitatively review existing work to examine 1) how impulsive personality traits affect SUD psychotherapy outcomes and 2) reductions in impulsive personality traits during SUD psychotherapy. Studies were identified by conducting a comprehensive review of the literature. For aim one (k=6), significant effects were found for lack of premeditation (g=0.60, SE=0.30, 95% CI 0.01-1.20; z=1.99, p=0.05) and negative urgency (g=0.55, SE=0.17, 95% CI 0.22-0.88, z=3.30, p=0.001), with trait scores related to poorer SUD psychotherapy outcomes. For aim two (k=10), decreases in sensation seeking (g=-0.10, SE=0.05, 95% CI -0.20 to 0.004; z=-1.88, p=0.02) and negative urgency (g=-0.25, SE=0.14, 95% CI -0.53 to 0.03; z=-1.75, p=0.03) during SUD psychotherapy were significant. Overall, our quantitative synthesis suggests that lack of premeditation and negative urgency are related to poorer SUD psychotherapy outcomes. Although negative urgency and sensation seeking are decreasing during SUD psychotherapy, the magnitude of the change is quite small. Overall, we suggest that the measurement and targeting of impulsive personality traits in psychotherapy has strong potential to improve clinical outcomes across SUDs and a wide range of clinical problems and disorders. Copyright © 2017 Elsevier B.V. All rights reserved.
-
Gossner, Martin M.; Simons, Nadja K.; Achtziger, Roland; Blick, Theo; Dorow, Wolfgang H. O.; Dziock, Frank; Köhler, Frank; Rabitsch, Wolfgang; Weisser, Wolfgang W.
2015-03-01
Analyses of species traits have increased our understanding of how environmental drivers such as disturbances affect the composition of arthropod communities and related processes. There are, however, few studies on which traits in the arthropod community are affected by environmental changes and which traits affect ecosystem functioning. The assembly of arthropod traits of several taxa is difficult because of the large number of species, limited availability of trait databases and differences in available traits. We sampled arthropod species data from a total of 150 managed grassland plots in three regions of Germany. These plots represent the spectrum from extensively used pastures to mown pastures to intensively managed and fertilized meadows. In this paper, we summarize information on body size, dispersal ability, feeding guild and specialization (within herbivores), feeding mode, feeding tissue (within herbivorous suckers), plant part (within herbivorous chewers), endophagous lifestyle (within herbivores), and vertical stratum use for 1,230 species of Coleoptera, Hemiptera (Heteroptera, Auchenorrhyncha), Orthoptera (Saltatoria: Ensifera, Caelifera), and Araneae, sampled by sweep-netting between 2008 and 2012. We compiled traits from various literature sources and complemented data from reliable internet sources and the authors’ experience.
-
Genetic Characterization of Dog Personality Traits.
Ilska, Joanna; Haskell, Marie J; Blott, Sarah C; Sánchez-Molano, Enrique; Polgar, Zita; Lofgren, Sarah E; Clements, Dylan N; Wiener, Pamela
2017-06-01
The genetic architecture of behavioral traits in dogs is of great interest to owners, breeders, and professionals involved in animal welfare, as well as to scientists studying the genetics of animal (including human) behavior. The genetic component of dog behavior is supported by between-breed differences and some evidence of within-breed variation. However, it is a challenge to gather sufficiently large datasets to dissect the genetic basis of complex traits such as behavior, which are both time-consuming and logistically difficult to measure, and known to be influenced by nongenetic factors. In this study, we exploited the knowledge that owners have of their dogs to generate a large dataset of personality traits in Labrador Retrievers. While accounting for key environmental factors, we demonstrate that genetic variance can be detected for dog personality traits assessed using questionnaire data. We identified substantial genetic variance for several traits, including fetching tendency and fear of loud noises, while other traits revealed negligibly small heritabilities. Genetic correlations were also estimated between traits; however, due to fairly large SEs, only a handful of trait pairs yielded statistically significant estimates. Genomic analyses indicated that these traits are mainly polygenic, such that individual genomic regions have small effects, and suggested chromosomal associations for six of the traits. The polygenic nature of these traits is consistent with previous behavioral genetics studies in other species, for example in mouse, and confirms that large datasets are required to quantify the genetic variance and to identify the individual genes that influence behavioral traits. Copyright © 2017 by the Genetics Society of America.
