Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement Summary.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe`s culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement. Summary
International Nuclear Information System (INIS)
1996-06-01
This summary gives the major points of the Draft Environmental Impact Statement (EIS) prepared for the Nez Perce Tribal Hatchery by the Nez Perce Tribe (NPT), the Bonneville Power Administration (BPA), the Bureau of Indian Affairs (BIA), and other interested parties. The Nez Perce once were one of the largest Plateau tribes in the Northwest and occupied a territory that included north central Idaho, southeastern Washington and northeastern Oregon. Salmon and other migratory fish species are an invaluable food resource and an integral part of the Nez Perce Tribe's culture. Anadromous fish have always made up the bulk of the Nez Perce tribal diet and this dependence on salmon was recognized in the treaties made with the Tribe by the US. The historic economic, social, and religious significance of the fish to the Nez Perce Tribe continues to this day, which makes the decline of fish populations in the Columbia River Basin a substantial detrimental impact to the Nez Perce way of life. The Nez Perce Tribal Hatchery is a supplementation program that would rear and release spring, summer, and fall chinook (Oncorhynchus tshawytscha), biologically similar to wild fish, to reproduce in the Clearwater River Subbasin. Program managers propose techniques that are compatible with existing aquatic and riparian ecosystems and would integrate hatchery-produced salmon into the stream and river environments needed to complete their life cycle
National Research Council Canada - National Science Library
Pfau, Scott E
2006-01-01
... Cavalry pursuit of the Nez Perce. Many of the tactics, techniques, and procedures used by the modern day warriors often derive from lessons learned in early US military confrontations, such as the Nez Perce, and are applicable...
Council of Energy Resources Tribes 1993 summer internship report: Nez Perce Tribe
Energy Technology Data Exchange (ETDEWEB)
Crow, J.S.
1993-08-01
This paper is designed to be a working part of a larger project which would deal with the topic of Tribal interests affected by the DOE Environmental Restoration and Waste Management program and the approaches by which those Tribal interests can be advanced. Topics discussed in this paper include: background history of the Nez Perce Tribe`s relations with the US government; a Nez Perce view of tribal interests affected by DOE activities at Hanford; and a Nez Perce framework for private/governmental/tribal interest.
Monitoring and evaluation plan for the Nez Perce Tribal Hatchery
Energy Technology Data Exchange (ETDEWEB)
Steward, C.R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan, the 1995 Supplement to the Master Plan, and the Nez Perce Tribal Hatchery Program Environmental Impact Statement. The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts.
Nez Perce Tribal Hatchery Program : Draft Environmental Impact Statement.
Energy Technology Data Exchange (ETDEWEB)
United States. Bonneville Power Administration; Nez Perce Tribal Hatchery (Idaho).
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management.
Nez Perce Tribal Hatchery Program: Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Spring, summer and fall chinook salmon would be reared and acclimated to different areas in the Subbasin and released at the hatchery and satellite sites or in other watercourses throughout the Subbasin. The supplementation program differs from other hatchery programs because the fish would be released at different sizes and would return to reproduce naturally in the areas where they are released. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia River juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increase competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management
Nez Perce Tribal Hatchery Program. Draft environmental impact statement
International Nuclear Information System (INIS)
1996-06-01
Bonneville Power Administration, the Bureau of Indian Affairs, and the Nez Perce Tribe propose a supplementation program to restore chinook salmon to the Clearwater River Subbasin in Idaho. The Clearwater River is a tributary to the Snake River, which empties into the Columbia River. The Nez Perce Tribe would build and operate two central incubation and rearing hatcheries and six satellite facilities. Several environmental issues were identified during scoping: the possibility that the project would fail if mainstem Columbia river juvenile and adult passage problems are not solved; genetic risks to fish listed as endangered or threatened; potential impacts to wild and resident fish stocks because of increased competition for food and space; and water quality. The Proposed Action would affect several important aspects of Nez Perce tribal life, primarily salmon harvest, employment, and fisheries management. Impacts to cultural resources can be avoided so impacts would be low. Soil impacts would be localized and their effects would be local and temporary during construction. Impacts to water quality would be low. Mitigation would be used if impacts to groundwater or surface water are greater than anticipated. No impacts to floodplains are expected. Impacts to all categories of fish range from no to high impacts
Energy Technology Data Exchange (ETDEWEB)
Harty, Harold R.; Lundberg, Jeffrey H.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-02-01
The Nez Perce Tribal Hatchery (NPTH) responds directly to a need to mitigate for naturally-reproducing salmon in the Clearwater River subbasin. The overall goal is to produce and release fish that will survive to adulthood, spawn in the Clearwater River subbasin and produce viable offspring that will support future natural production and genetic integrity. Several underlying purposes of fisheries management will be maintained through this program: (1) Protect, mitigate, and enhance Columbia River subbasin anadromous fish resources. (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater River subbasin. (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project completion. (4) Sustain long-term fitness and genetic integrity of targeted fish populations. (5) Keep ecological and genetic impacts to non-target populations within acceptable limits. (6) Promote Nez Perce Tribal Management of Nez Perce Tribal hatchery Facilities and production areas within Nez Perce Treaty lands. Nez Perce Tribal Hatchery is a supplementation program that will rear and release spring, fall, and early-fall stocks of chinook salmon. Two life stages of spring chinook salmon will be released: parr and presmolts. Fall and early-fall chinook salmon will be released as subyearling smolts. The intent of NPTHC is to use conventional hatchery and Natural Rearing Enhancement Systems (NATURES) techniques to develop, increase and restore natural populations of spring and fall chinook salmon in the Clearwater River subbasin.
Forest resources of the Nez Perce National Forest
Michele Disney
2010-01-01
As part of a National Forest System cooperative inventory, the Interior West Forest Inventory and Analysis (IWFIA) Program of the USDA Forest Service conducted a forest resource inventory on the Nez Perce National Forest using a nationally standardized mapped-plot design (for more details see the section "Inventory methods"). This report presents highlights...
Monitoring and Evaluation Plan for the Nez Perce Tribal Hatchery, 1996 Technical Report.
Energy Technology Data Exchange (ETDEWEB)
Steward, Cleveland R.
1996-08-01
The Nez Perce Tribe has proposed to build and operate the Nez Perce Tribal Hatchery (NPTH) in the Clearwater River subbasin of Idaho for the purpose of restoring self-sustaining populations of spring, summer, and fall chinook salmon to their native habitats. The project comprises a combination of incubation and rearing facilities, satellite rearing facilities, juvenile and adult collection sites, and associated production and harvest management activities. As currently conceived, the NPTH program will produce approximately 768,000 spring chinook parr, 800,000 summer chinook fry, and 2,000,000 fall chinook fry on an annual basis. Hatchery fish would be spawned, reared, and released under conditions that promote wild-type characteristics, minimize genetic changes in both hatchery and wild chinook populations, and minimize undesirable ecological interactions. The primary objective is to enable hatchery-produced fish to return to reproduce naturally in the streams in which they are released. These and other characteristics of the project are described in further detail in the Nez Perce Tribal Hatchery Master Plan (Larson and Mobrand 1992), the 1995 Supplement to the Master Plan (Johnson et al. 1995), and the Nez Perce Tribal Hatchery Program Environmental Impact Statement (Bonneville Power Administration et al. 1996). The report in hand is referred to in project literature as the NPTH Monitoring and Evaluation (M&E) Plan. This report describes monitoring and evaluation activities that will help NPTH managers determine. whether they were successful in restoring chinook salmon populations and avoiding adverse ecological impacts. Program success will be gauged primarily by changes in the abundance and distribution of supplemented chinook populations. The evaluation of project-related impacts will focus on the biological effects of constructing and operating NPTH hatchery facilities, introducing hatchery fish into the natural environment, and removing or displacing wild
2006-06-16
Battle in which US Regimental Commander, Captain David Perry, appeared in a US court of inquiry to explain his devastating loss to the Nez Perce. He...changed, however, with the massacre of a detachment of eighty men under the command of Captain William J. Fetterman on the morning of 21 December...University, Homepage; available from http://www.howard.edu; Internet; accessed on 26 April 2006. 14John H Eicher, and David J. Eicher, Civil War High
Energy Technology Data Exchange (ETDEWEB)
Backman, Thomas; Sprague, Sherman; Bretz, Justin [Nez Perce Tribe
2009-06-10
The Nez Perce Tribal Hatchery (NPTH) program has the following goals (BPA, et al., 1997): (1) Protect, mitigate, and enhance Clearwater Subbasin anadromous fish resources; (2) Develop, reintroduce, and increase natural spawning populations of salmon within the Clearwater Subbasin; (3) Provide long-term harvest opportunities for Tribal and non-Tribal anglers within Nez Perce Treaty lands within four generations (20 years) following project initiation; (4) Sustain long-term fitness and genetic integrity of targeted fish populations; (5) Keep ecological and genetic impacts to non-target populations within acceptable limits; and (6) Promote Nez Perce Tribal management of Nez Perce Tribal Hatchery Facilities and production areas within Nez Perce Treaty lands. The NPTH program was designed to rear and release 1.4 million fall and 625,000 spring Chinook salmon. Construction of the central incubation and rearing facility NPTH and spring Chinook salmon acclimation facilities were completed in 2003 and the first full term NPTH releases occurred in 2004 (Brood Year 03). Monitoring and evaluation plans (Steward, 1996; Hesse and Cramer, 2000) were established to determine whether the Nez Perce Tribal Hatchery program is achieving its stated goals. The monitoring and evaluation action plan identifies the need for annual data collection and annual reporting. In addition, recurring 5-year program reviews will evaluate emerging trends and aid in the determination of the effectiveness of the NPTH program with recommendations to improve the program's implementation. This report covers the Migratory Year (MY) 2007 period of the NPTH Monitoring & Evaluation (M&E) program. There are three NPTH spring Chinook salmon treatment streams: Lolo Creek, Newsome Creek, and Meadow Creek. In 2007, Lolo Creek received 140,284 Brood Year (BY) 2006 acclimated pre-smolts at an average weight of 34.9 grams per fish, Newsome Creek received 77,317 BY 2006 acclimated pre-smolts at an average of 24
International Nuclear Information System (INIS)
Liebow, E.B.; Younger, C.A.; Broyles, J.A.
1987-11-01
For the purposes of the Nuclear Waste Policy Act, the Confederated Tribes and Bands of the Yakima Indian Nation, the Confederated Tribes of the Umatilla Indian Reservation, and the Nez Perce Tribe have been accorded the status of ''Affected Indian Tribe'' and have become party to the proceedings to determine a suitable location for the nation's first commercial waste repository. Each of the Tribes has expressed concerns about the suitability of the Hanford Site in eastern Washington. These concerns, in general, address the proposed repository's effects on traditional spiritual beliefs and cultural practices, on tribal sovereignty and the Tribes' right to self-government, on the natural resources under tribal management jurisdiction, and on the health and socioeconomic characteristics of the Tribes' reservation communities. The Yakima, Umatilla, and Nez Perce have distinctive cultural traditions that may be adversely affected by activities related to the Basalt Waste Isolation Project (BWIP). Further, the Tribes enjoy a unique relationship with the federal government. Because of their distinctive cultures and governmental status, particular attention will be paid to expressed interests of the Tribes, and to ways in which these interests may be affected by the repository program. Monitoring is needed to describe current conditions among the Affected Tribes' populations, to describe BWIP site characterization activities affecting the Tribes, and to measure any changes in these conditions that may occur as a direct result of site characterization. This paper reports our first efforts at gathering historical information. It summarizes materials contained in two sources: the reports of field agents to the Commissioner of Indian Affairs (1854-1936), and the dockets of the Indian Claims Commission. 24 refs., 3 figs
Dennis E. Ferguson; John C. Byrne; William R. Wykoff; Brian Kummet; Ted Hensold
2011-01-01
Stands of dense, natural ponderosa pine (Pinus ponderosa var. ponderosa) regeneration were operationally, precommercially thinned at seven sites - four on Nez Perce Tribal lands in northern Idaho and three on Spokane Tribal lands in eastern Washington. Five spacing treatments were studied - control (no thinning), 5x5 ft, 7x7 ft, 10x10 ft, and 14x14 ft. Sample trees...
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2006-03-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2001 annual report combines information from two contracts with a combined value of $2,336,491. They are identified by Bonneville Power Administration as follows: (1) Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and (2) Planning and Design--Project No. 1983-350-00, Contract No. 4035. The Operations and Maintenance (O&M) budget of $2,166,110 was divided as follows: Facility Development and Fish Production Costs--$860,463; and Equipment Purchases as capital cost--$1,305,647 for equipment and subcontracts. The Planning and Design (P&D) budget of $170,381 was allocated to development of a Coho master planning document in conjunction with Nez Perce Tribal Hatchery. The O&M budget expenditures represent personnel and fish production expenses; e.g., administration, management, coordination, facility development, personnel training and fish production costs for spring Chinook and Coho salmon. Under Objective 1: Fish Culture Training and Education, tribal staff worked at Clearwater Anadromous Hatchery (CAFH) an Idaho Department of Fish and Game (IDFG) facility to produce spring Chinook smolt and parr for release that are intended to provide future broodstock for NPTH. As a training exercise, BPA allowed tribal staff to rear Coho salmon at Dworshak National Fish Hatchery, a U.S. Fish and Wildlife Service (USFWS) facility. This statement of work allows this type of training to prepare tribal staff to later rear salmon at Nez Perce Tribal Hatchery under Task 1.6. As a subset of the O&M budget, the equipment purchase budget of $1,305,647 less $82,080 for subcontracts provides operational and portable equipment necessary for NPTH facilities after construction. The equipment budget for the year was $1,223,567; this year's purchases amounted $287,364.48 (see
International Nuclear Information System (INIS)
Larson, Roy Edward; Walker, Grant
2002-01-01
Nez Perce Tribal Hatchery (NPTH) Year-2000 Combined Maintenance and Operations (O and M) and Planning and Design (P and D) contract is hereby completed based on this annual report patterned after the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration. Primary project activities focused on completion of the Northwest Power Planning Council Step-3 process that: (1) Accepted final design, (2) Authorized a capital construction amount of $16,050,000, and (3) Authorized contractor selection, and (4) Provided construction site dedication, and (5) Implemented construction activities over an anticipated 2-year period of July 2000 through October 2002
Energy Technology Data Exchange (ETDEWEB)
Larson, Roy Edward; Walker, Grant W.; Penney, Aaron K. (Nez Perce Tribe, Lapwai, ID)
2005-12-01
This report fulfills the contract obligations based on the Statement of Work (SOW) for the project as contracted with Bonneville Power Administration (BPA). Nez Perce Tribal Hatchery (NPTH) Year-2002 annual report combines information from two contracts with a combined value of $3,036,014. Bonneville Power Administration identifies them as follows; (1) Part I--Operations and Maintenance--Project No. 1983-350-00, Contract No. 4504, and $2,682,635 which includes--Equipment costs of $1,807,105. (2) Part II--Planning and Design--Project No. 1983-35-04, Contract No. 4035, $352,379 for Clearwater Coho Restoration Master Plan development Based on NPPC authorization for construction and operation of NPTH, the annual contracts were negotiated for the amounts shown above under (1) and (2). Construction contracts were handled by BPA until all facilities are completed and accepted.
Energy Technology Data Exchange (ETDEWEB)
Kucera, Paul A.; Johnson, David B. (Nez Perce Tribe, Lapwai, ID)
1986-08-01
A biological and physical inventory of selected tributaries in the lower Clearwater River basin was conducted to collect information for the development of alternatives and recommendations for the enhancement of the anadromous fish resources in streams on the Nez Perce Reservation. Five streams within the Reservation were selected for study: Bedrock and Cottonwood Creeks were investigated over a two year period (1983 to 1984) and Big Canyon, Jacks and Mission Creeks were studied for one year (1983). Biological information was collected and analyzed on the density, biomass, production and outmigration of juvenile summer steelhead trout. Physical habitat information was collected on available instream cover, stream discharge, stream velocity, water temperature, bottom substrate, embeddedness and stream width and depth. The report focuses on the relationships between physical stream habitat and juvenile steelhead trout abundance.
CERT tribal internship program. Final intern report: D`Lisa Penney, 1994
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
The purpose of this intern`s project was to: education the Nez Perce people of the Hanford situation; begin researching into past and present health effects from the Hanford site; and inform and educate the Nez Perce people of the Hanford site and past exposures. The specific objectives were to begin researching the history of Nez Perce people and Hanford; create an understanding for the importance of this research; define the radiation and risks and how they occur; inform the Nez Perce people of the issue; and write the paper so it is easy to understand. This intern report contains a copy of the final paper written for the Nez Perce people. Because the dose reconstruction for Hanford is not complete, the health effects section is informative, but not definitive.
Energy Technology Data Exchange (ETDEWEB)
Sintov, Nicole; Orosz, Michael; Schultz, P. Wesley
2015-01-01
The mission of the Personalized Energy Reduction Cyber-physical System (PERCS) is to create new possibilities for improving building operating efficiency, enhancing grid reliability, avoiding costly power interruptions, and mitigating greenhouse gas emissions. PERCS proposes to achieve these outcomes by engaging building occupants as partners in a user-centered smart service platform. Using a non-intrusive load monitoring approach, PERCS uses a single sensing point in each home to capture smart electric meter data in real time. The household energy signal is disaggregated into individual load signatures of common appliances (e.g., air conditioners), yielding near real-time appliance-level energy information. Users interact with PERCS via a mobile phone platform that provides household- and appliance-level energy feedback, tailored recommendations, and a competitive game tied to energy use and behavioral changes. PERCS challenges traditional energy management approaches by directly engaging occupant as key elements in a technological system.
Neutron Decay with PERC: a Progress Report
International Nuclear Information System (INIS)
Konrad, G; Abele, H; Erhart, J; Fillunger, H; Gösselsberger, C; Horvath, M; Jericha, E; Klauser, C; Maix, R K; Nowak, S; Sauerzopf, C; Beck, M; Heil, W; Drescher, C; Dubbers, D; Märkisch, B; Mest, H; Rebrova, N; Roick, C; Klenke, J
2012-01-01
The PERC collaboration will perform high-precision measurements of angular correlations in neutron beta decay at the beam facility MEPHISTO of the Forschungs-Neutronenquelle Heinz Maier-Leibnitz in Munich, Germany. The new beam station PERC, a clean, bright, and versatile source of neutron decay products, is designed to improve the sensitivity of neutron decay studies by one order of magnitude. The charged decay products are collected by a strong longitudinal magnetic field directly from inside a neutron guide. This combination provides the highest phase space density of decay products. A magnetic mirror serves to perform precise cuts in phase space, reducing related systematic errors. The new instrument PERC is under development by an international collaboration. The physics motivation, sensitivity, and applications of PERC as well as the status of the design and preliminary results on uncertainties in proton spectroscopy are presented in this paper.
Protect and Restore Red River Watershed, 2007-2008 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Bransford, Stephanie [Nez Perce Tribe Fisheries/Watershed Program
2009-05-04
The Nez Perce Tribe Department of Fisheries Resource Management, Watershed Division approaches watershed restoration with a ridge-top to ridge-top approach. The Nez Perce Tribe (NPT) and the Nez Perce National Forest (NPNF) have formed a partnership in completing watershed restoration activities, and through this partnership more work is accomplished by sharing funding and resources in our effort. The Nez Perce Tribe began watershed restoration projects within the Red River Watershed of the South Fork Clearwater River in 2001. Progress has been made in restoring the watershed through road decommissioning and culvert replacement. From completing a watershed assessment to two NEPA efforts and a final stream restoration design, we will begin the effort of restoring the mainstem channel of Red River to provide spawning and rearing habitat for anadromous and resident fish species. Roads have been surveyed and prioritized for removal or improvement as well as culverts being prioritized for replacement to accommodate fish passage throughout the watershed. Another major, and extremely, important component of this project is the Red River Meadow Conservation Easement. We have begun the process of pursuing a conservation easement on approximately 270 acres of prime meadow habitat (Red River runs through this meadow and is prime spawning and rearing habitat).
77 FR 68065 - Amendment of Class D and Class E Airspace; Lewiston, ID
2012-11-15
... Measuring Equipment (VOR/ DME), and the Lewiston-Nez Perce Instrument Landing System (ILS) Localizer... feet or more above the surface of the earth. * * * * * ANM ID E5 Lewiston, ID [Modified] Lewiston-Nez...
Directory of Open Access Journals (Sweden)
Jing Ma
2009-01-01
Full Text Available Perchloroethylene (PERC is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994–2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
International Nuclear Information System (INIS)
Ma, J.; Lessner, L.; Lessner, L.; Carpenter, D.O.; Schreiber, J.
2010-01-01
Perchloroethylene (PERC) is commonly used as a dry cleaning solvent and is believed to be a human carcinogen, with occupational exposure resulting in elevated rates of kidney cancer. Living near a dry cleaning facility using PERC has been demonstrated to increase the risk of PERC exposure throughout the building where the dry cleaning is conducted, and in nearby buildings. We designed this study to test the hypothesis that living in an area where there are many PERC dry cleaners increases PERC exposure and the risk of kidney cancer. We matched the diagnosis of kidney cancer from hospitalization discharge data in New York City for the years 1994-2004 by zip code of patient residence to the zip code density of dry cleaners using PERC, as a surrogate for residential exposure. We controlled for age, race, gender, and median household income. We found a significant association between the density of PERC dry cleaning establishments and the rate of hospital discharges that include a diagnosis of kidney cancer among persons 45 years of age and older living in New York City. The rate ratio increased by 10 to 27% for the populations in zip codes with higher density of PERC dry cleaners. Because our exposure assessment is inexact, we are likely underestimating the real association between exposure to PERC and rates of kidney cancer. Our results support the hypothesis that living near a dry cleaning facility using PERC increases the risk of PERC exposure and of developing kidney cancer. To our knowledge, this study is the first to demonstrate an association between residential PERC exposure and cancer risk.
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe Resources Management Staff, (Nez Perce Tribe, Department of Fisheries Resource Management, Lapwai, ID)
2005-09-01
White sturgeon in the Hells Canyon reach (HCR) of the Snake River are of cultural importance to the Nez Perce Tribe. However, subsistence and ceremonial fishing opportunities have been severely limited as a result of low numbers of white sturgeon in the HCR. Hydrosystem development in the Columbia River Basin has depressed numbers and productivity of white sturgeon in the HCR by isolating fish in impounded reaches of the basin, restricting access to optimal rearing habitats, reducing the anadromous forage base, and modifying early life-history habitats. Consequently, a proactive management plan is needed to mitigate for the loss of white sturgeon production in the HCR, and to identify and implement feasible measures that will restore and rebuild the white sturgeon population to a level that sustains viability and can support an annual harvest. This comprehensive and adaptive management plan describes the goals, objectives, strategies, actions, and expected evaluative timeframes for restoring the white sturgeon population in the HCR. The goal of this plan, which is to maintain a viable, persistent population that can support a sustainable fishery, is supported by the following objectives: (1) a natural, stable age structure comprising both juveniles and a broad spectrum of spawning age-classes; (2) stable or increasing numbers of both juveniles and adults; (3) consistent levels of average recruitment to ensure future contribution to reproductive potential; (4) stable genetic diversity comparable to current levels; (5) a minimum level of abundance of 2,500 adults to minimize extinction risk; and (6) provision of an annual sustainable harvest of 5 kg/ha. To achieve management objectives, potential mitigative actions were developed by a Biological Risk Assessment Team (BRAT). Identified strategies and actions included enhancing growth and survival rates by restoring anadromous fish runs and increasing passage opportunities for white sturgeon, reducing mortality rates
Las “Historias ilustrativas de la violencia” de Edilberto Jiménez: narrativa, testimonio y memoria
Directory of Open Access Journals (Sweden)
Elisa Cairati
2013-06-01
Full Text Available This work aims to analyse the cultural contents and aesthetic position of Edilberto Jiménez Quispe’s illustrations of the age of violence, presented in Chungui: violencia y trazos de memoria (Lima, 2009. Jiménez, through the plastic and figurative traditional style, makes public the concealed and denied memory of the Internal Armed Conflict. The combination of testimonies and paintings is concerned as an emotional significance of memory: a space of re-established dialogue after the age of violence, in the direction of the elaboration of identity in the region of Ayacucho.
Grande Ronde Basin Supplementation Program; Lostine River, 2000 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Grande Ronde Basin Supplementation Program; Lostine River, 2001 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Onjukka, Sam T. (Oregon Department of Fish and Wildlife, Portland, OR); Harbeck, Jim (Nez Perce Tribe, Department of Fisheries Resource Management, Enterprise, OR)
2003-03-01
The Northwest Power Planning Council (NPPC) identified supplementation as a high priority to achieve its goal of increasing runs of anadromous fish in the Columbia Basin. Supplementation activities in the Lostine River and associated monitoring and evaluation conducted by the Nez Perce Tribe relate directly to the needs addressed in the Columbia River Basin Fish and Wildlife Program (NPPC 1994). Measure 7.4L.1 of the Program mandates that appropriate research accompany any proposed supplementation. In addition, measure 7.3B.2 of the Program stresses the need for evaluating supplementation projects to assess their ability to increase production. Finally, Section 7.4D.3 encourages the study of hatchery rearing and release strategies to improve survival and adaptation of cultured fish. In 1997, Oregon Department of Fisheries and Wildlife (ODFW) requested a modification of Permit 1011 to allow the take of adult spring chinook salmon. In 1998, the Nez Perce Tribe also requested a permit specific to activities on Lostine River. The permit was issued in 2000. A special condition in the permits required the development of a long term management plan for the spring chinook salmon of the Grande Ronde Basin. The Nez Perce Tribe, ODFW, and the Confederated Tribes of the Umatilla Indian Reservation (CTUIR) completed a formal long range plan entitled ''Grande Ronde Basin Endemic Spring Chinook Salmon Supplementation Program''. The program proposes to increase the survival of spring chinook salmon in the Grand Ronde Basin through hatchery intervention. Adult salmon from the Lostine River, Catherine Creek, and the Upper Grande Ronde River are used for a conventional supplementation program in the basin. The Nez Perce program currently operates under the ESA Section 10 Permit 1149.
Juan Ramón Jiménez and Nietzsche
Directory of Open Access Journals (Sweden)
John P. Devlin
1983-01-01
Full Text Available The young Juan Ramón Jiménez shared the enthusiasm for the writings of Nietzsche prevalent among his contemporaries. More significant are the interest in and affinity with Nietzsche which persisted into the poet's maturity. Jiménez found in Nietzsche not only a man of ideas but a poet who claimed to be a potent spiritual force. Both writers held that the modern age could recover a sense of spiritual integrity through the will of the individual to live and interpret human existence as an aesthetic phenomenon. Nietzsche's views on the nature of art and the role of the artist helped to sustain Jiménez' exalted and elitist view of poetry and the poet's mission. Jiménez felt an ethical kinship with the philosopher who asserted the absolute uniqueness of the creative individual, the end of whose existence was self-realization through his art. Nietzsche's doctrine of heroic vitalism as an antidote to chronic spiritual malaise corresponds to Jiménez' revitalized vision of the poetic word proclaimed in the Diario and elaborated in subsequent verse and prose writings.
High precision neutron polarization for PERC
International Nuclear Information System (INIS)
Klauser, C.
2013-01-01
The decay of the free neutron into a proton, an electron and an anti-electron neutrino offers a simple system to study the semi-leptonic weak decay. High precision measurements of angular correlation coefficients of this decay provide the opportunity to test the standard model on the low energy frontier. The Proton Electron Radiation Channel PERC is part of a new generation of expriments pushing the accuracy of such an angular correlation coefficient measurement towards 10 -4 . Past experiments have been limited to an accuracy of 10 -3 with uncertainties on the neutron polarization as one of the leading systematic errors. This thesis focuses on the development of a stable, highly precise neutron polarization for a large, divergent cold neutron beam. A diagnostic tool that provides polarization higher than 99.99 % and analyzes with an accuracy of 10 -4 , the Opaque Test Bench, is presented and validated. It consists of two highly opaque polarized helium cells. The Opaque Test Bench reveals depolarizing effects in polarizing supermirrors commonly used for polarization in neutron decay experiments. These effects are investigated in detail. They are due to imperfect lateral magnetization in supermirror layers and can be minimized by significantly increased magnetizing fields and low incidence angle and supermirror factor m. A subsequent test in the crossed (X-SM) geometry demonstrated polarizations up to 99.97% from supermirrors only, improving neutron polarization with supermirrors by an order of magnitude. The thesis also discusses other neutron optical components of the PERC beamline: Monte-Carlo simulations of the beamline under consideration of the primary guide are carried out. In addition, calculation shows that PERC would statistically profit from an installation at the European Spallation source. Furthermore, beamline components were tested. A radio-frequency spin flipper was confirmed to work with an efficiency higher than 0.9999. (author) [de
Innovative manufacturing technologies for low-cost, high efficiency PERC-based PV modules
Energy Technology Data Exchange (ETDEWEB)
Yelundur, Vijay [Suniva Inc., Norcross, GA (United States)
2017-04-19
The goal this project was to accelerate the deployment of innovative solar cell and module technologies that reduce the cost of PERC-based modules to best-in-class. New module integration technology was to be used to reduce the cost and reliance on conventional silver bus bar pastes and enhance cell efficiency. On the cell manufacturing front, the cost of PERC solar cells was to be reduced by introducing advanced metallization approaches to increase cell efficiency. These advancements will be combined with process optimization to target cell efficiencies in the range of 21 to 21.5%. This project will also explore the viability of a bifacial PERC solar cell design to enable cost savings through the use of thin silicon wafers. This project was terminated on 4/30/17 after four months of activity due financial challenges facing the recipient.
75 FR 28612 - Environmental Impact Statements; Notice of Availability
2010-05-21
... Counties, OR and Adams and Nez Perce Counties, ID, Wait Period Ends: 06/21/2010, Contact: Robert W. Rock.... EIS No. 20100181, Final EIS, DOE, MS, Kemper County Integrated Gasification Combined-Cycle (IGCC...
Directory of Open Access Journals (Sweden)
Armiche Carrillo Delgado
2015-06-01
Full Text Available Aunque tradicionalmente se consideró a los cómics como un simple entretenimiento juvenil, lo cierto es que en realidad constituyen una herramienta para la transmisión de concepciones ideológicas y valores. A través del análisis de la obra de Carlos Giménez, publicada en El Papus, veremos como la historieta es perfectamente capaz de convertirse en una forma de lucha ideológica.Although traditionally considered to comics as a mere youth entertainment, the truth is that actually constitute a tool for the transmission of values and ideological concepts. Through the analysis of the work of Carlos Giménez, published in El Papus, we see how the comic-strip is perfectly capable of becoming a form of ideological struggle.
Directory of Open Access Journals (Sweden)
Peisheng Liu
2014-01-01
Full Text Available Crystalline silicon PERCs with dot or line openings on rear surface were studied here. By measuring the minor carrier lifetimes of the PERCs with dot and line openings, passivation effects of rear surface with dot and line openings were discussed. The performance affected by dot and line openings was analyzed in detail by testing the open-circuit voltages, short-circuit current densities, fill factors, and conversion efficiencies of the PERCs. The results show that the wider space resulted in better minor carrier lifetimes on the rear surface. And the cells with a line opening space of 0.5 mm had an average of 0.22% improvement of conversion efficiency, compared with the cells with full-area Al-BSF. On the other hand, the dot opening PERCs exhibited only a conversion efficiency of 17.4%, although there had been good rear surface reflectivity. The bad Al-Si alloy layer and large hollow densities in dot Al-contacts resulted in bad performance of the PERCs with dot openings.
Plaidoyer pour le lavage de nez dans les pathologies naso ...
African Journals Online (AJOL)
Le lavage de nez permet l'humidification des muqueuses partant favorise le nettoyage mucociliaire en enlevant voire diminuant les croutes favorise leur élimination et ainsi la guérison en réduisant le recours aux antibiotiques [4-10]. Sans danger, le lavage de nez est bien tolérée tant chez les enfants que chez les adultes.
Lower Red River Meadow Stream Restoration Project
International Nuclear Information System (INIS)
1996-05-01
As part of a continuing effort to restore anadromous fish populations in the South Fork Clearwater River basin of Idaho, Bonneville Power Administration (BPA) proposes to fund the Lower Red River Meadow Restoration Project (Project). The Project is a cooperative effort with the Idaho Soil and Water Conservation District, Nez Perce National Forest, Idaho Department of Fish and Game (IDFG), and the Nez Perce Tribe of Idaho. The proposed action would allow the sponsors to perform stream bank stabilization, aquatic and riparian habitat improvement activities on IDFG's Red River Management Area and to secure long-term conservation contracts or agreements for conducting streambank and habitat improvement activities with participating private landowners located in the Idaho County, Idaho, study area. This preliminary Environmental Assessment (EA) examines the potential environmental effects of stabilizing the stream channel, restoring juvenile fish rearing habitat and reestablishing a riparian shrub community along the stream
Coho Salmon Master Plan, Clearwater River Basin.
Energy Technology Data Exchange (ETDEWEB)
Nez Perce Tribe; FishPro
2004-10-01
The Nez Perce Tribe has a desire and a goal to reintroduce and restore coho salmon to the Clearwater River Subbasin at levels of abundance and productivity sufficient to support sustainable runs and annual harvest. Consistent with the Clearwater Subbasin Plan (EcoVista 2003), the Nez Perce Tribe envisions developing an annual escapement of 14,000 coho salmon to the Clearwater River Subbasin. In 1994, the Nez Perce Tribe began coho reintroduction by securing eggs through U.S. v. Oregon; by 1998 this agreement provided an annual transfer of 550,000 coho salmon smolts from lower Columbia River hatchery facilities for release in the Clearwater River Subbasin. In 1998, the Northwest Power and Conservation Council authorized the Bonneville Power Administration to fund the development of a Master Plan to guide this reintroduction effort. This Master Plan describes the results of experimental releases of coho salmon in the Clearwater River Subbasin, which have been ongoing since 1995. These data are combined with results of recent coho reintroduction efforts by the Yakama Nation, general coho life history information, and historical information regarding the distribution and life history of Snake River coho salmon. This information is used to assess a number of alternative strategies aimed at restoring coho salmon to historical habitats in the Clearwater River subbasin. These data suggest that there is a high probability that coho salmon can be restored to the Clearwater River subbasin. In addition, the data also suggest that the re-establishment of coho salmon could be substantially aided by: (1) the construction of low-tech acclimation facilities; (2) the establishment of a 'localized' stock of coho salmon; and (3) the construction of hatchery facilities to provide a source of juvenile coho salmon for future supplementation activities. The Nez Perce Tribe recognizes that there are factors which may limit the success of coho reintroduction. As a result of these
Bisbee, Yolanda J. Guzman
2013-01-01
This Indigenous Framed Research will utilize counter-storytelling through shared collaborator stories provided by Nez Perce Native American Graduates. The methodology is shaped by an Indigenous Framework as this form of research promotes and develops a culturally resonant environment for constructing, analyzing and sharing information. The…
76 FR 44000 - Environmental Impact Statements; Notice of Availability
2011-07-22
..., Review Period Ends: 08/15/2011, Contact: Charles J. O'Neill 615-781-5772. EIS No. 20110226, Draft EIS, USFS, ID, Little Slate Project, Proposes Watershed Improvement, Timber Harvest, Fuel Treatments, Soil Restoration and Access Changes in the Little Slate Creek, Salmon River Ranger District, Nez Perce National...
Energy Technology Data Exchange (ETDEWEB)
Faurot, Dave; Kucera, Paul A.; Armstrong, Robyn D. (Nez Perce Tribe, Lapwai, ID)
1998-06-01
Chinook salmon populations in the Northwest are decreasing in number. The Nez Perce Tribe was funded in 1997 by the Bonneville Power Administration to coordinate and initiate gene banking of adult male gametes from Endangered Species Act (ESA) listed spring and summer chinook salmon in the Snake River basin.
Trophic structure and mercury biomagnification in tropical fish assemblages, Iténez River, Bolivia.
Directory of Open Access Journals (Sweden)
Marc Pouilly
Full Text Available We examined mercury concentrations in three fish assemblages to estimate biomagnification rates in the Iténez main river, affected by anthropogenic activities, and two unperturbed rivers from the Iténez basin, Bolivian Amazon. Rivers presented low to moderate water mercury concentrations (from 1.25 ng L(-1 to 2.96 ng L(-1 and natural differences in terms of sediment load. Mercury biomagnification rates were confronted to trophic structure depicted by carbon and nitrogen stable isotopes composition (δ(15N; δ(13C of primary trophic sources, invertebrates and fishes. Results showed a slight fish contamination in the Iténez River compared to the unperturbed rivers, with higher mercury concentrations in piscivore species (0.15 µg g(-1 vs. 0.11 µg g(-1 in the unperturbed rivers and a higher biomagnification rate. Trophic structure analysis showed that the higher biomagnification rate in the Iténez River could not be attributed to a longer food chain. Nevertheless, it revealed for the Iténez River a higher contribution of periphyton to the diet of the primary consumers fish species; and more negative δ(13C values for primary trophic sources, invertebrates and fishes that could indicate a higher contribution of methanotrophic bacteria. These two factors may enhance methylation and methyl mercury transfer in the food web and thus, alternatively or complementarily to the impact of the anthropogenic activities, may explain mercury differences observed in fishes from the Iténez River in comparison to the two other rivers.
Harris, Elizabeth; McFarland, Joyce; Siebold, Wendi; Aguilar, Rafael; Sarmiento, Ana
2007-01-01
The Idaho Consortium for Safe Schools Healthy Students consists of three school districts in rural North Central Idaho and the Nez Perce Tribe's Students for Success Program. Universal prevention programs implemented in the elementary schools include Second Step and the middle schools implemented the Life Skills program. Each of the three…
Northeast Oregon Hatchery Spring Chinook Master Plan, Technical Report 2000.
Energy Technology Data Exchange (ETDEWEB)
Ashe, Becky L.; Concannon, Kathleen; Johnson, David B.
2000-04-01
Spring chinook salmon populations in the Imnaha and Grande Ronde rivers are listed as threatened under the Endangered Species Act (ESA) and are at high risk of extirpation. The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and Oregon Department of Fish and Wildlife, are co-managers of conservation/restoration programs for Imnaha and Grande Ronde spring chinook salmon that use hatchery supplementation and conventional and captive broodstock techniques. The immediate goal of these programs is to prevent extirpation and provide the potential for restoration once factors limiting production are addressed. These programs redirect production occurring under the Lower Snake River Compensation Plan (LSRCP) from mitigation to conservation and restoration. Both the Imnaha and Grande Ronde conservation/restoration programs are described in ESA Section 10 permit applications and the co-managers refer to the fish production from these programs as the Currently Permitted Program (CPP). Recently, co-managers have determined that it is impossible to produce the CPP at Lookingglass Hatchery, the LSRCP facility intended for production, and that without additional facilities, production must be cut from these conservation programs. Development of new facilities for these programs through the Columbia Basin Fish and Wildlife Program is considered a new production initiative by the Northwest Power Planning Council (NPPC) and requires a master plan. The master plan provides the NPPC, program proponents and others with the information they need to make sound decisions about whether the proposed facilities to restore salmon populations should move forward to design. This master plan describes alternatives considered to meet the facility needs of the CPP so the conservation program can be fully implemented. Co-managers considered three alternatives: modify Lookingglass Hatchery; use existing facilities elsewhere in the Basin; and use new facilities in
Salmonid Gamete Preservation in the Snake River Basin, 1998 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Armstrong, Robyn; Kucera, Paul A. (Nez Perce Tribe, Lapwai, ID)
1999-03-01
Steelhead (Oncorhynchus mykiss) and salmon (Oncorhynchus tshawytscha)populations in the Northwest are decreasing. The Nez Perce Tribe (Tribe) was funded in 1998 by the Bonneville Power Administration to coordinate gene banking of male gametes from Endangered Species Act (ESA) listed steelhead and spring and summer chinook salmon in the Snake River basin.
Park, Sungeun; Park, Hyomin; Kim, Dongseop; Yang, JungYup; Lee, Dongho; Kim, Young-Su; Kim, Hyun-Jong; Suh, Dongchul; Min, Byoung Koun; Kim, Kyung Nam; Park, Se Jin; Kim, Donghwan; Lee, Hae-Seok; Nam, Junggyu; Kang, Yoonmook
2018-05-01
Passivated emitter and rear contact (PERC) is a promising technology owing to high efficiency can be achieved with p-type wafer and their easily applicable to existing lines. In case of using p-type mono wafer, 0.5-1% efficiency increase is expected with PERC technologies compared to existing Al BSF solar cells, while for multi-wafer solar cells it is 0.5-0.8%. We addressed the optimization of PERC solar cells using the Al paste. The paste was prepared from the aluminum-silicon alloy with eutectic composition to avoid the formation of voids that degrade the open-circuit voltage. The glass frit of the paste was changed to improve adhesion. Scanning electron microscopy revealed voids and local back surface field between the aluminum electrode and silicon base. We confirmed the conditions on the SiNx passivation layer for achieving higher efficiency and better adhesion for long-term stability. The cell characteristics were compared across cells containing different pastes. PERC solar cells with the Al/Si eutectic paste exhibited the efficiency of 19.6%.
Directory of Open Access Journals (Sweden)
Rafaél Maya
1979-10-01
Full Text Available La aparición de Aurelio Martínez Mutis en el escenario de las letras colombianas, hace unos treinta y cinco años, más o menos, fue súbita y fulgurante. Su "Epopeya del Cóndor", poesía premiada en el concurso abierto por la revista Mundial, que dirigía en París Rubén Darío, lo hizo célebre, de la noche a la mañana, entre los pueblos de habla hispana.
A estratégia de pricing do Modelo Continente Hipermercados : perceção do consumidor
Sousa, Vasco Monteiro Carvalho de
2016-01-01
O objetivo da presente investigação é estudar a perceção dos consumidores sobre as estratégias de pricing do Modelo Continente Hipermercados, e surge no formato de uma tese de dissertação. O tema desta investigação abrange objetos predominantes da área de Marketing, nomeadamente o pricing, a distribuição e a perceção do consumidor. No estudo foi aplicado o método de estudo de caso incluindo a observação, análise e discussão. A investigação foi dividida por um lado na abordag...