-
Variation in CHI3LI in relation to type 2 diabetes and related quantitative traits
DEFF Research Database (Denmark)
Rathcke, Camilla Noelle; Holmkvist, Johan; Jørgensen, Torben
2009-01-01
BACKGROUND: CHI3LI encoding the inflammatory glycoprotein YKL-40 is located on chromosome 1q32.1. YKL-40 is involved in inflammatory processes and patients with Type 2 Diabetes (T2D) have elevated circulating YKL-40 levels which correlate with their level of insulin resistance. Interestingly...... in 6514 individuals from the Inter99 cohort and 2924 individuals from the outpatient clinic at Steno Diabetes Center. In cas-control studies a total of 2345 T2D patients and 5302 individuals with a normal glucose tolerance test were examined. We found no association between rs10399931 (OR, 0.98 (CI, 0...... (SNPs) or haplotypes thereof the CHI3LI locus might influence risk of T2D. The aim of the present study was to investigate the putative association between SNPs and haplotype blocks of CHI3LI and T2D and T2D related quantitative traits. METHODS/PRINCIPAL FINDINGS: Eleven SNPs of CHI3LI were genotyped...
-
Bhaskar, Radika; Porder, Stephen; Balvanera, Patricia; Edwards, Erika J
2016-05-01
We assessed the role of ecological and evolutionary processes in driving variation in leaf and litter traits related to nitrogen (N) use among tropical dry forest trees in old-growth and secondary stands in western Mexico. Our expectation was that legumes (Fabaceae), a dominant component of the regional flora, would have consistently high leaf N and therefore structure phylogenetic variation in N-related traits. We also expected ecological selection during succession for differences in nitrogen use strategies, and corresponding shifts in legume abundance. We used phylogenetic analyses to test for trait conservatism in foliar and litter N, C:N, and N resorption. We also evaluated differences in N-related traits between old-growth and secondary forests. We found a weak phylogenetic signal for all traits, partly explained by wide variation within legumes. Across taxa we observed a positive relationship between leaf and litter N, but no shift in resorption strategies along the successional gradient. Despite species turnover, N-resorption, and N-related traits showed little change across succession, suggesting that, at least for these traits, secondary forests rapidly recover ecosystem function. Collectively, our results also suggest that legumes should not be considered a single functional group from a biogeochemical perspective.
-
ThMYC4E, candidate Blue aleurone 1 gene controlling the associated trait in Triticum aestivum.
Directory of Open Access Journals (Sweden)
Na Li
Full Text Available Blue aleurone is a useful and interesting trait in common wheat that was derived from related species. Here, transcriptomes of blue and white aleurone were compared for isolating Blue aleurone 1 (Ba1 transferred from Thinopyrum ponticum. In the genes involved in anthocyanin biosynthesis, only a basic helix-loop-helix (bHLH transcription factor, ThMYC4E, had a higher transcript level in blue aleurone phenotype, and was homologous to the genes on chromosome 4 of Triticum aestivum. ThMYC4E carried the characteristic domains (bHLH-MYC_N, HLH and ACT-like of a bHLH transcription factor, and clustered with genes regulating anthocyanin biosynthesis upon phylogenetic analysis. The over-expression of ThMYC4E regulated anthocyanin biosynthesis with the coexpression of the MYB transcription factor ZmC1 from maize. ThMYC4E existed in the genomes of the addition, substitution and near isogenic lines with the blue aleurone trait derived from Th. ponticum, and could not be detected in any germplasm of T. urartu, T. monococcum, T. turgidum, Aegilops tauschii or T. aestivum, with white aleurone. These results suggested that ThMYC4E was candidate Ba1 gene controlling the blue aleurone trait in T. aestivum genotypes carrying Th. ponticum introgression. The ThMYC4E isolation aids in better understanding the genetic mechanisms of the blue aleurone trait and in its more effective use during wheat breeding.
-
Elzo, M A; Rae, D O; Lanhart, S E; Hembry, F G; Wasdin, J G; Driver, J D
2009-08-01
The objective of this research was to assess the association between 4 cow reproductive and weight traits, and 2 preweaning calf traits and ELISA scores for paratuberculosis (0 = negative, 1 = suspect, 2 = weak-positive, and 3 = positive) in a multibreed herd of cows ranging from 100% Angus (A) to 100% Brahman (B). Cow data were 624 gestation lengths (GL), 358 records of time open (TO), 605 calving intervals (CI), and 1240 weight changes from November to weaning in September (WC) from 502 purebred and crossbred cows. Calf data consisted of 956 birth weights (BWT), and 923 weaning weights adjusted to 205 d of age (WW205) from 956 purebred and crossbred calves. Traits were analyzed individually using multibreed mixed models that assumed homogeneity of variances across breed groups. Covariances among random effects were assumed to be zero. Fixed effects were year, age of cow, sex of calf, year x age of cow interaction (except WC), age of cow x sex of calf interaction (only for WC), and covariates for B fraction of sire and cow, heterosis of cow and calf, and ELISA score. Random effects were sire (except for TO and CI), dam, and residual. Regression estimates of cow and calf traits on ELISA scores indicated that lower cow fertility (longer TO), lower ability of cows to maintain weight (negative WC), lower calf BWT, and lower calf WW205 were associated with higher cow ELISA scores. Further research on the effects of subclinical paratuberculosis in beef cattle at regional and national levels seems advisable considering the large potential economic cost of this disease.
-
Oviedo, Gabriel Fernando; Gómez-Restrepo, Carlos; Rondón, Martín; Borda Bohigas, Juan Pablo; Tamayo Martínez, Nathalie
2016-12-01
Personality refers to the individual style in characteristic patterns of thinking, feeling and behaving. Traits may configure a personality disorder when there is a long-lasting rigid pattern of inner experience that deviates from the expectations of the individual's culture, are inflexible and form maladaptative schemes in different interpersonal scenarios. Given the pervasiveness of this structure, they cause impairment of functioning in the affected person. To establish the prevalence of personality traits in all selected adults, using the module-structured interview WHO WHM-CIDI-CAPI for clusters A, B and C of personality traits. Colombian National Survey on Mental Health with persons older than 18 years of age. Personality traits that are the most frequently described: Cluster A 46% (95%CI, 45.2-48.1) of people believe they are convinced that there are conspiracies behind many things in the world. Regarding the features of cluster B, 35.6% (95%CI, 34.2-37.0) of the population reports that generally they do not feel bad when offending or upsetting someone and 35.4% (95%CI, 33.9-36.8) refer to show feelings to anyone. The highest proportion of traits were found to the probable borderline personality disorder, as 4.6% (95%CI, 4.1-5.2) of the Colombian population aged 18 and older has 6 or more features of this type, and is the widely reported as an individual entity with similar rates in men and women. The high prevalence of disruptive personality traits requires more research. The high prevalence reported for borderline personality traits suggests the need to implement measures to improve and integrate a collaborative model of care for people afflicted with a possible borderline personality disorder. Copyright © 2016 Asociación Colombiana de Psiquiatría. Publicado por Elsevier España. All rights reserved.
-
Stavrova, Olga; Meckel, Andrea
2017-01-01
This research examines the role of trait empathy in emotional contagion through non-social targets-art objects. Studies 1a and 1b showed that high- (compared to low-) empathy individuals are more likely to infer an artist's emotions based on the emotional valence of the artwork and, as a result, are more likely to experience the respective emotions themselves. Studies 2a and 2b experimentally manipulated artists' emotions via revealing details about their personal life. Study 3 experimentally induced positive vs. negative emotions in individuals who then wrote literary texts. These texts were shown to another sample of participants. High- (compared to low-) empathy participants were more like to accurately identify and take on the emotions ostensibly (Studies 2a and 2b) or actually (Study 3) experienced by the "artists". High-empathy individuals' enhanced sensitivity to others' emotions is not restricted to social targets, such as faces, but extends to products of the human mind, such as objects of art.