José Miguel Jiménez receives Order of Alfonso X the Wise
CERN Bulletin
2016-01-01
On 12 July 2016, José Miguel Jiménez, Head of CERN Technology Department, has been awarded a spanish civil decoration — an encomienda — of the Order of Alfonso X the Wise (see here), for his outstanding experience in the field of research and scientific management in particle physics. The ceremony took place at the National Library of Spain, in Madrid, on 12 July. From left: Marcial Marín Hellín, Secretary of State for Education, Professional training and Universities; José María Lassalle Ruiz, Secretary of State for Culture; Íñigo Méndez de Vigo y Montojo, Ministry of Education, Culture and Sport; José Miguel Jiménez, Head of CERN Technology Department; Carmen Vela Olmo, Secretary of State for Investigation, Development and Innovation. (Photo: ©Javier Martínez de la Torre, M...
PERC 2 High-End Computer System Performance: Scalable Science and Engineering
Energy Technology Data Exchange (ETDEWEB)
Daniel Reed
2006-10-15
During two years of SciDAC PERC-2, our activities had centered largely on development of new performance analysis techniques to enable efficient use on systems containing thousands or tens of thousands of processors. In addition, we continued our application engagement efforts and utilized our tools to study the performance of various SciDAC applications on a variety of HPC platforms.
DEFF Research Database (Denmark)
Jensen, Kim Ebensgaard
2014-01-01
A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)......A review of Nuria del Campo Martínez: Illocutionary Constructions in English: Cognitive Motivation and Linguistic Realization (2013)...
Simulation Tools for Forest Health Analysis: An Application in the Red River Watershed, Idaho
Andrew J. McMahan; Eric L. Smith
2006-01-01
Software tools for landscape analyses--including FVS model extensions, and a number of FVS-related pre- and post-processing âtoolsâ--are presented, using an analysis in the Red River Watershed, Nez Perce National Forest as an example. We present (1) a discussion of pre-simulation data analysis; (2) the Physiographic Information Extraction System (PIES), a tool that can...
Fish Passage Assessment: Big Canyon Creek Watershed, Technical Report 2004.
Energy Technology Data Exchange (ETDEWEB)
Christian, Richard
2004-02-01
This report presents the results of the fish passage assessment as outlined as part of the Protect and Restore the Big Canyon Creek Watershed project as detailed in the CY2003 Statement of Work (SOW). As part of the Northwest Power Planning Council's Columbia Basin Fish and Wildlife Program (FWP), this project is one of Bonneville Power Administration's (BPA) many efforts at off-site mitigation for damage to salmon and steelhead runs, their migration, and wildlife habitat caused by the construction and operation of federal hydroelectric dams on the Columbia River and its tributaries. The proposed restoration activities within the Big Canyon Creek watershed follow the watershed restoration approach mandated by the Fisheries and Watershed Program. Nez Perce Tribal Fisheries/Watershed Program vision focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects. We strive toward maximizing historic ecosystem productive health, for the restoration of anadromous and resident fish populations. The Nez Perce Tribal Fisheries/Watershed Program (NPTFWP) sponsors the Protect and Restore the Big Canyon Creek Watershed project. The NPTFWP has the authority to allocate funds under the provisions set forth in their contract with BPA. In the state of Idaho vast numbers of relatively small obstructions, such as road culverts, block thousands of miles of habitat suitable for a variety of fish species. To date, most agencies and land managers have not had sufficient, quantifiable data to adequately address these barrier sites. The ultimate objective of this comprehensive inventory and assessment was to identify all barrier crossings within the watershed. The barriers were then prioritized according to the
El Profesor Académico, Dr. Pablo Gómez Martínez.
Directory of Open Access Journals (Sweden)
Zoilo Cuéllar-Montoya
2007-12-01
Más adelante, en la misma Presidencia de la Academia del Profesor Pedro José Almánzar Vargas (1963 – 1965, fue promovido Gómez Martínez a la categoría de Miembro de Número(2,10 con el trabajo “Ilio-cisto-plastia con colgajo sero-muscular invertido y reconstrucción de vejigas funcionales” (2,11. En la sesión ordinaria de la Academia del día 12 de marzo de 1964, el Académico Correspondiente Gómez Martínez presentó el trabajo mencionado(2,12 y, en la sesión ordinaria del día 14 de mayo de 1964, en virtud de haber quedado vacantes las sillas de los Señores Académicos de Número Jaime Jaramillo Arango, fallecido en Bogotá, el 31 de julio de 1962(2,13, Manuel José Luque Guevara, retirado por precarias condiciones de salud(2,14, y Fernando Torres Restrepo, trasladado definitivamente a los Estados Unidos(2,15, la Academia, en votación secreta, eligió, como Miembros de Número, a los Señores Académicos Correspondientes Pablo Gómez Martínez, Alfredo Artunduaga y J. Hernando Hernández Garay(2,16...
Red River Stream Improvement Final Design Nez Perce National Forest.
Energy Technology Data Exchange (ETDEWEB)
Watershed Consulting, LLC
2007-03-15
This report details the final stream improvement design along the reach of Red River between the bridge below Dawson Creek, upstream for approximately 2 miles, Idaho County, Idaho. Geomorphic mapping, hydrologic profiles and cross-sections were presented along with existing fish habitat maps in the conceptual design report. This information is used to develop a stream improvement design intended to improve aquatic habitat and restore riparian health in the reach. The area was placer mined using large bucket dredges between 1938 and 1957. This activity removed most of the riparian vegetation in the stream corridor and obliterated the channel bed and banks. The reach was also cut-off from most valley margin tributaries. In the 50 years since large-scale dredging ceased, the channel has been re-established and parts of the riparian zone have grown in. However, the recruitment of large woody debris to the stream has been extremely low and overhead cover is poor. Pool habitat makes up more than 37% of the reach, and habitat diversity is much better than the project reach on Crooked River. There is little large woody debris in the stream to provide cover for spawning and juvenile rearing, because the majority of the woody debris does not span a significant part of the channel, but is mainly on the side slopes of the stream. Most of the riparian zone has very little soil or subsoil left after the mining and so now consists primarily of unconsolidated cobble tailings or heavily compacted gravel tailings. Knapweed and lodgepole pine are the most successful colonizers of these post mining landforms. Tributary fans which add complexity to many other streams in the region, have been isolated from the main reach due to placer mining and road building.
South Fork Salmon River Watershed Restoration, 2008-2009 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Reaney, Mark D. [Nez Perce Tribe Department of Fisheries Resource Management
2009-04-15
The watershed restoration work elements within the project area, the South Fork Salmon River Watershed, follow the watershed restoration approach adopted by the Nez Perce Tribe Department of Fisheries Resource Management (DFRM) - Watershed Division. The vision of the Nez Perce Tribe DFRM-Watershed Division focuses on protecting, restoring, and enhancing watersheds and treaty resources within the ceded territory of the Nez Perce Tribe under the Treaty of 1855 with the United States Federal Government. The program uses a holistic approach, which encompasses entire watersheds, ridge top to ridge top, emphasizing all cultural aspects and strategies that rely on natural fish production and healthy river ecosystems. The Nez Perce Tribe DFRM-Watershed Division strives towards maximizing historic ecosystem productivity and health for the restoration of anadromous and resident fish populations and the habitat on which all depend on for future generations Originally, this project was funded to create a step/pool stream channel that was appropriate to restore fish passage where the 'Glory Hole Cascade' is currently located at the Stibnite Mine. Due to unforeseen circumstances at the time, the project is unable to move forward as planned and a request for a change in scope of the project and an expansion of the geographic area in which to complete project work was submitted. No additional funds were being requested. The ultimate goal of this project is to work with the holistic, ridge top to ridge top approach to protect and restore the ecological and biological functions of the South Fork Salmon River Watershed to assist in the recovery of threatened and endangered anadromous and resident fish species. FY 2008 Work Elements included two aquatic organism passage (AOP) projects to restore habitat connectivity to two fish-bearing tributaries to the East Fork South Fork Salmon River, Salt and Profile Creeks. The Work Elements also included road survey and assessment
Genetic diversity and conservation of Picea chihuahuana Martínez ...
African Journals Online (AJOL)
SAM
2014-07-09
Jul 9, 2014 ... individuals within a population and among populations within a species. Hence ... risks related to loss of species, populations and genetic resources; c) ... this spruce and two other congeners, Picea mexicana. Martínez and Picea .... high levels of self-fertilization and mating between closely related ...
Loyola University distingue al Ing. Martínez
Lezcano, Liseth
2011-01-01
El Ing. Axel Martínez, Director de Recursos Humanos de la Universidad Tecnológica de Panamá (UTP), recibió un reconocimiento que le hizo el Instituto de Recursos Humanos y Relaciones Industriales de Loyola University Chicago (LUC), como egresado destacado del Programa de Maestría en Recursos Humanos, por la prestigiosa carrera académica y por sus éxitos profesionales en un importante ambiente académico.
Genetic diversity and conservation of Picea chihuahuana Martínez ...
African Journals Online (AJOL)
The conservation of genetic diversity in tree populations is an essential component of sustainable forest management. Picea chihuahuana Martínez is an endemic conifer species in Mexico and is considered to be endangered. P. chihuahuana covers a total area of no more than 300 ha at the Sierra Madre Occidental, ...
Več kot predgovor: "urednik" Pepite Jiménez:
Fock, Ignac
2014-01-01
The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) "editor". Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator - ficti...
Controversy, Conflict and Compromise: A History of the Lower Snake River Development
1994-01-01
river, farmers cultivated the loess-covered hills, and ranchers grazed sheep and cattle in the Channeled Scablands. Towns grew up to serve the...North America, the Nez Perce and Palouse practiced selective breeding. They castrated poorer stallions and traded inferior stock to neighboring...rains," making it impossible for "some kinds of grain [to] flourish," he noted that cattle and horses grew fat on the rich bunchgrass, and, like Lewis
Tropic and race. Miguel Jiménez López and the Japanese Immigration in Colombia, 1920-1929
Directory of Open Access Journals (Sweden)
Abel Fernando Martínez Martín
2017-01-01
Full Text Available This article discusses the debate on immigration in Colombia, specifically focusing on Japanese immigration, an problem, by being so far from the desired European immigration. Likewise, the important role played by the psychiatrist and conservative Colombian politician Miguel Jiménez Lopez and his theory of degeneration of the Colombian race. Jiménez Lopez is the author of "The yellow immigration in the America", a publication of the National Academy of Medicine, written in response to the Ministry of Industries about the question for the possible impact of a Japanese immigration in the eastern plains. Jiménez Lopez maintains the problem from medicalization and biology, using more arguments from geographical determinism and racism that from eugenics, to justify that a Japanese immigration to Colombia was not advisable, because it jeopardizes the progressive bleaching managed —with the passage of time— by the Colombian race.
International Nuclear Information System (INIS)
Sung, Yon Mi; Choo, Sung Wook; Jeon, Seong Soo; Shin, Sung Wook; Park, Kwang Bo; Do, Young Soo
2006-01-01
To assess the efficacy and safety of a 'mini-perc' technique of percutaneous nephrolithotomy using a 14-Fr peel-away sheath for the removal of pyelocaliceal stones, and to determine appropriate inclusion criteria. Form July 1999 to June 2002, the medical records and radiographic images of 72 patients who underwent the 'mini-perc' technique of percutaneous nephrolithotomy with a 14-Fr peel-away sheath, were reviewed to determine clinical history, stone characteristics, immediate stone free rate, final stone free rate after additional procedures, complications, and hospital stay. We also analyzed the effect of the longest stone diameter, the cumulative longest diameter of stones, the cumulative stone burden, and the stone density on the immediate stone free rate using a Fisher exact test. The only major complication, arterial bleeding, occurred in a patient with Child A liver cirrhosis and was successfully treated by embolization with coils and a gelatin sponge. The immediate stone free rate was 80.6%, which was significantly influenced by stone diameter but not stone density. The mean hospital stay after the procedure was 3.97 days. The 'mini-perc' technique of percutaneous nephrolithotomy, which uses the 14-Fr peel-away sheath, is a safe and effective modality for treating renal calculi
Directory of Open Access Journals (Sweden)
Teresa Cabruja-Ubach
2014-12-01
Full Text Available Se trata de una reseña de la “Guía para incorporar la perspectiva de género a la investigación en salud” de María del Mar García Calvente , María Luisa Jiménez rodrigo y Emilia Martínez Morante, de la Escuela Andaluza de Salud Pública, 2010, que consiste en un documento de ayuda a la investigación en salud pues a partir de exponer los sesgos androcéntricos y patriarcales de la investigación en salud, organiza un sistema de buenas prácticas para cada uno de los pasos en el proceso de investigación. Trabajo muy riguroso e indispensable para colaborar en una investigación y atención en la salud más justa e igualitaria.
Directory of Open Access Journals (Sweden)
Elisa Kern de Castro
2015-07-01
Full Text Available ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70 e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C e de perceção da doença – “Revised Illness Perception Questionnaire for Healthy People” (IPQ-RH.ResultadosA presença de sintomas de TEPT variade 9,2% a 18,5% na amostra, e a perceção da doença esteve correlacionada com os sintomas deste transtorno. As subescalas Representação Emocional e Coerência da Doença (IPQ-RH, foram preditoras dos sintomas de Reexperiência (β = 0,0370; p < 0,01; β = 0,261; p < 0,05, respetivamente. A subescala Representação Emocional (IPQ-RH também foi preditora de sintomas de Esquiva (β = 0,330; p < 0,001.ConclusãoConcluiu-se que a perceção da doença deve ser investigada para prevenir os sintomas de TEPT em sobreviventes de câncer infantil.
Martínez Sanabria en un país de artesanos
Jimena Montaña Cuéllar
2011-01-01
De la arquitectura orgánica a la arquitectura del lugar en las casas Wilkie (1962) y Calderón (1963) de Fernando Martínez Sanabria. Germán Darío Rodríguez Botero. Universidad Nacional de Colombia (Sede Bogotá), Facultad de Artes, Colección Punto aparte, Bogotá, 2007, 232 págs.
Elisa Kern de Castro; Renata Klein Zancan; Lauro José Gregianin
2015-01-01
ObjetivoEste estudo teve como objetivo avaliar a presença de Transtorno de Estresse Pós-Traumático (TEPT) e a sua relação com a perceção da doença numa amostra de 65 jovens sobreviventes de cancro infantil, com uma média de idades de 19 anos (DP = 2,70) e que tinham terminado o tratamento, em média, há sete anos.MétodoForam aplicados instrumentos para obtenção de dados sociodemográficos e clínicos, de sintomas de TEPT – “Posttraumatic Stress Disorder Checklist – Civilian” (PCL-C) e de perceçã...
Directory of Open Access Journals (Sweden)
Diego Augusto Santos Silva
2012-06-01
Full Text Available Objetivou-se verificar o impacto da escolaridade materna e paterna na perceção da imagem corporal em acadêmicos de Educação Física. Participaram do estudo 217 acadêmicos, com média de 20.6 anos de idade (DP = 0.6, sendo 54.8% do sexo masculino. Coletaram-se informações sobre perceção da imagem corporal por meio da escala de silhuetas de Stunkard et al. (1983. O nível de escolaridade dos pais e dados sociodemográficos foram coletados por questionário autoadministrado. Empregaram-se a estatística descritiva e a regressão logística multinomial, adotando-se nível de significância de 5%. Em relação à perceção da imagem corporal, 41% dos alunos estavam insatisfeitos por magreza e 28.1% por excesso de peso. As chances de insatisfação por excesso de peso foram de sete a oito vezes maiores nos acadêmicos com escolaridade materna superiores a quatro anos de escolaridade, independentemente de sexo, idade, situação conjugal, nível econômico e curso. Não houve associação entre escolaridade paterna e imagem corporal. Conclui-se que há necessidade de uma educação básica e superior de qualidade com assuntos vinculados à perceção corporal e hábitos saudáveis, pois muitos acadêmicos apresentaram insatisfação com a imagem corporal e tal probabilidade foi maior em estudantes filhos de mães com mais de cinco anos de escolaridade.
International Nuclear Information System (INIS)
Blutke, A.S.; Vavruska, J.S.; Serino, J.F.
1996-01-01
Plasma Technology, Inc. (PTI), a Santa Fe, New Mexico corporation has developed the Plasma Energy Recycle and Conversion (PERC)trademark treatment process as a safe and environmentally clean alternative to conventional thermal destruction technologies. The PERC trademark treatment process uses as its heat source an advanced Induction Coupled Plasma (ICP) torch connected to a reaction chamber system with an additional emission control system. For example, organic-based gas, liquid, slurry, and/or solid waste streams can be converted into usable or even salable products while residual emissions are reduced to an absolute minimum. In applications for treatment of hazardous and radioactive waste streams, the PERC system could be used for destruction of the hazardous organic constituents and/or significant waste volume reduction while capturing the radioactive fraction in a non-leachable form. Like Direct Current (DC) and Alternating Current (AC) arc plasma systems, ICP torches offer sufficient energy to decompose, melt and/or vitrify any waste stream. The decision for an arc plasma or an IC plasma system has to be made on a case by case evaluation and is highly dependent on the specific waste stream's form and composition. Induction coupled plasma technology offers one simple, but significant difference compared to DC or AC arc plasma systems: the ICP torch is electrodeless. To date, enormous research effort has been spent to improve the lifetime of electrodes and the effectiveness of related cooling systems. Arc plasma systems are established in research laboratories worldwide and are approaching a broad use in commercial applications. ICP technology has been improved relatively recently, but nowadays offers complete new and beneficial approaches in the field of waste conversion and treatment
Lago artificial de Martiánez Canarias – España
Directory of Open Access Journals (Sweden)
Amigó, Juan A.
1980-06-01
Full Text Available In this article a technical description is given of the works of the Artificial Lake of Martiánez.
This work that was executed after gaining some 33,000 m2 from the sea mainly consisted of creating a small artificial lake of seawater surrounded by solariums, beaches and gardens.
Inside the lake — that has an area of some 15,000 m2 — five natural islands were formed, most of which have tourist complexes built on them, consisting of: night club, restaurants, bars, terraces, etc.
En este artículo se hace una descripción técnica de las obras del Lago Artificial de Martiánez.
Esta obra, realizada tras ganar al mar unos 33.000 m2 consistió, principalmente, en la creación de un pequeño lago artificial de agua de mar rodeado de solarios, playas y jardines.
En el interior del lago —cuya superficie es de unos 15.000 m2— se formaron cinco islas naturales, en la mayor de las cuales se construyó un complejo turístico que consta de: sala de fiestas, restaurantes, bares, terrazas, etc.
Libertad e inconformismo: sobre la concepción del relato de José Jiménez Lozano
Directory of Open Access Journals (Sweden)
Moreno González, Santiago
2010-12-01
Full Text Available José Jiménez Lozano is a unique writer in the Hispanic literary scene of these last decades. His work is vast and diverse, and this initial observation does not escape his narrative, which genre the write demonstrates more prolifically. Despite the apparent diversity, there is outstanding unity underlying Jiménez Lozano´s entire work. This unity lies not only on the constant return to the same matters, but also on the approaches or the reasons, from which his literary work begins. The writer reflects over his work and lets his ideas expand through the diverse manifestations of his ideas on prose. It is a talk about the rhetorical writing of this article, valuing the coherent existence between reflection and literary practice.José Jiménez Lozano es un escritor singular dentro del panorama literario hispánico de las últimas décadas. Su obra es vasta y diversa y a esta observación inicial no escapa su narrativa, género en el que el escritor se muestra más prolífico. A pesar de la diversidad aparente, existe una notable unidad subyacente a toda la obra de Jiménez Lozano. Esta unidad reposa no sólo sobre el regreso constante a unos mismos asuntos sino también sobre los planteamientos o fundamentos de los que parte su creación literaria. El escritor reflexiona sobre su labor y deja diseminado, a través de las diversas manifestaciones de su prosa de ideas, un discurso sobre la escritura que este artículo sintetiza, valorando, asimismo, la coherencia existente entre esta reflexión y la praxis literaria.
El acontecimiento en el cuento: nueva lectura de José Jiménez Lozano
Martínez-Illán, A. (Antonio)
2010-01-01
Se reseña un libro que estudia como un todo los cuentos de Jiménez Lozano publicados hasta la fecha (y, en particular, La Piel de los tomates) a la luz de una teoría del cuento desde la categoría del acontecimiento.
Big Canyon Creek Ecological Restoration Strategy.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn; Richardson, Shannon
2007-10-01
He-yey, Nez Perce for steelhead or rainbow trout (Oncorhynchus mykiss), are a culturally and ecologically significant resource within the Big Canyon Creek watershed; they are also part of the federally listed Snake River Basin Steelhead DPS. The majority of the Big Canyon Creek drainage is considered critical habitat for that DPS as well as for the federally listed Snake River fall chinook (Oncorhynchus tshawytscha) ESU. The Nez Perce Soil and Water Conservation District (District) and the Nez Perce Tribe Department of Fisheries Resources Management-Watershed (Tribe), in an effort to support the continued existence of these and other aquatic species, have developed this document to direct funding toward priority restoration projects in priority areas for the Big Canyon Creek watershed. In order to achieve this, the District and the Tribe: (1) Developed a working group and technical team composed of managers from a variety of stakeholders within the basin; (2) Established geographically distinct sub-watershed areas called Assessment Units (AUs); (3) Created a prioritization framework for the AUs and prioritized them; and (4) Developed treatment strategies to utilize within the prioritized AUs. Assessment Units were delineated by significant shifts in sampled juvenile O. mykiss (steelhead/rainbow trout) densities, which were found to fall at fish passage barriers. The prioritization framework considered four aspects critical to determining the relative importance of performing restoration in a certain area: density of critical fish species, physical condition of the AU, water quantity, and water quality. It was established, through vigorous data analysis within these four areas, that the geographic priority areas for restoration within the Big Canyon Creek watershed are Big Canyon Creek from stream km 45.5 to the headwaters, Little Canyon from km 15 to 30, the mainstem corridors of Big Canyon (mouth to 7km) and Little Canyon (mouth to 7km). The District and the Tribe
Sanders, Barbara P; Oakes, Isabel de los Rios; van Hoek, Vladimir; Liu, Ying; Marissen, Wilfred; Minor, Philip D; Wimmer, Eckard; Schuitemaker, Hanneke; Custers, Jerome H H V; Macadam, Andrew; Cello, Jeronimo; Edo-Matas, Diana
2015-11-27
As poliovirus eradication draws closer, alternative Inactivated Poliovirus Vaccines (IPV) are needed to overcome the risks associated with continued use of the Oral Poliovirus Vaccine and of neurovirulent strains used during manufacture of conventional (c) IPV. We have previously demonstrated the susceptibility of the PER.C6(®) cell line to cIPV strains; here we investigated the suspension cell culture platform for growth of attenuated poliovirus strains. We examined attenuated Sabin strain productivity on the PER.C6(®) cell platform compared to the conventional Vero cell platform. The suitability of the suspension cell platform for propagation of rationally-attenuated poliovirus strains (stabilized Sabin type 3 S19 derivatives and genetically attenuated and stabilized MonoCre(X) strains), was also assessed. Yields were quantified by infectious titer determination and D-antigen ELISA using either serotype-specific polyclonal rabbit sera for Sabin strains or monoclonal cIPV-strain-specific antibodies for cIPV, S19 and MonoCre(X) strains. PER.C6(®) cells supported the replication of Sabin strains to yields of infectious titers that were in the range of cIPV strains at 32.5°C. Sabin strains achieved 30-fold higher yields (pSabin strain productivity on the PER.C6(®) cell platform was maintained at 10l scale. Yields of infectious titers of S19 and MonoCre(X) strains were 0.5-1 log10 lower than seen for cIPV strains, whereas D-antigen yield and productivities in doses/ml using rationally-attenuated strains were in line with yields reported for cIPV strains. Sabin and rationally-attenuated polioviruses can be grown to high infectious titers and D-antigen yields. Sabin strain infection shows increased productivity on the PER.C6(®) cell platform as compared to the conventional Vero cell platform. Novel cell platforms with the potential for higher yields could contribute to increased affordability of a next generation of IPV vaccines needed for achieving and
CERT tribal internship program. Final intern report: David Conrad, 1993
Energy Technology Data Exchange (ETDEWEB)
NONE
1998-09-01
The intern`s report contains a Master`s thesis entitled, ``An implementation analysis of the US Department of Energy`s American Indian policy as part of its environmental restoration and waste management mission.`` This thesis examines the implementation of a working relationship between the Nez Perce Tribe and the US Department of Energy`s Office of Environmental Restoration and Waste Management at the Hanford reservation. It examines the relationship using a qualitative methodology and three generations of policy analysis literature to gain a clear understanding of the potential for successful implementation.
Era Sanctorum: la beatificación inconclusa del padre Diego Martínez, SJ (1627-1634
Directory of Open Access Journals (Sweden)
Coello de la Rosa, Alexandre
2009-06-01
Full Text Available This essay analyzes the politics of sanctity of the Society of Jesus in Viceregal Peru (17th Century through the process of beatification of the Spanish Father Diego Martínez (1627-34. An unfinished process that has been filed in the Jesuit archives for centuries and was never introduced in the Sacred Congregation of Rites, in the Vatican.Este ensayo analiza las políticas de santidad de la Compañía de Jesús en el Perú virreinal (siglo XVII a través del proceso de beatificación del padre extremeño Diego Martínez (1627-34. Un proceso inconcluso que ha permanecido en los archivos jesuitas durante siglos y que nunca se introdujo en la Sagrada Congregación de Ritos, en el Vaticano.
Sanders, Barbara P; Edo-Matas, Diana; Papic, Natasa; Schuitemaker, Hanneke; Custers, Jerome H H V
2015-10-13
Safety of vaccines can be compromised by contamination with adventitious agents. One potential source of adventitious agents is a vaccine seed, typically derived from historic clinical isolates with poorly defined origins. Here we generated synthetic poliovirus seeds derived from chemically synthesized DNA plasmids encoding the sequence of wild-type poliovirus strains used in marketed inactivated poliovirus vaccines. The synthetic strains were phenotypically identical to wild-type polioviruses as shown by equivalent infectious titers in culture supernatant and antigenic content, even when infection cultures are scaled up to 10-25L bioreactors. Moreover, the synthetic seeds were genetically stable upon extended passaging on the PER.C6 cell culture platform. Use of synthetic seeds produced on the serum-free PER.C6 cell platform ensures a perfectly documented seed history and maximum control over starting materials. It provides an opportunity to maximize vaccine safety which increases the prospect of a vaccine end product that is free from adventitious agents. Copyright © 2015 Elsevier Ltd. All rights reserved.
Directory of Open Access Journals (Sweden)
Tania Diz
2016-11-01
Full Text Available While Ezequiel Martínez Estrada writes Marta Riquelme, between his fiction and essays, and Victoria Ocampo begins to write her memories; it arises from both an emotional and intellectual relationship through letters along more than 15 years since the late '40s and until the death of Martinez Estrada in 1964. This article will discuss much of those letters with the intended to show that one of the central axes of the epistolary is the construction by Martínez Estrada, his interlocutor in a character: writer women who acquire multiple identities including Marta Riquelme looks.
More than a Preface: the »Editor« of Pepita Jiménez
Ignac Fock
2014-01-01
The present article analyses the narrative structure of Spanish author Juan Valera's first and best novel, Pepita Jiménez, and specificities regarding its alleged (fictional) “editor”. Published in 1872, this epistolary work shows numerous traits of its eighteenth-century predecessors, namely French and British. However archetypical in the beginning, the novel, surprisingly short for having a complex structure of five narrative voices, reveals a unique figure of extradiegetic narrator – ficti...
78 FR 24718 - Nez Perce-Clearwater National Forests; Idaho; Lolo Insect & Disease Project
2013-04-26
... Lolo Creek watershed. A total of 500 miles occurs within designated PACFISH buffers. Desired Condition... or displaced soil or loss of organic matter. Desired Condition: Soils are productive (functioning... riparian habitat conservation areas. Deferred maintenance opportunities (such as any needed reconstruction...
Lucas y Hernandez, J; Golanó, P; Roshan-Zamir, S; Darcel, V; Chauveaux, D; Laffenêtre, O
2016-03-01
The aim of this study was to report a single surgeon series of consecutive patients with moderate hallux valgus managed with a percutaneous extra-articular reverse-L chevron (PERC) osteotomy. A total of 38 patients underwent 45 procedures. There were 35 women and three men. The mean age of the patients was 48 years (17 to 69). An additional percutaneous Akin osteotomy was performed in 37 feet and percutaneous lateral capsular release was performed in 22 feet. Clinical and radiological assessments included the type of forefoot, range of movement, the American Orthopedic Foot and Ankle (AOFAS) score, a subjective rating and radiological parameters. The mean follow-up was 59.1 months (45.9 to 75.2). No patients were lost to follow-up. The mean AOFAS score increased from 62.5 (30 to 80) pre-operatively to 97.1 (75 to 100) post-operatively. A total of 37 patients (97%) were satisfied. At the last follow up there was a statistically significant decrease in the hallux valgus angle, the intermetatarsal angle and the proximal articular set angle. The range of movement of the first metatarsophalangeal joint improved significantly.. There was more improvement in the range of movement in patients who had fixation of the osteotomy of the proximal phalanx. Preliminary results of this percutaneous approach are promising. This technique is reliable and reproducible. Its main asset is that it maintains an excellent range of movement. The PERC osteotomy procedure is an effective approach for surgical management of moderate hallux valgus which combines the benefits of percutaneous surgery with the versatility of the chevron osteotomy whilst maintaining excellent first MTPJ range of motion. ©2016 The British Editorial Society of Bone & Joint Surgery.
Directory of Open Access Journals (Sweden)
Aline Vauchelle-Haquet
2006-12-01
Full Text Available In 1830, the philologist Pedro Martínez López was forced to go into exile in France for political reasons. In 1832, he published Representación a Fernando VII, rey de España, a lampoon in which he made a whole string of accusations against the tyrant. At the end of the following year, he published España en 1833, al expirar Fernando VII, another lampoon in which he blamed the king's despotic reign for the country's disastrous situation and asserted that such abuses and injustices could only be remedied by re-establishing the Constitution of Cádiz of 1812. In 1834, he ceased to rail against his political enemies, changed strategy, and using his considerable imagination, wrote a kind of fable entitled Una noche en el infierno, vista entre sueños. With a mixture of humour and acid wit, it told of how all the devils in the Kingdom of Darkness, embracing the «sacred» cause of liberalism, vented their anger on the deceased Ferdinand and his followers, who were still in power. It would appear that the work was a success, since it was republished in 1836. In 1835, disillusioned with the tepid and conservative liberal regime of the Estatuto Real, Martínez López wrote another story, Las Brujas en Zugarramurdi, in which different satanic creatures, this time sorceresses, take it upon themselves to defeat moderantismo and establish a progressive regime. After this, he ceased to publish lampoons and political parables and devoted himself to producing learned works, bringing out various dictionaries and grammars which were republished several times. | En 1830, el filólogo Pedro Martínez López tuvo que exiliarse a Francia por motivos políticos. En 1832, sacó a luz en Burdeos una Representación a Fernando VII, rey de España, panfleto en el que espetaba toda una sarta de acusaciones contra el tirano. A finales del año siguiente, publicó La España en 1833, al expirar Fernando VII, otro libelo en que responsabilizaba al despotismo de la
New Data on the Life of the Peruvian-Bolivian Composer Pedro Ximénez-Abrill Tirado (1784-1856
Directory of Open Access Journals (Sweden)
José Manuel Izquierdo König
2017-07-01
Full Text Available Since the mid-nineteenth century the name of Pedro Ximénez Abrill Tirado has been known in musicological and historiographical studies. However, his role and relevance as composer has been acknowledged only recently in the study of historical repertoires of South America, with the discovery of scores containing his music in a private collection in Bolivia, which was later acquired by various archives and individuals. In spite of this, biographical accounts on him have kept using the same information for decades, and mythical constructions have increased rapidly during the last decade. This paper presents a new biographical picture of Pedro Ximénez, with a broader understanding of the context surrounding his life and works along with the transition of his life between Peru and Bolivia, on the basis of important new sources gathered by both authors through research in various archives.
La influencia de Javier Marías en la traducción española de Martínez-Lage de Absalom, Absalom!
Alpuente Civera, Miguel; Marco Borillo, Josep; Martínez Vilinsky, Bárbara
2013-01-01
En el posfacio a su traducción de Absalom, Absalom!, Miguel Martínez-Lage declara haber tomado como «modelos estilísticos» a aquellos narradores en lengua española cuya prosa muestra sin lugar a dudas la influencia de Faulkner. En el presente artículo nos proponemos identificar, en primer lugar, los rasgos de estilo comunes a la traducción de Martínez-Lage y a uno de los modelos estilísticos mencionados –la novela Fiebre y lanza, de Javier Marías– y, en segundo lugar, los aspectos de la tradu...
Vida y obra de Luis Jiménez Moreno (1929-2007
Directory of Open Access Journals (Sweden)
Antonio Jiménez García
2008-10-01
Full Text Available Luis Jiménez Moreno passed away on 27 of October, 2007, 77 years old. For the last 30 years he was professor at Universidad Complutense de Madrid. He became Full Professor. He had studied in Salamanca, Roma, Valencia and München. He got a Ph. Degree whith a tesis about Nietzsche`s Antropological Thought by leading of José Luis López Aranguren. He was High School Teacher in Andujar, Ávila and Badalona; after he was professor at Universities of Barcelona and Madrid. This article develops information about his life and his works: books, articles, essays, conferences, papers to Congress, Symposios, Scientic meetings…
Realismo, margen y fragmentariedad en la narrativa de Ezequiel Martínez Estrada
Gasillón, María Lourdes
2012-01-01
En primer lugar, este trabajo intenta analizar los ensayos escritos por Ezequiel Martínez Estrada sobre Franz Kafka (1967) para luego reconocer sus influencias en el concepto de lo real y realismo en sus propias narraciones ficcionales. En este caso, se abordará uno de sus cuentos más conocidos, “Marta Riquelme”, que construye discursivamente una imagen de lo/s otro/s en distintos planos textuales: autor, narrador, organización, género, personajes, etc. Tanto el ensayista argentino como el es...
Directory of Open Access Journals (Sweden)
María Alegra García García
2014-02-01
Full Text Available Juan Martínez Siliceo (c. 1477-1557 was a Roman Catholic cardinal and archbishop and a distinguished humanist and mathematician who played an important role in the History and culture of Toledo and Spain during the 16th century. Furthermore, he was admired and recognized even after his death thanks to different literary sources and historiography. This article aims to approach his iconography through a selection of the most important literary and artistic sources from the 16th and 17th Centuries.Juan Martínez Silíceo (c.1477-1557, además de cardenal y arzobispo de Toledo, fue un importante humanista y matemático que desempeñó un destacado papel en la historia y cultura del Toledo y la España del siglo XVI y que gozó de gran admiración y reconocimiento más allá de su muerte, tal como evidencian las fuentes literarias y la historiografía posterior. Sin embargo, aún quedan pendientes de estudio pormenorizado algunos aspectos relativos a su relación con las artes. Este artículo pretende plantear un primer acercamiento a la iconografía de Silíceo a través de una selección de las fuentes literarias y visuales de los siglos XVI al XVIII consideradas más relevantes.
Enfermedad y muerte de Don Gonzalo Jiménez de Quesada
Directory of Open Access Journals (Sweden)
Fernando Serpa Florez
1997-12-01
Full Text Available
La lepra es una enfermedad que se caracteriza por la insidia de su presencia, su lenta evolución y la progresiva incapacidad que en sus víctimas causa.
Esto y el temor que ha infundido desde tiempos bíblicos, han hecho que ante ella se haya mantenido una actitud ambivalente de negación hasta donde es posible y de rechazo irracional a quien la padece, por temor al contagio.
Ejemplo de ello es el aura de sagrado misterio que envuelve la leyenda de los padecimientos del Adelantado don Gonzalo Jiménez de Quesada (1509-1579, conquistador del Nuevo Reino de Granada y fundador de Santafé de Bogotá en el año de 1538, muerto a la edad, avanzada para la época, de setenta años.
No se puede afirmar, en forma definitiva, que el conquistador fuera leproso. Se acepta, acogiendo el argumento de autoridad que tiene el primer historiador médico entre nosotros, don Pedro María Ibáñez, quien escribió en 1884, en las Memorias para la Historia de la Medicina en Santa Fe, que en “1579 falleció en la ciudad de Mariquita, y de mal de lepra o elefancía de los
Coincide ello con lo que consigna don José María Vergara y Vergara en su Cuadro Cronológico de la Nueva Granada (hoi Estados Unidos de Colombia, desde los cipas hasta nuestros días (se ha conservado la ortografía usada a mediados del siglo XIX, preconizada por don Andrés Bello, estudio publicado en 1866, en que informa que a poco de posesionarse el tercer Presidente del Nuevo Reino, don Lope Díez Aux de Armendáriz: “ocurrió la muerte del adelantado Gonzalo Jiménez de Quesada que tuvo lugar en Mariquita el 16 de febrero de 1579, a la edad de ochenta años no cumplidos (sic, i de enfermedad de lepra (…” (2.
Estos conceptos fueron debatidos por contemporáneos de Vergara y de Ibáñez como el doctor Juan de Dios Carrasquilla aduciendo, entre otros argumentos, que la lepra no fue mencionada por los coetáneos del conquistador. Y que la sífilis, com
Drescher, Michael J; Fried, Jeremy; Brass, Ryan; Medoro, Amanda; Murphy, Timothy; Delgado, João
2017-10-01
Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA) for pulmonary embolism (PE) ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC) rule, multi-modal education using principles of knowledge translation (KT), and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9-11.2]) to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3-9.4]) pPatient characteristics were similar for both periods. Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Salmon and the Adaptive Capacity of Nimiipuu (Nez Perce) Culture to Cope with Change
Colombi, Benedict J.
2012-01-01
Change due to natural disturbances and disasters, population growth and decline, economic crises, and environmental and climate change creates significant cultural challenges. Rapid change and the transformation it brings also involve complex relationships between sovereign tribes, resources, and the global system. This article explores how salmon…
78 FR 9029 - Nez Perce-Clearwater National Forests; ID; Clear Creek Integrated Restoration Project
2013-02-07
.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and..., and big game species. Fire dependent wildlife species would benefit from landscape burning. Watershed...
2012-02-17
.... Electronic comments will be accepted in MS Word, Word Perfect, or Rich Text formats. Comments received in... big game species. In the long term, large tree retention would help maintain habitat structure and... mammals, and big game species. Fire dependent wildlife species would benefit from landscape burning...
77 FR 775 - Nez Perce-Clearwater National Forests; Idaho; Clear Creek Integrated Restoration Project
2012-01-06
.... Shifting tree species composition by retaining and planting early seral species (i.e. ponderosa pine... such as insect, disease, and fire. Historical logging practices and fire suppression have created a... habitats by retaining large trees and promoting establishment of tall shrubs and hardwood tree by using...
2012-02-09
... patterns that more closely emulate natural mixed severity disturbance. Shifting tree species composition by... logging practices and fire suppression have created a landscape that is more highly fragmented than what... management would increase high quality early seral wildlife habitats by retaining large trees and promoting...
Trayectos de lectura de Espacio, de Juan Ramón Jiménez
Luján Atienza, Ángel Luis
2013-01-01
El estudio de Espacio, de Juan Ramón Jiménez, a partir de la teoría cognitiva de las metáforas conceptuales y la fusión de dominios conceptuales (blending), en confluencia con la filosofía heideggeriana, descubre en el poema dos movimientos contradictorios: el de la fuga y de la búsqueda de un centro, que se pueden poner en relación con dos trayectos de lectura y dos tendencias hermenéuticas: la modernista y la post-modernista. En este contexto se tratan de explicar las paradojas y complejida...
Leoncio Martínez Un personaje que marcó pauta en la disidencia
Omaira Zambrano Roa
2014-01-01
Cuando se analiza la historia política de un país, se observa énfasis en el estudio de sus períodos gubernamentales y en sus partidos políticos, en los cuales existen personajes que marcaron pauta en su desarrollo de la Nación. Durante la dictadura del general Juan Vicente Gómez (1908-1935) uno de estos personajes característicos fue Leoncio Martínez, quien ostenta entre sus labores más conocidas la fundación del semanario humorístico Fantoches junto a Francisco Pimentel (Job Pim). En el año...
Perceções de carreira e de sucesso em função do género
Tocalino, Renata Leone Pio Galveia
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia da Educação e da Orientação), Universidade de Lisboa, Faculdade de Psicologia, 2013 A presente investigação visa explorar o efeito do fator género no desenvolvimento da carreira das mulheres e dos homens, analisando a distribuição das formações e das profissões, as perceções de género e de sucesso profissional, os modelos, as crenças de autoeficácia, as motivações no trabalho e as experiências profissionais significativas. A fundamentação ...
Directory of Open Access Journals (Sweden)
Javier Muñoz Soro
2006-12-01
Full Text Available The biography of Joaquín Ruiz-Giménez is a virtual paradigm of two historical phenomena which distinguished the last two decades of the Franco regime and, to a large extent, paved the way for the future democracy: on the one hand, the rift between Catholic and Falangist intellectuals and the regime which they had enthusiastically helped to establish after the civil war; and on the other, the secularization of its political thinking and practice. Ruíz-Giménez, ambassador and minister under Franco, was an exception among the Catholic laity that collaborated with the dictatorship, in that he held high government positions and, despite all the reservations concerning his personal development, for many of his peers as well as many aspiring figures of the coming generations, he symbolized the definitive renunciation of all legitimacy of power based on victory in battle or on Catholic natural law, and the definitive adoption of the language of human rights and democracy. | La biografía de Joaquín Ruiz-Giménez representa casi de manera paradigmática dos fenómenos históricos que caracterizaron las dos últimas décadas del franquismo y sentaron, en buena medida las bases de la futura democracia: por un lado, el alejamiento de los intelectuales católicos y falangistas respecto al régimen que habían contribuido a levantar con entusiasmo tras la guerra civil; por otro, la secularización de su pensamiento y práctica política. Ruiz-Giménez, embajador y ministro de Franco, fue una excepción entre los seglares católicos que colaboraron con la dictadura desempeñando altas responsabilidades de gobierno y, pese a todas las cautelas de su evolución personal, simbolizó para bastantes compañeros de su generación, así como para muchos jóvenes alumnos de las nuevas generaciones, la renuncia definitiva a toda legitimación del poder basada en la victoria de las armas o en el iusnaturalismo católico y la adopción irreversible del lenguaje de
An Indian tribal view of the back end of the nuclear fuel cycle: historical and cultural lessons
International Nuclear Information System (INIS)
Tano, M.L.; Powankee, D.; Lester, A.D.