-
Energy Technology Data Exchange (ETDEWEB)
Vares, S.; Pulakka, S.; Toratti, T. [and others
2012-11-01
This report is the second part of the final report of Sustainable refurbishment of building facades and exterior walls (SUSREF). SUSREF project was a collaborative (small/medium size) research project within the 7th Framework Programme of the Commission and it was financed under the theme Environment (including climate change) (Grant agreement no. 226858). The project started in October 1st 2009 and ended in April 30th 2012. The project included 11 partners from five countries. SUSREF developed sustainable concepts and technologies for the refurbishment of building facades and external walls. This report together with SUSREF Final report Part B and SUSREF Final Report Part C introduce the main results of the project. Part A focuses on methodological issues. The descriptions of the concepts and the assessment results of the developed concepts are presented in SUSREF Final report part B (generic concepts) and SUSREF Final report Part C (SME concepts). The following list shows the sustainability assessment criteria defined by the SUSREF project. These are Durability; Impact on energy demand for heating; Impact on energy demand for cooling; Impact on renewable energy use potential; Impact on daylight; Environmental impact of manufacture and maintenance; Indoor air quality and acoustics; Structural stability; Fire safety; Aesthetic quality; Effect on cultural heritage; Life cycle costs; Need for care and maintenance; Disturbance to the tenants and to the site; Buildability. This report presents sustainability assessment results of general refurbishment concepts and gives recommendations on the basis of the results. The report covers the following refurbishment cases - External insulation - Internal insulation - Cavity wall insulation - Replacement Insulation during renovation.
-
Toward a knowledge infrastructure for traits-based ecological risk assessment.
Baird, Donald J; Baker, Christopher J O; Brua, Robert B; Hajibabaei, Mehrdad; McNicol, Kearon; Pascoe, Timothy J; de Zwart, Dick
2011-04-01
The trait approach has already indicated significant potential as a tool in understanding natural variation among species in sensitivity to contaminants in the process of ecological risk assessment. However, to realize its full potential, a defined nomenclature for traits is urgently required, and significant effort is required to populate databases of species-trait relationships. Recently, there have been significant advances in the area of information management and discovery in the area of the semantic web. Combined with continuing progress in biological trait knowledge, these suggest that the time is right for a reevaluation of how trait information from divergent research traditions is collated and made available for end users in the field of environmental management. Although there has already been a great deal of work on traits, the information is scattered throughout databases, literature, and undiscovered sources. Further progress will require better leverage of this existing data and research to fill in the gaps. We review and discuss a number of technical and social challenges to bringing together existing information and moving toward a new, collaborative approach. Finally, we outline a path toward enhanced knowledge discovery within the traits domain space, showing that, by linking knowledge management infrastructure, semantic metadata (trait ontologies), and Web 2.0 and 3.0 technologies, we can begin to construct a dedicated platform for TERA science. Copyright © 2010 SETAC.
-
Directory of Open Access Journals (Sweden)
Zili Wei
2016-11-01
Full Text Available Brassica juncea (AjAjBjBj, is an allotetraploid that arose from two diploid species, B. rapa (ArAr and B. nigra (BnBn. It is an old oilseed crop with unique favorable traits, but the genetic improvement on this species is limited. We developed an approach to broaden its genetic base within several generations by intensive selection. The Ar subgenome from the Asian oil crop B. rapa (ArAr and the Bc subgenome from the African oil crop B. carinata (BcBcCcCc were combined in a synthesized allohexaploid (ArArBcBcCcCc, which was crossed with traditional B. juncea to generate pentaploid F1 hybrids (ArAjBcBjCc, with subsequent self-pollination to obtain newly synthesized B. juncea (Ar/jAr/jBc/jBc/j. After intensive cytological screening and phenotypic selection of fertility and agronomic traits, a population of new-type B. juncea was obtained and was found to be genetically stable at the F6 generation. The new-type B. juncea possesses good fertility and rich genetic diversity and is distinctly divergent but not isolated from traditional B. juncea, as revealed by population genetic analysis with molecular markers. More than half of its genome was modified, showing exotic introgression and novel variation. In addition to the improvement in some traits of the new-type B. juncea lines, a considerable potential for heterosis was observed in inter-subgenomic hybrids between new-type B. juncea lines and traditional B. juncea accessions. The new-type B. juncea exhibited a stable chromosome number and a novel genome composition through multiple generations, providing insight into how to significantly broaden the genetic base of crops with subgenome introgression from their related species and the potential of exploring inter-subgenomic heterosis for hybrid breeding.
-
Merriman, T.R.; Fanciulli, M.; Merriman, M.E.; Alizadeh, B.Z.; Koeleman, B.P.C.; Dalbeth, N.; Gow, P.; Harrison, A.A.; Highton, J.; Jones, P.B.; Stamp, L.K.; Steer, S.; Barrera, P.; Coenen, M.J.H.; Franke, B.; Vyse, T.; Aitman, T.; Radstake, T.; McKinney, C.
2009-01-01
Aim: There is increasing evidence that gene copy-number variation influences phenotypic variation. The low-affinity Fc receptor 3B (FCGR3B) is a copy-number polymorphic gene involved in the recruitment to sites of inflammation and activation of polymorphonuclear neutrophils (PMN). Given the
-
Madin, Joshua S.; Anderson, Kristen D.; Andreasen, Magnus Heide; Bridge, Tom C. L.; Cairns, Stephen D.; Connolly, Sean R.; Darling, Emily S.; Diaz, Marcela; Falster, Daniel S.; Franklin, Erik C.; Gates, Ruth D.; Hoogenboom, Mia O.; Huang, Danwei; Keith, Sally A.; Kosnik, Matthew A.; Kuo, Chao-Yang; Lough, Janice M.; Lovelock, Catherine E.; Luiz, Osmar; Martinelli, Julieta; Mizerek, Toni; Pandolfi, John M.; Pochon, Xavier; Pratchett, Morgan S.; Putnam, Hollie M.; Roberts, T. Edward; Stat, Michael; Wallace, Carden C.; Widman, Elizabeth; Baird, Andrew H.
2016-03-01
Trait-based approaches advance ecological and evolutionary research because traits provide a strong link to an organism’s function and fitness. Trait-based research might lead to a deeper understanding of the functions of, and services provided by, ecosystems, thereby improving management, which is vital in the current era of rapid environmental change. Coral reef scientists have long collected trait data for corals; however, these are difficult to access and often under-utilized in addressing large-scale questions. We present the Coral Trait Database initiative that aims to bring together physiological, morphological, ecological, phylogenetic and biogeographic trait information into a single repository. The database houses species- and individual-level data from published field and experimental studies alongside contextual data that provide important framing for analyses. In this data descriptor, we release data for 56 traits for 1547 species, and present a collaborative platform on which other trait data are being actively federated. Our overall goal is for the Coral Trait Database to become an open-source, community-led data clearinghouse that accelerates coral reef research.
-
Madin, Joshua S; Anderson, Kristen D; Andreasen, Magnus Heide; Bridge, Tom C L; Cairns, Stephen D; Connolly, Sean R; Darling, Emily S; Diaz, Marcela; Falster, Daniel S; Franklin, Erik C; Gates, Ruth D; Harmer, Aaron; Hoogenboom, Mia O; Huang, Danwei; Keith, Sally A; Kosnik, Matthew A; Kuo, Chao-Yang; Lough, Janice M; Lovelock, Catherine E; Luiz, Osmar; Martinelli, Julieta; Mizerek, Toni; Pandolfi, John M; Pochon, Xavier; Pratchett, Morgan S; Putnam, Hollie M; Roberts, T Edward; Stat, Michael; Wallace, Carden C; Widman, Elizabeth; Baird, Andrew H
2016-03-29
Trait-based approaches advance ecological and evolutionary research because traits provide a strong link to an organism's function and fitness. Trait-based research might lead to a deeper understanding of the functions of, and services provided by, ecosystems, thereby improving management, which is vital in the current era of rapid environmental change. Coral reef scientists have long collected trait data for corals; however, these are difficult to access and often under-utilized in addressing large-scale questions. We present the Coral Trait Database initiative that aims to bring together physiological, morphological, ecological, phylogenetic and biogeographic trait information into a single repository. The database houses species- and individual-level data from published field and experimental studies alongside contextual data that provide important framing for analyses. In this data descriptor, we release data for 56 traits for 1547 species, and present a collaborative platform on which other trait data are being actively federated. Our overall goal is for the Coral Trait Database to become an open-source, community-led data clearinghouse that accelerates coral reef research.