1995-01-01
The Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation and the Yakama Indian Nation have entered into cooperative agreements with the US Department of Energy to oversee the cleanup of the Hanford Reservation. The Mescalero Apache Tribe and the Meadow Lake Tribal Council have come under severe criticism from some ''ideological pure'' Indians and non-Indians for aiding and abetting the violation of Mother Earth by permitting the land to be contaminated by radioactive wastes. This paper suggests that this view of the Indian relationship to nature and the environment is too narrow and describes aspects of Indian religion that support tribal involvement in radioactive waste management. (O.M.)
Energy Technology Data Exchange (ETDEWEB)
Williams, John G.; Bjornn (Bjomn), Theodore C.
1998-05-01
In 1996, the National Marine Fisheries Service, the Nez Perce Tribe, and the U.S. Fish and Wildlife Service completed the second year of cooperative research to investigate migrational characteristics of subyearling fall chinook salmon in the Snake River Basin. In spring and early summer, we captured natural subyearling fall chinook salmon by beach seine, PIT tagged them, and released them in two reaches of the Snake River. Also, subyearling fall chinook salmon reared at Lyons Ferry Hatchery were PIT tagged at the hatchery, transported, and released weekly at Pittsburg Landing on the Snake River and Big Canyon Creek on the Clearwater River to collect data on survival detection probabilities, and travel time.
International Nuclear Information System (INIS)
Ashe, B.L.; Miller, A.C.; Kucera, P.A.; Blenden, M.L.
1995-01-01
In 1994, the Nez Perce Tribe began a smolt monitoring study on the Imnaha River in cooperation with the Fish Passage Center (FPC). A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from March 1 to June 15, 1994. We PIT tagged and released 956 wild chinook salmon, 661 hatchery chinook salmon, 1,432 wild steelhead trout and 2,029 hatchery steelhead trout. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 62.2% for wild chinook salmon, 45.2% for hatchery chinook salmon, 51.3% for wild steelhead trout, and 34.3% for hatchery steelhead trout
Ces silences de la narration qui rapprochèrent Jean Giono et Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Dominique Bonnet
2010-01-01
Full Text Available This article intends to show how JeanGiono discovered a purity of writing inJuan Ramón Jiménez that he practicedhimself in his elliptical narratives. Thus,this purifying desire that both sought intheir writings would be one of the commonpoints that would persuade Jean Giono todo the film adaptation of Platero y yo.
En memoria de Michael Jiménez (1948-2001
Directory of Open Access Journals (Sweden)
Mauricio Archila Neira
2001-01-01
Full Text Available El 1 de septiembre de 2001 murió el historiador Michael Jiménez. Su apellido provenía de España de donde emigró su abuelo en busca de mejor suerte al otro lado del Atlántico. Nacido en el pequeño pueblo de Merced, California (Estados Unidos en agosto de 1948 en el seno de una familia obrera, Michael vivió su infancia en Colombia. A fines de ese año, su padre se desplazó a estas tierras para ser funcionario de la Texas, una multinacional petrolera que tenía sus reales en Puerto Boyacá. Michael estudió en el colegio Nueva Granada -becado por la Texas- hasta los catorce años. En dicho colegio fue compañero de pupitre de Herbert Braun, descendiente a su vez de una familia de emigrantes a Colombia, y con quien la vida lo juntaría de nuevo en las tierras del norte y en oficios similares.
El Manuscrito Cerramientos y trazas de montea de Ginés Martínez de Aranda
Directory of Open Access Journals (Sweden)
Calvo López, José
2009-03-01
Full Text Available Ginés Martínez de Aranda, master mason in the cathedrals of Cádiz and Santiago de Compostela during the late 16th century, wrote a manuscript, Cerramientos y trazas de montea, concerning geometrical problems in stone construction. This article deals with the copy of Cerramientos in the Servicio Histórico Militar (Madrid, its copyist, dating, the existence of an earlier version and whether or not Aranda intended to publish it. Also examined are the connections between Cerramientos and other Spanish stonecutting texts of the period, such as those by Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia or Juan de Portor y Castro. Finally, an assessment is made of Martínez de Aranda’s original contributions to European stonecutting literatura.
El arquitecto y cantero baezano Ginés Martínez de Aranda, que trabajó a finales del siglo XVI y ejerció la maestría de las catedrales de Cádiz y Santiago de Compostela, compuso un manuscrito llamado Cerramientos y trazas de montea, que trata de los problemas geométricos de la construcción pétrea. El artículo analiza la copia del manuscrito conservada en el Servicio Histórico Militar de Madrid, la identidad del copista, la fecha de la primera redacción de la obra y la de la copia conservada, y el destino de la obra; a continuación, se estudia la relación del manuscrito con otras obras españolas de cantería, en especial las de Alonso de Vandelvira, Cristóbal de Rojas, Alonso de Guardia y Juan de Portor y Castro, para finalizar tratando diversas aportaciones originales de Aranda a la literatura europea de la cantería.
Directory of Open Access Journals (Sweden)
Michael J. Drescher
2017-09-01
Full Text Available Introduction: Computerized decision support decreases the number of computed tomography pulmonary angiograms (CTPA for pulmonary embolism (PE ordered in emergency departments, but it is not always well accepted by emergency physicians. We studied a department-endorsed, evidence-based clinical protocol that included the PE rule-out criteria (PERC rule, multi-modal education using principles of knowledge translation (KT, and clinical decision support embedded in our order entry system, to decrease the number of unnecessary CTPA ordered. Methods: We performed a historically controlled observational before-after study for one year pre- and post-implementation of a departmentally-endorsed protocol. We included patients > 18 in whom providers suspected PE and who did not have a contraindication to CTPA. Providers entered clinical information into a diagnostic pathway via computerized order entry. Prior to protocol implementation, we provided education to ordering providers. The primary outcome measure was the number of CTPA ordered per 1,000 visits one year before vs. after implementation. Results: CTPA declined from 1,033 scans for 98,028 annual visits (10.53 per 1,000 patient visits (95% CI [9.9–11.2] to 892 scans for 101,172 annual visits (8.81 per 1,000 patient visits (95% CI [8.3–9.4] p<0.001. The absolute reduction in PACT ordered was 1.72 per 1,000 visits (a 16% reduction. Patient characteristics were similar for both periods. Conclusion: Knowledge translation clinical decision support using the PERC rule significantly reduced the number of CTPA ordered.
Directory of Open Access Journals (Sweden)
Elisabete Matos Freitas
2015-05-01
Full Text Available http://dx.doi.org/10.5902/1984686X15273O papel dos pais no processo de inclusão de crianças com necessidades educativas especiais é fundamental, seja no apoio familiar, desmontando mitos e criando um contexto favorável à experiência e à proximidade. O objetivo deste trabalho é, assim, conhecer as perceções dos pais relativamente à inclusão, assim como os factores que as influenciam. Para isso, foi aplicado um inquérito a 300 pais, com e sem filhos com necessidades educativas especiais. Os resultados permitiram perceber atitudes genericamente positivas, sem diferenças relativamente ao género e ao fato de serem pais de crianças com necessidades educativas especiais. Contudo as variáveis idade, escolaridade e proximidade / contato pareceram influenciar a perceção em relação a inclusão de crianças NEE. Assim, os pais com atitudes mais favoráveis à inclusão tendem a ser os mais novos, que tiveram proximidade / contato com criança NEE. Os resultados são discutidos em função da literatura.
Directory of Open Access Journals (Sweden)
Amán Rosales Rodríguez
2010-01-01
Full Text Available The purpose of this paper is to critically review some of the main theoretical tenets in Ezequiel Martínez Estrada’s pessimistic stance about the Argentinean history and society of his time. Focusing on his critical remarks about the so-called «literatura o poesía gauchesca» as well as on his enthusiastic assessment of José Hernández’ Martín Fierro, the achievements and missing points in Martínez Estrada’s skeptical diagnosis will be underlined and put in broader philosophical context. For the Argentinean writer the controversial notion of a “superimposed reality” – as he infers its existence from the Martín Fierro – captures a kind of ambivalent metaphysical concurrence among the literary creation, the geographical setting and the sociopolitical state of the country.
International Nuclear Information System (INIS)
Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.
1997-04-01
For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts
International Nuclear Information System (INIS)
Blendon, M.L.; Rocklage, S.J.; Kucera, P.A.
1997-01-01
For the third consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 23 to June 24, 1996. A total of 1,797 wild chinook salmon, 11,896 hatchery chinook salmon, 3,786 wild steelhead trout, and 31,094 hatchery steelhead trout smolts were captured during outmigration studies on the Imnaha River in 1996. Mortality associated with trapping, handling and tagging was low, being 1.4% for wild chinook, 0.18% for hatchery chinook, 0.21% for wild steelhead and 0.28% for hatchery steelhead trout smolts
Napal, María Celeste
2016-01-01
Napal, M. C. (2016). La presidencia de María Estela Martínez de Perón: la búsqueda de legitimidad y la descalificación del “otro” (1974-1976). Divulgatio, 1(1). El presente artículo busca analizar, a través de los discursos presidenciales, la imagen que la presidente María Estela Martínez de Perón (Isabel) construye del “otro” no partidario en un contexto político en el que se ve cuestionada su propia legitimidad. Partimos de la idea de que el período de su presidencia (1° de julio de 1974...
Directory of Open Access Journals (Sweden)
Gutiérrez Pastor, Ismael
2005-09-01
Full Text Available Por adquisición en el comercio de antigüedades francés se conserva en una colección particular de Bilbao el Retrato de una niña (fig. 2, pintura de carácter velazqueño, que puede ser clasificada perfectamente como obra indiscutible del pintor Juan Bautista Martínez del Mazo (¿Beteta?, Cuenca, 1611-Madrid, 1667, tanto por la característica soltura técnica, como por tratarse de uno de los modelos infantiles que aparecen en el Retrato de la familia del pintor del Kunsthistorisches Museum de Viena (fig. 3, en relación con la cual se conoce otro Retrato de Luis Martínez del Mazo conservado en la Dulwich Picture Gallery de Londres (fig. 1. La importancia de la obra es notable no sólo porque incrementa el catálogo de Martínez del Mazo con una obra indudable, sino también por contribuir a precisar la cronología de la pintura conservada en Viena...
Francisco Ibarra Martínez: renovador de la pedagogía cubana
Directory of Open Access Journals (Sweden)
Lic. Osmar Oliva-Crespo
2015-10-01
Full Text Available The article entitled Francisco Ibarra Martínez: reformer of Cuban Pedagogy, is first of all a well deserved homage to one of the most important pedagogues of the republican period. His thought and his work are approached, from his initial stage of academic formation to his contributions to the educational cuban thought. Stands out his social dimension of his pedagogic work, his integration to the civic life of the city, his reforming vision of the practice of sports and study of the history of his country. Likewise, we refer to his contributions to the historiography as a science, the journalism and his concern for the social and political destination of the country. For this reason this work has among its contributions the treatment to the local history from the specific fild of pedagogy and education, modestly contributing to the rescue of historic memory.
Perceção de falhas de memória, ansiedade e depressão em pacientes com dor crónica
Lobato, Filipa
2012-01-01
Dissertação apresentada à Universidade Fernando Pessoa como parte dos requisitos para a obtenção do grau de Mestre em Psicologia, ramo de Psicologia Clínica e da Saúde Diversos estudos têm mostrado que as alterações cognitivas e os estados de humor fazem parte dos quadros com pacientes com dor, o que acaba por limitar, ainda mais, a sua autonomia em termos funcionais das atividades do dia-a-dia. O principal objetivo do presente estudo foi analisar a perceção de falhas de memóri...
Chemins de traverse d’Ignacio Martínez de Pisón, roman de l’absence, roman de l’amour
Directory of Open Access Journals (Sweden)
André-Alain Morello
2012-08-01
Full Text Available Chemins de traverse d’Ignacio Martínez de Pisón se présente comme la pseudo autobiographie d’un adolescent, Felipe, qui, à la mort de sa mère, est condamné à vivre avec un père marginal. Le texte est aussi la conversion d’un récit de type picaresque en un roman qui débouche sur la découverte mutuelle d’un père et d’un fils. L’errance des deux personnages, chemin de fuite destiné à compenser la disparition de Cecilia, conduit à une sorte d’assomption de l’amour.Caminos secundarios, de Ignacio Martínez de Pisón, se presenta como la supuesta autobiografía de un adolescente, Felipe, quien, a la muerte de su madre, se ve forzado a vivir con un padre marginal. El texto es también la evolución de una narración de carácter picaresco hacia una novela que desemboca en el descubrimiento mutuo entre padre e hijo. El vagabundeo de ambos personajes, escape y consuelo por la desaparición de Cecilia, lleva a una forma de exaltación amorosa.
2013-07-11
... pursuant to the 2012 Forest Planning Rule. This process will ultimately result in a Forest Land Management... Planning Rule) which implements the NFMA. Forest Plans describe the strategic direction for management of... is the first phase of the planning process. Only informal public input is required at this stage (36...
Directory of Open Access Journals (Sweden)
M.ª Belén Piqueras García
2013-12-01
Full Text Available The present study is centered in the analysis of the Inventory of valuable objects of Juan Martínez, Jerez de la Frontera notary public during the first half of 15th century; Persecuting to bring to light this document from notarial type, until now unpublished, that approached its content and diplomatic analysis.
Directory of Open Access Journals (Sweden)
Guadalupe Arbona Abascal
2017-01-01
Full Text Available This paper analyzes the writing process of José Jiménez Lozano’s Retorno de un cruzado (2013, his 24th novel. First, taking into account the author’s comments about the creation of the text, it presents the different versions and the literary reasons for his final choice. Second, literary intertextualities found in the novel are examined. Finally, the condition of the main character as storyteller is identified as the novel’s major source of originality.
Diiagnóstico económico y financiero de Electrónica Martínez de Cartagena
García García, Nuria
2015-01-01
Este Trabajo Fin de Máster está incluido en los estudios del Máster en Contabilidad y Finanzas Corporativas realizados en la Universidad Politécnica de Cartagena en el curso académico 2014-2015. El objetivo principal de este proyecto es realizar un análisis económico y financiero de la empresa Electrónica Martínez de Cartagena, S.L. en el periodo de 2008 a 2013, mediante la utilización de una serie de técnicas estudiadas a lo largo de la carrera y perfeccionadas durante el M...
(ReConstrução Mítica de Eva Perón no Romance Santa Evita (1996 – Tomás Eloy Martínez
Directory of Open Access Journals (Sweden)
Josiane Valcarenghi Ribeiro Nantes
2017-06-01
Full Text Available Eva Perón é um nome significativo na história política da Argentina, sua influência surtiu, e continua surtindo efeito, no povo desse país até os dias atuais. “Evita” foi odiada/amada em níveis extremos, tanto que foi considerada uma santa, um mito para muitas pessoas. Tomás Eloy Martínez escreveu o romance – Santa Evita (1995 – em que narra como viveu a esposa de Juan Domingo Perón. Nesta obra encontra-se muitos elementos que dão indícios da (remitificação de Eva, por isso tenta-se aqui, explorar como se deu a (reconstrução mitológica de Eva Perón, personagem histórica no romance Santa Evita (1996 de Tomás Eloy Martínez, e ainda, expor quais foram os procedimentos adotados pelo autor que (reconstruíram esse mito. Utiliza-se, como base teórica, Linda Hutcheon (1991 e Fleck (2007 no conceito de metaficção historiográfica, Mircea Eliade (1991 e Martín Cezar Feijó (1984 no que cabe à análise do Mito. Esta breve pesquisa se dará a partir da análise bibliográfica e de forma comparativa entre a história e a escrita ficcional do romance Santa Evita (1996 de Tomás Eloy Martínez, discute-se os elementos utilizados e o caminho percorrido para a (reconstrução do mito Eva Perón na obra citada.
The Literary Criticism and Memoirs of Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Allen W. Phillips
1983-01-01
Full Text Available Equally as demanding of others as he was of himself, Juan Ramón Jiménez conceived of literary criticism as a serious and exacting task. The critic and the poet, standing side by side, are devoted to complementary activities of mutual enrichment. However fragmentary and partial the critical opinions of Juan Ramón may be (also outspoken and polemical in nature, they are invaluable as a personal historical and aesthetic guide to about fifty or sixty years of Hispanic literary development (1900-1960. Not to take them into account is to fail to recognize a highly important aspect of his total artistic personality. These varied critical texts are a product of a first rate intelligence and the sensibility of a writer of consummate discrimination who was endowed not only with an excellent memory but also a very special talent for appreciating the authentic. Juan Ramón as a critic is quick to praise (San Juan, Bécquer, Dario, Unamuno and Machado and at the same time strong in his censure of certain contemporaries. Several recently collected volumes of miscellaneous critical materials have resolved the bibliographical muddle for the initial study of this fundamental aspect of the poet, but still particularly important are the expressionistic portraits of Españoles de tres mundos , longer tributes to Valle, Ortega and Villaespesa as well as the extensive lectures delivered in his latter years. Examination of these pages gives us an historical and creative overview of the period in which he lived and worked in addition to original considerations about the evolution of Hispanic poetry. Of course, one of the constant focal points of his literary criticism was the modernist epoch of his early days, a movement or attitude which he considered to be a modern twentieth century renaissance. Together with detailed study of these two areas of historical and aesthetic nature, in the ensuing pages some conclusions are pointed out as to the essence of poetry
Francisco Martínez de la Rosa and church-state controversial relation in Spain (1834-1835
Directory of Open Access Journals (Sweden)
María José Vilar García
2016-12-01
Full Text Available This study aims to provide and analyze Francisco Martínez de la Rosa’s unpublished correspondence during his term as President of the Spanish Government in the 1834-1835 biennium, maintained with Amat di San Filippo Luigi, nuncio in Spain, and kept in the Vatican Secret Archives. Such correspondence consists of three letters with official mail format, although they could be considered rather confidential for their content. In these documents, the Spanish government strives, albeit unsuccessfully, to achieve recognition by Rome of Elizabeth II of Spain and his liberal regime. And last but not least, in this paper, it is also noteworthy to highlight the urgent need to fill the many vacant Dioceses in Spain.
A prática de formação da câmara municipal de Setúbal: a perceção dos
Claré, Lúcia Sofia Balagueira
2013-01-01
Dissertação de Mestrado em Gestão Estratégica de Recursos Humanos O objetivo global desta investigação assenta na prática de formação da Câmara Municipal de Setúbal, a partir da perceção dos dirigentes entrevistados. Na Administração Pública e ao nível da Gestão de Recursos Humanos, a formação tem vindo a ser encarada como um elemento chave para a melhoria da performance organizacional, através da aquisição de novas qualificações dos seus trabalhadores, refletindo-se no aum...
A military officer in Rif: Jesús Jiménez Ortoneda (1911-1936
Directory of Open Access Journals (Sweden)
José Luis Villanova
2009-08-01
Full Text Available This paper uses original and for the most part unpublished documentation in order to examine the career of Jesús Jiménez Ortoneda, a highly successful career officer who served in the Spanish Protectorate of Morocco between 1907 and 1936. He occupied important positions in the political administration of the Protectorate (as director of the political section of Melilla’s Oficina Central de Intervenciones and a senior official in the Department of Indigenous Affairs; he was fluent in Arab and Tamazight, and gained a sound knowledge of the geography of the Rif mountains. His military career, in which he achieved the rank of lieutenant colonel, was characterized by his strictly professional attitude. He was one of the few career officers in Africa who were faithful to Spain’s republican government and who did not participate in the military uprising of 1936. This discussion of his career brings into question some well-established ideas concerning Spanish colonial policy in Morocco.
Directory of Open Access Journals (Sweden)
María Flores Rodríguez
2013-03-01
Full Text Available Cet article étudie les théories eugénistes du juriste et socialiste espagnol Luis Jiménez de Asúa, exposées dans son livre Libertad de amar y derecho a morir (1928, dont l’examen met en évidence l’importance des débats autour de la légalisation de l’eugénisme en Espagne. En démontrant sa viabilité juridique, fondée sur le respect du droit et des principes socialistes, Jiménez de Asúa ouvre de nouvelles perspectives au mouvement eugéniste espagnol, laissant entrevoir les contours d’un nouvel ordre, au détriment de la Dictature de Primo de Rivera, déjà sclérosée.
Donnay, Karsten
2015-03-01
The past several years have seen a rapidly growing interest in the use of advanced quantitative methodologies and formalisms adapted from the natural sciences to study a broad range of social phenomena. The research field of computational social science [1,2], for example, uses digital artifacts of human online activity to cast a new light on social dynamics. Similarly, the studies reviewed by D'Orsogna and Perc showcase a diverse set of advanced quantitative techniques to study the dynamics of crime. Methods used range from partial differential equations and self-exciting point processes to agent-based models, evolutionary game theory and network science [3].
Pujol i Gómez, Josep
1998-01-01
Obra ressenyada: L. A. SÈNECA; edició crítica de Tomàs MARTÍNEZ ROMERO, Tragèdies. Barcelona: Barcino, 1995. Tomàs Martínez fa una edició crítica de les traduccions catalanes medievals de les següents tragèdies de Sèneca: 'Hercules furens', 'Thyestes', 'Thebais (Phoenissiae)', 'Hippolytus (Phaedra)' 'Oedipus', 'Troades', 'Medea' i 'Agamemnon'. A banda de l'edició, tracta qüestions com la difusió tardomedieval de Sèneca a la corona d'Aragó, la bibliografia sobre la diversitat dels mètodes d...
Vargas Jiménez, Dolores: Picasso: iconografías del baile.
Directory of Open Access Journals (Sweden)
José Jiménez Guerrero
2016-01-01
Full Text Available Fue en el año 1967. Bajo el mecenazgo de una institución ya desaparecida, el Liceo de Málaga, se convocó la primera edición del «Premio Málaga de Investigación». Esta loable iniciativa tuvo una continuidad temporal ininterrumpida hasta 1999. Tras ocho años de silencio, y gracias al respaldo de la Real Academia de Bellas Artes de San Telmo y de la Academia Malagueña de Ciencias, y al patrocinio de la entidad Cajamar, este prestigioso premio fue de nuevo convocado. A ello se sumó en el año 2012 la decisión adoptada por la Diputación de Málaga de publicar los trabajos premia dos en las dos modalidades del referido premio: Humanidades y Ciencias. Los libros editados forman parte de la colección que lleva por título «Premios Málaga de Investigación». En la convocatoria del año 2013, el premio de la sección humanística recayó en el trabajo presentado por Dolores Vargas Jiménez, doctora en Historia del Arte, bajo el título de Picasso: iconografías del baile. Y siguiendo lo preestablecido, su obra fue editada por la entidad supramunicipal.
Directory of Open Access Journals (Sweden)
Juan Miguel Monterrubio Prieto
2013-11-01
Full Text Available This study examines verb modes and tenses as well as the predicate structure in «Libro decimosexto» of Bartolomé Jiménez Patón’s Comentarios de erudición in an effort to demonstrate how the text straddles the line between Medieval and Golden Age norms. Jiménez Patón, thus, combines traits already considered archaic at the time, due perhaps to his solid training in grammar and his linguistic awareness, with those modern solutions which, towards the end of the 1500’s, were forging the new Spanish language (that of the «plain style», which he championed, one that was gradually being refined in order to take its place as the language of culture.
Directory of Open Access Journals (Sweden)
Victor Rayon García
2015-01-01
Full Text Available Carlos Martínez Assad publicó Los rebeldes vencidos. Cedillo contra el Estado cardenista en 1990. En ese trabajo, el ahora investigador emérito por la Universidad Nacional Autónoma de México y el Sistema Nacional de Investigadores dio cuenta, mediante un meticuloso análisis de fuentes primarias, de la última rebelión que conmovió al México contemporáneo. La investigación de Martínez Assad tuvo muchos méritos, aunque tal vez el mayor de ellos fue el hecho de analizar el movimiento de Saturnino Cedillo en sus aspectos económicos, sociales, políticos e ideológicos. Con la seriedad académica que siempre lo caracteriza, el ahora también Premio Nacional de Ciencias y Artes 2013 examinó los momentos más importantes en la vida del cacique potosino: su incursión en el torbellino revolucionario (1912, su apoyo al Plan de Agua Prieta (1920, su alianza con los gobiernos de Álvaro Obregón (1920-1924 y Plutarco Elías Calles (1924-1928, y su enfrentamiento final con el gobierno de Lázaro Cárdenas (1934-1940. De esta manera, Martínez Assad demostró que Cedillo, al rechazar el socialismo, las huelgas y el ejido, fue expuesto por el Estado cardenista —empeñado en lograr una centralización política y administrativa— como aliado de las compañías petroleras expropiadas el 18 de marzo de 1938 y portavoz del fascismo alemán en México.
Directory of Open Access Journals (Sweden)
Ricardo Muñoz Solla
2016-12-01
Full Text Available
Halfway through the 16th century in Spain the reading and interpretation of the Bible based on its original languages involved a very real danger for humanists who were seeking a better understanding of the Scriptures. The exclusive authority of the Latin Vulgate version declared by the Council of Trent in 1546 hindered the intellectual work of many Biblicists and Theologians, who were subjected to tight ideological control. In this context it must be considered the case of the Hebraist and scholar from the University of Salamanca, Martín Martínez de Cantalapiedra (1518-1579, who was prosecuted by the Inquisition of Valladolid in 1572 along with his colleagues Fray Luis de León and Gaspar de Grajal. All of them were accused of deviating from the genuine sense of the Vulgate in their more literal interpretations of the Masoretic text. The purpose of this article is to provide new evidence for the intellectual biography of Master Martínez de Cantalapiedra as well a to analyze the hermeneutical principles exposed during his inquisitorial in which he defended the Hebrew knowledge as an essential means of interpreting the Old Testament.
Santa Efigenia / Ifigenia : hagiografía y mito en "San Mateo en Etiopía", de Felipe Godínez
Márquez, Esther
2017-01-01
Este artículo aborda el estudio de las fuentes de San Mateo en Etiopía, obra que lleva a las tablas la vida del apóstol San Mateo, centrándose en el episodio de la evangelización de Etiopía y la conversión al cristianismo de Santa Efigenia, la hija del rey Egipo. Mediante el examen de sus fuentes, tanto hagiográficas como mitológicas, se pretende demostrar la contaminación que lleva a cabo Godínez entre la historia de Santa Efigenia y el mito de Ifigenia, la hija de Agamenón. El estudio compa...
Directory of Open Access Journals (Sweden)
Isabel Montes Romero-Camacho
2014-06-01
Full Text Available A partir de la conquista de Sevilla, en 1248, fueron muchos los judíos, primero, y los conversos, después, que llegaron a ocupar una posición preeminente, tanto en la ciudad, como en la corte, desempeñando, casi siempre, importantes oficios, al servicio de la hacienda real castellana, en una secuencia prácticamente ininterrumpida que va desde Alfonso X (1252-1284 hasta la nueva dinastía Trastámara. Uno de estos importantes conversos fue Nicolás Martínez de Medina (o de Sevilla, cuya actuación pública se desarrolló durante los reinados y a la sombra de los primeros Trastámara, desde Enrique II (1369-1379 hasta Juan II (1406-1454 y que, tras una brillante carrera en Sevilla y en la corte, llegaría a ser contador mayor de Castilla y, por tanto, uno de los personajes más influyentes de su época.After the conquest of Seville in 1248, many Jews and later «Conversos» played a prominent role both in the city and in the Court. They occupied significant positions at the service of the Spanish royal treasury almost uninterruptedly from the reign of Alfonso X (1252-1284 to that of the new Trastámara dynasty. One of these important «Conversos» was Nicolás Martínez de Medina (or de Sevilla, who held public positions under the reigns of the first Trastámara kings, from Enrique II (1369-1379 to Juan II (1406-1454. After a brilliant career in Seville and in the Court, he would become chief accountant of Castile and, consequently, one of the most influential individuals of his time.
An Indian tribal view of the back end of the nuclear fuel cycle: Historical and cultural lessons
International Nuclear Information System (INIS)
Tano, M.L.; Reuben, J.H.; Powaukee, D.; Lester, A.D.
1996-01-01
Indian tribes of the western United States, including the Nez Perce Tribe, the Confederated Tribes of the Umatilla Indian Reservation, and the Yakama Indian Nation, have entered into cooperative agreements with the U.S. Department of Energy to oversee the cleanup of the Hanford Reservation, in Washington state. These and other tribes considering involvement in nuclear waste management programs have been subjected to severe criticism from some Indians and non-Indians, accusing them of aiding and abetting the violation of Mother Earth by acquiescing in the contamination of lands by radioactive wastes. We'd like to suggest that this view of the Indian relationship to nature and the environment is too narrow. While the purpose of this article is not to suggest that Indian beliefs support the location of waste management facilities on Indian lands, we will describe aspects of Indian religion and culture that support tribal involvement in radioactive waste management and environmental restoration, and participation in radioactive waste management decision making
Directory of Open Access Journals (Sweden)
Alberto Pérez Pérez
2014-02-01
Full Text Available Nació hace cien años, pero su pensamiento sigue plenamente vigente.Su gran obra – verdadero tratado de Derecho Constitucional Uruguayo aunque él no le haya dado ese nombre –terminó de publicarse hace casi seis décadas, pero sigue siendo imprescindible obra de consulta para todos los juristas de nuestro país.Falleció en 1980, pero aún hoy – y sin duda por mucho tiempo más – no hay estudio serio de su especialidad que no comience por indagar lo que él pensaba al respecto.Ése es Justino Jiménez de Aréchaga, la grande, inmensa personalidad uruguaya de cuyo nacimiento se cumplen hoy cien años.Los Institutos de Derecho Constitucional y Derechos Humanos, que me honro en dirigir, le rinden hoy un merecidísimo homenaje, que podemos sintetizar en cuatro afirmaciones:I.Justino Jiménez de Aréchaga hizo una obra maestraII.Fue un Maestro del Derecho y de la vida en democraciaIII.Como verdadero Maestro, también nos enseñó/incitó a tratar de continuar su obraIV.El homenaje que le debemos al Maestro Aréchaga consiste, precisamente, no en palabras sino en obras que lo honren.
De mitos y realidades (respuesta a Luciano Martínez
Directory of Open Access Journals (Sweden)
José Luis Coraggio
2009-10-01
Full Text Available Este artículo constituye la respuesta del autor al comentario crítico realizado, en esta misma sección, por Luciano Martínez, en la pasada edición. El autor sostiene que la economía social y solidaria como un ámbito en construcción, que alberga a diversas vertientes que intentan avanzar hacia otra economía. Este carácter si bien puede albergar dudas, no debe transformase en un fatalismo inmovilizador, que permite la actualización constante del libre mercado como institución hegemónica. Antes que una utopía a denunciar desde una visión “realista”, se trata de construir una economía que combine mecanismos de mercado regulados socio-políticamente y relaciones de reciprocidad y redistribución. El texto explora, en pos de la argumentación, algunos de los elementos que conforman la economía social y solidaria.This article represents the author's response to critical commentary made in this section in the last edition by Luciano Martinez. The author maintains that the social and solidarity economy is a sphere under construction, in which several strands can be found. All of these approaches aim to move towards a different type of economy. This character as a developing realm can prompt doubts; this, however, should not lead to a paralyzing fatalism which allows the constant updating of the free market as a hegemonic institution. Far from a utopia to be denounced from a “realistic” viewpoint of economy, its concerns the construction of an economy that combines socio-politically regulated market mechanisms as well as relations of reciprocity and redistribution. The text also explores some of the elements that make up the solidarity and social economy.
International Nuclear Information System (INIS)
Johnson, B.J.Bradley J.
2002-01-01
The Asotin County Conservation District (ACCD) is the primary entity coordinating habitat projects on both private and public lands within the Asotin Creek watershed. The watershed covers approximately 325 square miles in the Blue Mountains of southeastern Washington in Water Resource Inventory Area (WRIA) 35. According to Washington Department of Fish and Wildlife's (WDFW) Priority WRIA's by ''At-Risk Stock Significance Map'', it is the highest priority WRIA in southeastern Washington. Summer steelhead, bull trout, and Snake River spring chinook salmon which are listed under the Endangered Species Act (ESA), are present in the watershed. WDFW manages it as a Wild Steelhead Reserve; no hatchery fish have been released here since 1997. The ACCD has been working with landowners, Bonneville Power Administration (BPA), Washington State Conservation Commission (WCC), Natural Resource Conservation Service (NRCS), Washington Department of Fish and Wildlife (WDFW), U.S. Forest Service, Pomeroy Ranger District (USFS), Nez Perce Tribe, Washington Department of Ecology (DOE), National Marine Fisheries Service (NMFS), and U.S. Fish and Wildlife Service (USFWS) to address habitat projects in Asotin County. Local students, volunteers and Salmon Corps members from the Nez Perce Tribe have been instrumental in the success of the Model Watershed Program on Asotin Creek. ACCD began coordinating habitat projects in 1995 with the help of BPA funding. Approximately two hundred and seventy-six projects have been implemented as of 1999. The Washington State Legislature was successful in securing funding for endangered salmon and steelhead recovery throughout the State in 1998. While these issues were new to most of the State, the ACCD has been securing and administering funding for endangered salmonids since 1994. The ''Asotin Creek Riparian Planting 2000-053-00 and Asotin Creek Riparian Fencing 2000-054-00'' teamed BPA and the Governor's Salmon Recovery Funding to plant approximately 84
Bottai, Alessio
2016-01-01
Síntesis L’esilio antifranchista e l'antifascismo italiano. Le relazioni tra José Martínez, Ruedo ibérico e l’azionismo torinese. Esta investigación tiene como objeto la historia de las relaciones que se mantuvieron durante más de dos décadas entre un grupo de intelectuales italianos, pertenecientes sobre todo a los azionisti, y algunos exponentes del antifranquismo español. Más específicamente, la tesis se centra en las relaciones activas de solidaridad humana y política que vincular...
Figueira, Maria Margarida Góis
2016-01-01
Dissertação para obtenção do grau de Mestre no Instituto Superior de Ciências da Saúde Egas Moniz Introdução: Esta investigação pretende explorar, estudar e descrever a perceção individual e adaptativa, relativamente ao tratamento com aparelhos funcionais removíveis, da população jovem a ser seguida na consulta assistencial de Ortodontia da Clínica Universitária Egas Moniz, percebendo-se um envolvimento positivo dos pacientes predispõe ao sucesso do seu tratamento. Materiais e Métodos: ...
Towards a Poetry of Silence: Stéphane Mallarmé and Juan Ramón Jiménez
Directory of Open Access Journals (Sweden)
Mervyn Coke-Enguídanos
1983-01-01
Full Text Available In an era of apparent dissolution, "la Obra" of Juan Ramón Jiménez, like "l'Oeuvre" of Stéphane Mallarmé, has for its goal the attainment of timelessness. In both poets, the concept of absolute Time—the timelessness of eternal Time—is yoked with the ideal of silence. But this is no ordinary silence, and certainly not the kind that results from inadequacy of expression. It is the silence of perfection, the expression of the ineffable: pure Poetry. Since the poetic language is the silent language of thought, both Mallarmé and Juan Ramón seek to convey the pure idea. In so doing, both must stringently eliminate whatever is not essential in their poetry. The astonishing paradox, central to Mallarmé and Juan Ramón alike, is the urge to create an "unwritten" poetry.
Zafra Anta, Miguel Ángel; Flores Martín, Carlos; Ponte Hernando, Fernando Julio; Gil García, Andrés; Gómez López, Ana; Fernández Durán, Carla
2016-01-01
On the centenary of the foundation of the Paediatrics Society of Madrid, a tribute is presented to rural medical practice of that time, although there are few documents on the history of rural medicine. The main objective is to describe the context of the rural medical practice in the late 19th and beginning 20th century, while presenting a historical biographical review of Manuel Martínez Saldise, who was medical specialist from Cazalegas (Toledo). He was appointed an Honorary Member by the Paediatrics Society of Madrid in 1927. A search was carried out in repositories of digitized media, web portals of history of medicine, PubMed, IME files of local councils and medical colleges. The family archives were reviewed with the collaboration of his descendants. The hiring of rural doctors was carried out by the municipalities, and the salary largely depended on private practice as well as "retainers". Specialist physicians took part in epidemics, legal medicine, and in hygiene measures. They also had disputes with mayors, chiefs, with colleagues and with protectionism. A summary of the biography and occupational activity of Manuel Martínez Saldise is presented. Rural doctors were subjected to the society of their time, with the issues that arose, denouncing the shortcomings of the local administrations, dedicated efforts to their family and the most disadvantaged. Copyright © 2015 Elsevier España, S.L.U. All rights reserved.
« Nez et langues électroniques » : bilan et perspectives pour les huiles alimentaires
Directory of Open Access Journals (Sweden)
Mielle Patrick
2003-07-01
Full Text Available Le « Nez électronique », et plus récemment la « Langue électronique » ont été fort médiatisés durant la dernière décennie. Aussi est-il nécessaire, avec le recul, de faire le point sur les bénéfices que ces technologies peuvent apporter dans le domaine des produits alimentaires, et en particulier pour huiles végétales. On trouve une littérature relativement abondante dans ce domaine, mais les applications qui ont réussi à franchir le cap de l’utilisation industrielle sont extrêmement restreintes. S’agit-il d’une frilosité des industriels pour des investissements de contrôle-qualité ou d’un manque de fiabilité des résultats de laboratoire ? Pourtant, la demande en outils rapides de contrôle-qualité (ou de contrôle d’origine n’a jamais été aussi pressante. Nous expliquerons ce point par la nature même du produit, principalement pour l’huile d’olive extra vierge. D’autres techniques faisant appel à l’enrichissement en composés volatils seront introduites, laissant espérer à l’avenir une amélioration de la fiabilité des analyses.
Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed, Technical Report 2003-2006.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn
2007-02-01
The Restoring Anadromous Fish Habitat in the Lapwai Creek Watershed is a multi-phase project to enhance steelhead trout in the Lapwai Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District (District). Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period December 1, 2003 through February 28, 2004 include; seven grade stabilization structures, 0.67 acres of wetland plantings, ten acres tree planting, 500 linear feet streambank erosion control, two acres grass seeding, and 120 acres weed control.
Torres Corominas, Eduardo
2013-01-01
Como fruto maduro de una larga trayectoria docente e investigadora en la Universidad Autónoma de Madrid, José Martínez Millán y Carlos Javier de Carlos Morales ofrecen en Religión, política y tolerancia en la Europa Moderna una serena reflexión sobre la época del Antiguo Régimen que pretende superar, desde los estudios sobre la Corte, los límites y contradicciones de las escuelas y paradigmas precedentes, como la escuela de los Annales y el marxismo, por medio de un discurso renovador donde s...
Belda et al., Afr J Tradit Complement Altern Med. (2013) 10(2):299 ...
African Journals Online (AJOL)
AJTCAM
Análisis de la biodiversidad de fauna vertebrada en el Parque Natural de la Serra de Mariola mediante fototrampeo. Mediter., 20: 7-34. 7. Belda, A., Martínez, J.E., Martín, C., Peiró, V. and Seva, E. (2010). Plants used to capture and sustain wild finches. (Fringillidae) in Southeast Spain. Econ. Bot., 64(4): 367–373. 8.
Directory of Open Access Journals (Sweden)
Enrico Di Pastena
2012-12-01
Full Text Available Review of Ignacio Arellano y Carlos Mata, Vida y obra de Lope de Vega, Homo Legens (Bibliotheca Homolegens, 63, Madrid, 2011, 334 pp. ISBN: 978-84-92518-72-2 y José Florencio Martínez, Biografía de Lope de Vega. 1562-1635. Un friso literario del Siglo de Oro, PPU, Barcelona, 2011, 783 pp. ISBN: 978-84-477-1114-7.
Directory of Open Access Journals (Sweden)
María Merino Bobillo
2011-11-01
Full Text Available Las enfermedades de la sociedad contemporánea son descritas, con lucidez y brillantez literaria, por el periodista y escritor José Jiménez Lozano, en las entregas periodísticas al Grupo Promecal. Los nacionalismos, la movida y el botellón, la violencia de género, el lenguaje sexista, etc. son retazos de la actualidad que su mirada atraviesa y dimensiona. Sus artículos traspasan la contingencia de lo periodístico para convertirse en propuestas culturales con tonalidad universal. No se quedan en la crítica de los sucesos concretos sino que, apoyándose en ellos, derivan en reflexiones de corte antropológico y ofrecen pensamientos válidos para los lectores de hoy y de mañana.
Castelo Blasco, Carmen
2015-01-01
Objetivos.- El presente trabajo analiza 300 columnas de opinión del periodista murciano José García Martínez publicadas en el periódico La Verdad entre los años 1975 y 2010. Para ello, se ha utilizado un análisis de contenido que ha permitido identificar las particularidades y características en cuanto a temas, enfoque, estructura y lenguaje que el autor utiliza. Se trata de un periodista singular por el hecho de haber desarrollado durante más de medio siglo su carrera profesional en un único...
Energy Technology Data Exchange (ETDEWEB)
Carmichael, Richard W. (Oregon Department of Fish and Wildlife, La Grande, OR)
2003-07-01
Endangered Species Permit Number 1011 (formerly Permit No. 973) authorizes ODFW to take listed spring chinook salmon juveniles from Catherine Creek (CC), Lostine River (LR) and Grande Ronde River (GR) for research and enhancement purposes. Modification 2 of this permit authorizes ODFW to take adults for spawning and the production and release of smolts for the Captive and Conventional broodstock programs. This report satisfies the requirement that an annual report be submitted. Herein we report on activities conducted and provide cursory data analyses for the Grande Ronde spring chinook salmon Captive and Conventional broodstock projects from 1 January-31 December 2002. The Grande Ronde Basin Spring Chinook Salmon Captive Broodstock Project is designed to rapidly increase numbers of salmon in stocks that are in imminent danger of extirpation. Parr are captured in Catherine Creek, upper Grande Ronde River and Lostine River and reared to adulthood in captivity. Upon maturation, they are spawned (within stocks) and their progeny reared to smoltification before being released into the natal stream of their parents. This program is co-managed by ODFW, National Marine Fisheries Service, the Nez Perce Tribe and Confederated Tribes of the Umatilla Indian Reservation.