-
Varella, Marco Antonio Correa; Valentova, Jaroslava Varella; Pereira, Kamila Janaina; Bussab, Vera Silvia Raad
2014-11-01
One of the possible explanations for human within-sex variation in promiscuity stems from conditional strategies dependent on the level of body sex-dimorphism. There is some evidence that masculine men and feminine women are more promiscuous than their sex-atypical counterparts, although mixed results persist. Moreover, another line of evidence shows that more promiscuous women are rather sex-atypical. We tested whether diverse sex-dimorphic body measures (2D:4D, WHR/WSR, handgrip strength, and height and weight) influence sociosexual desires, attitudes, promiscuous behavior, and age of first intercourse in a sex-typical or sex-atypical direction. Participants were 185 young adults, 51 men and 54 women from Brazil, and 40 men and 40 women from the Czech Republic. In men stronger handgrip and more feminine 2D:4D predicted higher sociosexual behaviors, desires, and lower age of the first sexual intercourse. While in women, sociosexual desires were predicted by lower handgrip strength and more feminine 2D:4D. It thus seems that it is rather a mixture of masculine and feminine traits in men, and feminine traits in women that increase their sociosexuality. Masculine traits (height) predicting female promiscuous behavior were specific for only one population. In conclusion, a mosaic combination of sex-typical but also sex-atypical independent body traits can lead to higher promiscuity, particularly in men. Limitations, implications, and future directions for research are considered. This article is part of a Special Issue entitled: Neotropical Behaviour. Copyright © 2014 Elsevier B.V. All rights reserved.
-
Torgersen, S; Czajkowski, N; Jacobson, K; Reichborn-Kjennerud, T; Røysamb, E; Neale, M C; Kendler, K S
2008-11-01
The personality disorders (PDs) in the 'dramatic' cluster B [antisocial (ASPD), histrionic (HPD), narcissistic (NPD) and borderline (BPD)] demonstrate co-morbidity. However, the degree to which genetic and/or environmental factors influence their co-occurrence is not known and, with the exception of ASPD, the relative impact of genetic and environmental risk factors on liability to the cluster B PDs has not been conclusively established. PD traits were assessed in 1386 Norwegian twin pairs between the age of 19 and 35 years using the Structured Interview for DSM-IV Personality Disorders (SIDP-IV). Using the statistical package Mx, multivariate twin models were fitted to dimensional representations of the PDs. The best-fitting model, which did not include sex or shared family environment effects, included common genetic and environmental factors influencing all four dramatic PD traits, and factors influencing only ASPD and BPD. Heritability was estimated at 38% for ASPD traits, 31% for HPD traits, 24% for NPD traits and 35% for BPD traits. BPD traits had the lowest and ASPD traits the highest disorder-specific genetic variance. The frequently observed co-morbidity between cluster B PDs results from both common genetic and environmental influences. Etiologically, cluster B has a 'substructure' in which ASPD and BPD are more closely related to each other than to the other cluster B disorders.
-
The impact of SF3B1 mutations in CLL on the DNA-damage response
DEFF Research Database (Denmark)
Te Raa, G D; Derks, I A M; Navrkalova, V
2015-01-01
Mutations or deletions in TP53 or ATM are well-known determinants of poor prognosis in chronic lymphocytic leukemia (CLL), but only account for approximately 40% of chemo-resistant patients. Genome-wide sequencing has uncovered novel mutations in the splicing factor sf3b1, that were in part assoc...
-
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The Oak Ridge National Laboratory Technology Logic Diagram (TLD) was developed to provide a decision support tool that relates environmental restoration (ER) and waste management (WM) problems at Oak Ridge National Laboratory (ORNL) to potential technologies that can remediate these problems. The TLD identifies the research, development, demonstration testing, and evaluation needed to develop these technologies to a state that allows technology transfer and application to decontamination and decommissioning (D&D), remedial action (RA), and WM activities. The TLD consists of three fundamentally separate volumes: Vol. 1, Technology Evaluation; Vol. 2, Technology Logic Diagram and Vol. 3, Technology EvaLuation Data Sheets. Part A of Vols. 1 and 2 focuses on RA. Part B of Vols. 1 and 2 focuses on the D&D of contaminated facilities. Part C of Vols. 1 and 2 focuses on WM. Each part of Vol. 1 contains an overview of the TM, an explanation of the problems facing the volume-specific program, a review of identified technologies, and rankings of technologies applicable to the site. Volume 2 (Pts. A. B. and C) contains the logic linkages among EM goals, environmental problems, and the various technologies that have the potential to solve these problems. Volume 3 (Pts. A. B, and C) contains the TLD data sheets. This volume provides the technology evaluation data sheets (TEDS) for ER/WM activities (D&D, RA and WM) that are referenced by a TEDS code number in Vol. 2 of the TLD. Each of these sheets represents a single logic trace across the TLD. These sheets contain more detail than is given for the technologies in Vol. 2.
-
Biazzi, Elisa; Nazzicari, Nelson; Pecetti, Luciano; Brummer, E Charles; Palmonari, Alberto; Tava, Aldo; Annicchiarico, Paolo
2017-01-01
Genetic progress for forage quality has been poor in alfalfa (Medicago sativa L.), the most-grown forage legume worldwide. This study aimed at exploring opportunities for marker-assisted selection (MAS) and genomic selection of forage quality traits based on breeding values of parent plants. Some 154 genotypes from a broadly-based reference population were genotyped by genotyping-by-sequencing (GBS), and phenotyped for leaf-to-stem ratio, leaf and stem contents of protein, neutral detergent fiber (NDF) and acid detergent lignin (ADL), and leaf and stem NDF digestibility after 24 hours (NDFD), of their dense-planted half-sib progenies in three growing conditions (summer harvest, full irrigation; summer harvest, suspended irrigation; autumn harvest). Trait-marker analyses were performed on progeny values averaged over conditions, owing to modest germplasm × condition interaction. Genomic selection exploited 11,450 polymorphic SNP markers, whereas a subset of 8,494 M. truncatula-aligned markers were used for a genome-wide association study (GWAS). GWAS confirmed the polygenic control of quality traits and, in agreement with phenotypic correlations, indicated substantially different genetic control of a given trait in stems and leaves. It detected several SNPs in different annotated genes that were highly linked to stem protein content. Also, it identified a small genomic region on chromosome 8 with high concentration of annotated genes associated with leaf ADL, including one gene probably involved in the lignin pathway. Three genomic selection models, i.e., Ridge-regression BLUP, Bayes B and Bayesian Lasso, displayed similar prediction accuracy, whereas SVR-lin was less accurate. Accuracy values were moderate (0.3-0.4) for stem NDFD and leaf protein content, modest for leaf ADL and NDFD, and low to very low for the other traits. Along with previous results for the same germplasm set, this study indicates that GBS data can be exploited to improve both quality traits
-
Impact of enhanced ultraviolet-B radiation on flower, pollen, and nectar production
International Nuclear Information System (INIS)
Sampson, B.J.; Cane, J.H.
1999-01-01
Intensified ultraviolet-B radiation or UV-B (wavelengths between 280 and 320 nm) can delay flowering and diminish lifetime flower production in a few plants. Here we studied the effects of enhanced UV-B on floral traits crucial to pollination and pollinator reproduction. We observed simultaneous flowering responses of a new crop plant, Limnanthes alba (Limnathaceae), and a wildflower, Phacelia campanularia (Hydrophyllaceae), to five lifetime UV-B dosages ranging between 2.74 and 15.93 kJ·m -2 ·d -1 . Floral traits known to link plant pollination with bee host preference, host fidelity and larval development were measured. Intensified UV-B had no overall effect on nectar and pollen production of L. alba and P. campanularia flowers. A quadratic relationship between UV-B and nectar sugar production occurred in P. campanularia and showed that even subambient UV-B dosages can be deleterious for a floral trait. Other floral responses to UV-B were more dramatic and idiosyncratic. As UV-B dosage increased, L. alba plants were less likely to flower, but suffered no delays in flowering or reductions to lifetime flower production for those that did flower. Conversely, an equal proportion of P. campanularia plants flowered under all UV-B treatments, but these same plants experienced delayed onset to bloom and produced fewer flowers at greater UV-B intensities. Therefore, intensified UV-B elicits idiosyncratic responses in flowering phenology and flower production from these two annual plants. Diurnal patterns in nectar and pollen production strongly coincided with fluctuating humidity and only weakly with UV-B dosage. Overall, our results indicated that intensified UVB can alter some flowering traits that impinge upon plant competition for pollinator services, as well as plant and pollinator reproductive success. (author)