Directory of Open Access Journals (Sweden)
Néstor Bórquez
2013-12-01
Full Text Available The following paper shall focus especially on the work of Carlos Giménez, a comic author from Madrid who attempts to represent there Spanish daily life from Civil War times up to the end of the Francoist regime –and his own life experience displays there an unavoidable reference point: 36-39 Malos tiempos, but mostly Paracuellos and Barrio are part of his own life story during the Civil War and the Francoist regime. In Argentina, authors such as Mariano Grassi or María Delia Lozupone and Rafael Cippolini try a similar intimist gaze upon the representation of dictatorship times in Argentina. This paper shall seek to establish a dialogue between these manifestations, attempting thereby to analyze the intimate plot of history and representation in these comic books.
Directory of Open Access Journals (Sweden)
Adolfo León Atehortúa Cruz
2012-08-01
Full Text Available A partir del intercambio epistolar entre Medófilo Medina y Timoleón Jiménez, el presente artículo debate los puntos centrales de la correspondencia aludida: la vigencia de la lucha armada, la concepción de dominación y dependencia y las vías de la democracia en Colombia. Finalmente, explora la madurez del conflicto armado en nuestro país y las posibilidades de una salida negociada con participación de la sociedad. Como conclusión, ofrece respuesta a dos preguntas: ¿Será posible una salida negociada que preserve la dignidad de los combatientes? Más aún, ¿será posible inducir esa salida desde la sociedad?
Directory of Open Access Journals (Sweden)
Lúcia Macedo
2012-03-01
Full Text Available Objetivo: avaliar as perceções parentais sobre estado nutricional, imagem corporal e saúde nas crianças que frequentam o 1º ciclo do ensino básico. Material e métodos: foi avaliado o IMC e a perceção dos pais sobre a imagem corporal e saúde dos seus filhos, por questionários enviados a todos os pais das crianças matriculadas nas escolas pertencentes aos Agrupamentos Vertical de Anes de Cernache e de Vila d’Este, do Concelho de Vila Nova de Gaia, no início do ano letivo 2008/2009 (n=936 e incluídas 532 crianças e pais que aderiram (57% da população amostral. As perceções parentais foram comparadas com o percentil de IMC da criança para avaliar eventuais discrepâncias. Trata-se de um estudo descritivo-correlacional. Resultados: verificou-se que 49.9% dos pais apresentaram uma distorção da perceção relativamente ao estado nutricional e 37.9% relativamente à imagem corporal. Constatou-se que apenas a idade da criança tinha relação com a perceção parental sobre a imagem corporal. Os pais referiram ter “boa” perceção de saúde. Conclusão: estes resultados são congruentes com outros na área e alertam os profissionais para a necessidade de uma intervenção mais efetiva na educação para a saúde para prevenir e detetar precocemente casos de crianças em risco de se tornarem obesas.Objetivo: evaluar las percepciones de los padres sobre el estado nutricional, la imagen corporal, la salud de los niños que asisten al 1 º ciclo de la educación básica. Métodos: se evaluaron el IMC y la percepción de los padres sobre la imagen corporal y la salud de sus hijos por medio de cuestionarios, enviados a todos los padres de los niños matriculados en las escuelas pertenecientes a los “Agrupamentos Vertical” de Anes de Cernache y de Vila d’Este, del municipio de Vila Nova de Gaia, al inicio del curso 2008/2009 (n = 936 e incluyó a 532 niños y padres que a él adhirieron (57% de la población de muestreo. Las
Impact of repeated exposure on toxicity of perchloroethylene in Swiss Webster mice
International Nuclear Information System (INIS)
Philip, Binu K.; Mumtaz, Moiz M.; Latendresse, John R.; Mehendale, Harihara M.
2007-01-01
The aim was to study the subchronic toxicity of perchloroethylene (Perc) by measuring injury and repair in liver and kidney in relation to disposition of Perc and its major metabolites. Male SW mice (25-29 g) were given three dose levels of Perc (150, 500, and 1000 mg/kg day) via aqueous gavage for 30 days. Tissue injury was measured during the dosing regimen (0, 1, 7, 14, and 30 days) and over a time course of 24-96 h after the last dose (30 days). Perc produced significant liver injury (ALT) after single day exposure to all three doses. Liver injury was mild to moderate and regressed following repeated exposure for 30 days. Subchronic Perc exposure induced neither kidney injury nor dysfunction during the entire time course as evidenced by normal renal histology and BUN. TCA was the major metabolite detected in blood, liver, and kidney. Traces of DCA were also detected in blood at initial time points after single day exposure. With single day exposure, metabolism of Perc to TCA was saturated with all three doses. AUC/dose ratio for TCA was significantly decreased with a concomitant increase in AUC/dose of Perc levels in liver and kidney after 30 days as compared to 1 day exposures, indicating inhibition of metabolism upon repeated exposure to Perc. Hepatic CYP2E1 expression and activity were unchanged indicating that CYP2E1 is not the critical enzyme inhibited. Hepatic CYP4A expression, measured as a marker of peroxisome proliferation was increased transiently only on day 7 with the high dose, but was unchanged at later time points. Liver tissue repair peaked at 7 days, with all three doses and was sustained after medium and high dose exposure for 14 days. These data indicate that subchronic Perc exposure via aqueous gavage does not induce nephrotoxicity and sustained hepatotoxicity suggesting adaptive hepatic repair mechanisms. Enzymes other than CYP2E1, involved in the metabolism of Perc may play a critical role in the metabolism of Perc upon subchronic exposure
Indoor tetrachloroethylene levels and determinants in Paris dwellings.
Roda, Célina; Kousignian, Isabelle; Ramond, Anna; Momas, Isabelle
2013-01-01
There is growing public health concern about indoor air quality. Tetrachloroethylene (PERC), a chlorinated volatile organic compound widely used as a solvent in dry cleaning facilities, can be a residential indoor air pollutant. As part of an environmental investigation included in the PARIS (Pollution and asthma Risk: an Infant Study) birth cohort, this study firstly aimed to document domestic PERC levels, and then to identify the factors influencing these levels using standardized questionnaires about housing characteristics and living conditions. Air samples were collected in the child's bedroom over one week using passive devices when infants were 1, 6, 9, and 12 months. PERC was identified and quantified by gas chromatography/mass spectrometry. PERC annual domestic level was calculated by averaging seasonal levels. PERC was omnipresent indoors, annual levels ranged from 0.6 to 124.2 μg/m3. Multivariate linear and logistic regression models showed that proximity to dry cleaning facilities, do-it-yourself activities (e.g.: photographic development, silverware), presence of air vents, and building construction date (<1945) were responsible for higher domestic levels of PERC. This study, conducted in an urban context, provides helpful information on PERC contamination in dwellings, and identifies parameters influencing this contamination. Copyright © 2012 Elsevier Inc. All rights reserved.
Cunha, Catarina Gradíssimo Dias da
2012-01-01
Dissertação de mestrado integrado em Psicologia (área de especialização em Psicologia Clínica) Esta dissertação constitui-se como um estudo exploratório e descritivo da perceção que os/as psicoterapeutas, com experiência de acompanhamento de casos de Disfunção Erétil, têm acerca do impacto que os estereótipos de género e o funcionamento das relações íntimas têm nas vivências desta disfunção. Para tal, realizaram-se entrevistas semiestruturadas a 9 psicoterapeutas (psicólogos/as...
Directory of Open Access Journals (Sweden)
Victor Aguilar-Soto
2015-03-01
Full Text Available Species distribution models (SDMs help identify areas for the development of populations or communities to prevent extinctions, especially in the face of the global environmental change. This study modeled the potential distribution of the tree Picea chihuahuana Martínez, a species in danger of extinction, using the maximum entropy modeling method (MaxEnt at three scales: local, state and national. We used a total of 38 presence data from the Sierra Madre Occidental. At the local scale, we compared MaxEnt with the reclassification and overlay method integrated in a geographic information system. MaxEnt generated maps with a high predictive capability (AUC > 0.97. The distribution of P. chihuahuana is defined by vegetation type and minimum temperature at national and state scales. At the local scale, both models calculated similar areas for the potential distribution of the species; the variables that better defined the species distribution were vegetation type, aspect and distance to water flows. Populations of P. chihuahuana have always been small, but our results show potential habitat greater than the area of the actual distribution. These results provide an insight into the availability of areas suitable for the species’ regeneration, possibly through assisted colonization.
Riva Novoa, Ronal
2015-01-01
Es una investigación descriptiva correlacional, orientada a estudiar la relación entre toma de decisión y la actitud emprendedora estudiantes del 5° grado de secundaria de la Institución Educativa Pública José Jiménez Borja del Cercado de Lima, Se seleccionó una población de 80 estudiantes de ambos sexos del 5° año de educación secundaria. A dicha población se les aplicó Cuestionario para evaluar la aptitud en la Toma de Decisiones, el cuestionario fue elaborado por Jonifer Benitez (2011) ...
Pantelia, Anna
2014-01-01
17 January 2014 - Y. Sakurada Japanese Senior Vice Minister of Education, Culture, Sports, Science and Technology signing the Guest book with CERN Director-General R. Heuer and visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez. Head of International Relations R. Voss present throughout.
Freund, Yonathan; Cachanado, Marine; Aubry, Adeline; Orsini, Charlotte; Raynal, Pierre-Alexis; Féral-Pierssens, Anne-Laure; Charpentier, Sandrine; Dumas, Florence; Baarir, Nacera; Truchot, Jennifer; Desmettre, Thibaut; Tazarourte, Karim; Beaune, Sebastien; Leleu, Agathe; Khellaf, Mehdi; Wargon, Mathias; Bloom, Ben; Rousseau, Alexandra; Simon, Tabassome; Riou, Bruno
2018-02-13
The safety of the pulmonary embolism rule-out criteria (PERC), an 8-item block of clinical criteria aimed at ruling out pulmonary embolism (PE), has not been assessed in a randomized clinical trial. To prospectively validate the safety of a PERC-based strategy to rule out PE. A crossover cluster-randomized clinical noninferiority trial in 14 emergency departments in France. Patients with a low gestalt clinical probability of PE were included from August 2015 to September 2016, and followed up until December 2016. Each center was randomized for the sequence of intervention periods. In the PERC period, the diagnosis of PE was excluded with no further testing if all 8 items of the PERC rule were negative. The primary end point was the occurrence of a thromboembolic event during the 3-month follow-up period that was not initially diagnosed. The noninferiority margin was set at 1.5%. Secondary end points included the rate of computed tomographic pulmonary angiography (CTPA), median length of stay in the emergency department, and rate of hospital admission. Among 1916 patients who were cluster-randomized (mean age 44 years, 980 [51%] women), 962 were assigned to the PERC group and 954 were assigned to the control group. A total of 1749 patients completed the trial. A PE was diagnosed at initial presentation in 26 patients in the control group (2.7%) vs 14 (1.5%) in the PERC group (difference, 1.3% [95% CI, -0.1% to 2.7%]; P = .052). One PE (0.1%) was diagnosed during follow-up in the PERC group vs none in the control group (difference, 0.1% [95% CI, -∞ to 0.8%]). The proportion of patients undergoing CTPA in the PERC group vs control group was 13% vs 23% (difference, -10% [95% CI, -13% to -6%]; P < .001). In the PERC group, rates were significantly reduced for the median length of emergency department stay (mean reduction, 36 minutes [95% CI, 4 to 68]) and hospital admission (difference, 3.3% [95% CI, 0.1% to 6.6%]). Among very low-risk patients with suspected
Directory of Open Access Journals (Sweden)
Eduardo Silva
2010-11-01
Full Text Available El artículo de Martínez, Silva y Hernández (en este número argumenta que los jóvenes chilenos se han distanciado de la participación sociopolítica convencional, porque perciben una falta de validación de las personas en el sistema sociopolítico actual, debido a la vulneración de derechos, inequidad social y falta de voz y poder de los ciudadanos. Esto choca con sus valores de fraternidad y desarrollo justo y digno de las personas. En este ensayo se examina si ese sentir tiene fundamentos reales en la estructura y lógica del modelo político-económico que ellos critican. Se aborda el tema desde el marco analítico de la economía política, que parte del supuesto de que las estructuras económicas y políticas determinan sujetos sociales, sus intereses y su poder relativo. Se encontró una asociación directa entre la lógica del modelo político-económico y los sentimientos de exclusión que expresaron los entrevistados.The article by Martínez, Silva, and Hernández (in this issue argues that Chilean youth have disengaged from participation in conventional socio-political institutions because they believe that the sociopolitical system does not validate the persons, violates their rights, is highly inequitable, and excludes them from having a real voice in public decision-making. This perception clashes with their values of fraternity and a just and dignified development for everyone. This essay examines if these beliefs have a real basis in the structure and logic of the economic and political model they criticize. This issue is analyzed from a political economy perspective, built on the assumption that economic and political structures determine social subjects, their interests, and their relative power. A direct association was found between the logic of Chile's political-economic model and the feelings of exclusion that the interviewees expressed.
Series Resistance Analysis of Passivated Emitter Rear Contact Cells Patterned Using Inkjet Printing
Directory of Open Access Journals (Sweden)
Martha A. T. Lenio
2012-01-01
Full Text Available For higher-efficiency solar cell structures, such as the Passivated Emitter Rear Contact (PERC cells, to be fabricated in a manufacturing environment, potentially low-cost techniques such as inkjet printing and metal plating are desirable. A common problem that is experienced when fabricating PERC cells is low fill factors due to high series resistance. This paper identifies and attempts to quantify sources of series resistance in inkjet-patterned PERC cells that employ electroless or light-induced nickel-plating techniques followed by copper light-induced plating. Photoluminescence imaging is used to determine locations of series resistance losses in these inkjet-patterned and plated PERC cells.
Improving couples' quality of life through a Web-based prostate cancer education intervention.
Song, Lixin; Rini, Christine; Deal, Allison M; Nielsen, Matthew E; Chang, Hao; Kinneer, Patty; Teal, Randall; Johnson, David C; Dunn, Mary W; Mark, Barbara; Palmer, Mary H
2015-03-01
To evaluate the feasibility and acceptability of a newly developed web-based, couple-oriented intervention called Prostate Cancer Education and Resources for Couples (PERC). Quantitative, qualitative, mixed-methods approach. Oncology outpatient clinics at the University of North Carolina (UNC) Lineberger Comprehensive Cancer Center at UNC–Chapel Hill. 26 patients with localized prostate cancer (PCa) and their partners. Pre- and postpilot quantitative assessments and a postpilot qualitative interview were conducted. General and PCa-specific symptoms, quality of life, psychosocial factors, PERC’s ease of use, and web activities. Improvement was shown in some PCa-specific and general symptoms (small effect sizes for patients and small-to-medium effect sizes for partners), overall quality of life, and physical and social domains of quality of life for patients (small effect sizes). Web activity data indicated high PERC use. Qualitative and quantitative analyses indicated that participants found PERC easy to use and understand,as well as engaging, of high quality, and relevant. Overall, participants were satisfied with PERC and reported that PERC improved their knowledge about symptom management and communication as a couple. PERC was a feasible, acceptable method of reducing the side effects of PCa treatment–related symptoms and improving quality of life. PERC has the potential to reduce the negative impacts of symptoms and enhance quality of life for patients with localized PCa and their partners, particularly for those who live in rural areas and have limited access to post-treatment supportive care.
Directory of Open Access Journals (Sweden)
J. Navarro-Martínez
2005-01-01
Full Text Available El presente trabajo contribuye al conocimiento de las características y propiedades tecnológicas de la madera de Palo morado (Peltogyne mexicana Martínez, mediante la caracterización anatómica, porcentaje de elementos y determinación de las propiedades físicas y tres mecánicas. Se colectaron dos árboles en Tierra Colorada Guerrero. El material se obtuvo de trozas a 1.30 m de altura. Para el estudio macroscópico se usaron muestras de 7 x 15 x 1 cm y para el microscópico se elaboraron preparaciones fijas de cortes y de material disociado. La madera presenta un color violeta intenso, porosidad difusa, parénquima en bandas y aliforme confluente con cristales, los elementos de vaso son cortos de diámetro medio, con inclusiones, rayos uniseriados, biseriados, triseriados y raramente multiseriados; las fibras son de tipo libriforme de longitud media, diámetro fino y pared gruesa, presenta densidad básica, contracciones y dureza alta.
Pantelia, Anna
2014-01-01
1 April 2014 - President of the Parliament of the Principality of Liechtenstein A. Frick and his delegation visiting the LHC tunnel at Point 1 with Technology Department Head J.M. Jiménez and signing the Guest book with CERN Director-General R. Heuer. Deputy Head of International Relations E. Tsesmelis present throughout.
A Origem dos Maus-Tratos: Revisão Sobre a Evolução Histórica das Perceções de Criança e Maus-Tratos
Directory of Open Access Journals (Sweden)
Raquel V. Oliveira
2014-03-01
Full Text Available ObjetivoNeste trabalho elabora-se, com base em revisão bibliográfica, a evolução histórica das perceções acerca de maus-tratos e de criança. Começa-se por abordar o constructo de maus-tratos, passando seguidamente pela Antiguidade e Idade Média, onde as crianças eram sujeitas a constantes maus-tratos, sendo prevalentes os maus-tratos físicos, abuso sexual e o trabalho infantil, progredindo até à Idade Moderna, onde a criança passa a ser vista como um ser com características particulares e merecedor de cuidados especiais. Aborda-se de forma breve as tipologias de maus-tratos na atualidade e as variações culturais.ConclusãoTorna-se fulcral compreender o impacto que os maus-tratos têm vindo ao longo da histórico e que continuam a ter na atualidade, sendo fundamental a considerar estes aspetos nas intervenções a serem desenvolvidas nesta área, tendo em particular consideração o amplo leque de variações culturais cada vez mais presentes e evidentes.
Energy Technology Data Exchange (ETDEWEB)
Kozusko, Shana
2003-12-01
The Nez Perce Tribe (NPT) currently manages a 15,325 acre parcel of land known as the Precious Lands Wildlife Management Area that was purchased as mitigation for losses incurred by construction of the four lower Snake River dams. The Management Area is located in northern Wallowa County, Oregon and southern Asotin County, Washington (Figure 1). It is divided into three management parcels--the Buford parcel is located on Buford Creek and straddles the WA-OR state line, and the Tamarack and Basin parcels are contiguous to each other and located between the Joseph Creek and Cottonwood Creek drainages in Wallowa County, OR. The project was developed under the Pacific Northwest Electric Power Planning and Conservation Act of 1980 (P.L. 96-501), with funding from the Bonneville Power Administration (BPA). The acreage protected under this contract will be credited to BPA as habitat permanently dedicated to wildlife and wildlife mitigation. A modeling strategy known as Habitat Evaluation Procedure (HEP) was developed by the U.S. Fish and Wildlife Service and adopted by BPA as a habitat equivalency accounting system. Nine wildlife species models were used to evaluate distinct cover type features and provide a measure of habitat quality. Models measure a wide range of life requisite variables for each species and monitor overall trends in vegetation community health and diversity. One product of HEP is an evaluation of habitat quality expressed in Habitat Units (HUs). This HU accounting system is used to determine the amount of credit BPA receives for mitigation lands. After construction of the four lower Snake River dams, a HEP loss assessment was conducted to determine how many Habitat Units were inundated behind the dams. Twelve target species were used in that evaluation: Canada goose, mallard, river otter, downy woodpecker, song sparrow, yellow warbler, marsh wren, western meadowlark, chukar, ring-necked pheasant, California quail, and mule deer. The U.S. Army Corp of
Directory of Open Access Journals (Sweden)
Alexandra dos Anjos Cassado
Full Text Available The peritoneal cavity (PerC is a singular compartment where many cell populations reside and interact. Despite the widely adopted experimental approach of intraperitoneal (i.p. inoculation, little is known about the behavior of the different cell populations within the PerC. To evaluate the dynamics of peritoneal macrophage (MØ subsets, namely small peritoneal MØ (SPM and large peritoneal MØ (LPM, in response to infectious stimuli, C57BL/6 mice were injected i.p. with zymosan or Trypanosoma cruzi. These conditions resulted in the marked modification of the PerC myelo-monocytic compartment characterized by the disappearance of LPM and the accumulation of SPM and monocytes. In parallel, adherent cells isolated from stimulated PerC displayed reduced staining for β-galactosidase, a biomarker for senescence. Further, the adherent cells showed increased nitric oxide (NO and higher frequency of IL-12-producing cells in response to subsequent LPS and IFN-γ stimulation. Among myelo-monocytic cells, SPM rather than LPM or monocytes, appear to be the central effectors of the activated PerC; they display higher phagocytic activity and are the main source of IL-12. Thus, our data provide a first demonstration of the consequences of the dynamics between peritoneal MØ subpopulations by showing that substitution of LPM by a robust SPM and monocytes in response to infectious stimuli greatly improves PerC effector activity.
Eulalia Hernández Ciro
2015-01-01
Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprens...
La conformación de la provincia jesuítica de Toledo en torno al generalato de Diego Laínez 1556-1565
Directory of Open Access Journals (Sweden)
Martín López, David
2014-12-01
Full Text Available The newest Jesuits soon began incardinated in the Iberian territory, home of its founder. As one of the most important territories of Catholic Christianity, soon saw the need to distribute what would soon become a large crown in a number of provinces for a more effective government and evangelization. After the first division, at the time of the Spanish general Lines were the final foundations of penta-provincialization between Portugal, Castile, Aragon, Andalusia and —novelty— Toledo.La novísima Compañía de Jesús empezó pronto a incardinarse en el territorio ibérico, patria de su fundador. Como uno de los territorios más importantes de la Cristiandad católica, pronto se vio la necesidad de distribuir lo que pronto sería una gran corona en una serie de provincias para unos más eficaces gobierno y evangelización. Después de una primera división, en la época del generalato del español Laínez se pusieron las bases de la pentaprovincialización definitiva entre Portugal, Castilla, Aragón, Bética y —la novedad— Toledo.
Directory of Open Access Journals (Sweden)
Raquel Batista de Oliveira
2017-12-01
Full Text Available Data de submissão: 30-10-2017 Data de Aceitação: 22-12-2017Este estudo insere-se na temática da inclusão de alunos com Necessidades Educativas Especiais (NEE nas escolas da Região Centro em Portugal Continental, tendo como objetivo conhecer as perceções dos diferentes atores sobre as práticas inclusivas de alunos com Necessidades Educativas Especiais nas escolas portuguesas com base no Decreto-Lei 3/2008. Neste sentido, procedeu-se a entrevista semiestruturada direcionada para professores da Educação Especial, professores do Ensino Regular, equipa técnico pedagógica, utilizando a técnica análise de conteúdo para as análises dos dados onde pode-se obter alguns resultados. Os resultados desta investigação revelam que no que se refere as perceções dos diferentes atores educativos face à práticas de colaboração, que há alguma convergência nas respostas destes atores, no entanto, emergem algumas divergências nas respostas destes no que se refere a presença dos recursos humanos e materiais, bem como o seu reconhecimento face utilização destes recursos no espaço escolar. Os resultados também revelam que há diferentes respostas dos participantes face a perceção sobre as práticas de colaboração o que remete a necessidade de um maior fortalecimento entre as culturas de escola que visem o desenvolvimento coeso entre todos os agentes educativos no tocante às práticas de colaboração desenvolvidas neste espaço.Collaboration practices for inclusion of students with special educational needs in Portuguese schools: Teacher perceptions and pedagogical technical teamThis study expands upon the theme of inclusion of students with special needs educational (ENE in schools of the Região Centro in Portugal Continental. It aims to know different practitioners’ perceptions of inclusion practices of pupils with special needs educational in Portuguese schools based on the Decree-Law 3/2008. In this respect, semi
A la costa de Luis A. Martínez: ¿la defensa de un proyecto liberal para Ecuador?
Directory of Open Access Journals (Sweden)
1998-01-01
Full Text Available A LA COSTA DE LUIS A. MARTINEZ : LA DEFENSE DUN PROJET LIBERAL POUR LÉQUATEUR ? A la Costa est souvent analysé comme une peinture de moeurs, témoignage de la réalité sociale et politique de l´Équateur de la fin du XIX et du début du XX. En effet, ce roman prétend décrire le conflit traditionnel qui oppose socialement, économiquement et politiquement les Andes et la Côte. Mais il se présente aussi et surtout comme la défense d´un projet libéral pour l´Équateur et développe une démonstration idéologique systématique. En outre, il propose une lecture du sens de la vie et une réflexion sur le devenir de l´homme dont la portée dépasse largement l´argumentation idéologique. Ce sont sans aucun doute ces nuances, introduites tout au long de la narration, qui permettent à l´oeuvre d´échapper à son statut exemplaire, simple témoignage d´une époque, pour proposer une vision personnelle et créative. Muchos han visto en A la Costa una novela de tendencia costumbrista, testimonio de la realidad social y política del Ecuador a finales del siglo XIX y comienzos del XX. En efecto, la novela pretende describir el conflicto tradicional social, económico, político entre Sierra y Costa. Pero es también, y ante todo, la defensa de un proyecto liberal para Ecuador, desarrollando una sistemática demostración ideológica. Además, propone una lectura del sentido de la vida y una reflexión sobre el porvenir del hombre cuyo alcance va más allá de la defensa de un proyecto ideológico. Sin duda son estos matices, introducidos a lo largo de la narración, los que permiten que la obra escape del estatuto de novela ejemplar y testimonial para proponer una visión autónoma y creativa. THE NOVEL A LA COSTA OF LUIS A. MARTÍNEZ: THE DEFENSE OF A LIBERAL PROJECT FOR ECUADOR? The novel A la Costa has often been analyzed as a portrait of national costumes, a testimony to the social and political realities of Ecuador at the end of
Yuan, Lu; LeBlanc, James
1998-01-01
This thesis investigates the effects of the High Power Amplifier (HPA) and the filters over a satellite or telemetry channel. The Volterra series expression is presented for the nonlinear channel with memory, and the algorithm is based on the finite-state machine model. A RAM-based algorithm operating on the receiver side, Pre-cursor Enhanced RAM-FSE Canceler (PERC) is developed. A high order modulation scheme , 16-QAM is used for simulation, the results show that PERC provides an efficient and reliable method to transmit data on the bandlimited nonlinear channel. The contribution of PERC algorithm is that it includes both pre-cursors and post-cursors as the RAM address lines, and suggests a new way to make decision on the pre-addresses. Compared with the RAM-DFE structure that only includes post- addresses, the BER versus Eb/NO performance of PERC is substantially enhanced. Experiments are performed for PERC algorithms with different parameters on AWGN channels, and the results are compared and analyzed. The investigation of this thesis includes software simulation and hardware verification. Hardware is setup to collect actual TWT data. Simulation on both the software-generated data and the real-world data are performed. Practical limitations are considered for the hardware collected data. Simulation results verified the reliability of the PERC algorithm. This work was conducted at NMSU in the Center for Space Telemetering and Telecommunications Systems in the Klipsch School of Electrical and Computer Engineering Department.
Directory of Open Access Journals (Sweden)
Andreia Pinto de Sousa
2015-07-01
Full Text Available A Interface é incontornável quando se estudam os sistemas de informação. Com este artigo, pretendemos contribuir para o aumento do conhecimento sobre os processos de apresentação de informação de saúde online e, sobre as relações do utilizador com a Interface. A proposta aqui apresentada consiste na divisão da interface em cinco dimensões (visual, arquitetura da informação, interação, presença social e experiência de utilização para um maior conhecimento da relevância de cada uma das dimensões e dos seus elementos no estudo da credibilidade e confiança online. Apresenta-se também um modelo de análise que serve como base de construção dos instrumentos de análise para a recolha de dados que caraterizam os utilizadores, e os seus comportamentos relativamente ao acesso e participação e avaliam a sua perceção de credibilidade e de confiança em websites partindo da análise de cada uma das dimensões da Interface.
Directory of Open Access Journals (Sweden)
Córdoba, Joaquín Mª
2005-04-01
Full Text Available A comienzos del siglo XX, cuando el redescubrimiento de Oriente se había trocado en su colonización tras la I Guerra Mundial, la poesía del viaje y el reencuentro con gentes y paisajes parecían ya imposibles. De hecho, la literatura «clásica» del viaje a Oriente estaba ya más que acabada. Sin embargo, un accidente de la historia de la aviación española haría que el capitán Rafael Martínez Esteve, integrante de la patrulla que emprendió el viaje Madrid-Manila, viviera una trágica aventura en el desierto jordano- iraquí. Fruto de esa experiencia sería un libro que es, al mismo tiempo que emocionante relato, descripción poética del desierto y la vida de los beduinos, sarcástica mirada a los poderes coloniales, y un amable epígono en la historia de la literatura española de viajes a Oriente.…
INHIBITORY EFFECTS OF PERCHLOROETHYLENE ON HUMAN NEURONAL NICOTINIC ACETYLCHOLINE RECEPTORS.
Perchloroethylene (PERC) is a volatile organic solvent with a variety of industrial uses. PERC exposure has been shown to cause adverse neurological effects including deficits in vision and memory in exposed individuals. Despite knowledge of these effects, the mechanisms by whi...
Friar, John T.
Two factors of predicted learning disorders were investigated: (1) inability to maintain appropriate classroom behavior (BEH), (2) perceptual discrimination deficit (PERC). Three groups of first-graders (BEH, PERC, normal control) were administered measures of impulse control, distractability, auditory discrimination, and visual discrimination.…
2010-03-24
... Propane Education and Research Council's Operations, Market Changes and Federal Programs AGENCY... Education and Research Council (PERC), in conjunction with the cumulative effects of market changes and... requirements under the Propane Education and Research Act of 1996 that established PERC and requires the...
Directory of Open Access Journals (Sweden)
Juan José Martín García
2016-07-01
Full Text Available La aparición en un archivo particular de la localidad burgalesa de Pradoluengo, del libro de cuentas de Manuel Martínez Lerma, y su análisis desde los puntos de vista formal, conceptual y de contenidos, supone uno de los pocos casos sobre contabilidad privada, estudiados en el ámbito rural castellano de la primera mitad del siglo XIX. En su funcionamiento interno, este documento contable es deudor de la tradición castellana. Su fin es eminentemente práctico y su contexto cronológico le hace no estar sujeto a supervisiones de estamentos superiores, lo que le otorga una verosimilitud prácticamente absoluta. Sin lugar a dudas, supuso la piedra angular del trabajo de despacho de su redactor, quien, a pesar de declarar como actividad principal la de escribano, diversificó sus negocios en multitud de ámbitos: fabricación de tejidos, comercio al por menor, actividades financieras y de préstamo, compraventa de lanas, adquisición de tierras e inmuebles, etcétera. La versatilidad de nuestro personaje, se plasma en múltiples perspectivas que manan constantemente del libro de cuentas, cuyo análisis hemos apoyado con documentación notarial, parroquial y municipal. Manuel se situará progresivamente en lo más alto de la cúspide social, estableciendo relaciones clientelares con grandes comerciantes, convirtiéndose en un destacado fabricante local, accediendo a puestos de responsabilidad municipal, fijando alianzas matrimoniales ventajosas para sus hijos, o siendo pieza clave en el encumbramiento de uno de ellos como arzobispo de Manila.
International Nuclear Information System (INIS)
James, Jean-Baptiste
2001-11-01
Since 1965, the site of the Nez-de-Jobourg, in the Manche district and at the vicinity of the La Hague plant, has been a site of ornithological follow-up, notably because it harbours different population of nesting sea birds. Since 1990, it has been noticed that the population of European shags has been keeping on decreasing, with abnormally low birth rate, while the European herring gull has totally disappeared. If the relationship between this decline and the releases of the La Hague nuclear waste processing plant is easily and quickly suspected, other reasons are also plausible. The authors report a study of this decline and an investigation of its possible origins. After a presentation of the site, of its status regarding hunting and specie protection, and a presentation of other close sites (small islands, bay), the report addresses the case of the European shag. It gives information on its biology, characteristics, location and population, reproduction sites and nesting cycle. It presents the method adopted to test the various hypotheses of origin of the noticed decline: contamination by radioactive materials or by chemical substances, problems of disturbance by fishers, tourists or others, problems of predation, parasitism or lack of food resources. Samplings have been performed within the studied site and also within reference sites located some miles away. Based on data and observations, hypotheses are then discussed. An analytical report of measurement of artificial radio-elements performed by gamma spectrometry is provided
CARACTERIZACIÓN TECNOLÓGICA DE LA MADERA DE Juniperus flaccida VAR. POBLANA MARTÍNEZ
Directory of Open Access Journals (Sweden)
A. Borja de la Rosa
2010-01-01
Full Text Available El presente estudio se realizó con la finalidad de conocer las características y propiedades tecnológicas de la madera de Juniperus flaccida var. poblana Martínez, para lo cual se utilizó la metodología del Laboratorio de Anatomía y Tecnología de la Madera de la División de Ciencias Forestales de la Universidad Autónoma Chapingo. Las propiedades físicas se determinaron según la norma NOM-EE-167-83 y las mecánicas de acuerdo a las normas ASTM 143-83 en el Campo Experimental San Martinito, del Instituto de Investigaciones Forestales, Agrícolas y Pecuarias (INIFAP. Los resultados con relación a las características anatómicas fueron los siguientes: la madera presenta un color castaño claro en el duramen y amarillo pálido en la albura, brillo medio, veteado suave, textura fina, hilo recto, sabor característico y olor aromático. Las traqueidas son largas, de diámetro tangencial mediano y paredes delgadas; presentan una hilera de puntuaciones areoladas seriadas, las puntuaciones de los campos de cruzamiento son tipo cupresoide y el parénquima axial es escaso. Los rayos de tipo uniseriados numerosos, muy bajos y muy angostos; los rayos y las células parenquimatosas axiales presentan aceites. La proporción de elementos fue 92 % de traqueidas, 7.72 de parénquima de rayo y 0.18 % de parénquima axial. La densidad básica fue de 0.50 g·cm-3, las contracciones totales fueron: volumétrica de 8.42 %, tangencial de 4.26 % y radial de 3.02 %; y los hinchamientos totales: volumétrico de 9.17 %, tangencial de 4.45 % y radial de 3.12 %. El punto de saturación de la fibra fue de 33 %; el coeficiente de hinchamiento 0.278 %, y la relación de anisotropía de 1.41. Los valores promedio de las propiedades mecánicas al 12 % de contenido de humedad (CH y en condición verde, se clasificaron de medios a bajos en ambas condiciones de contenido de humedad. Considerando las características anatómicas y los valores de las propiedades f
Reception of the Istrian musical tradition(s
Directory of Open Access Journals (Sweden)
Marušić Dario
2007-01-01
Full Text Available The successive colonization of Istria with culturally differentiated populations, and peripheral position of the peninsula regarding both the Latin and Slav worlds, has conditioned interesting phenomena which defines the traditional life of the province. On the spiritual level it is primarily reflected in two cultural dimensions: the language and traditional music.
Sarmini; Nadiroh, Ulin; Saeun Fahmi, Muhammad
2018-01-01
Marriage is a container for framing the inner-to-heart relationship, the bond of love and affection between a man and woman to nurture a joy of happiness. This study aims to find out how the process and stages in traditional merariq traditions in the Sasak people, conflicts arising from merariq traditions, and reduce conflict through the tradition of selabar. The method used in this research is qualitative analysis method. In the process, merariq tradition is done by kidnapping the bride without the knowledge of the parents or the family of the women. There are several stages that must be passed by the bride and groom in the tradition merariq, namely: besejati, nyelabar, bait wali, sorong serah dan nyongkolang. Conflict that often arises, for internal family, merariq often become a place of coercion against the female family. For society, merariq impact on disruption of harmony of social life. In order to reduce the conflicts done selabar tradition, the tragedy is regarded as an alternative problem solving in the form of negotiations between the bride and groom’s family and the bride-to-be relating to ajikrame and pisuke transactions.
Lifescience Database Archive (English)
Full Text Available some 3 SCAF14756, whole genome shot... 77 3e-13 tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste...|A8IF50_9PERC Intestinal peptide transporter OS=Sebastes nebulosus GN=SLC15A1 PE=2 SV=1 Length = 742 Score =
Lifescience Database Archive (English)
Full Text Available 8IF50_9PERC Intestinal peptide transporter OS=Sebaste... 93 8e-18 tr|A7ST97|A7ST97_NEMVE Predicted protein (...++D +L KY TI+YLS+ Y Sbjct: 66 ALCYLTPILGAIVADSWLGKYKTIVYLSIVY 96 >tr|A8IF50|A8IF50_9PERC Intestinal peptide transporter OS=Sebaste
Hamilton, D; Aronsen, P; Løken, J H; Berg, I M; Skotheim, R; Hopper, D; Clarke, A; Briffa, N K
2006-01-01
Objective To examine in a cross sectional study the influence of femoral torsion (FT) and passive hip external rotation (PER) on turnout (TO). Starting age, years of classical ballet training, and current and past dance training intensity were assessed to determine their influence on FT, PER, and TO in pre‐professional female dancers. Methods Sixty four dancers (mean (SD) age 18.16 (1.80) years) were recruited from four different dance training programmes. They completed a dance history questionnaire. FT was measured using a clinical method. PER was measured with the subjects prone, and TO was measured with the subjects standing. Results Mean TO was 136°, mean unilateral PER was 49.4°, and mean FT was 18.4°. A positive correlation was observed between PER combined (PERC) and TO (r = 0.443, pballet training and FTC, PERC, or TO. Dancers who trained for six hours a week or more during the 11–14 year age range had less FT than those who trained less (mean difference 6°, 95% confidence interval 1.4 to 10.3). Students currently training for longer had higher levels of TO (p<0.001) but comparable PERC and FTC. Conclusion FT is significantly associated with PERC. Dancers who trained for six hours a week or more at 11–14 years of age had significantly less FT. FTC had a significant influence on PERC, but no influence on the execution of TO. PMID:16556782
Restoring Anadromous Fish Habitat in Big Canyon Creek Watershed, 2004-2005 Annual Report.
Energy Technology Data Exchange (ETDEWEB)
Rasmussen, Lynn (Nez Perce Soil and Conservation District, Lewiston, ID)
2006-07-01
The ''Restoring Anadromous Fish Habitat in the Big Canyon Creek Watershed'' is a multi-phase project to enhance steelhead trout in the Big Canyon Creek watershed by improving salmonid spawning and rearing habitat. Habitat is limited by extreme high runoff events, low summer flows, high water temperatures, poor instream cover, spawning gravel siltation, and sediment, nutrient and bacteria loading. Funded by the Bonneville Power Administration (BPA) as part of the Northwest Power Planning Council's Fish and Wildlife Program, the project assists in mitigating damage to steelhead runs caused by the Columbia River hydroelectric dams. The project is sponsored by the Nez Perce Soil and Water Conservation District. Target fish species include steelhead trout (Oncorhynchus mykiss). Steelhead trout within the Snake River Basin were listed in 1997 as threatened under the Endangered Species Act. Accomplishments for the contract period September 1, 2004 through October 31, 2005 include; 2.7 riparian miles treated, 3.0 wetland acres treated, 5,263.3 upland acres treated, 106.5 riparian acres treated, 76,285 general public reached, 3,000 students reached, 40 teachers reached, 18 maintenance plans completed, temperature data collected at 6 sites, 8 landowner applications received and processed, 14 land inventories completed, 58 habitat improvement project designs completed, 5 newsletters published, 6 habitat plans completed, 34 projects installed, 2 educational workshops, 6 displays, 1 television segment, 2 public service announcements, a noxious weed GIS coverage, and completion of NEPA, ESA, and cultural resources requirements.
Santiago Martínez Delgado, pionero del diseño gráfico colombiano: una reseña de su vida y obra
Directory of Open Access Journals (Sweden)
Diego Giovanni Bermúdez Aguirre
2017-06-01
Full Text Available Hablar del diseño gráfico en Colombia como profesión autónoma es aproximarse a una historia todavía en construcción, dada la juventud de este espacio de conocimiento, el cual dio sus primeros pasos solo hasta principios del siglo XX, debido al desarrollo industrial que vino a definir un nuevo lenguaje de producción, estético y comunicativo que ahora se llama “diseño”. Este texto pretende acercarse a la vida de Santiago Martínez Delgado, uno de los primeros hombres que con su obra definió, en el contexto colombiano, los rumbos de una nueva forma de expresión y comunicación: el diseño gráfico. Se intenta comprender el carácter innovador presente en la vida y obra de este diseñador colombiano, desde la ciencia histórica a partir de la condición de lugar de producción, acercamiento al tiempo histórico como reconstrucción o representación de un presente por medio de un proceso de ficcionalización, el cual edifica y evidencia una ruptura temporal entre el pasado, asumido como espacio de experiencia, y el ahora (presente, constituido a partir de una visión prospectiva de la vida en el futuro, horizonte de expectativa.
Understanding traditional African healing.
Mokgobi, M G
2014-09-01
Traditional African healing has been in existence for many centuries yet many people still seem not to understand how it relates to God and religion/spirituality. Some people seem to believe that traditional healers worship the ancestors and not God. It is therefore the aim of this paper to clarify this relationship by discussing a chain of communication between the worshipers and the Almighty God. Other aspects of traditional healing namely types of traditional healers, training of traditional healers as well as the role of traditional healers in their communities are discussed. In conclusion, the services of traditional healers go far beyond the uses of herbs for physical illnesses. Traditional healers serve many roles which include but not limited to custodians of the traditional African religion and customs, educators about culture, counselors, social workers and psychologists.
Directory of Open Access Journals (Sweden)
García-Abad García, M. Teresa
2005-06-01
Full Text Available The cinema, his synthetic character, and the dialogue that it establishes from the origin with other arts as literature, has not stopped offering a wide space of synergies for the adaptation practice and for the study of confluence areas between image and word. New generations of writers and directors propiciate across their work an opening that, beside integrating the expressive resources of the literature and the screen, consider the text as a productive and plural activity, capable of being spread in a stereophony that postpones its meaning in every process of reading, making it coincide with a practice of writing and creation. Ignacio Martinez de Pisón's literature contains sugerent keys to advance in the dialogue between literature and cinema in current Spanish narrative.El cine, su carácter sintético, y el diálogo que desde el origen establece con otras artes como la literatura, no han dejado de ofrecer un espacio amplio de sinergias para la práctica adaptativa y para la reflexión acerca de los ámbitos de confluencia entre la imagen y la palabra. Las generaciones de escritores y de directores más jóvenes propician a través de su obra una apertura que, además de integrar los recursos expresivos de la literatura y la pantalla, considera al texto como una actividad productiva y plural capaz de diseminarse en una estereofonía que aplaza su significado en cada proceso de lectura haciéndolo coincidir con una práctica de escritura y de creación. La literatura de Martínez de Pisón contiene claves sugerentes para desentrañar este diálogo entre literatura y cine en la narrativa española actual.
DEFF Research Database (Denmark)
Otto, Ton
2016-01-01
: beliefs, practices, institutions, and also things. In this sense, the meaning of the term in social research is very close to its usage in common language and is not always theoretically well developed (see Shils, 1971: 123). But the concept of tradition has also been central to major theoretical debates...... on the nature of social change, especially in connection with the notion of modernity. Here tradition is linked to various forms of agency as a factor of both stability and intentional change....
CONSUMERS’ BRAND EQUITY PERCEPTIONS OF TRADITIONAL AND NON-TRADITIONAL BRANDS
Catli, Ozlem; Ermec Sertoglu, Aysegul; Ors, Husniye
2017-01-01
Thisstudy aims to compare consumers' brand perception of traditional brands withbrand perceptions of non-traditional brands. Consumers livingin Ankara constitute the universe of work, and data were gathered in aface-to-face interview using the survey method. the demographic characteristicsof the participants was prepared with the aim of evaluating and comparing onetraditional brand and one non traditional brand of brand equity related to thebrand equity by the participants. According to...
A review of potential neurotoxic mechanisms among three chlorinated organic solvents
International Nuclear Information System (INIS)
Bale, Ambuja S.; Barone, Stan; Scott, Cheryl Siegel; Cooper, Glinda S.
2011-01-01
The potential for central nervous system depressant effects from three widely used chlorinated solvents, trichloroethylene (TCE), perchloroethylene (PERC), and dichloromethane (DCM), has been shown in human and animal studies. Commonalities of neurobehavioral and neurophysiological changes for the chlorinated solvents in in vivo studies suggest that there is a common mechanism(s) of action in producing resultant neurotoxicological consequences. The purpose of this review is to examine the mechanistic studies conducted with these chlorinated solvents and to propose potential mechanisms of action for the different neurological effects observed. Mechanistic studies indicate that this solvent class has several molecular targets in the brain. Additionally, there are several pieces of evidence from animal studies indicating this solvent class alters neurochemical functions in the brain. Although earlier evidence indicated that these three chlorinated solvents perturb the lipid bilayer, more recent data suggest an interaction between several specific neuronal receptors produces the resultant neurobehavioral effects. Collectively, TCE, PERC, and DCM have been reported to interact directly with several different classes of neuronal receptors by generally inhibiting excitatory receptors/channels and potentiating the function of inhibitory receptors/channels. Given this mechanistic information and available studies for TCE, DCM, and PERC, we provide hypotheses on primary targets (e.g. ion channel targets) that appear to be most influential in producing the resultant neurological effects. - Research highlights: → Comparison of neurological effects among TCE, PERC, and DCM. → Correlation of mechanistic findings to neurological effects. → Data support that TCE, PERC, and DCM interact with several ion channels to produce neurological changes.
Directory of Open Access Journals (Sweden)
Silvia Bermúdez
2006-01-01
Full Text Available Exactly ten years after its traumatic defeat in the Spanish-American War of 1898, Spain appeared to find some compensation for the loss of its last colonies by undertaking the invasion of Morocco in 1908. The enterprise proved difficult when the forces of Abd-el-Krim defeated the Spanish army in the summer of 1921. This terrible loss was metaphorized as an "open wound" and entered the collective imagination by becoming a theme in novels such as José Díaz Fernández's El blocao (1928, Ramón Sender's Imán (1930, and Arturo Barea's series La forja de un rebelde (1941-1944. Known as the "Disaster of Annual," the defeat appeared to be almost forgotten until a series of narratives in the late twentieth and early twenty-first centuries obsessively returned to this particular moment of Spanish history. I focus on how one such narrative, Martínez de Pisón's Una guerra africana (2000, revisits this war as adolescent literature ("novelas juveniles" and within the literary genre of the "novels of the War in Africa," and by so doing, contributes to the articulation of a Spanish collective identity with the historical memory of the feared Moroccan Other.
Understanding traditional African healing
MOKGOBI, M.G.
2014-01-01
Traditional African healing has been in existence for many centuries yet many people still seem not to understand how it relates to God and religion/spirituality. Some people seem to believe that traditional healers worship the ancestors and not God. It is therefore the aim of this paper to clarify this relationship by discussing a chain of communication between the worshipers and the Almighty God. Other aspects of traditional healing namely types of traditional healers, training of tradition...
Voluntad de estilo en el muy joven José Martínez Ruiz: un aprendiz de crítico satírico (1893-1894
Directory of Open Access Journals (Sweden)
Miguel Ángel Martín-Hervás Jiménez
2017-02-01
Full Text Available Este artículo se enmarca dentro la etapa de producción juvenil de José Martínez Ruiz, Azorín (1873-1967 y en él se analizan con un doble objetivo las tres primeras obras de su carrera literaria: La crítica literaria en España (1893, Moratín (1893 y Buscapiés (1894. El primer y principal objetivo consiste en utilizar como fundamento metodológico la teoría de la voluntad de estilo desarrollada por Juan Marichal en su libro Teoría e historia del ensayismo hispánico (1984 para analizar el tipo de personalidad literaria que aspiró a construirse el autor en sus tres primeras obras. En segundo lugar, se comprobará si es cierto o no que bebió en ellas de las fuentes de la ideología anarquista para forjar su imagen pública de escritor. Se concluirá que el futuro Azorín se encontraba en el periodo de 1893-1894 en una fase de aprendizaje y de búsqueda de maestros en la que quiso proyectar de sí mismo la imagen de Crítico Discordante o Crítico Satírico. Asimismo, se aclarará que hasta el momento todavía no había encontrado en el anarquismo el sustrato ideológico-estético que impregnará obras posteriores.
Directory of Open Access Journals (Sweden)
Margarita Garrido
2016-07-01
Full Text Available El libro editado por Francisco Ortega Martínez y Yobenj Aucardo Chicangana-Bayona es, en buena parte, producto de una investigación colectiva sobre los lenguajes políticos del período de la Independencia neogranadina, iniciada ya hace más de siete años con un grupo de estudiantes de maestría de la Universidad Nacional que, al ampliar sus fronteras, ha involucrado a otros investigadores nacionales y extranjeros, con quienes discute su propuesta metodológica y de principios con respecto a la historia conceptual. Lo interesante es que el libro no es la respuesta a un llamado a enviar artículos que más o menos se acomoden a unos temas y problemas, sino el resultado de lecturas conjuntas, debates y reflexiones que le permitió compartir a los autores lo que en su momento entendían por historia conceptual y por cultura política. Así, decidieron formular preguntas que no solo dieran cuenta de la semántica histórica sino que además, como lo plantean en la introducción, indagan por las experiencias que alimentaron los sentidos dados a un concepto y las expectativas que despertaron entre quienes lo usaron. Los conceptos a trabajar fueron escogidos, entendiendo que tenían esa calidad precisamente por haber estado en el centro de los debates por el sentido y el significado de los acontecimientos; porque fue con esos conceptos que los contemporáneos reflexionaron y elaboraron las experiencias vividas.
Directory of Open Access Journals (Sweden)
Juana Irma Manzano Banda
2014-07-01
Full Text Available Se evaluó el efecto de la aplicación de estiércol bovino, yeso, ácido sulfúrico y lavado de suelos sobre la concentración de sales solubles y proporción de sodio en dos suelos salino-sódicos, provenientes del Distrito de Riego 086 de Jiménez, Tamaulipas, México. Se utilizaron macetas con 6 kg de suelo bajo condiciones de invernadero para ensayar dos niveles de salinidad-sodicidad (suelo Carretas con nivel moderado y suelo Macahuistle con nivel alto, dos mejoradores inorgánicos (yeso y ácido sulfúrico y un mejorador orgánico (estiércol. Se utilizó un diseño experimental completamente al azar con arreglo factorial 2 × 2 × 3. Las variables de respuesta fueron conductividad eléctrica (CE, porciento de sodio intercambiable (PSI y pH. La salinidad inicial en el suelo Carretas, con CE = 7.75 dS m-1 y Macahuistle con CE = 22.2 dS m-1, disminuyó a menos de 4 dS m-1. El PSI inicial del suelo Carretas fue 18.4 y el del suelo Macahuistle 34, valores que se abatieron a niveles menores de 8. El pH inicial de 7.8 en el suelo Carretas y 8 en el suelo Macahuistle, disminuyeron a un valor de 7.4 con la aplicación de estiércol y ácido sulfúrico. El lavado redujo la salinidad y sodicidad de ambos suelos hasta niveles satisfactorios para cultivos convencionales, con y sin de la aplicación de estiércol bovino, yeso y ácido sulfúrico.
Traditional and non-traditional educational outcomes : Trade-off or complementarity?
van der Wal, Marieke; Waslander, Sietske
2007-01-01
Recently, schools have increasingly been charged with enhancing non-traditional academic competencies, in addition to traditional academic competencies. This article raises the question whether schools can implement these new educational goals in their curricula and simultaneously realise the
Song, Peipei; Xia, Jufeng; Rezeng, Caidan; Tong, Li; Tang, Wei
2016-07-19
As a form of traditional, complementary, and alternative medicine (TCAM), traditional Tibetan medicine has developed into a mainstay of medical care in Tibet and has spread from there to China and then to the rest of the world. Thus far, research on traditional Tibetan medicine has focused on the study of the plant and animal sources of traditional medicines, study of the histology of those plants and animals, chemical analysis of traditional medicines, pharmacological study of those medicines, and evaluation of the clinical efficacy of those medicines. A number of papers on traditional Tibetan medicines have been published, providing some evidence of the efficacy of traditional Tibetan medicine. However, many traditional Tibetan medicines have unknown active ingredients, hampering the establishment of drug quality standards, the development of new medicines, commercial production of medicines, and market availability of those medicines. Traditional Tibetan medicine must take several steps to modernize and spread to the rest of the world: the pharmacodynamics of traditional Tibetan medicines need to be determined, the clinical efficacy of those medicines needs to be verified, criteria to evaluate the efficacy of those medicines need to be established in order to guide their clinical use, and efficacious medicines need to be acknowledged by the pharmaceutical market. The components of traditional Tibetan medicine should be studied, traditional Tibetan medicines should be screened for their active ingredients, and techniques should be devised to prepare and manufacture those medicines.
La Seguridad Integral: España 2020
Pardo Buendía, Mercedes
2009-01-01
Dirección y co-redacción principal: Óscar Jaime Jiménez, Antonio M. Díaz Fernández. Expertos que han participado en la elaboración: Rogelio Alonso Pascual, Félix Arteaga Martín, Pedro Arrojo Agudo, Rut Bermejo Casado, Julio Bordas Martínez, Lorenzo Castro Moral, Andrés García Gómez, Raúl C. Mainar-Jaime, Rafael Martínez Martínez, Miguel Ángel Muñoz Rodríguez, Mercedes Pardo Buendía, René Pita Pita, Gonzalo Sáenz de Miera, Fernando Soteras Escartín, Diego Torrente Robles, F...
Energy Technology Data Exchange (ETDEWEB)
Cleary, Peter; Kucera, Paul; Blenden, Michael
2003-12-01
This report summarizes the emigration studies of the Nez Perce Tribe in the Imnaha River subbasin during the 2001 and 2002 migration years. A migration year for the Imnaha River is defined here as beginning July 31 of the previous year and ending July 30 the following year. The conclusion of the studies at the end of migration year 2002 marked the 11th year of the Nez Perce Tribe's Lower Snake River Emigration Studies. The Nez Perce Tribe has participated in the Fish Passage Center's Smolt Monitoring Program for nine of the 11 years. These studies collect and tag juvenile chinook salmon and steelhead at two locations in the fall, rkm 74 and rkm 7, and at rkm 7 during the spring. Data from captured and tagged fish provide an evaluation of hatchery production and releases strategies, post release survival of hatchery chinook salmon, abundance of natural chinook salmon, and downstream survival and arrival timing of natural and hatchery chinook salmon and steelhead. The hydrologic conditions that migrating fish encountered in 2001 were characterized as a drought and conditions in 2002 were characterized as below average. Hatchery chinook salmon had a mean fork length that was 34 mm greater in 2001 and 35 mm greater in 2002 than the mean fork length of natural chinook smolts. Hatchery steelhead smolt mean fork lengths were 39 mm greater than natural steelhead smolts in 2001 and 44 mm greater than natural steelhead smolt fork lengths in 2002. A significant difference (p < 0.05) between hatchery and natural chinook salmon and steelhead fork lengths has been documented by these emigration studies from 1997 to 2002. Hatchery chinook salmon were volitionally released in 2001 and 2002 and the 90% arrivals for 2001 and 2002 at the lower rkm 7 trap were within the range of past observations of 22 to 38 days observed in 1999 and 2000. We estimated that 93.9% of the 123,014 hatchery chinook salmon released in 2001 survived to the lower trap and 90.2% of the 303
Testing Algorithmic Skills in Traditional and Non-Traditional Programming Environments
Csernoch, Mária; Biró, Piroska; Máth, János; Abari, Kálmán
2015-01-01
The Testing Algorithmic and Application Skills (TAaAS) project was launched in the 2011/2012 academic year to test first year students of Informatics, focusing on their algorithmic skills in traditional and non-traditional programming environments, and on the transference of their knowledge of Informatics from secondary to tertiary education. The…
Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez.
Directory of Open Access Journals (Sweden)
Francisco José Rodríguez Marín
2013-01-01
Full Text Available Revistas UMA Encabezado de página Usuaria/o Contraseña No cerrar sesión Notificaciones Vista Suscribirse Idioma Contenidos Examinar Por número Por autor/a Por título Otras revistas Información Para lectores/as Para autores/as Para bibliotecarios/as Open Journal Systems Inicio Acerca de Actual Archivos Avisos Inicio > Núm. 34 (2013 > Rodríguez Marín Lo necrológico en la producción científica de la Dra. Rosario Camacho Martínez. Francisco José Rodríguez Marín Resumen Ver Resumen El interés de Rosario Camacho por la multiplicidad de mensajes y la cultura simbólica de carácter funerario fue, inicialmente, una consecuencia natural de sus investigaciones sobre la arquitectura barroca. En uno de sus libros más reconocidos, Málaga barroca. Arquitectura religiosa de los siglos XVII y XVIII (1981 analizó el panteón de los condes de Buenavista en la iglesia del monasterio de la Victoria y su impresionante conjunto de relieves y esculturas en torno a la muerte, recogiendo algunas de las interpretaciones que hasta entonces se habían realizado, como las de Juan Temboury o Santiago Sebastián. El carácter excepcional del conjunto arquitectónico de la iglesia, el monasterio, y especialmente, de la rica y original superposición de espacios verticales integrado por el mencionado panteón, la sacristía y el camarín de la Virgen, justifican la atención pormenorizada que se le prestó en una de las carpetas que, incluyendo planimetría y dedicadas al Barroco, fueron publicadas por el Colegio de Arquitectos de Málaga. La titulada El Santuario de la Victoria de Málaga (1986 tuvo por autores a Rosario Camacho y al arquitecto José María Romero.
Directory of Open Access Journals (Sweden)
Rooel Campos-Rodríguez
2013-06-01
Full Text Available Los procesos productivos no son totalmente eficientes, lo cual contribuye a la generación de residuos. En Costa Rica, son las municipalidades las responsables del manejo integral de los residuos sólidos. Es por eso que la problemática de esta investigación se centra en el manejo de tales desechos, que se ha convertido en uno de los principales problemas ambientales que enfrentan los municipios del país. Es necesario hacerle frente desde la perspectiva del desarrollo sostenible, para lo cual se requiere una nueva visión y sensibilización de los gobiernos locales y de los habitantes ante esta problemática. Un ejemplo de cómo encarar la problemática ambiental es la labor que están desarrollando los municipios de Jiménez y Oreamuno. Estas dos instituciones han trabajado en aspectos de educación ambiental, desarrollo y sostenibilidad y han logrado resultados favorables en el tratamiento y disposición adecuada de los residuos sólidos. El municipio de Oreamuno cuenta con un plan de manejo integral de residuos sólidos, tanto orgánicos como inorgánicos. También tiene un centro de acopio y se está trabajando en la implementación de biorreactores que permitirán la producción de bioabonos, captación de gas metano, remoción de metales en los lixiviados, así como la recuperación, comercialización y transformación de los residuos reciclables y reutilizables. Por su parte, el municipio de Jiménez realiza un manejo adecuado de los residuos; los desechos inorgánicos reciclables son aprovechados por medio del centro de acopio del cantón y los residuos orgánicos son transformados en abono orgánico, el cual se utiliza en las fincas de la localidad. El objetivo de este artículo es analizar estos planteamientos, así como su relación con el desarrollo y la sostenibilidad.Currently, the production processes are not efficient, which contributes to the generation of waste. In Costa Rica the municipalities are responsible for
Directory of Open Access Journals (Sweden)
Navarrete Prieto, Benito
2005-09-01
Full Text Available Three drawings of altarpieces executed by the Sevillian sculptor Juan Martinez Montañés, preserved in the copy of Vignola's architectural treatise in the Colegio de Arquitectos de Valencia are analyzed here. The first drawing is a preliminary study for the altarpiece of the Immaculate Conception in the Parrochial Church of El Pedroso (Seville. The second drawing, also a preliminary idea, is for the lost altarpiece of the Dominican monastery of Portacelli in Seville, from which only the figure of St Dominic of Guzman flagellating himself has survived (Museo de Bellas Artes de Sevilla. The third is the model for the type of altarpiece-tabernacle used by Montañés in the Convent of Santa Clara (Seville. The author also points out the origin of certain elements of Montañés's designs in the prints of Vignola's treatise.
Presentamos un análisis de tres de los dibujos de retablos que se conservan en el ejemplar del Vignola del Colegio de Arquitectos de Valencia y que pertenecen al escultor sevillano Juan Martínez Montañés. El primero de ellos es preparatorio para el retablo de la Inmaculada de la iglesia parroquial del Pedroso (Sevilla, conservado in situ actualmente. El segundo es para el perdido Retablo de los dominicos de Portacoeli de Sevilla, del que se conserva el Santo Domingo de Guzman azotándose en el Museo de Bellas Artes de Sevilla, y el tercero es modelo para la tipología del Montañés del Retablo-Tabernáculo en la iglesia del convento de Santa Clara de Sevilla, estudiándose además el origen de algunos elementos de Montañés en los propios grabados del libro de Vignola.
Jorissen, A.J.M.; Hamer, den J.; Leijten, A.J.M.; Salenikovich, A.
2014-01-01
Due to new possibilities traditional timber framing has become increasingly popular since the beginning of the 21e century. Although traditional timber framing has been used for centuries, the expected mechanical behaviour is not dealt with in great detail in building codes, guidelines or text
Nyika, Aceme
2009-11-01
The disease burden in Africa, which is relatively very large compared with developed countries, has been attributed to various factors that include poverty, food shortages, inadequate access to health care and unaffordability of Western medicines to the majority of African populations. Although for 'old diseases' knowledge about the right African traditional medicines to treat or cure the diseases has been passed from generation to generation, knowledge about traditional medicines to treat newly emerging diseases has to be generated in one way or another. In addition, the existing traditional medicines have to be continuously improved, which is also the case with Western scientific medicines. Whereas one school of thought supports the idea of improving medicines, be they traditional or Western, through scientific research, an opposing school of thought argues that subjecting African traditional medicines to scientific research would be tantamount to some form of colonization and imperialism. This paper argues that continuing to use African traditional medicines for old and new diseases without making concerted efforts to improve their efficacy and safety is unethical since the disease burden affecting Africa may continue to rise in spite of the availability and accessibility of the traditional medicines. Most importantly, the paper commends efforts being made in some African countries to improve African traditional medicine through a combination of different mechanisms that include the controversial approach of scientific research on traditional medicines.
Between tradition and renewal: Some considerations about the use of tradition in reformed theology
Directory of Open Access Journals (Sweden)
Willem van Vlastuin
2013-08-01
Full Text Available In the theology and practice of the Christian church a tension between tradition and renewal exists. This essay focuses on this tension to provide a first step of methodological reflection to deal with it. Firstly, this tension is illustrated from the reformed perspective of sola scripturathat led to criticism of the tradition on the one hand, whilst understanding the reformed movement as part of the tradition on the other hand. A danger of unqualified sola scriptura is subjectivity. Subsequently, the importance of tradition is elaborated from the perspective of the church as the body of Christ across all ages. This implies that Christians should study and love the traditional theology because of the fundamental unity of the church that transcends cultural diversity. Rejecting tradition will cut the church from its historical and spiritual roots. Thirdly, this raises the question whether the church is imprisoned by tradition, as well as the problem of the relation between tradition and renewal. In response, it is argued that the doctrine of incarnation guarantees openness to history. With the help of the philosophical and Christian view on structural contingency, the belief that tradition is principally open to renewal is defended. Some examples are given as illustrations of how classic theological concepts can be reframed in our postmodern context. The last part of this essay concludes with the insight of Cyprian that only the conveyed tradition can be renewed, implying that renewal is in essence not a new theology, but a new application of apostolic theology.
Traditional Medicine in Developing Countries
DEFF Research Database (Denmark)
Thorsen, Rikke Stamp
or spiritual healer and self-treatment with herbal medicine or medicinal plants. Reliance on traditional medicine varies between countries and rural and urban areas, but is reported to be as high as 80% in some developing countries. Increased realization of the continued importance of traditional medicine has......People use traditional medicine to meet their health care needs in developing countries and medical pluralism persists worldwide despite increased access to allopathic medicine. Traditional medicine includes a variety of treatment opportunities, among others, consultation with a traditional healer...... led to the formulation of policies on the integration of traditional medicine into public health care. Local level integration is already taking place as people use multiple treatments when experiencing illness. Research on local level use of traditional medicine for health care, in particular the use...
Spatially correlated heterogeneous aspirations to enhance network reciprocity
Tanimoto, Jun; Nakata, Makoto; Hagishima, Aya; Ikegaya, Naoki
2012-02-01
Perc & Wang demonstrated that aspiring to be the fittest under conditions of pairwise strategy updating enhances network reciprocity in structured populations playing 2×2 Prisoner's Dilemma games (Z. Wang, M. Perc, Aspiring to the fittest and promoted of cooperation in the Prisoner's Dilemma game, Physical Review E 82 (2010) 021115; M. Perc, Z. Wang, Heterogeneous aspiration promotes cooperation in the Prisoner's Dilemma game, PLOS one 5 (12) (2010) e15117). Through numerical simulations, this paper shows that network reciprocity is even greater if heterogeneous aspirations are imposed. We also suggest why heterogeneous aspiration fosters network reciprocity. It distributes strategy updating speed among agents in a manner that fortifies the initially allocated cooperators' clusters against invasion. This finding prompted us to further enhance the usual heterogeneous aspiration cases for heterogeneous network topologies. We find that a negative correlation between degree and aspiration level does extend cooperation among heterogeneously structured agents.
Revisiting mouse peritoneal macrophages: heterogeneity, development and function
Directory of Open Access Journals (Sweden)
Alexandra Dos Anjos Cassado
2015-05-01
Full Text Available Tissue macrophages play a crucial role in the maintenance of tissue homeostasis and also contribute to inflammatory and reparatory responses during pathogenic infection and tissue injury. The high heterogeneity of these macrophages is consistent with their adaptation to distinct tissue environments and specialization to develop niche-specific functions. Although peritoneal macrophages are one of best-studied macrophage populations, only recently it was demonstrated the co-existence of two subsets in mouse PerC, which exhibit distinct phenotypes, functions and origins. These macrophage subsets have been classified according to their morphology as LPMs (large peritoneal macrophages and SPMs (small peritoneal macrophages. LPMs, the most abundant subset under steady-state conditions, express high levels of F4/80 and low levels of class II molecules of the major histocompatibility complex (MHC. LPMs appear to be originated from embriogenic precursors, and their maintenance in PerC is regulated by expression of specific transcription factors and tissue-derived signals. Conversely, SPMs, a minor subset in unstimulated PerC, have a F4/80lowMHC-IIhigh phenotype and are generated from bone-marrow-derived myeloid precursors. In response to infectious or inflammatory stimuli, the cellular composition of PerC is dramatically altered, where LPMs disappear and SPMs become the prevalent population together with their precursor, the inflammatory monocyte. SPMs appear to be the major source of inflammatory mediators in PerC during infection whereas LPMs contribute for gut-associated lymphoid tissue (GALT-independent and retinoic acid-dependent IgA production by peritoneal B-1 cells. In the last years, considerable efforts have been made to broaden our understanding of LPM and SPM origin, transcriptional regulation and functional profile. This review addresses these issues, focusing on the impact of tissue-derived signals and external stimulation in the complex
Aportaciones a la flora Granatense, III
Martínez Parras, J.Mª.; Molero Mesa, J.
1983-01-01
Se comentan algunas especies nuevas o críticas para la provincia de Granada. Se establecen las nuevas combinaciones siguientes: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa y Cerastium alpinum subsp. nevadense (Pau) Martínez Parras & Molero Mesa. In this paper, some plants from Granada province are studied. The following new combinations are stablished: Cerastium alpinum subsp. aquaticum (Boiss.) Martínez Parras & Molero Mesa and Cerastium alpinum subsp. ...
Raja Ikram, Raja Rina; Abd Ghani, Mohd Khanapi; Abdullah, Noraswaliza
2015-11-01
This paper shall first investigate the informatics areas and applications of the four Traditional Medicine systems - Traditional Chinese Medicine (TCM), Ayurveda, Traditional Arabic and Islamic Medicine and Traditional Malay Medicine. Then, this paper shall examine the national informatics infrastructure initiatives in the four respective countries that support the Traditional Medicine systems. Challenges of implementing informatics in Traditional Medicine Systems shall also be discussed. The literature was sourced from four databases: Ebsco Host, IEEE Explore, Proquest and Google scholar. The search term used was "Traditional Medicine", "informatics", "informatics infrastructure", "traditional Chinese medicine", "Ayurveda", "traditional Arabic and Islamic medicine", and "traditional malay medicine". A combination of the search terms above was also executed to enhance the searching process. A search was also conducted in Google to identify miscellaneous books, publications, and organization websites using the same terms. Amongst major advancements in TCM and Ayurveda are bioinformatics, development of Traditional Medicine databases for decision system support, data mining and image processing. Traditional Chinese Medicine differentiates itself from other Traditional Medicine systems with documented ISO Standards to support the standardization of TCM. Informatics applications in Traditional Arabic and Islamic Medicine are mostly ehealth applications that focus more on spiritual healing, Islamic obligations and prophetic traditions. Literature regarding development of health informatics to support Traditional Malay Medicine is still insufficient. Major informatics infrastructure that is common in China and India are automated insurance payment systems for Traditional Medicine treatment. National informatics infrastructure in Middle East and Malaysia mainly cater for modern medicine. Other infrastructure such as telemedicine and hospital information systems focus its
Directory of Open Access Journals (Sweden)
Iván Pérez-Santos
2013-03-01
Full Text Available Con un microperfilador SCAMP (Self Contained Autonomous MicroProfile se detectó un proceso de Doble Difusión Convectiva (DDC, en los canales Martínez y Baker de la Patagonia central, Chile. Este perfilador midió temperatura y salinidad en la columna de agua con una resolución del orden de milímetros. El muestreo se efectuó en diciembre 2011, en 19 estaciones oceanográficas de ~55 m de profundidad. Los registros del microperfilador permitieron detectar la formación de escaleras termohalinas que caracterizan la formación de la DDC. Por medio del ángulo de Turner se confirmó que debajo de una capa superficial fuertemente estratificada (7-10 m se registraron eventos de DDC a profundidades entre 15 y 45 m. La DDC fue débil en la mayoría de los registros pero se evidenciaron eventos fuertes entre 15 y 40 m. En la capa subsuperficial, su origen se debió al intercalamiento de las masas aguas estuarinas (aguas frías y menos saladas encima de las oceánicas (aguas más cálidas y saladas, mientras que en la superficie la interacción océano-atmósfera favoreció su ocurrencia. La DDC en conjunto con el viento, las mareas y las ondas internas, puede constituir un mecanismo importante para la mezcla vertical, influenciando los flujos de calor, el hábitat de las especies marinas en estas profundidades y la exportación de carbono hacia los sedimentos.
From medical tradition to traditional medicine: A Tibetan formula in the European framework.
Schwabl, Herbert; Vennos, Cécile
2015-06-05
The increasing prevalence of complex multi-factorial chronic diseases and multimorbidity reveals the need for an enlargement of the therapeutic options. Potent multicompound herbal formulations from traditional medicine systems such as Tibetan Medicine might meet the requirements. With its practice over the centuries Tibetan Medicine is one of the important medical heritages of the world. In the 20th century Tibetan formulas came to Switzerland, where the formula Gabur-25 was then registered as medicine in 1977 (Padma 28, Swissmedic No 35872). The new European directive 2004/24/EC opened the avenue for traditional herbal medicinal products and registrations followed in Austria (HERB-00037) and the UK (39568/0001). The aim of this review was to analyse not only the critical points and hazards but also chances that occur in the endeavour of bringing a ethnopharmacological based preparation to the market within a modern Western medical and regulatory framework and to discuss the necessary transformation steps from a traditional herbal formula towards a modern pharmaceutical product with the example of the Tibetan formula Gabur-25. The historic transformation process from the 19th to the 21st century is analysed, using the registration documents and other material from the library of Padma AG, Hinwil, Switzerland. The transformation of a traditional formula into a modern traditional herbal medicinal product according to the present EU regulations is a multi faceted process. The modern indication represents only a small part of the possible traditional indications. Quality and product labelling has to be adopted to modern standards. The formula, once registered, is a fixed combination of herbal and mineral ingredients. Contrary to this the concept of Asian medical tradition allows a certain flexibility in the composition of an herbal formula. The ingredients are constantly adapted to local conditions, availability of raw material and therapeutic situation. The example
García-Ramos, Amador; González-Hernández, Jorge M; Baños-Pelegrín, Ezequiel; Castaño-Zambudio, Adrián; Capelo-Ramírez, Fernando; Boullosa, Daniel; Haff, Guy G; Jiménez-Reyes, Pedro
2017-10-20
García-Ramos, A, González-Hernández, JM, Baños-Pelegrín, E, Castaño-Zambudio, A, Capelo-Ramírez, F, Boullosa, D, Haff, GG, and Jiménez-Reyes, P. Mechanical and metabolic responses to traditional and cluster set configurations in the bench press exercise. J Strength Cond Res XX(X): 000-000, 2017-This study aimed to compare mechanical and metabolic responses between traditional (TR) and cluster (CL) set configurations in the bench press exercise. In a counterbalanced randomized order, 10 men were tested with the following protocols (sets × repetitions [inter-repetition rest]): TR1: 3 × 10 (0-second), TR2: 6 × 5 (0-second), CL5: 3 × 10 (5-second), CL10: 3 × 10 (10-second), and CL15: 3 × 10 (15-second). The number of repetitions (30), interset rest (5 minutes), and resistance applied (10 repetition maximum) were the same for all set configurations. Movement velocity and blood lactate concentration were used to assess the mechanical and metabolic responses, respectively. The comparison of the first and last set of the training session revealed a significant decrease in movement velocity for TR1 (Effect size [ES]: -0.92), CL10 (ES: -0.85), and CL15 (ES: -1.08) (but not for TR2 [ES: -0.38] and CL5 [ES: -0.37]); while blood lactate concentration was significantly increased for TR1 (ES: 1.11), TR2 (ES: 0.90), and CL5 (ES: 1.12) (but not for CL10 [ES: 0.03] and CL15 [ES: -0.43]). Based on velocity loss, set configurations were ranked as follows: TR1 (-39.3 ± 7.3%) > CL5 (-20.2 ± 14.7%) > CL10 (-12.9 ± 4.9%), TR2 (-10.3 ± 5.3%), and CL15 (-10.0 ± 2.3%). The set configurations were ranked as follows based on the lactate concentration: TR1 (7.9 ± 1.1 mmol·L) > CL5 (5.8 ± 0.9 mmol·L) > TR2 (4.2 ± 0.7 mmol·L) > CL10 (3.5 ± 0.4 mmol·L) and CL15 (3.4 ± 0.7 mmol·L). These results support the use of TR2, CL10, and CL15 for the maintenance of high mechanical outputs, while CL10 and CL15 produce less metabolic stress than TR2.
From event analysis to global lessons: disaster forensics for building resilience
Keating, Adriana; Venkateswaran, Kanmani; Szoenyi, Michael; MacClune, Karen; Mechler, Reinhard
2016-07-01
With unprecedented growth in disaster risk, there is an urgent need for enhanced learning and understanding of disasters, particularly in relation to the trends in drivers of increasing risk. Building on the disaster forensics field, we introduce the post-event review capability (PERC) methodology for systematically and holistically analysing disaster events, and identifying actionable recommendations. PERC responds to a need for learning about the successes and failures in disaster risk management and resilience, and uncovers the underlying drivers of increasing risk. We draw generalisable insights identified from seven applications of the methodology to date, where we find that across the globe policy makers and practitioners in disaster risk management face strikingly similar challenges despite variations in context, indicating encouraging potential for mutual learning. These lessons highlight the importance of integrated risk reduction strategies. We invite others to utilise the freely available PERC approach and contribute to building a repository of learning on disaster risk management and resilience.
Thomae, M.; Houston, Diane
2016-01-01
Two studies examine preferences for a long-term partner who conforms to traditional or non- traditional gender\\ud roles. The studies both demonstrate a link between benevolent sexism and preference for a traditional partner.\\ud However, Study 1 also demonstrates a strong preference among women for a non-traditional partner. We measured\\ud ambivalent sexist ideologies before introducing participants to either a stereotypically traditional or stereotypically non-traditional character of the opp...
A Novel Role for C5a in B-1 Cell Homeostasis
Directory of Open Access Journals (Sweden)
Katharina Bröker
2018-02-01
Full Text Available B-1 cells constitute a unique subpopulation of lymphocytes residing mainly in body cavities like the peritoneal cavity (PerC but are also found in spleen and bone marrow (BM. As innate-like B cells, they mediate first line immune defense through low-affinity natural IgM (nIgM antibodies. PerC B-1 cells can egress to the spleen and differentiate into nIgM antibody-secreting plasma cells that recognize conserved exogenous and endogenous cellular structures. Homing to and homeostasis within the PerC are regulated by the chemokine CXCL13 released by PerC macrophages and stroma cells. However, the exact mechanisms underlying the regulation of CXCL13 and B-1 homeostasis are not fully explored. B-1 cells play important roles in the inflammatory response to infection, autoimmunity, ischemia/reperfusion injury, obesity, and atherosclerosis. Remarkably, this list of inflammatory entities has a strong overlap with diseases that are regulated by complement suggesting a link between B-1 cells and the complement system. Interestingly, up to now, no data exist regarding the role of complement in B-1 cell biology. Here, we demonstrate for the first time that C5a regulates B-1 cell steady-state dynamics within the peritoneum, the spleen, and the BM. We found decreased B-1a cell numbers in the peritoneum and the spleen of C5aR1−/− mice associated with increased B1-a and B1-b numbers in the spleen and high serum titers of nIgM antibodies directed against phosphorylcholine and several pneumococcal polysaccharides. Similarly, peritoneal B-1a cells were decreased in the peritoneum and splenic B-1a and B-1b cells were increased in C5aR2−/− mice. The decrease in peritoneal B-1 cell numbers was associated with decreased peritoneal CXCL13 levels in C5aR1−/− and C5aR2−/− mice. In search for mechanisms, we found that combined TLR2 and IL-10 receptor activation in PerC macrophages induced strong CXCL13 production, which was significantly reduced in cells
Directory of Open Access Journals (Sweden)
Mederos Martín, Alfredo
2014-12-01
, Claudio Sanchez-Albornoz. Menghin was not permitted to give lectures until 1953, and only consolidated his position when his criminal trial was cancelled in December 1956. In 1957 at the age of 69, he obtained the position of Acting Professor of Prehistory at the National University of La Plata. In 1958, Menghin was appointed Professor in General and Old World Prehistory at the University of Buenos Aires, where he retired in 1968, aged 80.Oswald Menghin, Catedrático de Prehistoria del Hombre de la Universidad de Viena entre 1922-1945, fue partidario de la unidad de Austria con Alemania y simpatizante con ideas del NSDAP sobre la necesidad de evitar una mezcla racial entre arios y judíos. Durante su etapa como Catedrático-Residente en la Universidad de Fouad en El Cairo entre 1930-1933, por contacto con Hermann Junker, radicalizó sus puntos de vista y redactó su libro Espíritu y sangre. Principios básicos de raza, lengua, cultura y nación. Su etapa como Rector en el curso 1935-1936 le catapultó a la política como miembro del consejo directivo del partido fascista austriaco, Vaterländische Front, entre 1936-1937 y su posterior nombramiento como Ministro de Educación entre marzo y mayo de 1938, justo después de la invasión de Hitler de Austria. Siendo Ministro, solicitó su ingreso en el NSDAP, que no se aceptó hasta junio de 1940, por su pertenencia previa a organizaciones católicas secretas. Menghin entró en contacto con Martínez Santa-Olalla, después de la celebración del Jubileo del Instituto de Morfología Cultural de Frankfurt en junio y julio de 1938. A raíz de una estancia de investigación de Almagro Basch en Alemania y Austria en enero y febrero de 1942, y la posterior visita a Barcelona de Menghin en junio de 1942, optó por distanciarse de Martínez Santa-Olalla, no visitando Madrid, cortando la relación epistolar e informando negativamente sobre él a las SS-Ahnenerbe. Prisionero en dos campos de concentración norteamericanos entre mayo de
Traditional Chinese Biotechnology
Xu, Yan; Wang, Dong; Fan, Wen Lai; Mu, Xiao Qing; Chen, Jian
The earliest industrial biotechnology originated in ancient China and developed into a vibrant industry in traditional Chinese liquor, rice wine, soy sauce, and vinegar. It is now a significant component of the Chinese economy valued annually at about 150 billion RMB. Although the production methods had existed and remained basically unchanged for centuries, modern developments in biotechnology and related fields in the last decades have greatly impacted on these industries and led to numerous technological innovations. In this chapter, the main biochemical processes and related technological innovations in traditional Chinese biotechnology are illustrated with recent advances in functional microbiology, microbial ecology, solid-state fermentation, enzymology, chemistry of impact flavor compounds, and improvements made to relevant traditional industrial facilities. Recent biotechnological advances in making Chinese liquor, rice wine, soy sauce, and vinegar are reviewed.
Unveiling Cebuano Traditional Healing Practices
Directory of Open Access Journals (Sweden)
ZachiaRaiza Joy S. Berdon
2016-02-01
Full Text Available This study aims to identify the features of Cebuano’s traditional healing practices. Specifically, it also answers the following objectives: analyze traditional healing in Cebuano’s perspectives, explain the traditional healing process practiced in terms of the traditional healers’ belief, and extrapolate perceptions of medical practitioners toward traditional healing. This study made use of qualitative approach, among five traditional healers who performed healing for not less than ten years, in the mountain barangays of Cebu City. These healers served as the primary informants who were selected because of their popularity in healing. The use of open-ended interview in local dialect and naturalistic observation provided a free listing of their verbatim accounts were noted and as primary narratives. Participation in the study was voluntary and participants were interviewed privately after obtaining their consent. The Cebuano traditional healing practices or “panambal” comprise the use of “himolso” (pulse-checking, “palakaw” (petition, “pasubay” (determining what causes the sickness and its possible means of healing, “pangalap” (searching of medicinal plants for “palina” (fumigation, “tayhop” (gentle-blowing, “tutho” (saliva-blowing,“tuob” (boiling, “orasyon” (mystical prayers, “hilot” (massage, and “barang” (sorcery. Though traditional with medical science disapproval, it contributes to a mystical identity of Cebuano healers, as a manifestation of folk Catholicism belief, in order to do a good legacy to the community that needs help. For further study, researchers may conduct further the studies on the: curative effects of medicinal plants in Cebu, psychological effect pulsechecking healed persons by the mananambal, and unmasking the other features of traditional healing.
Brändle, Tobias; Häuberer, Julia
2015-01-01
Social capital is of particular value for the acquisition of education. Not only does it prevent scholars from dropping out but it improves the educational achievement. The paper focuses on access to social resources by traditional and non-traditional students at a German university and asks if there are group differences considering this…
Traditional medicine and genomics.
Joshi, Kalpana; Ghodke, Yogita; Shintre, Pooja
2010-01-01
'Omics' developments in the form of genomics, proteomics and metabolomics have increased the impetus of traditional medicine research. Studies exploring the genomic, proteomic and metabolomic basis of human constitutional types based on Ayurveda and other systems of oriental medicine are becoming popular. Such studies remain important to developing better understanding of human variations and individual differences. Countries like India, Korea, China and Japan are investing in research on evidence-based traditional medicines and scientific validation of fundamental principles. This review provides an account of studies addressing relationships between traditional medicine and genomics.
Lessons Learned from Creating the Public Earthquake Resource Center at CERI
Patterson, G. L.; Michelle, D.; Johnston, A.
2004-12-01
The Center for Earthquake Research and Information (CERI) at the University of Memphis opened the Public Earthquake Resource Center (PERC) in May 2004. The PERC is an interactive display area that was designed to increase awareness of seismology, Earth Science, earthquake hazards, and earthquake engineering among the general public and K-12 teachers and students. Funding for the PERC is provided by the US Geological Survey, The NSF-funded Mid America Earthquake Center, and the University of Memphis, with input from the Incorporated Research Institutions for Seismology. Additional space at the facility houses local offices of the US Geological Survey. PERC exhibits are housed in a remodeled residential structure at CERI that was donated by the University of Memphis and the State of Tennessee. Exhibits were designed and built by CERI and US Geological Survey staff and faculty with the help of experienced museum display subcontractors. The 600 square foot display area interactively introduces the basic concepts of seismology, real-time seismic information, seismic network operations, paleoseismology, building response, and historical earthquakes. Display components include three 22" flat screen monitors, a touch sensitive monitor, 3 helicorder elements, oscilloscope, AS-1 seismometer, life-sized liquefaction trench, liquefaction shake table, and building response shake table. All displays include custom graphics, text, and handouts. The PERC website at www.ceri.memphis.edu/perc also provides useful information such as tour scheduling, ask a geologist, links to other institutions, and will soon include a virtual tour of the facility. Special consideration was given to address State science standards for teaching and learning in the design of the displays and handouts. We feel this consideration is pivotal to the success of any grass roots Earth Science education and outreach program and represents a valuable lesson that has been learned at CERI over the last several
Traditional games in primary school curriculum
Popeska, Biljana; Jovanova-Mitkovska, Snezana
2017-01-01
Traditional games are cultural and national heritage. They, cultural and traditional activities transmitted from one generation to another, sharing different movement and cognitive games used in order to educate, to socialize, to share the experience and to influence toward development of young generation. The people create traditional games, and they represent the habits, culture and tradition of countries, region or even a town or village. There are lot of different traditional games. They ...
TRADITIONAL CHINESE HERBAL MEDICINE
ZHU, YP; WOERDENBAG, HJ
1995-01-01
Herbal medicine, acupuncture and moxibustion, and massage and the three major constituent parts of traditional Chinese medicine. Although acupuncture is well known in many Western countries, Chinese herbal medicine, the mos important part of traditional Chinese medicine, is less well known in the
Traditional medicine and genomics
Directory of Open Access Journals (Sweden)
Kalpana Joshi
2010-01-01
Full Text Available ′Omics′ developments in the form of genomics, proteomics and metabolomics have increased the impetus of traditional medicine research. Studies exploring the genomic, proteomic and metabolomic basis of human constitutional types based on Ayurveda and other systems of oriental medicine are becoming popular. Such studies remain important to developing better understanding of human variations and individual differences. Countries like India, Korea, China and Japan are investing in research on evidence-based traditional medicines and scientific validation of fundamental principles. This review provides an account of studies addressing relationships between traditional medicine and genomics.
KASTAMONU TRADITIONAL WOMEN CLOTHES
Directory of Open Access Journals (Sweden)
E.Elhan ÖZUS
2015-08-01
Full Text Available Clothing is a unique dressing style of a community, a period or a profession. In clothing there is social status and difference principle rather than fashion. In this context, the society created a clothing style in line with its own customs, traditions and social structure. One of the features separating societies from each other and indicating their cultural and social classes is the clothing style. As it is known, traditional Turkish clothes reflecting the characteristics of Turkish society is our most beautiful heritage from past to present. From this heritage there are several examples of women's clothes c arried to present. When these examples are examined, it is possible to see the taste, the way of understanding art, joy and the lifestyle of the history. These garments are also the documents outlining the taste and grace of Turkish people. In the present study, traditional Kastamonu women's clothing, that has an important place in traditional cultural clothes of Anatolia, is investigated . The method of the present research is primarily defined as the examination of the written sources. The study is complet ed with the observations and examinations made in Kastamonu. According to the findings of the study, traditional Kastamonu women's clothing are examined and adapted to todays’ clothing.
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
Energy Technology Data Exchange (ETDEWEB)
Ninaber, Maarten K., E-mail: m.k.ninaber@lumc.nl [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Stolk, Jan; Smit, Jasper; Le Roy, Ernest J. [Department of Pulmonology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Kroft, Lucia J.M. [Department of Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Els Bakker, M. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Vries Bouwstra, Jeska K. de; Schouffoer, Anne A. [Department of Rheumatology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands); Staring, Marius; Stoel, Berend C. [Division of Image Processing, Radiology, Leiden University Medical Center, Albinusdreef 2, 2333ZA Leiden (Netherlands)
2015-05-15
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Lung structure and function relation in systemic sclerosis: Application of lung densitometry
International Nuclear Information System (INIS)
Ninaber, Maarten K.; Stolk, Jan; Smit, Jasper; Le Roy, Ernest J.; Kroft, Lucia J.M.; Els Bakker, M.; Vries Bouwstra, Jeska K. de; Schouffoer, Anne A.; Staring, Marius; Stoel, Berend C.
2015-01-01
Highlights: • A quantitative CT parameter of lung parenchyma in systemic sclerosis is presented. • We examine the optimal percentage threshold for the percentile density. • The 85th percentile density threshold correlated significantly with lung function. • A lung structure–function relation is confirmed. • We report applicability of Perc85 in progression mapping of interstitial lung disease. - Abstract: Introduction: Interstitial lung disease occurs frequently in patients with systemic sclerosis (SSc). Quantitative computed tomography (CT) densitometry using the percentile density method may provide a sensitive assessment of lung structure for monitoring parenchymal damage. Therefore, we aimed to evaluate the optimal percentile density score in SSc by quantitative CT densitometry, against pulmonary function. Material and methods: We investigated 41 SSc patients by chest CT scan, spirometry and gas transfer tests. Lung volumes and the nth percentile density (between 1 and 99%) of the entire lungs were calculated from CT histograms. The nth percentile density is defined as the threshold value of densities expressed in Hounsfield units. A prerequisite for an optimal percentage was its correlation with baseline DLCO %predicted. Two patients showed distinct changes in lung function 2 years after baseline. We obtained CT scans from these patients and performed progression analysis. Results: Regression analysis for the relation between DLCO %predicted and the nth percentile density was optimal at 85% (Perc85). There was significant agreement between Perc85 and DLCO %predicted (R = −0.49, P = 0.001) and FVC %predicted (R = −0.64, P < 0.001). Two patients showed a marked change in Perc85 over a 2 year period, but the localization of change differed clearly. Conclusions: We identified Perc85 as optimal lung density parameter, which correlated significantly with DLCO and FVC, confirming a lung parenchymal structure–function relation in SSc. This provides
Frye, Richard E; Sreenivasula, Swapna; Adams, James B
2011-05-18
Despite the high prevalence of seizure, epilepsy and abnormal electroencephalograms in individuals with autism spectrum disorder (ASD), there is little information regarding the relative effectiveness of treatments for seizures in the ASD population. In order to determine the effectiveness of traditional and non-traditional treatments for improving seizures and influencing other clinical factor relevant to ASD, we developed a comprehensive on-line seizure survey. Announcements (by email and websites) by ASD support groups asked parents of children with ASD to complete the on-line surveys. Survey responders choose one of two surveys to complete: a survey about treatments for individuals with ASD and clinical or subclinical seizures or abnormal electroencephalograms, or a control survey for individuals with ASD without clinical or subclinical seizures or abnormal electroencephalograms. Survey responders rated the perceived effect of traditional antiepileptic drug (AED), non-AED seizure treatments and non-traditional ASD treatments on seizures and other clinical factors (sleep, communication, behavior, attention and mood), and listed up to three treatment side effects. Responses were obtained concerning 733 children with seizures and 290 controls. In general, AEDs were perceived to improve seizures but worsened other clinical factors for children with clinical seizure. Valproic acid, lamotrigine, levetiracetam and ethosuximide were perceived to improve seizures the most and worsen other clinical factors the least out of all AEDs in children with clinical seizures. Traditional non-AED seizure and non-traditional treatments, as a group, were perceived to improve other clinical factors and seizures but the perceived improvement in seizures was significantly less than that reported for AEDs. Certain traditional non-AED treatments, particularly the ketogenic diet, were perceived to improve both seizures and other clinical factors.For ASD individuals with reported
Marketing - tool transformation of traditional societies
Directory of Open Access Journals (Sweden)
V. D. Shinkarenko
2013-12-01
Full Text Available The article considers the influence of marketing on the TRANSformation of a traditional society with its traditional values in a society of consumption. The development of capitalism inevitably leads to changes in the sociopolitical order of the whole modern world. This leads to the fact that the disappearance of the traditional elements of culture, crafts, songs and dances, rites, destroyed traditional norms and values, beliefs, moral and ethical values. Instead of the traditional culture is formed by the mass culture, society develops consumption goods and becoming all that you can sell. Marketing is one tool for the formation of a society of consumption, but it also performs other less prominent function transforms the traditional society into a consumer society with its values, mythology, norms and moral principles.
International Nuclear Information System (INIS)
1988-01-01
As part of the process for siting the nation's first geologic repository for radioactive waste, the Department of Energy (DOE) is preparing a site characterization plan for the Hanford site in Benton County, Washington. As a step in the preparation of that plan, the DOE has provided, for information and review, a consultation draft of the plan to the State of Washington, the affected Indian Tribes - the Confederated Tribes of the Umatilla Indian Reservation, the Nez Perce Indian Tribe, and the Yakima Indian Nation - and the US Nuclear Regulatory Commission. The Hanford site is one of three sites that the DOE currently plans to characterize;the other sites are the Deaf Smith County site in Texas and the Yucca Mountain site in Nevada. After site characterization has been completed and its results evaluated, the DOE will identify from among the three characterized sites the site that is preferred for the repository. The overview presented here consists of brief summaries of important topics covered in the consulation draft of the site characterization plan;it is not a substitute for the site characterization plan. The arrangement of the overview is similar to that of the plan itself, with breif descriptions of the dispoal system - the site, the repository, and the waste package - preceding the discussion of the characterization program to be carried out at the Hanford site. It is intended primarily for the management staff of organizations involved in the DOE's repository program or other persons who might wish to understand the general scope of the site-characterization program, the activities to be conducted, and the facilities to be constructed rather than the technical details of site characterization
Energy Technology Data Exchange (ETDEWEB)
Daniel, Mitch; Gebhards, John
2003-05-01
The Nez Perce Tribe, through funding provided by the Bonneville Power Administration, has implemented a small scale chinook salmon supplementation program on Johnson Creek, a tributary in the South Fork of the Salmon River, Idaho. The Johnson Creek Artificial Propagation Enhancement project was established to enhance the number of threatened Snake River summer chinook salmon (Oncorhynchus tshawytscha) returning to Johnson Creek through artificial propagation. Adult chinook salmon collection and spawning began in 1998. A total of 114 fish were collected from Johnson Creek and 54 fish (20 males and 34 females) were retained for Broodstock. All broodstock were transported to Lower Snake River Compensation Plan's South Fork Salmon River adult holding and spawning facility, operated by the Idaho Department of Fish and Game. The remaining 60 fish were released to spawn naturally. An estimated 155,870 eggs from Johnson Creek chinook spawned at the South Fork Salmon River facility were transported to the McCall Fish Hatchery for rearing. Average fecundity for Johnson Creek females was 4,871. Approximately 20,500 eggs from females with high levels of Bacterial Kidney Disease were culled. This, combined with green-egg to eyed-egg survival of 62%, resulted in about 84,000 eyed eggs produced in 1998. Resulting juveniles were reared indoors at the McCall Fish Hatchery in 1999. All of these fish were marked with Coded Wire Tags and Visual Implant Elastomer tags and 8,043 were also PIT tagged. A total of 78,950 smolts were transported from the McCall Fish Hatchery and released directly into Johnson Creek on March 27, 28, 29, and 30, 2000.
Edward F. Millen
2017-01-01
The study of traditional food and healthy eating habits has been one of the fast growing areas. All humans, both men and women, require food for their survival. However, both men and women indulge in food as if it were their sole purpose of existence. Hence, eating disorders are common among men and women. Then media has played an effective role not only in establishing faulty standards for traditional healthy food but also it has highlighted the importance of healthy eating. It has brought t...
Traditional birth attendants in Malawi
Directory of Open Access Journals (Sweden)
J. J. M. Smit
1994-03-01
Full Text Available Traditional Birth Attendants (TBAs and traditional healers form an important link in the chain of health personnel providing primary health care in Malawi. In spite of the establishment of hospitals and health centres, it is to these traditional healers and TBAs that the majority of people turn in times of sickness and child-birth. Approximately 60 percent of all deliveries in Malawi occur in the villages. It is therefore important that due regard be paid to the activities of these traditional practitioners in order to ensure the achievement of the goal - "Health for all by the year 2000". The training of TBAs is seen as part of the Maternal and Child Health Services in the country.
Traditional birth attendants in Malawi
Directory of Open Access Journals (Sweden)
J. J. M. Smit
1994-05-01
Full Text Available Traditional Birth Attendants (TBAs and traditional healers form an important link in the chain of health personnel providing primary health care in Malawi. In spite of the establishment of hospitals and health centres, it is to these traditional healers and TBAs that the majority of people turn in times of sickness and child-birth. Approximately 60 percent of all deliveries in Malawi occur in the villages. It is therefore important that due regard be paid to the activities of these traditional practitioners in order to ensure the achievement of the goal - "Health for all by the year 2000". The training of TBAs is seen as part of the Maternal and Child Health Services in the country.
Evaluation of available MHD seed-regeneration processes on the basis of energy considerations
International Nuclear Information System (INIS)
Sheth, A.C.; Johnson, T.R.
1978-09-01
Of the several processes described in the literature that are capable of separating sulfur from alkali-metal sulfates, seven processes were selected as candidates for regenerating seed material for reuse in open-cycle MHD. After a brief assessment of each process, two were selected for a detailed analysis, namely, a process developed by the Pittsburgh Energy Research Center (PERC) and a modified version of the Tampella process. The processes were compared on the bases of energy requirements and the amount of research work needed to develop a seed-regeneration process for MHD systems. The energy requirements given should be considered as rough values, because factors such as heat losses and component efficiency were not included in the analysis. On the basis of energy consumption, the PERC process has a slight advantage over the Tampella process; on the basis of the present state of development of various components, the Tampella process has a clear advantage. Accordingly, it was recommended that developmental programs be carried out for both the PERC and Tampella processes
Directory of Open Access Journals (Sweden)
Ali Goodarzi
2014-06-01
Full Text Available Traditional Iranian houses have always been recognized as examples of 'good-design' in the context of Iranian Architecture according to many scholars. It is believed that their creation has been influenced by the systems of beliefs in the traditional Iranian society; an established system closely followed in their design process which has led to their phenomenal architectural design. The traditional houses of Kashan are excellent examples of such which have often been described as the finest examples of Traditional Iranian houses. However insufficient documentation of the design process of these architectural masterpieces has led to disputes among scholars in determining the exacct architectural system, behind their creation. The effect therefore is not only the inability in creating houses with the same quality in current architectural societies of Iran, but also their decay due to lack of attention and preservation. Historical studies point towards an influence of Indian Architectural system, Vastu Shastra, on the creation of traditional Iranian houses, which appears to be the earlier practice of house design within the Indo-Aryan communities. Using Vastu Shastra as a framework, the objective is to conduct case studies on 22 traditional houses of Kashan to identify the existence of a similar well-established system in Iran based on which all the traditional houses have been designed, and further to introduce it as the traditional architectural system in Iran. In this way the principles of traditional houses of Kashan can be identified in the light of Vastu Shastra, the traditional Indian wisdom.
Adapted Traditions: The Case of Traditional Palestinian Women Healers in Israel
Directory of Open Access Journals (Sweden)
Ariela Popper-Giveon
2009-02-01
Full Text Available This article examines transformations in the roles and treatment practices of traditional Palestinian women healers in Israel. Comparing narratives of women healers residing in Jewish-Arab mixed cities in central Israel with those of their counterparts in the Bedouin community of the Negev reveals that traditional healing has not disappeared as a result of modernization but rather has transformed. Urban women healers are abandoning treatment of physical problems in favor of addressing life hardships; they distance themselves from problems whose cause and treatment are considered natural and prefer those perceived as derived from supernatural causes and treated through supernatural, magical and religious means. Despite these transformations, traditional Palestinian women healers appear as agents of preservation and conservatism, a role that imbues them with a central position in their community. Hence, their place is currently secured and expected to remain so as processes of modernization and acculturation increase in intensity. URN: urn:nbn:de:0114-fqs0902119
The Living Indian Critical Tradition
Directory of Open Access Journals (Sweden)
Vivek Kumar Dwivedi
2010-11-01
Full Text Available This paper attempts to establish the identity of something that is often considered to be missing – a living Indian critical tradition. I refer to the tradition that arises out of the work of those Indians who write in English. The chief architects of this tradition are Sri Aurobindo, C.D. Narasimhaiah, Gayatri Chakravorty Spivak and Homi K. Bhabha. It is possible to believe that Indian literary theories derive almost solely from ancient Sanskrit poetics. Or, alternatively, one can be concerned about the sad state of affairs regarding Indian literary theories or criticism in English. There have been scholars who have raised the question of the pathetic state of Indian scholarship in English and have even come up with some positive suggestions. But these scholars are those who are ignorant about the living Indian critical tradition. The significance of the Indian critical tradition lies in the fact that it provides the real focus to the Indian critical scene. Without an awareness of this tradition Indian literary scholarship (which is quite a different thing from Indian literary criticism and theory as it does not have the same impact as the latter two do can easily fail to see who the real Indian literary critics and theorists are.
Directory of Open Access Journals (Sweden)
Muhammad Ferri Setiawan
2017-02-01
Full Text Available The policy on tourism development program of Surakarta especially on the calendar of the event takes advantage from religious tradition as tourism commodity. The purpose of this study is to describe the religious tradition haul, the programs by the tourism department of Surakarta, and how commodification through a well implemented marketing communications process, messaging, and other media, as well as responses from the audience regarding the marketing of haul tradition in general toward creating a leading tourism object. Haul which is a tradition for commemorating the death of clerics (ulama who are followed by some local communities in Surakarta, especially those in Pasar Kliwon Regency, is utilized in tourism. Through critical study, the cultural values that are supposed to be preserved, changed into marketing values to attract visitors. The used media are the advertisement and the calendar of events. The local community gain advantages economically from this policy, but they object to it socio-culturally. Meanwhile, the tourists are generally interested in haul tradition.
Study Of Lampungnese Traditional Home Garden Design
Pratiwi, R. A.; Gunawan
2017-10-01
Lampung is one area in Indonesia which has a traditional culture that comes from two groups of descents, they are ulun Lampung Pepadun and ulun Lampung Saibatin. Lampungnese traditional culture has been well-known by Indonesian people for its traditional dances, traditional clothing, or traditional home architecture. However, Lampungnese traditional home garden recently may not yet been described. Information related to Lampungnese traditional home garden is still very limited and it does not yet represented the culture based design concept. This research was directed to identify the elements of the home garden and map it into design concept of the Lampungnese traditional home garden based on information of Lampungnese traditional culture. The study was conducted by using descriptive approach through literature review, interviews and cultural exploration, as well as field observation. The study was able to identify the elements forming the Lampungnese traditional home garden, namely gakhang hadap, walai, outdoor kitchenette, firewood place, outdoor kitchen, livestock barns, as well as plants. Space layout of the home garden comprises front yard (tengahbah/terambah/beruan), side yard (kebik/kakebik), and backyard (kudan/juyu/kebon). Each element of the garden is located in the right place of the space layout.
Traditional botanical medicine: an introduction.
Rosenbloom, Richard A; Chaudhary, Jayesh; Castro-Eschenbach, Diane
2011-01-01
The role of traditional medicine in the well-being of mankind has certainly journeyed a long way. From an ancient era, in which knowledge was limited to a few traditional healers and dominated by the use of whole plants or crude drugs, the science has gradually evolved into a complete healthcare system with global recognition. Technologic advancements have facilitated traditional science to deliver numerous breakthrough botanicals with potency equivalent to those of conventional drugs. The renewed interest in traditional medicine is mainly attributed to its ability to prevent disease, promote health, and improve quality of life. Despite the support received from public bodies and research organizations, development of botanical medicines continues to be a challenging process. The present article gives a summarized description of the various difficulties encountered in the development and evaluation of botanical drugs, including isolation of active compounds and standardization of plant ingredients. It indicates a future direction of traditional medicine toward evidence-based evaluation of health claims through well-controlled safety and efficacy studies.
Modernism and tradition and the traditions of modernism
Directory of Open Access Journals (Sweden)
Kros Džonatan
2006-01-01
Full Text Available Conventionally, the story of musical modernism has been told in terms of a catastrophic break with the (tonal past and the search for entirely new techniques and modes of expression suitable to a new age. The resulting notion of a single, linear, modernist mainstream (predicated on the basis of a Schoenbergian model of musical progress has served to conceal a more subtle relationship between past and present. Increasingly, it is being recognized that there exist many modernisms and their various identities are forged from a continual renegotiation between past and present, between tradition(s and the avant-garde. This is especially relevant when attempting to discuss the reception of modernism outside central Europe, where the adoption of (Germanic avant-garde attitudes was often interpreted as being "unpatriotic". The case of Great Britain is examined in detail: Harrison Birtwistle’s opera The Mask of Orpheus (1973–83 forms the focus for a wider discussion of modernism within the context of late/post-modern thought.
The Decline of Traditional Banking Activities
Directory of Open Access Journals (Sweden)
Gabriela Cornelia Piciu
2011-05-01
Full Text Available The decline of traditional banking activities raise the issue of efficiency of financial stability, in terms ofquantitative and qualitative aspects – the increasing danger of banking failures as well as of susceptibility due toincreased propensity of banking institutions to assume additional to risks either in the form of riskier loans offer orengaging in other "non-traditional" financial activities which give a promise for greater profitability, but also higherrisks. Non-traditional activities of banking as financial products dealers (financial derivatives, generate an increasingrisks and vulnerabilities in the form of moral hazard issues. That is the reason why and these activities should beregulated as well as are the traditional activities. Challenges posed by the decline of traditional banking activities istwofold: the stability of the banking system must be maintained, while the banking system needs to be restructured toachieve financial stability in the long run. One possible way is an appropriate regulatory framework to encourage atransition period of changing the structure of banking activity(reduction of traditional activities and expanding nontraditional activities to enable banking institutions to perform a deep methodic analysis of non traditional activities,oriented to the financial banking efficiency.
DEFF Research Database (Denmark)
Leer, Jonatan
– very often with a distinct focus on the margins of these countries- and valorising the exoticism in the proximity. In these shows there is often uphold another kind of modern-premodern dichotomy not between white and darker cultures, but between the urban, post-traditional culture (incorporated...... by the host) and the traditional pastoral culture in which archaic modes of being and living still exists. In the programs we often see a negotiation between the post-traditional and the traditional culture that often try to underline the entanglement and the interdependency of the two worlds in the national...
Menorrhagia Management in Iranian Traditional Medicine.
Tansaz, Mojgan; Memarzadehzavareh, Hajar; Qaraaty, Marzieh; Eftekhar, Tahereh; Tabarrai, Malihe; Kamalinejad, Mohammad
2016-01-01
Menorrhagia is a common problem. Medical management for menorrhagia includes hormonal and nonhormonal treatments. These treatments have different side effects, which reduce quality of life. Complementary and traditional medicines have been used to handle menorrhagia for centuries in many cultures. There is a lot of information and data in Iranian traditional documents or books about medicinal herbs that are used by Iranian traditional medicine scientists for the treatment of menorrhagia. The aim of this study was to review the approaches to menorrhagia in Iranian traditional medicine texts. In this study, some main Iranian traditional medicine manuscripts including Canon of Medicine and Al-Havi of Rhazes were studied to extract important information about menorrhagia management. Iranian traditional medicine physicians have relied on an organized system of etiological theories and treatments for menorrhagia. Their methods for menorrhagia management may be able to convince the desire of many women to preserve their uterus and avoid hormonal therapy. © The Author(s) 2015.
PERCEÇÕES SOBRE AS ABORDAGENS À APRENDIZAGEM – ESTUDO DE VARIÁVEIS PSICOLÓGICAS
Lourenço, Abílio Afonso; Nogueira, Carla Maria Leite
2014-01-01
Esta investigação, realizada numa escola básica no norte de Portugal, tem como objetivo analisar as perceções que os alunos apresentam sobre algumas variáveis relativas à forma como desenvolvem a sua aprendizagem, nomeadamente: a autorregulação para a aprendizagem; os processos de estudo utilizados; o controlo volitivo; a planificação da gestão do tempo; e a procrastinação. Outra finalidade deste estudo éverificar se existe uma relação significativa entre estas variáveis e a perceção de autoe...
Fragoso, Nuno Miguel do Rosário Mendes
2013-01-01
Tese de mestrado, Psicologia (Secção de Psicologia Clínica e da Saúde - Núcleo de Psicologia Clínica Dinâmica), Universidade de Lisboa, Faculdade de Psicologia, 2013 O presente trabalho foca-se no estudo da influência da auto-perceção do envelhecimento e dos traços de personalidade na satisfação com a reforma, numa amostra de idosos oriundos da comunidade e sem psicopatologia diagnosticada. Tem como objetivos: (1) analisar a auto-perceção do envelhecimento, os traços de personalidade e a s...
[Common household traditional Chinese medicines].
Zhang, Shu-Yuan; Li, Mei; Fu, Dan; Liu, Yang; Wang, Hui; Tan, Wei
2016-02-01
With the enhancement in the awareness of self-diagnosis among residents, it's very common for each family to prepare common medicines for unexpected needs. Meanwhile, with the popularization of the traditional Chinese medicine knowledge, the proportion of common traditional Chinese medicines prepared at residents' families is increasingly higher than western medicines year by year. To make it clear, both pre-research and closed questionnaire research were adopted for residents in Chaoyang District, Beijing, excluding residents with a medical background. Based on the results of data, a analysis was made to define the role and influence on the quality of life of residents and give suggestions for relevant departments to improve the traditional Chinese medicine popularization and promote the traditional Chinese medicine market. Copyright© by the Chinese Pharmaceutical Association.
Documenting indigenous knowledge about Africa's traditional ...
African Journals Online (AJOL)
This article examines the global debates about indigenous knowledge and Africa's traditional medicine. It explores whether it is possible to document all the elements of indigenous knowledge about Africa's traditional medicine that is used for the treatment of diverse forms of sickness. Certain types of Africa's traditional ...
Recordando y descubriendo a Gala, la última descendiente de Rosalía de Castro
García Vega, Lucía
2015-01-01
Recientemente, se ha cumplido medio siglo del fallecimiento de Gala Martínez de Castro (1871-1964), último miembro de la familia ilustre fundada por la escritora Rosalía de Castro (1837-1885) y el historiador Manuel Martínez Murguía (1833-1923). A tr
Directory of Open Access Journals (Sweden)
Nicat Hagverdiyev
2016-12-01
Full Text Available The significant share of oil sector of the Azerbaijan export portfolio necessitates promotion of non-oil exports. This study analyzes weather the commodities which contain the main share (more than 70% in non-oil export are traditional or non-traditional areas, using the so-called Commodity-specific cumulative export experience function, for the 1995-2015 time frame. Then, the impact of traditional and non-traditional exports on non-oil GDP investigated employing econometric model. The results of the study based on 16 non-oil commodities show that cotton, tobacco, and production of mechanic devices are traditional sectors in non-oil export. The estimation results of the model indicate that both, traditional and non-traditional non-oil export sectors have economically and statistically significant impact on non-oil GDP.
Directory of Open Access Journals (Sweden)
Tiziana Palmiero
2011-12-01
ágicos hechos de Cajamarca. Pero más allá de determinar si algunas de las tonadas del Códice pudieran ser parte de una representación de la captura y muerte de Atahualpa de finales de la colonia, nos interesó interpretar estos cantos como signos portadores de un discurso colonial propio en dos sentidos: la relectura de hechos históricos cuales la captura y la muerte de Atahualpa; la persistencia de códigos andinos en la rememoración de ciertos rituales como el "llanto ceremonial". En este sentido se consideró, para el análisis musical, la existencia de un tono -visto en un primer momento como elemento perteneciente a un sistema de tonos incaicos cercano al sistema de modos eclesiásticos-, que llamaremos "llanto del Inca", su relación con el llanto ceremonial incaico y su rol en la transmisión de significados ligados a la ritualidad andina colonial.Throughout the colonial period a memory of the history of the Andean tribes was created. This memory considered the Inca empire as its main reference and the Inca as its natural symbol. From the narration of the facts of the Inca history, particularly those referring to the Spanish conquest, sprang up the myth of the Inca death to which contributed both conquerors and those who were conquered. During the eighthteenth century the death of the Inca was presented in numerous theatrical performances accompanied with music. The codex Martínez Compañón (1782-85 consists of nine volumes with about 1500 color plates depicting different aspects of both the social life and the natural phenomena of the Trujillo zone in Peru. Thirty eight plates, included in volume II, are related directly or indirectly with music of oral tradition of the period. The original folio numbers of these plates are all preceded by the letter E, standing for '"estampa" (plate. A total of twenty scores appear between E. 176 though E. 193. Judging from the title the text of the following two tunes -"E 188: Allegro tonada El tupamaro, Caxamarca" and "E. 191
[Traditional medicine under Japanese rule after 1930s].
Shin, Dong-won
2003-12-01
Japan, which occupied Korea from 1910 through the end of World War II, transformed traditional medicine. Japanese colonialists propagandized the "benefits of modern civilization such as western medicine" and rejected the advantages of traditional medicine. This bias against Korean traditional medicine mirrored the government's rejection of its own traditional medicine. So, Korean traditional medicine was marginalized in the national health care system: traditional doctors were excluded from public institutions and references to traditional medicine were purged from school textbooks and newspapers. The wars that Japan waged between 1931 and 1944 effected a favorable change toward traditional medicines, however. The wars created a severe shortage of drugs and medical personnel. Thus the colonial government was eager for Koreans to cultivate and gather herbal drugs; it also built a large research institute for herbalism at the Keijo Imperial University in 1938. The colonial government made pharmacopoeia for traditional herbal drugs including plant and animal drugs from 1937 to 1942, independently from Japan. Under these conditions, the prestige of traditional medicine was greatly improved. Influential newspapers and magazines covered the traditional medicine and public lectures on traditional medicine drew large audiences. The wartime government abandoned its opposition to traditional medicine, and appointed a traditional practitioner to the staff of the public hospital in 1934. Moreover, the government allowed the association of the traditional medical doctors in Seoul to train three hundred more practitioners between 1937 and 1942. Japanese colonial policy toward traditional medicine reflected the contradiction between modernizing ideology and the reality of poor colonial medical care. Japanese propaganda promised that the colonial regime would provide more advanced medicine to Korea, but the promise was an empty one. In this situation, traditional medical doctors
Challenging tradition in Nigeria.
Supriya, K E
1991-01-01
In Nigeria since 1987, the National Association of Nigeria Nurses and Midwives (NSNNM) has used traditional medial and traditional health care workers to curtail the practice of female circumcision. Other harmful traditions are being changed also, such as early marriage, taboos of pregnancy and childbirth, and scarification. 30,000 member of NANNM are involved in this effort to halt the harmful practices themselves and to change community opinion. The program involved national and state level workshops on harmful health consequences of traditional practices and instruction on how to conduct focus group discussions to assess women's beliefs and practices. The focus groups were found to be a particularly successful method of opening up discussion of taboo topics and expressing deep emotions. The response to the knowledge that circumcision was not necessary was rage and anger, which was channeled into advocacy roles or change in the practice. The result was the channeled into advocacy roles for change in the practice. The result was the development of books, leaflets and videos. One community group designed a dress with a decorative motif of tatoos and bodily cuts to symbolize circumcision and scarring. Plays and songs were written and performed. Artists provided models of female genitalia both before and after circumcision. The campaign has been successful in bringing this issue to the public attention in prominent ways, such a national television, health talk shows, and women;s magazines. One of the most important results of the effort has been the demonstration that culture and tradition can be changed from within, rather than from outside imposition of values and beliefs.
How 'Digital' is Traditional Crime?
Montoya, L.; Junger, Marianne; Hartel, Pieter H.
Measuring how much cybercrime exists is typically done by first defining cybercrime and then quantifying how many cases fit that definition. The drawback is that definitions vary across countries and many cybercrimes are recorded as traditional crimes. An alternative is to keep traditional
POLITICAL TRADITIONS: THE CONCEPT AND STRUCTURE
Directory of Open Access Journals (Sweden)
Наталья Алексеевна Мамина
2013-05-01
Full Text Available The article refers to the theoretical aspects of the study of the political traditions phenomenon. The influence of traditional components of the political culture on the current political process is recognized in contemporary literature, but political traditions rarely become the original subject of a scientific research, which explains the vagueness of their interpretation and the need of their system understanding.The author analyzes existing interpretations of the concept "tradition", on which formulates the definition of "political traditions" as (1 a form of fixation for meaningful content of the nation’s socio-political experience and as (2 a mechanism of political-cultural continuity.The author identifies mental, behavioral and institutional levels in the structure of political traditions. Mental level consists of political symbols, myths and stereotypes, which form the image of political reality and authority, and values and norms, which affect the motivation of political behavior. Behavioral level includes models of behavior and patterns of action, such as political habits and rituals. Institutional level reflects historical features of interaction between branches of power and relations between the state and society.The author pays attention to the influence of structural elements of political traditions on the political consciousness and behavior of individuals and social groups. DOI: http://dx.doi.org/10.12731/2218-7405-2013-4-25
True ownership of traditional medicines in South Africa
Gabriel Louw; André Duvenhage
2017-01-01
Background Literature postulates that traditional medicines form an important part of modern-day South African healthcare. The belief is that the traditional healer and traditional medicine is a close-knit unit, with the traditional healer as the true owner and manufacturer of traditional medicines. Various studies also postulate that the growth and development of South African traditional medicines are restricted by the pharmaceutical industries and other role players...
P1-11: Visual Function and Neurotoxic Symptoms Related to Exposure to Organic Solvents
Directory of Open Access Journals (Sweden)
Ingrid Jimenez Barbosa
2012-10-01
Full Text Available Aim: Exposure to Perchloroethylene (PERC, a solvent used in dry-cleaning, is associated with neurotoxicity and changes in colour vision (CV and contrast sensitivity (CS. However, PERCs' impact on other aspects of visual function (VF such as chromatic contrast sensitivity (CCS, glass pattern detection (GPP, visual search (VS, and global motion sensitivity (GMS remains unclear. This study compared VF and neurotoxicity in two populations at risk, dry-cleaners (cases from Colombia and Australia. Control groups of people with community levels of exposure to PERC were also assessed. Methods: A case-control study of VF in people who are working in the dry-cleaning industry for at least 1 year (n = 40 Colombia; n= 34 Australia with controls (n = 35 each site. VF measures assessed were CSF, CCS, the FM Hue 100 test, VS, GPP, and GMS. Neurotoxic symptoms were assessed using the Q16 modified version questionnaire. Results: Cases had poorer CCS, hue discrimination, GPP, GMS, and higher Q16 scores than controls (p < .05. There was no effect of country. CS function was poorer than controls (p < .05 for spatial frequencies≥0.50 cpd for Australian cases but for ≥1.0 cpd for Colombian cases. There were no significant differences between cases and controls for serial and parallel VS. Conclusion: Our CSF and CV findings indicate that the CS deficit extends to lower spatial frequencies. Furthermore we report a reduction in the detection of form, motion, and CCS. These deficits were associated with neurotoxic symptoms. Because VS was unaffected, it suggests that PERC affects lower order visual functions more severely than higher level cognition.
Traditional and ayurvedic foods of Indian origin
Directory of Open Access Journals (Sweden)
Preetam Sarkar
2015-09-01
Full Text Available The Ayurveda contains a wealth of knowledge on health sciences. Accordingly traditional foods and their dietary guidelines are prescribed in Ayurveda. There is so much similarity in ayurvedic dietetics and traditional foods that many of the traditional health foods in India can be called ayurvedic foods. This review article introduces the concepts of ayurvedic health foods in India and describes several traditional heath foods across various regions of India. Recommended dietary guidelines according to age and health condition of the consumer, and seasonal considerations are presented for each of the traditional health foods of India. In the era of globalization of the population and international food trading, health conscious citizens around the globe will benefit from the wealth of knowledge on traditional Indian and ayurvedic health foods of Indian origin.
International Nuclear Information System (INIS)
Umezu, Toyoshi; Shibata, Yasuyuki
2014-01-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles
Energy Technology Data Exchange (ETDEWEB)
Umezu, Toyoshi, E-mail: umechan2@nies.go.jp; Shibata, Yasuyuki, E-mail: yshibata@nies.go.jp
2014-09-01
The present study aimed to clarify whether dose–response profiles of acute behavioral effects of 1,2-dichloroethane (DCE), 1,1,1-trichloroethane (TCE), trichloroethylene (TRIC), and tetrachloroethylene (PERC) differ. A test battery involving 6 behavioral endpoints was applied to evaluate the effects of DCE, TCE, TRIC, and PERC in male ICR strain mice under the same experimental conditions. The behavioral effect dose–response profiles of these compounds differed. Regression analysis was used to evaluate the relationship between the dose–response profiles and structural and physical properties of the compounds. Dose–response profile differences correlated significantly with differences in specific structural and physical properties. These results suggest that differences in specific structural and physical properties of DCE, TCE, TRIC, and PERC are responsible for differences in behavioral effects that lead to a variety of dose–response profiles. - Highlights: • We examine effects of 4 chlorinated hydrocarbons on 6 behavioral endpoints in mice. • The behavioral effect dose–response profiles for the 4 compounds are different. • We utilize regression analysis to clarify probable causes of the different profiles. • The compound's physicochemical properties probably produce the different profiles.
Directory of Open Access Journals (Sweden)
Carlos Tasso Eira de Aquino
2016-10-01
Full Text Available Trends in higher education indicate transformations from teachers to facilitators, mentors, or coaches. New classroom management requires diverse teaching methods for a changing population. Non-traditional students require non-traditional faculty. Higher education operates similar to a traditional corporation, but competes for students, faculty, and funding to sustain daily operations and improve academic ranking among peers (Pak, 2013. This growing phenomenon suggests the need for faculty to transform the existing educational culture, ensuring the ability to attract and retain students. Transitions from student learning to the student experience and increasing student satisfaction scores are influencing facilitation in the classroom. On-line facilitation methods are transforming to include teamwork, interactive tutorials, media, and extending beyond group discussion. Faculty should be required to provide more facilitation, coaching, and mentoring with the shifting roles resulting in transitions from traditional faculty to faculty-coach and faculty mentor. The non-traditional adult student may require a more hands on guidance approach and may not be as self-directed as the adult learning theory proposes. This topic is important to individuals that support creation of new knowledge related to non-traditional adult learning models.
Noodles, traditionally and today
Directory of Open Access Journals (Sweden)
Na Zhang
2016-09-01
Full Text Available Chinese noodles originated in the Han dynasty, which has more than 4,000 years of history. There are many stories about the origin of noodles. To a certain extent, noodles also reflect the cultural traditions and customs of China, which essentially means “human nature” and “worldly common sense”. There are thousands of varieties of noodles in China, according to the classification of the shape of noodles, seasoning gravy, cooking craft, and so on. Many noodles have local characteristics. Noodles are accepted by people from all over the world. The industrial revolution and the development of the food industry realized the transition from a traditional handicraft industry to mass production using machinery. In addition, the invention of instant noodles and their mass production also greatly changed the noodle industry. In essence, noodles are a kind of cereal food, which is the main body of the traditional Chinese diet. It is the main source of energy for Chinese people and the most economical energy food. Adhering to the principle of “making cereal food the main food”, is to maintain our Chinese good diet tradition, which can avoid the disadvantages of a high energy, high fat, and low carbohydrate diet, and promote health. The importance of the status of noodles in the dietary structure of residents in our country and the health impact should not be ignored.
Traditional Chinese food technology and cuisine.
Li, Jian-rong; Hsieh, Yun-Hwa P
2004-01-01
From ancient wisdom to modern science and technology, Chinese cuisine has been established from a long history of the country and gained a global reputation of its sophistication. Traditional Chinese foods and cuisine that exhibit Chinese culture, art and reality play an essential role in Chinese people's everyday lives. Recently, traditional Chinese foods have drawn a great degree of attention from food scientists and technologists, the food industry, and health promotion institutions worldwide due to the extensive values they offer beyond being merely another ethnic food. These traditional foods comprise a wide variety of products, such as pickled vegetables, salted fish and jellyfish, tofu and tofu derived products, rice and rice snack foods, fermented sauces, fish balls and thousand-year-old eggs. An overview of selected popular traditional Chinese foods and their processing techniques are included in this paper. Further development of the traditional techniques for formulation and production of these foods is expected to produce economic, social and health benefits.
Aurorae in Australian Aboriginal Traditions
Hamacher, Duane W.
2013-07-01
Transient celestial phenomena feature prominently in the astronomical knowledge and traditions of Aboriginal Australians. In this paper, I collect accounts of the Aurora Australis from the literature regarding Aboriginal culture. Using previous studies of meteors, eclipses, and comets in Aboriginal traditions, I anticipate that the physical properties of aurora, such as their generally red colour as seen from southern Australia, will be associated with fire, death, blood, and evil spirits. The survey reveals this to be the case and also explores historical auroral events in Aboriginal cultures, aurorae in rock art, and briefly compares Aboriginal auroral traditions with other global indigenous groups, including the Maori of New Zealand.
The Reformed tradition as public theology
Directory of Open Access Journals (Sweden)
Vuyani S. Vellem
2013-05-01
Full Text Available This article is a South African perspective of a Black African reflection on the publicity of Reformed faith. Whilst the notion of public theology is fairly new, the article argues, it is important to define the ‘public’ of the type of public theology to which Reformed faith and tradition could be linked. As a confessional tradition, Reformed faith is intrinsically public, the article demonstrates. The publicity of this tradition is however ambivalent and tainted. I attempt to show this by discussing two important tenets of the Reformed Tradition: sola scriptura and sola fide, within the festering wounds of Black African colonialism, apartheid and the hegemony of the neoliberal paradigm in the 21st century.
Traditional and ayurvedic foods of Indian origin
Preetam Sarkar; Lohith Kumar DH; Chanda Dhumal; Shubham Subrot Panigrahi; Ruplal Choudhary
2015-01-01
The Ayurveda contains a wealth of knowledge on health sciences. Accordingly traditional foods and their dietary guidelines are prescribed in Ayurveda. There is so much similarity in ayurvedic dietetics and traditional foods that many of the traditional health foods in India can be called ayurvedic foods. This review article introduces the concepts of ayurvedic health foods in India and describes several traditional heath foods across various regions of India. Recommended dietary guidelines ac...
Protecting traditional knowledge - Does secrecy offer a solution ...
African Journals Online (AJOL)
... their traditional knowledge. This paper reviews the concerns that may arise when holders of traditional knowledge attempt to rely on claiming unfair competition and contract laws to protect their traditional knowledge. Keywords: Traditional knowledge; TRIPS Agreement; unfair competition; confidential information; secrecy.
Infusing Qualitative Traditions in Counseling Research Designs
Hays, Danica G.; Wood, Chris
2011-01-01
Research traditions serve as a blueprint or guide for a variety of design decisions throughout qualitative inquiry. This article presents 6 qualitative research traditions: grounded theory, phenomenology, consensual qualitative research, ethnography, narratology, and participatory action research. For each tradition, the authors describe its…
Zenhong, C.; Buwalda, P.L.
2011-01-01
Chinese dumplings such as Jiao Zi and Bao Zi are two of the popular traditional foods in Asia. They are usually made from wheat flour dough (rice flour or starch is sometimes used) that contains fillings. They can be steamed, boiled and fried and are consumed either as a main meal or dessert. As
Vietnamese traditional medicine from a pharmacist's perspective.
Woerdenbag, H.J.; Nguyen, T.M.; Vu, D.V.; Tran, H.; Nguyen, D.T.; Tran, T.V.; Smet, P.A.G.M. de; Brouwers, J.R.B.J.
2012-01-01
Traditional medicine plays an important role in the healthcare system of Vietnam. Vietnamese traditional medicine (VTM) is underpinned by the oriental philosophy and theory of healing. VTM is largely influenced by traditional Chinese medicine, but differs to a certain extent. VTM is largely not
Vietnamese traditional medicine from a pharmacist's perspective
Woerdenbag, H.J.; Nguyen, T.M.; Vu, D.V.; Tran, Hung; Nguyen, D.T.; Tran, T.V.; De Smet, P.A.; Brouwers, J.R.
Traditional medicine plays an important role in the healthcare system of Vietnam. Vietnamese traditional medicine (VTM) is underpinned by the oriental philosophy and theory of healing. VTM is largely influenced by traditional Chinese medicine, but differs to a certain extent. VTM is largely not
Public Information and African Traditional Communication Delivery ...
African Journals Online (AJOL)
This paper is an analysis of how African traditional communication and the literature produced about it portray African traditional communication. The analysis premises an interest to ascertain whether the portrayal is in a perspective showing traditional media as capable of playing expected public information role. Drawing ...
Effect of extrusion parameters on some properties of dietary fiber ...
African Journals Online (AJOL)
use
2011-11-21
Nov 21, 2011 ... Méndez-García, S.1, Martínez-Flores, H.E.2* and Morales-Sánchez, E.3. 1Student of ... product (Sánchez-Alonso et al., 2007), coconut fiber ..... Rodríguez R, Jiménez A, Fernández-Bolaños J, Guillén R, Heredia A. (2006).
Traditional practices used by infertile women in Turkey.
Ayaz, S; Efe, S Yaman
2010-09-01
Numerous traditional methods are used in the treatment of infertility around the world. To identify the traditional practices of infertile women using one clinic in Ankara, Turkey. The population comprised all women (5700) who attended one infertility outpatient clinic in 2007. The sample was calculated using sample calculation formula and 410 women were included in the study. The survey method was used for data collection. Of the responding women, 27.3% had tried a traditional practice, and 67.8% who tried traditional practices used an herbal mixture. The reason for the women's use of a traditional practice was 'hope' (66.9%), and 15.2% of them had experienced an adverse effect related with traditional practice. Maternal education level, perceived economic status, duration of marriage all significantly affected the use of traditional practices (Pwomen who had received unsuccessful medical treatment for infertility and who had experienced side effects after medical treatment had a higher rate of use of traditional practice (Pwomen who responded to the questionnaire had tried traditional methods, and some experienced adverse effects related to the practice. For couples with infertility problems, educational programmes and consultation services should be organized with respect to their traditional culture. Women should be informed about the hazards of traditional practices and avoidance of harmful practices, and continuous emotional support must be provided for infertile couples. In the future, nursing staff should play a much larger role in these supportive services.
Challenges and Prospects of Traditional Food Processing ...
African Journals Online (AJOL)
This paper focuses on challenges and prospects of traditional food processing technologies and their products in Nigeria. The major objective of the paper is to identify the challenges confronting traditional food processing technologies as well as the potentials the traditional food processing technologies has in boosting the ...
Practice Location Characteristics of Non-Traditional Dental Practices.
Solomon, Eric S; Jones, Daniel L
2016-04-01
Current and future dental school graduates are increasingly likely to choose a non-traditional dental practice-a group practice managed by a dental service organization or a corporate practice with employed dentists-for their initial practice experience. In addition, the growth of non-traditional practices, which are located primarily in major urban areas, could accelerate the movement of dentists to those areas and contribute to geographic disparities in the distribution of dental services. To help the profession understand the implications of these developments, the aim of this study was to compare the location characteristics of non-traditional practices and traditional dental practices. After identifying non-traditional practices across the United States, the authors located those practices and traditional dental practices geographically by zip code. Non-traditional dental practices were found to represent about 3.1% of all dental practices, but they had a greater impact on the marketplace with almost twice the average number of staff and annual revenue. Virtually all non-traditional dental practices were located in zip codes that also had a traditional dental practice. Zip codes with non-traditional practices had significant differences from zip codes with only a traditional dental practice: the populations in areas with non-traditional practices had higher income levels and higher education and were slightly younger and proportionally more Hispanic; those practices also had a much higher likelihood of being located in a major metropolitan area. Dental educators and leaders need to understand the impact of these trends in the practice environment in order to both prepare graduates for practice and make decisions about planning for the workforce of the future.
TERMITES ENDANGERED TRADITIONAL MEDICAL PLANTS
Directory of Open Access Journals (Sweden)
Syaukani Syaukani
2014-04-01
Full Text Available Surveys on traditional medical plants affected by termites have been conducted since June to August 2010 at Ketambe, northern Aceh. Traditional medical plants and their natural habitats were obtained through interviewing local people. Termites were collected by adopted a Standardized Sampling Protocol and final. taxonomic confirmation was done with the help of Termite Research Group (the Natural History Museum, London. About 20 species of medical plants were attacked by termites with various levels. Nine genera and 20 species were collected from various habitats throughout Ketambe, Simpur as well as Gunung Setan villages. Coffe (Coffea arabica, hazelnut (Aleurites moluccana , and areca (Area catechu were among the worse of traditional medical plant that had been attached by the termites.
Johnston, N. A. C.; Bundy, B. A.; Andrew, J. P.; Grimm, B. K.; Ketcherside, D.; Rivero-Zevallos, J. A.; Uhlorn, R. P.
2017-12-01
Lewiston, Idaho is a small city in the Snake River Valley bordering North-Central Idaho and Southeastern Washington, with a population of over 40,000 including the surrounding areas. One of the main industries and employers in the region is a kraft paper mill in North Lewiston, which results in odorous levels of sulfur air pollutants there. The Idaho Department of Environmental Quality has an air monitoring station in Lewiston but measures only air particulate matter (PM). Surprisingly, not much long-term data exists on this area for specific air constituents such as volatile organics, hazardous air pollutants, and sulfur compounds. One year-long study conducted in 2006-2007 by the Nez Perce Tribe found high formaldehyde levels in the area, and warranted further study in July of 2016-2017. Our ongoing study began in the fall of 2016 and investigates the seasonal air composition in the Lewiston area. Specifically, active air sampling via sorbent tubes and analysis by thermal desorption gas chromatography-mass spectrometry (TD-GC-MS). was utilized to measure over 50 volatile organic compounds, hazardous air pollutants, and sulfurous compounds in ambient air (adapted from EPA Method TO-17). Seasonal, diurnal, and spatial variations in air composition were explored with weekly to monthly grab sampling. Dimethyl sulfide (DMS) and dimethyl disulfide (DMDS) were the primary sulfur compounds detected, and these varied considerably depending on time of day, season, location and meteorology. DMS was more prevalent in the summer months, while DMDS was more prevalent in the spring. Elevated concentrations of benzene and chloroform were found in the region during 2017, with average values of short term grab samples over three times the acceptable ambient concentrations in Idaho. These levels did not persist during longer term sampling of 12-hours, however further monitoring is needed to assess a potential health concern.
Columbia River system operation review. Final environmental impact statement
International Nuclear Information System (INIS)
1995-11-01
The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930's, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D'Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation
Columbia River System Operation Review : Final Environmental Impact Statement, Appendix D: Exhibits.
Energy Technology Data Exchange (ETDEWEB)
Columbia River System Operation Review (U.S.)
1995-11-01
The Columbia River and its tributaries are the primary water system in the Pacific Northwest, draining some 219,000 square miles in seven states and another 39,500 square miles in British Columbia. Beginning in the 1930`s, the Columbia River has been significantly modified by construction of 30 major dams on the river and its tributaries, along with dozens of non-Federal projects. Construction and subsequent operation of these water development projects have contributed to eight primary uses of the river system, including navigation, flood control, irrigation, electric power generation, fish migration, fish and wildlife habitat, recreation, and water supply and quality considerations. Increasing stress on the water development of the Columbia River and its tributaries has led primary Federal agencies to undertake intensive analysis and evaluation of the operation of these projects. These agencies are the U.S. Army Corps of Engineers and the Bureau of Reclamation, who operate the large Federal dams on the river, and the Bonneville Power Administration who sells the power generated at the dams. This review, termed the System Operation Review (SOR), has as its ultimate goal to define a strategy for future operation of the major Columbia River projects which effectively considers the needs of all river uses. This volume, Appendix D: Cultural resources appendix, Technical imput includes the following: Development of geomorphology based framework for cultural resources management, Dworshak Reservoir, Idaho; Impact profiles for SOR reservoirs; comments from the following Native American tribes: Burns Paiute Tribe; Coville Confederated Tribes; Confederated Tribes of the Warm Springs Indian Reservation; Confederated Tribes and bands of the Yakama Indian Nation (comments); Nez Perce Tribe; Coeur D`Alene Tribe; Spokane Tribe of Indians; The confederated Tribes of the Umatilla Indian Reservation.
Milk-based traditional Turkish desserts
Directory of Open Access Journals (Sweden)
Tulay Ozcan
2009-12-01
Full Text Available Traditional foods are the reflection of cultural inheritance and affect the lifestyle habits. Culture can be viewed as a system of socially transmitted patterns of behaviour that characterises a particular group. Despite the fact of globalisation, these are key elements to accurately estimate a population’s dietary patterns and how these have been shaped through time. In Turkey, a meal with family or friends traditionally ends with a dessert, which is a testimony to the hosts’ hospitality or to the housewife’s love and affection for her husband and children, since sweets and desserts are important elements of Turkish cuisine. However, the consciousnesses of nutrition and healthy eating, due to rapid change in popular life style and dietary patterns, has contributed to the increased interest in traditional foods with potential health benefits, with increased uncertainty for dessert consumption. Dairy desserts are extensively consumed due to their nutritive and sensoric characteristics. Some of traditional dairy desserts are Mustafakemalpasa, Gullac, Kazandibi, Hosmerim and Tavukgogsu, which are mainly made from milk or fresh cheese, and the current paper discusses their manufacturing processes and composition.
Frost, Jo; Robinson, H Fiona; Hibberd, Judi
2018-06-01
Dysphagia in adults arises from a range of causes including acquired neurological disorders and some cancers. Previous research has suggested that treatment using neuromuscular electrical stimulation (NMES) when used in conjunction with conventional therapy is effective. This review describes the recent literature and a small prospective case series carried out in the United Kingdom. This study contributed to support National Institute of Clinical Excellence (NICE) guidance for clinicians who wish to include NMES in a rehabilitation programme for dysphagic patients, specifically with reference to safety and the impact on swallowing function of this intervention. In 2014, the UK NICE issued guidelines enabling UK therapists to trial the use of NMES, but the guidelines also sought additional evidence on the impact on swallowing function of NMES and the incidence of side effects. This small prospective case series investigated both of these aspects with a group of patients with dysphagia of neurological origin who had not achieved adequate swallowing function with traditional therapy alone. This study recruited 10 adult patients with dysphagia of neurological origin. All had previously received traditional swallowing therapy for at least 6 months but only achieved a Functional Oral Intake Scale of 4 or less (a scale for amounts and types of oral intake). The total study period was 10 weeks for each subject comprising 5 weeks of traditional therapy delivered three times a week followed by 5 weeks of NMES concurrent with traditional therapy (NMES + traditional therapy) delivered three times a week using the VitalStim stimulator (VitalStim Therapy, UK). In addition, the Quality of Life in Swallowing and Eating Assessment Tool 10 (quality of life scales) were determined to allow comparison between studies. Nine subjects achieved an improvement in swallowing function after NMES + traditional therapy was measured using the Functional Oral Intake Scale, giving a
Spread of Traditional Medicines in India
Srinivasan, R.; Sugumar, V. Raji
2015-01-01
For the first time, we have a comprehensive database on usage of AYUSH (acronym for Ayurveda, naturopathy and Yoga, Unani, Siddha, and Homeopathy) in India at the household level. This article aims at exploring the spread of the traditional medical systems in India and the perceptions of people on the access and effectiveness of these medical systems using this database. The article uses the unit level data purchased from the National Sample Survey Organization, New Delhi. Household is the basic unit of survey and the data are the collective opinion of the household. This survey shows that less than 30% of Indian households use the traditional medical systems. There is also a regional pattern in the usage of particular type of traditional medicine, reflecting the regional aspects of the development of such medical systems. The strong faith in AYUSH is the main reason for its usage; lack of need for AYUSH and lack of awareness about AYUSH are the main reasons for not using it. With regard to source of medicines in the traditional medical systems, home is the main source in the Indian medical system and private sector is the main source in Homeopathy. This shows that there is need for creating awareness and improving access to traditional medical systems in India. By and large, the users of AYUSH are also convinced about the effectiveness of these traditional medicines. PMID:26438717
Wiegand, Susanna; Raile, Klemens; Reinehr, Thomas; Hofer, Sabine; Näke, Andrea; Rabl, Wolfgang; Holl, Reinhard W
2008-04-01
The purpose of this study was to generate insulin dose (ID) percentiles for children and adolescents with type 1 diabetes mellitus (DM1) having the opportunity to assess this important parameter in relation to age and sex. Daily IDs per weight (ID/kg) were recorded in 22,177 patients with DM1 (3-25 years of age, DM1 duration of more than 2 years, 48% female) and ID percentiles (ID-Perc) were created statistically. The ID-Perc were compared between male and female, and between multiple insulin injection therapy (MIT) and continuous s.c. insulin infusion (CSII). A multivariate regression analysis was performed for ID in the third year of DM1 with ID/kg, body weight, age, gender, and insulin delivery regimen as variables. The 50th ID-Perc (P50) varied among 0.67 IU/kg (age 3 years), 0.93 IU/kg (13 years), and 0.70 IU/kg (23 years) increasing from early childhood to adolescence and decreasing toward adulthood. Highest P50 ID was found at 12 years in females (0.94 IU/kg) and at 14 years in males (0.92 IU/kg). Using ICT, the ID was significantly higher compared with CSII (P50: 0.94 IU/kg versus 0.79 IU/kg at 13 years). In multivariate regression analysis, ID was significantly (P>0.001) associated with age, gender, and insulin delivery regime. The ID-Perc were significantly different during various periods of childhood and were influenced by gender, body weight, and insulin injection regimes. Therefore, the presented data 1) provide evidence to interpret individual ID in children and adolescents with DM1 and 2) more specifically identify children with unusually high (insulin resistance and non-compliance) or low (MODY and persistent remission) insulin requirement.
Why Breast Cancer Patients Seek Traditional Healers
Directory of Open Access Journals (Sweden)
Mazanah Muhamad
2012-01-01
Full Text Available Traditional healing is a common practice in low and middle income countries such as Malaysia. Eighty percent of Malaysians consult traditional healers or “bomoh” at some time in their life for health-related issues. The purpose of our study was to explore why breast cancer patients visit traditional healers. This is a qualitative study utilizing in-depth interviews with 11 cancer survivors who sought both traditional and Western medicine. The findings revealed the following reasons for which patients seek traditional healers: (1 recommendation from family and friends, (2 sanction from family, (3 perceived benefit and compatibility, (4 healer credibility, and (5 reservation with Western medicine and system delay. These factors work together and are strongly influenced by the Malaysian cultural context. The issue with the Western health system is common in a developing country with limited health facilities.
Why Breast Cancer Patients Seek Traditional Healers
International Nuclear Information System (INIS)
Muhamad, M.; Merriam, Sh.; Merriam, Sh.; Suhami, N.
2012-01-01
Traditional healing is a common practice in low and middle income countries such as Malaysia. Eighty percent of Malaysians consult traditional healers or bomoh at some time in their life for health-related issues. The purpose of our study was to explore why breast cancer patients visit traditional healers. This is a qualitative study utilizing in-depth interviews with 11 cancer survivors who sought both traditional and Western medicine. The findings revealed the following reasons for which patients seek traditional healers: (1) recommendation from family and friends, (2) sanction from family, (3) perceived benefit and compatibility, (4) healer credibility, and (5) reservation with Western medicine and system delay. These factors work together and are strongly influenced by the Malaysian cultural context. The issue with the Western health system is common in a developing country with limited health facilities
Investigation of Indonesian Traditional Houses through CFD Simulation
Suhendri; Koerniawan, M. D.
2017-03-01
Modern buildings in Indonesia rely mostly on artificial lighting, heating, cooling and ventilation. It means more energy is used to drive mechanical appliances, and presumably not sustainable. Meanwhile modern buildings consume much energy, traditional architectures are known as the source of knowledge for sustainable, energy efficient and climate responsive design. Noticeably, one of the differences between modern and traditional buildings in Indonesia is shown in their strategy to provide thermal comfort to the user. Traditional buildings use natural ventilation, but modern buildings use mechanical air conditioning. By focusing on wind-driven ventilation, the study aims to investigate natural ventilation strategy of Indonesian traditional house, and their potential improvement to be used in modern Indonesian buildings. Three traditional houses are studied in this research, representing west, central, and east Indonesia. The houses are Lampung traditional house, Javanese traditional house, and Toraja traditional house. CFD simulation is conducted to simulate wind-driven ventilation behaviour and the temperature of the buildings. Concisely, the wind-natural ventilation of case study houses is potential to provide thermal comfort inside the houses. However, the strategy still can be optimized by adding some other passive design strategies: sun-shading; vegetation; or buildings arrangement in the traditional dwelling. Consideration about the roof’s shape and windows position to the roof is important as well to create a uniform air distribution.
Recognition and respect for African traditional medicine | IDRC ...
International Development Research Centre (IDRC) Digital Library (Canada)
2011-02-01
Feb 1, 2011 ... ... where he presented recommendations from traditional healers on how traditional medicine ... Recognizing that traditional medicine is “the most affordable and accessible system of health care for the .... Related articles ...
Raden Sanusi, H R; Werner, R
1985-01-01
The practitioners of traditional and indigenous medicine rely mainly upon medicinal plants and herbs for the preparation of therapeutic substances. The therapeutic properties of several medicinal plants and popular traditional medicine remedies are being investigated and validated. Present health care systems place people from developing countries in a dilemma. Countries can either continue providing a type of health care which cannot be extended to all in need or rethink and offer more inclusive types of medical care and delivery systems. Traditional medicine has a clear role to play in society, and even the World Health Organization supports the practice of traditional medicine to complement modern medicine. Traditional Malay medicine is the distillation of vast historical experience dating back more than 1000 years. It is often based upon observation, clinical trials, and experiments. The promotion and development of Malay traditional medicine can both foster dignity and self-confidence in communities through self-reliance, while considerably reducing the country's drug costs. The integrity and dignity of a people stems from self-respect and self-reliance. The practice of traditional medicine practitioners can help promote such conditions in many ways. It serves as an important focus for international technical cooperation and offers the potential for major breakthroughs in therapeutics and health care delivery. Effort should be taken to keep the practice of traditional medicine alive in Malaysia.
Malawi's Traditional Leadership and Democracy Consolidation ...
African Journals Online (AJOL)
is that the tendency to brand traditional leadership as undemocratic masks debate on its great potential for the promotion of democracy. The article contends that efforts towards democracy consolidation require foregoing harmonious power relations and linkages between traditional leaders and elected local governments; ...
Active Learning versus Traditional Teaching
Directory of Open Access Journals (Sweden)
L.A. Azzalis
2009-05-01
Full Text Available In traditional teaching most of the class time is spent with the professor lecturing and the students watching and listening. The students work individually, and cooperation is discouraged. On the other hand, active learning changes the focus of activity from the teacher to the learners, in which students solve problems, answer questions, formulate questions of their own, discuss, explain, debate during class; moreover, students work in teams on problems and projects under conditions that assure positive interdependence and individual accountability. Although student-centered methods have repeatedly been shown to be superior to the traditional teacher-centered approach to instruction, the literature regarding the efficacy of various teaching methods is inconclusive. The purpose of this study was to compare the student perceptions of course and instructor effectiveness, course difficulty, and amount learned between the active learning and lecture sections in Health Sciences´ courses by statistical data from Anhembi Morumbi University. Results indicated significant difference between active learning and traditional teaching. Our conclusions were that strategies promoting active learning to traditional lectures could increase knowledge and understanding.
Aboriginal oral traditions of Australian impact craters
Hamacher, Duane W.; Goldsmith, John
2013-11-01
In this paper we explore Aboriginal oral traditions that relate to Australian meteorite craters. Using the literature, first-hand ethnographic records and field trip data, we identify oral traditions and artworks associated with four impact sites: Gosses Bluff, Henbury, Liverpool and Wolfe Creek. Oral traditions describe impact origins for Gosses Bluff, Henbury and Wolfe Creek Craters, and non-impact origins for Liverpool Crater, with Henbury and Wolfe Creek stories having both impact and non-impact origins. Three impact sites that are believed to have been formed during human habitation of Australia -- Dalgaranga, Veevers, and Boxhole -- do not have associated oral traditions that are reported in the literature.
Sadum: Traditional and Contemporary
Directory of Open Access Journals (Sweden)
Ratna Panggabean
2009-07-01
Full Text Available Sadum is one of the traditional cloths of the Batak people in North Sumatra. It is woven on a back strap loom with supplementary weft technique. Sadum is a warp faced weaving made of cotton and beads woven into the cloth. Ritually it is used as a shoulder cloth, gifts exchanges, and in dances. It also bears the symbol of good tidings and blessings for the receiver. The cloth has change during times in technique, color, patterns, as well as in functions. But the use as a ritual cloth stays the same. The basic weaving techniques and equipments used to create it hasn’t change, but its material and added techniques has made this cloth become more rich in color, pattern, and texture. Most changes began when the Europeans came to Indonesia and introduced new material such as synthetic fibers and colors. In the 70s traditional cloth of Indonesia got its boost when the government declared batik as Indonesian national attire. This encourages other traditional weavings to develop into contemporary clothing. Later, new techniques and material were introduced to the Sadum weavings including embroidery, silk and golden threads which were never used before.
Frye, Richard E; Sreenivasula, Swapna; Adams, James B
2011-01-01
Abstract Background Despite the high prevalence of seizure, epilepsy and abnormal electroencephalograms in individuals with autism spectrum disorder (ASD), there is little information regarding the relative effectiveness of treatments for seizures in the ASD population. In order to determine the effectiveness of traditional and non-traditional treatments for improving seizures and influencing other clinical factor relevant to ASD, we developed a comprehensive on-line seizure survey. Methods A...
Little Eyolf and dramatic tradition
Directory of Open Access Journals (Sweden)
Roland Lysell
2015-02-01
Full Text Available The article criticises an Ibsen tradition who has seen the last scene of Little Eyolf as a reconciliation. Instead, the article discusses the improbability of a happy marriage characterised by social engagement. The play is open but it is hardly probable that Rita, with her erotic desire, and Allmers, whose desire has turned into metaphysics, can be happy together. The arguments refer to inner criteria and the constantly present dramatic tradition.
Was the Monetarist Tradition Invented?
George S. Tavlas
1998-01-01
In 1969, Harry Johnson charged that Milton Friedman 'invented' a Chicago oral quantity theory tradition, the idea being that in order to launch a monetarist counter-revolution, Friedman needed to establish a linkage with pre-Keynesian orthodoxy. This paper shows that there was a distinct pre-Keynesian Chicago quantity-theory tradition that advocated increased government expenditure during the Great Depression in order to put money directly into circulation. This policy stance distinguished th...
Electronic commerce versus traditional commerce
Dorin Vicentiu Popescu; Manoela Popescu
2007-01-01
The internet represents new opportunities for the traditional companies, including the diversification of the given services and also the promotion of the new ones, which are personalized and attractive and they are possible thanks to the information and communication technologies. According to this, the Internet impact, which has allowed the development of a new form of commerce- the commerce via Internet (which is a component of the electronic commerce), against the traditional global comme...
MARKETING OF TRADITIONAL PRODUCT IN TRANSYLVANIA
Directory of Open Access Journals (Sweden)
M. MATIUTI
2009-05-01
Full Text Available Transylvania and the Banat are two historical regions that gave birth to several domestic animal breeds. Over the last 15 years, number have sunken dramatically, because these local breeds have been greatly replaced by imported ones. Although very many so- called agrotouristic pensions are now on the market, only about 1% of them promote real traditional food products obtained from local animal breeds. Only few people, especially old people, know traditional recipes older than two or three hundred years and the youth totally ignore them. On the one hand, a large variety of names for different products have appeared on the market, but they are manufactured by big firms and do not have the quality of the traditional products. On the other hand, small producers often have hygiene problems. The reinforcement of traditional products can only occur if people know the quality and the value of the products obtained from the local animal breeds, many of them being endangered species.
Los novatores como etapa histórica
Directory of Open Access Journals (Sweden)
Antonio MESTRE
2009-11-01
Full Text Available Los trabajos de Cenai sobre la historia de la filosofía española del siglo XVII y, en concreto, sobre la presencia de los filósofos modernos, encontraron una sorprendente constatación en el libro de O. V. Quiroz-Martínez. En 1949 aparecía La introducción de la filosofía moderna en España de la autora mexicana. Quiroz- Martínez estudiaba unos años muy complejos del pensamiento español: desde la aparición de la Philosofía libera de Isaac Cardoso (1673 hasta el Ocaso de las formas aristotélicas de Mateo Zapata (1745. Ahora bien, si el tema esencial era la filosofía, dada la implicación de la escolástica con la física aristotélica, la introducción de la filosofía moderna (Descartes o Gassendi provocaba las alusiones a cuestiones científicas. Así lo reconoce Quiroz-Martínez, cuando escribe: «Todas estas obras (de Tosca, Berní, Martín Martínez son favorables a la física moderna».
Tradition and Agency. Tracing cultural continuity and invention
DEFF Research Database (Denmark)
Tradition helps ensure continuity and stability in human affairs, signifying both the handing down of cultural heritage from one generation to the next, and the particular customs, beliefs and rituals being handed down. In the social sciences, tradition has been a central concept from the very st...... address the larger questions of cultural continuity, agency and the use of cultural resources. In the postscript, Terence Ranger offers a complementary perspective by tracing the effects of nationalism, imperialism and globalised exchange on tradition.......Tradition helps ensure continuity and stability in human affairs, signifying both the handing down of cultural heritage from one generation to the next, and the particular customs, beliefs and rituals being handed down. In the social sciences, tradition has been a central concept from the very...... revolutionize the understanding of tradition in anthropology, history and sociology, stimulating an enormous amount of research on invented and imagined traditions. However, most of this research has focussed on the cultural dynamics of specific local innovations and reactions to global developments...
Kang, Young Min; Komakech, Richard; Karigar, Chandrakant Shivappa; Saqib, Asma
2017-06-01
Traditional and complementary medicine (T&CM) plays an integral role in providing health care worldwide. It is based on sound fundamental principles and centuries of practices. This study compared traditional Indian medicine (TIM) and traditional Korean medicine (TKM) basing on data obtained from peer reviewed articles, respective government institutional reports and World Health Organization reports. Despite the fact that TIM and TKM have individual qualities that are unique from each other including different histories of origin, they share a lot in common. Apart from Homeopathy in TIM, both systems are hinged on similar principle of body constitutional-based concept and similar disease diagnosis methods of mainly auscultation, palpation, visual inspection, and interrogation. Similarly, the treatment methods of TIM and TKM follow similar patterns involving use of medicinal herbs, moxibustion, acupuncture, cupping, and manual therapy. Both T&CM are majorly practiced in well-established hospitals by T&CM doctors who have undergone an average of 6-7 years of specialized trainings. However, unlike TIM which has less insurance coverage, the popularity of TKM is majorly due to its wide national insurance coverage. These two medical traditions occupy increasingly greater portion of the global market. However, TIM especially Ayurveda has gained more global recognition than TKM although the emergence of Sasang Constitutional Medicine in TKM is beginning to become more popular. This comparative analysis between TIM and TKM may provide vital and insightful contribution towards constitutional-based concept for further development and future studies in T&CM.
International Nuclear Information System (INIS)
Stokowski, P.A.; Friedli, E.A.
1987-11-01
A series of BWIP Socioeconomic Profile Reports are being prepared. This report is one of the first set of five separate BWIP Profile Reports, which cover: economic/demographic conditions; fiscal conditions; housing characteristics; public services and facilities; and socioeconomic conditions in cultural communities. The BWIP Socioeconomic Profile Reports are designed to provide information about the characteristics of the communities in which socioeconomic impacts from BWIP may occur. The Profile Reports present a compilation of historical information about socioeconomic conditions in the affected communities. These reports are designed to provide a transition between the BWIP EA, published in 1986, the Monitoring Reports, and other technical reports associated with the BWIP SMMP and CSP. The principal objectives of the Profile Reports are to update the DOE BWIP socioeconomic database by compiling available secondary and primary data and to make this information available to both the DOE program and other interested parties. The initial Profile Reports will help identify the need for additional data. The database developed for the profiles will assemble socioeconomic data in a uniform, readily accessible format. 16 refs., 1 fig., 17 tabs
Milk-based traditional Turkish desserts
Akpinar-Bayizit, Arzu; Ozcan, Tulay; Yilmaz-Ersan, Lutfiye
2009-01-01
Traditional foods are the reflection of cultural inheritance and affect the lifestyle habits. Culture can be viewed as a system of socially transmitted patterns of behaviour that characterises a particular group. Despite the fact of globalisation, these are key elements to accurately estimate a population’s dietary patterns and how these have been shaped through time. In Turkey, a meal with family or friends traditionally ends with a dessert, which is a testimony to the hosts’ hospitality or ...
Sugiyama, Shigeru
2006-01-01
The commercialization of drugs started toward the end of Heian period (794-1192) when not only aristocrats and monks who were traditional patrons to drug makers, but also local clans and landlords who became powerful as a result of the disbanding of aristocratic manors accumulated enough wealth to spend money on medicine. Although traveling around the country was still a dangerous endeavor, merchants assembled groups to bring lucrative foreign drugs (mainly Chinese) to remote areas. The spread of commercial drugs to common people, however, did not happen until the early Edo period (1603-1867), when the so-called barrier system was installed nationwide to make domestic travel safe. Commercialization started in large cities and gradually spread to other areas. Many nostrums popular until recently appeared in the Genroku period (1688-1703) or later. Many such nostrums were all-cures, often consisting of such active ingredients as Saussureae radix, Agalloch, or Gambir. Even in the Edo period, many people living in agricultural or fishing villages, as well as those in the lower tier, were still poor. Much of the medication available to those people was therefore made of various plant or animal-derived substances that were traditionally used as folk medicines.
Traditional Postpartum Practices Among Malaysian Mothers: A Review.
Fadzil, Fariza; Shamsuddin, Khadijah; Wan Puteh, Sharifa Ezat
2016-07-01
To briefly describe the postpartum practices among the three major ethnic groups in Malaysia and to identify commonalities in their traditional postpartum beliefs and practices. This narrative review collated information on traditional postpartum practices among Malaysian mothers through a literature search for published research papers on traditional postpartum practices in Malaysia. This review shows that Malaysian mothers have certain postpartum practices that they considered to be important for preventing future ill health. Despite the perceived differences in intra-ethnic postpartum practices, most Malaysian mothers, although from different ethnicities, share similarities in their postpartum regimens and practices in terms of beliefs and adherence to food taboos, use of traditional postpartum massage and traditional herbs, and acknowledgment of the role of older female family members in postpartum care. Health care providers should be aware of multiethnic traditional postpartum practices and use the commonalities in these practices as part of their postpartum care regimen.
Toward justice and social transformation? Appealing to the tradition against the tradition
Directory of Open Access Journals (Sweden)
Piet J. Naude
2017-05-01
Full Text Available This article starts with a brief statement on the well-known contradictory nature of the Reformed tradition in South Africa, defending injustice and struggling for justice in the name of the same tradition. By following the work of Reformed systematic theologian D.J. Smit, it argues that the justice-affirming potential of the Reformed tradition is a hermeneutical task built on three specific re-interpretations: (1 the reinterpretation of Scripture from the perspective of the weak, the poor and the oppressed (against a hermeneutic of creation orders and God-willed division of people (2 a rereading of John Calvin to affirm the dignity and freedom of all humans (against the grain of neo-Calvinist interpretations (3 a rereading of Karl Barth with a focus on God’s inclusive grace, Christian confessions and the nature of the Christian life (against the limitation of his influence because of his perceived actualistic view on Scripture or unscientific, foundational methodology. The article closes with a brief look into the agenda for social transformation faced by us in the second decade of the 21st century, and under what conditions the Reformed faith will be able to make an enduring contribution to public life in (South Africa.
Zhenhui, Rao
1999-01-01
This article discusses traditional methods, such as the grammar-translation, and modern methods, the communicative approach, for teaching English-as-a-foreign-language in China. The relationship between linguistic accuracy and communicative competence, student-centered orientation, and the role of the teacher are highlighted. (Author/VWL)
Traditional marketing vs. Internet marketing. A comparison
Varfan, Mona; Shima, Alfa
2008-01-01
Title: Traditional marketing vs. Internet marketing: A comparison Problem: Marketing is an important strategy for businesses and it contains numerous effective tools. Traditional marketing has been in use for many years and nowadays Internet has brought new ways of doing business for companies and that has affected marketing. What are the main differences between Internet marketing and traditional marketing? Which one of the two approaches contains the most used and effective marketing tools ...
[Study on incompatibility of traditional Chinese medicines].
Fan, Xin-sheng; Duan, Jin-ao; Hua, Hao-ming; Qian, Da-wei; Shang, Er-xin; Guo, Jian-ming
2015-04-01
The incompatibility of traditional Chinese medicines is related to the clinical medication safety, so has attracted wide attentions from the public. With the deepening of studies on the incompatibility of traditional Chinese medicines represented by 18 incompatible herbs, the incompatibility of theory traditional Chinese medicines has raised to new heights. From the origin of incompatibility theory of traditional Chinese medicines, relationship of herbs, harms of incompatible herbs and principle of prevention to toxic effects of specific incompatible medicines, the innovation and development of the traditional Chinese medicine incompatibility theory was explored. Structurally, the incompatibility of traditional Chinese medicines refers to the opposition of two herbs based on seven emotions and clinical experience. The combination of incompatible herbs may lead to human harms, especially latent harm and inefficacy of intervention medicines. The avoidance of the combination of incompatible herbs and the consideration of both symptoms and drug efficacy are the basic method to prevent adverse reactions. The recent studies have revealed five characteristics of incompatible herbs. Toxicity potentiation, toxication, efficacy reduction and inefficacy are the four manifestations of the incompatible relations. The material changes can reflect the effects of toxicity potentiation and toxication of opposite herbs. The accumulation of toxicity and metabolic changes are the basis for latent harms. The antagonistic effect of main efficacies and the coexistence of positive and negative effects are the distinctive part of the incompatibility. The connotation of incompatible herbs plays an important role in the innovation of the traditional Chinese medicine incompatibility theory.
Impact of African traditional worldviews on climate change adaptation.
Sanganyado, Edmond; Teta, Charles; Masiri, Busani
2018-03-01
Recent studies show cultural worldviews are a key determinant of environmental risk perceptions; thus, they could influence climate change adaptation strategies. African traditional worldviews encourage harmony between humans and the environment through a complex metaphysical belief system transmitted through folklore, taboos, and traditional knowledge. However, African traditional worldviews hold a belief in traditional gods that was shown to have a low connectedness to nature and a low willingness to change. In Makueni District, Kenya, 45% of agropastoralists surveyed believed drought was god's plan and could not be changed. In contrast, traditional knowledge, which is shaped by African traditional worldviews, is often used to frame adaptive strategies such as migration, changing modes of production, and planting different crop varieties. Furthermore, traditional knowledge has been used as a complement to science in areas where meteorological data was unavailable. However, the role of African traditional worldviews on climate change adaption remains understudied. Hence, there is a need to systematically establish the influence of African traditional worldviews on climate change risk perception, development of adaptive strategies, and policy formulation and implementation. In this commentary, we discuss the potential impacts of African traditional worldviews on climate change adaptation. Integr Environ Assess Manag 2018;14:189-193. © 2018 SETAC. © 2018 SETAC.
TRADITIONAL PHYSICAL CULTURE OF BELARUSIANS
Shamak, Ales
2017-01-01
Relevance. The study of the history of physical culture makes it possible to reveal the laws of its development, the relationship with socio-political and economic factors. The aim of the research is to substantiate the essence, types and structure of the traditional physical culture of Belarusians. Results of the Research. Traditional physical culture has been the main type of physical culture of the Belarusian people for about a thousand years. It is regarded as the activity of the society ...
Chapter 1. Traditional marketing revisited
Lambin, Jean-Jacques
2013-01-01
The objective of this chapter is to review the traditional marketing concept and to analyse its main ambiguities as presented in popular textbooks. The traditional marketing management model placing heavy emphasis of the marketing mix is in fact a supply-driven approach of the market, using the understanding of consumers’ needs to mould demand to the requirements of supply, instead of adapting supply to the expectations of demand. To clarify the true role of marketing, a distinction is made b...
Protecting traditional knowledge from the grassroots up
Energy Technology Data Exchange (ETDEWEB)
Arugomedo, Alejandro [ANDES Association (Peru); Pant, Ruchi [Ecoserve (India); Vedavathy, S. [Herbal Folklore Reseach Centre (India); Munyi, Peter [International Centre of Insect Physiology and Ecology (Kenya); Mutta, Doris [Kenya Forestry Research Institute (Kenya); Herrera, Heracilo [Dobbo Yala Foundation (Panama); Song, Yinching; Li, Jingsong [Centre of Chinese Agricultural Policy (China); Swiderska, Krystyna
2009-06-15
For indigenous peoples round the world, traditional knowledge based on natural resources such as medicinal herbs forms the core of culture and identity. But this wealth of knowledge is under pressure. Indigenous communities are increasingly vulnerable to eviction, environmental degradation and outside interests eager to monopolise control over their traditional resources. Intellectual property rights such as patents, however, sit uneasily with traditional knowledge. Their commercial focus wars with fundamental indigenous principles such as resource access and sharing. Local customary law offers a better fit, and findings in China, India, Kenya, Panama and Peru show how this pairing can work in practice. The research has identified common elements, and key differences, in customary law that should be informing policy on traditional knowledge and genetic resources.
Traditional medicine for the rich and knowledgeable
DEFF Research Database (Denmark)
Thorsen, Rikke Stamp; Pouliot, Mariéve
2016-01-01
Traditional medicine is commonly assumed to be a crucial health care option for poor households in developing countries. However, little research has been done in Asia to quantify the reliance on traditional medicine and its determinants. This research contributes to filling in this knowledge gap...... show that traditional medicine, and especially self-treatment with medicinal plants, prevail as treatment options in both rural and peri-urban populations. Contrarily to what is commonly assumed, high income is an important determinant of use of traditional medicine. Likewise, knowledge of medicinal...... plants, age, education, gender and illness chronicity were also significant determinants. The importance of self-treatment with medicinal plants should inform the development of health policy tailored to people’s treatment-seeking behaviour....
PROMOTING TRADITIONAL FOOD PRODUCTS AS HEALTHY DIET PRODUCTS
Directory of Open Access Journals (Sweden)
Mihaela Teodora TARCZA
2015-12-01
Full Text Available The aim of this paper is to propose a brief introspection in the literature review in an attempt to highlight the peculiarities of traditional foodstuffs that enable them to be promoted as the primary food for a healthy diet. The trend of healthy eating is gaining ground not only for experts and researchers, but also for consumers on a daily basis. Traditional foodstuffs are brought back into the consumers’ attention in a market full of highly-processed foodstuffs. Marketing specialists noticed the link between the two concepts and they elaborated promotional strategies for traditional foodstuffs, having the ‘healthy diet’ as insight. Throughout the paper we will present theoretical considerations such as the concept of ‘traditional food product’, ‘promotion’, and ‘healthy diet’ from a marketing perspective followed by several examples of traditional food products perceived as healthy, and lastly, we will highlight the benefits of promoting a healthy diet by consuming traditional food products.
Vulgarization of popular music tradition in Serbia
Božilović, Nikola
2011-01-01
The vulgarization of tradition in this paper implies the alteration, false representation, and adaptation of tradition in line with the interests of certain individuals or groups in power. The author observes popular music in Serbia (jazz, pop, rock) under a sociological magnifying glass, attempting to explain and motivate the thesis which proposes a valid historical foundation of popular culture and music in the social life of Serbia. In his opinion, this kind of tradition is being 'swept un...
Traditional Market Accounting: Management or Financial Accounting?
Wiyarni, Wiyarni
2017-01-01
The purpose of this study is to explore the area of accounting in traditional market. There are two areas of accounting: management and financial accounting. Some of traditional market traders have prepared financial notes, whereas some of them do not. Their financial notes usually consist of receivables, payables, customer orders, inventories, sales and cost price, and salary expenses. The purpose of these financial notes is usually for decision making. It is very rare for the traditional ma...
Traditional Mediterranean and European herbal medicines.
Leonti, Marco; Verpoorte, Robert
2017-03-06
Written history allows tracing back Mediterranean and European medical traditions to Greek antiquity. The epidemiological shift triggered by the rise of modern medicine and industrialization is reflected in contemporary reliance and preferences for certain herbal medicines. We sketch the development and transmission of written herbal medicine through Mediterranean and European history and point out the opportunity to connect with modern traditions. An ethnopharmacological database linking past and modern medical traditions could serve as a tool for crosschecking contemporary ethnopharmacological field-data as well as a repository for data mining. Considering that the diachronic picture emerging from such a database has an epidemiological base this could lead to new hypotheses related to evolutionary medicine. The advent of systems pharmacology and network pharmacology opens new perspectives for studying past and current herbal medicine. Since a large part of modern drugs has its roots in ancient traditions one may expect new leads for drug development from novel systemic studies, as well as evidence for the activity of certain herbal preparations. Copyright © 2017 Elsevier Ireland Ltd. All rights reserved.
The convergence and convenience of talent, traditional knowledge ...
African Journals Online (AJOL)
The convergence and convenience of talent, traditional knowledge and performance in the Chewa drumming tradition. ... the elements that constitute the Chewa art of drumming, the application of this art in the traditional medium of music and dance, and the adaptation of the art by Malawi's contemporary music performers.
Directory of Open Access Journals (Sweden)
Young Min Kang
2017-06-01
Full Text Available Traditional and complementary medicine (T&CM plays an integral role in providing health care worldwide. It is based on sound fundamental principles and centuries of practices. This study compared traditional Indian medicine (TIM and traditional Korean medicine (TKM basing on data obtained from peer reviewed articles, respective government institutional reports and World Health Organization reports. Despite the fact that TIM and TKM have individual qualities that are unique from each other including different histories of origin, they share a lot in common. Apart from Homeopathy in TIM, both systems are hinged on similar principle of body constitutional-based concept and similar disease diagnosis methods of mainly auscultation, palpation, visual inspection, and interrogation. Similarly, the treatment methods of TIM and TKM follow similar patterns involving use of medicinal herbs, moxibustion, acupuncture, cupping, and manual therapy. Both T&CM are majorly practiced in well-established hospitals by T&CM doctors who have undergone an average of 6–7 years of specialized trainings. However, unlike TIM which has less insurance coverage, the popularity of TKM is majorly due to its wide national insurance coverage. These two medical traditions occupy increasingly greater portion of the global market. However, TIM especially Ayurveda has gained more global recognition than TKM although the emergence of Sasang Constitutional Medicine in TKM is beginning to become more popular. This comparative analysis between TIM and TKM may provide vital and insightful contribution towards constitutional-based concept for further development and future studies in T&CM.
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
African Journal of Traditional, Complementary and Alternative Medicines. ... and Ficus thonningii blume (moraceae), two plants used in traditional medicine in the ... The effective method for investigation meridian tropism theory in rats · EMAIL ...
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
African Journal of Traditional, Complementary and Alternative Medicines: Advanced Search. Journal Home > African Journal of Traditional, Complementary and Alternative Medicines: Advanced Search. Log in or Register to get access to full text downloads.
Personalized medicine: a confluence of traditional and contemporary medicine.
Jafari, Samineh; Abdollahi, Mohammad; Saeidnia, Soodabeh
2014-01-01
Traditional systems of medicine have attained great popularity among patients in recent years. Success of this system in the treatment of disease warrants consideration, particularly in cases for which conventional medicine has been insufficient. This study investigates the similarities in principles and approaches of 3 traditional systems and explores whether conventional medicine is able to exploit the advantages of traditional systems. This study first identifies and explores the advantages of 3 well-known systems-traditional Iranian medicine (TIM), ayurveda, and traditional Chinese medicine (TCM)-that are similar in their basic principles and methods. Second, it clarifies whether and how conventional medicine could exploit the advantages of traditional systems as it modernizes, to become more personalized. Finally, this study investigates the possibility that conventional medicine could benefit from traditional typology to improve its personalization. The acknowledgment of the unity of humans and nature, applying rational methods, and personalized approaches is fundamentally similar in the 3 systems. Additionally, they all promote the holistic view that health is harmony and disease is disharmony of the body. Other similarities include their recognition of the unique nature of every person and their categorization of people into different body types. Although conventional medicine has mostly failed to incorporate the advantages of traditional medicine, its integration with traditional medicine is achievable. For instance, exploiting traditional typologies in genomic and other studies may facilitate personalization of conventional medicine. From its review, the research team concludes that prospects are bright for the integration of traditional and conventional medicines and, consequently, for a dramatic improvement in health systems.
The Traditional Medicine and Modern Medicine from Natural Products
Directory of Open Access Journals (Sweden)
Haidan Yuan
2016-04-01
Full Text Available Natural products and traditional medicines are of great importance. Such forms of medicine as traditional Chinese medicine, Ayurveda, Kampo, traditional Korean medicine, and Unani have been practiced in some areas of the world and have blossomed into orderly-regulated systems of medicine. This study aims to review the literature on the relationship among natural products, traditional medicines, and modern medicine, and to explore the possible concepts and methodologies from natural products and traditional medicines to further develop drug discovery. The unique characteristics of theory, application, current role or status, and modern research of eight kinds of traditional medicine systems are summarized in this study. Although only a tiny fraction of the existing plant species have been scientifically researched for bioactivities since 1805, when the first pharmacologically-active compound morphine was isolated from opium, natural products and traditional medicines have already made fruitful contributions for modern medicine. When used to develop new drugs, natural products and traditional medicines have their incomparable advantages, such as abundant clinical experiences, and their unique diversity of chemical structures and biological activities.
The Traditional Medicine and Modern Medicine from Natural Products.
Yuan, Haidan; Ma, Qianqian; Ye, Li; Piao, Guangchun
2016-04-29
Natural products and traditional medicines are of great importance. Such forms of medicine as traditional Chinese medicine, Ayurveda, Kampo, traditional Korean medicine, and Unani have been practiced in some areas of the world and have blossomed into orderly-regulated systems of medicine. This study aims to review the literature on the relationship among natural products, traditional medicines, and modern medicine, and to explore the possible concepts and methodologies from natural products and traditional medicines to further develop drug discovery. The unique characteristics of theory, application, current role or status, and modern research of eight kinds of traditional medicine systems are summarized in this study. Although only a tiny fraction of the existing plant species have been scientifically researched for bioactivities since 1805, when the first pharmacologically-active compound morphine was isolated from opium, natural products and traditional medicines have already made fruitful contributions for modern medicine. When used to develop new drugs, natural products and traditional medicines have their incomparable advantages, such as abundant clinical experiences, and their unique diversity of chemical structures and biological activities.
The commercialization of traditional medicine in modern Cambodia.
Ros, Bandeth; Lê, Gillian; McPake, Barbara; Fustukian, Suzanne
2018-01-01
Globally, traditional medicine has long been used to address relatively common illness, mental ill health and during childbirth and post-natal care. However, traditional medicine is primarily provided by the private sector and it is unclear how far expenditures on traditional medicine contribute to household impoverishment. A life history method was used to understand the health seeking experience of 24 households over the last 60 years in Cambodia, a country with high out-of-pocket expenditures for health. The life histories suggest that traditional medicine in Cambodia has been undergoing a process of commercialization, with significant impacts on poor households. In the earlier lives of respondents, payments for traditional medicine were reported to have been flexible, voluntary or appropriate to patients' financial means. In contrast, contemporary practitioners appear to seek immediate cash payments that have frequently led to considerable debt and asset sales by traditional medicine users. Given traditional medicine's popularity as a source of treatment in Cambodia and its potential to contribute to household impoverishment, we suggest that it needs to be included in a national conversation about achieving Universal Health Coverage in the country. © The Author 2017. Published by Oxford University Press in association with The London School of Hygiene and Tropical Medicine.
Factors that negatively influence consumption of traditionally ...
African Journals Online (AJOL)
Factors that negatively influence consumption of traditionally fermented milk ... in various countries of sub-Saharan Africa and a number of health benefits to human ... influence consumption of Mursik, a traditionally fermented milk product from ...
Protecting traditional knowledge of Chinese medicine: concepts and proposals.
Liu, Changhua; Gu, Man
2011-06-01
With the development of the knowledge economy, knowledge has become one of the most important resources for social progress and economic development. Some countries have proposed measures for the protection of their own traditional knowledge. Traditional Chinese medicine belongs to the category of intangible cultural heritage because it is an important part of Chinese cultural heritage. Today the value of traditional knowledge of Chinese medicine has been widely recognized by the domestic and international public. This paper discusses the definition of traditional knowledge of Chinese medicine and its protection, and evaluates research on its classification. We review the present status of the protection of traditional knowledge of Chinese medicine and tentatively put forward some possible ideas and methods for the protection of traditional knowledge of Chinese medicine. Our goal is to find a way to strengthen the vitality of traditional Chinese medicine and consolidate its foundation. We believe that if we could establish a suitable sui generis(sui generis is a Latin term meaning "of its own kind" and is often used in discussions about protecting the rights of indigenous peoples. Here we use it to emphasize the fact that protection of traditional knowledge of Chinese medicine cannot be achieved through existing legal means of protection alone due to its unique characteristics) system for traditional knowledge, a more favorable environment for the preservation and development of traditional Chinese medicine will ultimately be created.
Analysis of Traditional Historical Clothing
DEFF Research Database (Denmark)
Jensen, Karsten; Schmidt, A. L.; Petersen, A. H.
2013-01-01
for establishing a three-dimensional model and the corresponding two-dimensional pattern for items of skin clothing that are not flat. The new method is non-destructive, and also accurate and fast. Furthermore, this paper presents an overview of the more traditional methods of pattern documentation and measurement......A recurrent problem for scholars who investigate traditional and historical clothing is the measuring of items of clothing and subsequent pattern construction. The challenge is to produce exact data without damaging the item. The main focus of this paper is to present a new procedure...
Traditional medicines, HIV, and related infections: workshop 2C.
Patel, M; Bessong, P; Liu, H
2011-04-01
Traditional medicines are an integral part of health care worldwide, even though their efficacy has not been scientifically proven. HIV-infected individuals may use them singularly or in combination with conventional medicines. Many in vitro studies have proven the anti-HIV, anti-Candida, and anti-herpes simplex virus potential of traditional plants and identified some of the mechanisms of action. Very few in vivo studies are available that involve a small number of participants and show controversial results. In addition, knowledge is limited of the role of traditional medicines in the enhancement of the immune system. The use of traditional medicines with antiretroviral drugs (ARVs) has created a problem because drug interactions compromise the efficacy of ARVs. Several currently popular plants have been studied in the laboratory for their interaction with ARVs, with disadvantageous results. Unfortunately, no clinical trials are available. The science of traditional medicines is relatively new and is at present being modernized worldwide. However, there are still ethical issues regarding traditional medicines that need to be addressed-for example, regulations regarding quality control and standardization of medicines, regulation and education of healers who deliver these medicines, and unregulated clinical trials. The workshop addressed the following questions about traditional medicine and their use in HIV infection: What are the mechanisms of action of anti-HIV traditional medicines? Should traditional medicines be used in conjunction with ARV? Do traditional medicines enhance the immune system? Should medicinal plants be used for the control of oral infections associated with HIV? What are the ethical issues surrounding the use of traditional medicines for the treatment of HIV and associated infections?
ORAL TRADITION AND HISTORICAL RECONSTRUCTION IN IGBO ...
African Journals Online (AJOL)
FBL
control, which exists in all societies that make for near accurate preservation of traditions ... historical sources from written sources and from material objects. ..... traditions were detached very early from the rural to the urban areas, where urban.
Hendrix, Janey B.
A collection for children and teachers of traditional Cherokee recipes emphasizes the art, rather than the science, of cooking. The hand-printed, illustrated format is designed to communicate the feeling of Cherokee history and culture and to encourage readers to collect and add family recipes. The cookbook could be used as a starting point for…
Traditional Chinese and Thai medicine in a comparative perspective.
He, Ke
2015-12-01
The work presented in this paper compares traditional Chinese medicine and traditional Thai medicine, expounding on origins, academic thinking, theoretical system, diagnostic method and modern development. Based on a secondary analysis of available literature, the paper concentrates on two crucial historical developments: (1) the response to, and consequences of, the impact of the Western medicine; and (2) the revival of traditional medicine in these two countries and its prospects. From a comparative perspective, the analysis has led to the conclusion that the rise and fall of traditional medicine is an issue closely related with social and political issues; and the development of traditional medicines requires national policy and financial support from governments, human resource development, the improvement of service quality, and the dissemination of traditional medicine knowledge to the public. In addition, this paper also suggests deepening exchanges and cooperation between China and Thailand, strengthening cooperation between traditional medicine and medical tourism. Copyright © 2015 Elsevier Ltd. All rights reserved.
Staff competence in dealing with traditional approaches
DEFF Research Database (Denmark)
Kastrup, M.
2008-01-01
backgrounds of patients there is a need for mental health professionals to recognize the existence of traditional approaches and be aware of the parallel systems of care. Competent treatment of such patients requires that mental health professionals are aware of this and exhibit a willingness and ability...... to bridge between the more traditional and the Western approaches to treatment. The delineations and various aspects of the concept cultural competence and its dimensions will be discussed from a clinical perspective. Comparative studies of the various Western and the traditional approaches respectively...
Indonesian Traditional Toys and the Development of Batik Motifs
Directory of Open Access Journals (Sweden)
Bagus Indrayana
2016-06-01
Full Text Available There is a wide array of traditional toys in Indonesia. In the past, traditional toys played an important role for skill and creativity development of children. Today, the position of traditional toys in the society is displaced by toys from large-scale manufacturers. Given the critical role of traditional toys for children’s motoric and social development, there is a need to develop media that can be used to promote these traditional products and strengthen their position in the public. We propose to use Batik as a way to effectively disseminate and promote traditional toys to the general public. Apart from this, using traditional toys to create new Batik motifs can have an economic value for the producers of Batik, promote Indonesian products and enrich the Indonesian Batik. This study aims to explore the variety of traditional toys, mainly from Klaten and Magelang, in the Central Java province of Indonesia, and use them as the basis for the development of Batik motif creation. This study used Trilogi Keseimbangan (or Harmony Trilogy aesthetic theory analytical approach that explains the creation of craft consists of the following phases: exploration, design, and materialization. The creation method in this study adopts Tiga Tahap Enam Langkah (Three Phases, Six Steps method offered in the theory. The finding in the field found that the traditional toys material used in Klaten and Magelang, mostly made from waste wood, plywood, and zinc. The manufacturing process is done manually by two or three craftsmen using a simple technology. The traditional toys are designed by the artisans mostly, although there may be designs from the clients. In addition, we also found that the traditional toys have never been used as a Batik motif. The traditional toys Batik motif presented in this work is researcher’s design. For the purposes of this study, we first research the variety of traditional toys available in the market today in Indonesia. We look
Owens, Buffy
2009-01-01
This article presents a recipe for non-traditional wraps. In this article, the author describes how adults and children can help with the recipe and the skills involved with this recipe. The bigger role that children can play in the making of the item the more they are apt to try new things and appreciate the texture and taste.
Centers for Disease Control (CDC) Podcasts
2007-11-01
In this podcast, a Latina nutrition educator shows how a community worked with local farmers to grow produce traditionally enjoyed by Hispanic/Latinos. Created: 11/1/2007 by National Diabetes Education Program (NDEP), a joint program of the Centers for Disease Control and Prevention and the National Institutes of Health. Date Released: 11/10/2007.
Post-modern career assessment for traditionally disadvantaged ...
African Journals Online (AJOL)
Post-modern career assessment for traditionally disadvantaged South African learners: Moving away from the 'expert opinion' ... Perspectives in Education ... This article explores the perceptions of learners from a disadvantaged community regarding the limitations and advantages of traditional and post-modern career ...
Traditional healers and pulmonary tuberculosis in Malawi
Brouwer, J. A.; Boeree, M. J.; Kager, P.; Varkevisser, C. M.; Harries, A. D.
1998-01-01
Queen Elizabeth Central Hospital (QECH) and Blantyre district, Malawi. To investigate the use that tuberculosis (TB) patients in Malawi make of traditional healers and traditional medicine. A questionnaire study was carried out on 89 smear-positive pulmonary TB patients admitted to QECH. Seven
Ethnobotany of pru, a traditional Cuban refreshment
Volpato, G.; Godínez, D.
2004-01-01
Gouania polygama (Jacq.) Urban, Smilax domingensis Willd., and Pimenta dioica Merr., are three species widely used within Cuban ethnobotanical traditions and practices. Pru is a traditional refreshment and medicinal drink produced by their decoction and fermentation with sugar. It is claimed to have
Sustainable architecture in the traditional Iranian homes
Energy Technology Data Exchange (ETDEWEB)
Rezaei, Davood; Niloufari, Morteza; Sadegh Falahat, Mohammad [Zanjan University (Iran, Islamic Republic of)], email: d_rezaei@znu.ac.ir, email: mortezagharibeh@yahoo.com, email: safalahat@yahoo.com
2011-07-01
With the coming shortage of fossil fuels it is important to develop energy efficient buildings to reduce both energy consumption and pollution at the same time. In Iran, traditional homes have been built in a sustainable manner to withstand the high climate diversity of the country. The aim of this paper is to present the different methods used in Iranian traditional architecture. Among the architectural principles is appropriate orientation of the building to allow the capture of solar energy and at the same time protect against the cold wind. In addition, indigenous materials were used in the constructions to provide the highest degree of comfort possible with minimal damage to the environment. Finally, Iranian traditional architecture took advantage of the soil's constant temperature by building a Shvadan which is an underground space beneath the house. This article highlighted the different Iranian traditional methods which can create a sustainable architecture.
Directory of Open Access Journals (Sweden)
Eulalia Hernández Ciro
2015-07-01
Full Text Available Conversar por escrito es lo que hacía Rafael Uribe Uribe con su esposa, Sixta Tulia Gaviria, a través de las cartas, retratos, telegramas y cables que intercambiaron durante varios años y que hoy podemos leer de corrido, gracias al libro Cartas de amor en tiempos de guerra..., compilado por el historiador Pablo Rodríguez Jiménez y publicado en el 2014 por la Editorial de la Universidad del Rosario, que agrupa conversas que, además de su riqueza literaria, son valioso material para la comprensión de la historia de nuestro país, no solo porque muestran el lado sensible y cotidiano de la vida de un hombre que ocupa un lugar privilegiado en la historia de Colombia, sino porque dejan entrever los discursos, las representaciones y las prácticas de la clase dirigente del país. Acercarse a esta correspondencia posibilita conocer asuntos concernientes a los roles femeninos y masculinos, a la educación de los hijos, a las relaciones sociales y públicas, a la vida doméstica, es decir, tanto las ideas y los sentimientos, como la geografía y la cultura material de una época.
Directory of Open Access Journals (Sweden)
Gabriel Louw
2017-02-01
Full Text Available Background In South Africa, it is an accepted fact that the main role players in the manufacturing and selling of so called traditional medicine (TAM are traditional healers. The Traditional Health Practitioners Act No 22 not only strengthened this perception in 2007 by giving statutory recognition to traditional healers as traditional health practitioners, but also with its various definitions as they are reflected in the Act. There is an estimation that South African research on traditional healing that TAM, specifically under the guardianship of the traditional healers, generates in excess of R2 billion (R2,000 million annually. The idea also exists that the traditional healers offer a widespread indispensable medical service, specifically through their medical and health products, which contributes to a further R1 billion (R1,000 million or more in income. Aims The study aims to estimate the annual income generated by South African traditional healers in their practices and with the manufacturing, prescription and selling of their traditional health products for the period 2015/2016. Methods This is an exploratory and descriptive study that makes use of an historical approach by means of investigation and a literature review. The emphasis is on using current documentation like articles, books and newspapers as primary sources to reflect on the South African traditional healers’ estimated annual incomes as generated by their practices and the manufacturing, prescription and selling of their health and medical products for the period 2015/2016. The findings are offered in narrative form. Results Over the years, it seems that a misconception was established in South Africa about what traditional medicines really are and who the specific manufacturers and sellers are. There is no differentiation between the traditional medicines offered and marketed in the South African retail and commercial market, and those prepared by traditional healers
Adherence to traditional Indian customs surrounding birth ...
African Journals Online (AJOL)
Customs traditionally followed by Indian women during pregnancy, birth and early parenthood have been documented. An exploratory investigation of the extent to which some of these traditional beliefs, customs and practices are currently adhered to was undertaken by interviewing Indian mothers living in Johannesburg ...
Use of traditional medicine among type 2 diabetic Libyans.
Ashur, Sana Taher; Shah, Shamsul Azhar; Bosseri, Soad; Shamsuddin, Khadijah
2017-07-16
The use of traditional medicines is common among patients with chronic illnesses and this practice might pose health risks. The use among Libyan patients with diabetes is unknown. Therefore, this study aimed to estimate the prevalence of traditional medicine use in the previous year among Libyans with type 2 diabetes and to examine the association between its use and sociodemographic and clinical characteristics of the patients. A cross-sectional study was conducted at a large diabetes centre in Tripoli. A self-reported questionnaire was used for data collection. Of the 523 respondents, 28.9% used traditional remedies. Sex was the only variable significantly associated with traditional medicine use; more women used traditional medicines (P = 0.01). A total of 77 traditional medicine items were reported to be used, of which herbs were the most common. The use of traditional medicine for diabetes is prevalent and some of the reported items could pose health risks. Health education programmes are suggested to raise the awareness of the health risks of this practice.
Chinese Traditional Philosophy and Indigenous Management Research
DEFF Research Database (Denmark)
Li, Xin
2013-01-01
This paper focuses on three key notions of Chinese traditional philosophy, i.e., Zhongyong, Yin Yang, and Wu, pointing out the possible mistakes in Prof. Peter Ping Li's arguments as well as some questions that are often neglected and taken for granted. The author posits, Chinese traditional...... philosophy is a system of thought distinct from the Western philosophy; while the Western philosophy is mainly concerned about the True, i.e., the objective knowledge of the world, the aim of Chinese traditional philosophy is the pursuit of the Good, i.e., the unification of heaven and human....
Sexuality and spirituality: the relevance of eastern traditions.
Francoeur, R T
1992-01-01
This article outlines some of the major Eastern sexual and spiritual traditions (primarily Hinduism, Taoism and Tantrism), and discusses their relevance for the contemporary Western world. The article begins by examining the sources of Eastern sexual traditions, before and after the "Axial" period, the turning point at which male consciousness and power gained ascendancy over the female principle. Although a phallocentric view of the world came to dominate the East, Eastern cultures -- unlike the West -- maintained a respect for nature. According to this view, health and spirituality are gained only when humanity respects its place in the cosmos and lives in harmony with nature. The article then examines the sexual traditions of Hinduism, in which sexual asceticism not only coexisted but also complimented the celebration of sexual desire and pleasure. The article then discusses the Taoist traditions, which, among other things, stressed the importance of female sexual satisfaction. Taoism argued that men cannot experience true sexual ecstasy unless they develop the ability to control their ejaculation. The Tantric sexual tradition, the article explains, maintained that ultimate sexual pleasure would enable one to experience the true nature of reality. The article then goes on to review variations of these traditions: the Hindu Tantric Doctrine (Shaktism), the Buddhist Tantric Doctrine, and Tantra and Yoga. Finally, the article considers the relevance of these Eastern philosophies to the Western sexual tradition, which has tended to view sexuality as antagonistic to spiritual liberation.
Traditional Games and Children of Today. Belgrade-OMEP Traditional Games Project.
Ivic, Ivan, Ed.; Marjanovic, Aleksandra, Ed.
Collected in this volume are preliminary materials related to the Belgrade-OMEP Project whose purpose is to make a record of those traditional children's games which are a part of the folk culture of various countries. The purpose of this publication is two-fold: (1) to serve as a handbook for the present collaborators on the Project in their…
Haschke, Jan; Seif, Johannes P.; Riesen, Yannick; Tomasi, Andrea; Cattin, Jean; Tous, Loï c; Choulat, Patrick; Aleman, Monica; Cornagliotti, Emanuele; Uruena, Angel; Russell, Richard; Duerinckx, Filip; Champliaud, Jonathan; Levrat, Jacques; Abdallah, Amir A.; Aï ssa, Brahim; Tabet, Nouar; Wyrsch, Nicolas; Despeisse, Matthieu; Szlufcik, Jozef; De Wolf, Stefaan; Ballif, Christophe
2017-01-01
architectures, including so-called Aluminum back-surface-field (BSF), passivated emitter and rear cell (PERC), passivated emitter rear totally diffused (PERT), and silicon heterojunction (SHJ) solar cells. We compare measured temperature coefficients (TC
An Assessment Of Traditional Uighur Medicine In Current Xinjiang ...
African Journals Online (AJOL)
Results: Data showed that, among the registered and studied traditional Uighur medicine, the main therapeutic areas of traditional Uighur medicine focused on skin disease, urogenital disease, rheumatism and digestive system disease. The representative traditional Uighur patent medicine included the following: ...
A MISCELLANY ON INDIAN TRADITIONAL MUSIC
Directory of Open Access Journals (Sweden)
Rauf Kerimov
2013-06-01
Full Text Available Indian music has a very long, unbroken tradition and is an accumulated heritage of centuries. Music in India was popular among all the sections of society and intertwined in life and culture from birth to death. Indian music was formed with the evolution of ancient religious and secular music. The Indian culture absorbed all the best that was brought by other nations in the process of historical development. The Indian music is quite diverse: there are classical instrumental and vocal works and traditional singing of sacred hymns, folk songs and music of different nations. In contrast to the music scholarship, where typically image is a certain regularity, discipline and harmony, beauty of the traditional Indian music in the free improvisation, which is used by the performer. Listening carefully of this music, the man in a new world, a different sounds and explore a different idea of music for himself. The aim of the Indian music, unlike European musical culture define, explore, create and move depths to people's moods. And the Indian instruments is a miracle, that could reflect all these philosophical and aesthetic views. Along with the vocal art, this musical tradition has rich variety of melodic and rhythmic instruments.
Directory of Open Access Journals (Sweden)
Joel Marashe
2014-01-01
Full Text Available This study examines the role of traditional leaders, as custodians of culture, in the fight against infection with the HI virus and the AIDS pandemic in the Chipinge District of Zimbabwe. The research aims to assess traditional leaders� knowledge of HIV and AIDS and its causes. It also examines some traditional practices to determine whether they expose people to HIV and AIDS, and it evaluates the traditional leaders� roles in curbing the pandemic. From a phenomenological standpoint � and grounded in the African traditional religious landscape � the study uses a survey research design. A convenient sample of 18 participants for the study consisted of 3 chiefs and 5 headmen who completed a questionnaire as well as 5 village heads and 5 elders who were interviewed and involved in four focus-group discussions (FGDs that provided a variety of insightful information. The study identifies promiscuity as a major cause of HIV infection in communities. The results show that traditional leaders discourage barika and kuputsa as being harmful traditional marriage practices. Furthermore, the study indicates that traditional leaders encourage behavioural change amongst the youth and adults alike to curb the spread of HIV and that the pandemic could possibly be contained if government fully empowered the traditional leaders. The research has value in attempting to minimise the spread of HIV if communities discontinue harmful cultural practices. Therefore, donor agencies involved in intervention projects concerning the HIV and AIDS pandemic and government should work closely with traditional leaders who wield considerable power in areas under their jurisdiction to arrest the spread of the HIV and AIDS pandemic in the Chipinge district in Zimbabwe.
Application of nuclear irradiation to traditional chinese medicine
International Nuclear Information System (INIS)
Liang Jianping; Li Xuehu; Lu Xihong; Tao Lei; Wang Shuyang
2010-01-01
The application of nuclear irradiation in the field of traditional Chinese medicine has received much attention. In this paper we reviewed the application of nuclear radiation on the cultivation, breeding and disinfection of traditional Chinese medicine, and pointed out that the combination of radiation-induced mutagenesis and biological technology would promise broad prospects for increasing the cellular mutation rate and speeding up the genetic improvement of traditional Chinese medicine. (authors)
Why Should One Want to Participate in a Religious Tradition?
Sarot, M.
2003-01-01
In this article, I apply the theory of tradition Karl Popper developed in an article on the rationalist tradition to Christianity. Popper helps us to distinguish between four functions of the Christian tradition. (1) The Christian tradition helps people to order their perceptions by suggesting
Comparison of biophysical factors influencing on emphysema quantification with low-dose CT
Heo, Chang Yong; Kim, Jong Hyo
2014-03-01
Emphysema Index(EI) measurements in MDCT is known to be influenced by various biophysical factors such as total lung volume, and body size. We investigated the association of the four biophysical factors with emphysema index in low-dose MDCT. In particular, we attempted to identify a potentially stronger biophysical factor than total lung volume. A total of 400 low-dose MDCT volumes taken at 120kVp, 40mAs, 1mm thickness, and B30f reconstruction kernel were used. The lungs, airways, and pulmonary vessels were automatically segmented, and two Emphysema Indices, relative area below -950HU(RA950) and 15th percentile(Perc15), were extracted from the segmented lungs. The biophysical factors such as total lung volume(TLV), mode of lung attenuation(ModLA), effective body diameter(EBD), and the water equivalent body diameter(WBD) were estimated from the segmented lung and body area. The association of biophysical factors with emphysema indices were evaluated by correlation coefficients. The mean emphysema indices were 8.3±5.5(%) in RA950, and -930±18(HU) in Perc15. The estimates of biophysical factors were 4.7±1.0(L) in TLV, -901±21(HU) in ModLA, 26.9±2.2(cm) in EBD, and 25.9±2.6(cm) in WBD. The correlation coefficients of biophysical factors with RA950 were 0.73 in TLV, 0.94 in ModLA, 0.31 in EBD, and 0.18 WBD, the ones with Perc15 were 0.74 in TLV, 0.98 in ModLA, 0.29 in EBD, and 0.15 WBD. Study results revealed that two biophysical factors, TLV and ModLA, mostly affects the emphysema indices. In particular, the ModLA exhibited strongest correlation of 0.98 with Perc15, which indicating the ModLA is the most significant confounding biophysical factor in emphysema indices measurement.
Herbal mixtures in the traditional medicine of Eastern Cuba
Hernández, J.; Volpato, G.
2004-01-01
Herbal mixtures in the traditional medicine of Eastern Cuba. Traditional herbal mixtures in Eastern Cuba are investigated through interviews with 130 knowledgeable people and traditional healers of the provinces of Santiago de Cuba and Guantanamo. One hundred seventy plant species and other products
Energy Technology Data Exchange (ETDEWEB)
Bordeleau, Serge, E-mail: Serge.Bordeleau@uqat.ca [Chaire de Recherche du Canada en Foresterie Autochtone, Université du Québec en Abitibi-Témiscamingue, 445 boul. de l' Université, Rouyn-Noranda, Québec J9X 5E4 (Canada); Chaire Industrielle CRSNG-UQAT-UQÀM en Aménagement Forestier Durable, Université du Québec en Abitibi-Témiscamingue, 445 boul. de l' Université, Rouyn-Noranda, Québec J9X 5E4 (Canada); Asselin, Hugo, E-mail: Hugo.Asselin@uqat.ca [Chaire de Recherche du Canada en Foresterie Autochtone, Université du Québec en Abitibi-Témiscamingue, 445 boul. de l' Université, Rouyn-Noranda, Québec J9X 5E4 (Canada); Chaire Industrielle CRSNG-UQAT-UQÀM en Aménagement Forestier Durable, Université du Québec en Abitibi-Témiscamingue, 445 boul. de l' Université, Rouyn-Noranda, Québec J9X 5E4 (Canada); and others
2016-09-15
Food insecurity is a growing concern for indigenous communities worldwide. While the risk of heavy metal contamination associated to wild food consumption has been extensively studied in the Arctic, data are scarce for the Boreal zone. This study addressed the concerns over possible heavy metal exposure through consumption of traditional food in four Anishnaabeg communities living in the Eastern North American boreal forest. Liver and meat samples were obtained from 196 snowshoe hares (Lepus americanus) trapped during winter 2012 across the traditional lands of the participating communities and within 56–156 km of a copper smelter. Interviews were conducted with 78 household heads to assess traditional food habits, focusing on snowshoe hare consumption. Concentrations in most meat and liver samples were below the detection limit for As, Co, Cr, Ni and Pb. Very few meat samples had detectable Cd and Hg concentrations, but liver samples had mean dry weight concentrations of 3.79 mg/kg and 0.15 mg/kg respectively. Distance and orientation from the smelter did not explain the variability between samples, but percent deciduous and mixed forest cover had a marginal negative effect on liver Cd, Cu and Zn concentrations. The estimated exposition risk from snowshoe hare consumption was low, although heavy consumers could slightly exceed recommended Hg doses. In accordance with the holistic perspective commonly adopted by indigenous people, the nutritional and sociocultural importance of traditional food must be considered in risk assessment. Traditional food plays a significant role in reducing and preventing serious health issues disproportionately affecting First Nations, such as obesity, diabetes, and cardiovascular diseases. Traditional consumption of snowshoe hare (Lepus americanus) entails low risk of heavy metal exposure if animals are tapped > 50 km from a point emission source (such as a copper smelter in the present study), if risk-increasing behaviours are
International Nuclear Information System (INIS)
Bordeleau, Serge; Asselin, Hugo
2016-01-01
Food insecurity is a growing concern for indigenous communities worldwide. While the risk of heavy metal contamination associated to wild food consumption has been extensively studied in the Arctic, data are scarce for the Boreal zone. This study addressed the concerns over possible heavy metal exposure through consumption of traditional food in four Anishnaabeg communities living in the Eastern North American boreal forest. Liver and meat samples were obtained from 196 snowshoe hares (Lepus americanus) trapped during winter 2012 across the traditional lands of the participating communities and within 56–156 km of a copper smelter. Interviews were conducted with 78 household heads to assess traditional food habits, focusing on snowshoe hare consumption. Concentrations in most meat and liver samples were below the detection limit for As, Co, Cr, Ni and Pb. Very few meat samples had detectable Cd and Hg concentrations, but liver samples had mean dry weight concentrations of 3.79 mg/kg and 0.15 mg/kg respectively. Distance and orientation from the smelter did not explain the variability between samples, but percent deciduous and mixed forest cover had a marginal negative effect on liver Cd, Cu and Zn concentrations. The estimated exposition risk from snowshoe hare consumption was low, although heavy consumers could slightly exceed recommended Hg doses. In accordance with the holistic perspective commonly adopted by indigenous people, the nutritional and sociocultural importance of traditional food must be considered in risk assessment. Traditional food plays a significant role in reducing and preventing serious health issues disproportionately affecting First Nations, such as obesity, diabetes, and cardiovascular diseases. Traditional consumption of snowshoe hare (Lepus americanus) entails low risk of heavy metal exposure if animals are tapped > 50 km from a point emission source (such as a copper smelter in the present study), if risk-increasing behaviours are
Tao Masters: tradition, experience and ethnography
Directory of Open Access Journals (Sweden)
José Bizerril Neto
Full Text Available In this article I analyse the performative dimension that constitutes the transmission of tradition in taoist lineage located in Brazil, from the perspective of the anthropology of experience. The idea of knowing in taoism is based on a practical notion: one knows the legacy of tradition through personal embodied experience. The very possibility of knowing is based upon a personal relation between master and apprentice, inserted on a dialogical and genealogical.
Brändle, Tobias; Lengfeld, Holger
2017-01-01
Since 2009, German universities were opened by law to freshmen who do not possess the traditional graduation certificate required for entry into University, but who are rather vocationally qualified. In this article, we track the grades of these so-called non-traditional students and compare them to those of traditional students using a…
Traditional Healers' Views On Fertility | Mashamba | Indilinga ...
African Journals Online (AJOL)
Infertility is one of the major problems facing families, both in the public and private health sectors. This article reports on findings of a study that investigated the traditional perspectives regarding infertility. The study was conducted using qualitative research methods with five traditional healers who were selected through ...
Application of isotopes in traditional Chinese medicine
International Nuclear Information System (INIS)
Ye Ling; Liu Ning; Yang Yuanyou; Mo Shangwu
2006-01-01
Modernization of traditional Chinese medicine necessitates many new or advanced methods. Among these methods, isotopes are considered to be a convenient, fast and feasible method. The recent advance of isotope's application to traditional Chinese medicine is reviewed. In addition, their present status, problems and prospect are discussed. (authors)
Health traditions of Sikkim Himalaya
Directory of Open Access Journals (Sweden)
Ashok Kumar Panda
2010-01-01
Full Text Available Ancient medical systems are still prevalent in Sikkim, popularly nurtured by Buddhist groups using the traditional Tibetan pharmacopoeia overlapping with Ayurvedic medicine. Traditional medical practices and their associated cultural values are based round Sikkim′s three major communities, Lepcha, Bhutia and Nepalis. In this study, a semi-structured questionnaire was prepared for folk healers covering age and sex, educational qualification, source of knowledge, types of practices, experience and generation of practice, and transformation of knowledge. These were administered to forty-eight folk healers identified in different parts of Sikkim. 490 medicinal plants find their habitats in Sikkim because of its large variations in altitude and climate. For 31 commonly used by these folk healers, we present botanical name, family, local name, distribution, and parts used, together with their therapeutic uses, mostly Rheumatoid arthritis, Gout, Gonorrhea, Fever, Viral flu, asthma, Cough and Cold, indigestion, Jaundice etc. A case treated by a folk healer is also recounted. This study indicates that, in the studied area, Sikkim′s health traditions and folk practices are declining due to shifts in socio-economic patterns, and unwillingness of the younger generation to adopt folk healing as a profession.
First developmental stages of advertising in traditional media
Kesl, Jakub
2011-01-01
The first developmental stages of advertising in traditional media Jakub Kesl Abstract Diploma thesis "The first developmental stages of advertising in traditional media" deals with the commercial use of media in its first forms and handles the evolution of advertising communication in conjunction with the development of media. Traditional media - print, radio and television in the period starting with emergence of these media until the point of establishment of advertising as their more or l...
A scoping review of traditional food security in Alaska.
Walch, Amanda; Bersamin, Andrea; Loring, Philip; Johnson, Rhonda; Tholl, Melissa
2018-12-01
Food insecurity is a public health concern. Food security includes the pillars of food access, availability and utilisation. For some indigenous peoples, this may also include traditional foods. To conduct a scoping review on traditional foods and food security in Alaska. Google Scholar and the High North Research Documents were used to search for relevant primary research using the following terms: "traditional foods", "food security", "access", "availability", "utilisation", "Alaska", "Alaska Native" and "indigenous". Twenty four articles from Google Scholar and four articles from the High North Research Documents were selected. The articles revealed three types of research approaches, those that quantified traditional food intake (n=18), those that quantified food security (n=2), and qualitative articles that addressed at least one pillar of food security (n=8). Limited primary research is available on food security in Alaskan. Few studies directly measure food security while most provide a review of food security factors. Research investigating dietary intake of traditional foods is more prevalent, though many differences exist among participant age groups and geographical areas. Future research should include direct measurements of traditional food intake and food security to provide a more complete picture of traditional food security in Alaska.
Comet and meteorite traditions of Aboriginal Australians
Hamacher, Duane W.
2014-06-01
This research contributes to the disciplines of cultural astronomy (the academic study of how past and present cultures understand and utilise celestial objects and phenomena) and geomythology (the study of geological events and the formation of geological features described in oral traditions). Of the hundreds of distinct Aboriginal cultures of Australia, many have oral traditions rich in descriptions and explanations of comets, meteors, meteorites, airbursts, impact events, and impact craters. These views generally attribute these phenomena to spirits, death, and bad omens. There are also many traditions that describe the formation of meteorite craters as well as impact events that are not known to Western science.
Emotional Problems in Traditional and Cyber Victimization
Sjursø, Ida Risanger; Fandrem, Hildegunn; Roland, Erling
2016-01-01
Previous studies show an association between traditional and cyber victimization. However, there seem to be differences in how these forms of being bullied relates to emotional problems in the victims. Few studies focus on symptoms of general anxiety and depression as separate variables when comparing traditional and cyber victimization.…
Las guerras carlistas en la literatura juvenil / Carlist Wars in children´s literature
Directory of Open Access Journals (Sweden)
Fermín Ezpeleta Aguilar
2013-01-01
Full Text Available Resumen: A partir de la tradición literaria sobre las contiendas carlistas en la España del siglo XIX, la narrativa juvenil más reciente retoma este motivo para sus ideaciones en obras de autores como José María Mendiola, Juan Bas, Emili Teixidor, Benardo Atxaga o Fernando Martínez Lainez, entre otros. Estos escritores adaptan sus propuestas a los nuevos valores, dentro de subgéneros actuales para receptores jóvenes tales como novela de misterio, histórica, libros de conocimientos, metaficción. No obstante, casi siempre se aprovecha el esquema de la aventura mítica del héroe con fondo histórico, presente en la novela matriz Zalacaín el aventurero de Pío Baroja.Abstract: From the literary tradition of “Carlist” Wars in nineteenth century, the Spanish later youth narrative takes this occasion to their ideation into works of authors such as José María Mendiola, Juan Bas, Emili Teixidor, Bernardo Atxaga or Fernando Martínez Lainez, among others. These writers tailor their proposals to the new values within current subgenres for young readers such as mystery, historical novel, books of knowledge, metafiction. However, these authors usually use the scheme mythical hero adventure with historical background, present in the novel by Pío Baroja, Zalacaín el aventurero.
[Different philosophical traditions for knowledge development in nursing sciences].
Ballard, Ariane; Khadra, Christelle; Le May, Sylvie; Gendron, Sylvie
2016-03-01
doctoral studies in nursing engage a critical reflections about philosophical traditions inherent to knowledge development. critical realism, hermeneutics, postmodernism and poststructuralism refer to philosophical traditions that are generally less explored in nursing, although they are attracting greater attention. this paper offers an introductory presentation to these traditions as the authors also reflect upon their contribution to nursing knowledge development in. for each tradition, ontological and epistemological properties are presented to provide an overview of their main features. Contributions to nursing knowledge development are then discussed. ontology refers to stratified, fixed and changing, or multiple realities, depending on the philosophical tradition. Likewise, epistemology emphasizes the explanatory power of knowledge, intersubjectivity, or inherent power dynamics. the diversity of philosophical traditions represents an asset that can significantly contribute to the advancement of the nursing discipline. clarification of the philosophical dimensions that underlie knowledge development is essential for doctoral nursing students in the process of developing their research projects and future programmes of research.
Perinatal Practices & Traditions Among Asian Indian Women.
Goyal, Deepika
2016-01-01
As the population in the United States grows more diverse, nurses caring for childbearing women must be aware of the many cultural traditions and customs unique to their patients. This knowledge and insight supports women and their families with the appropriate care, information, and resources. A supportive relationship builds trust, offers guidance, and allows for the new family to integrate information from nurses and other healthcare providers with the practice of certain perinatal cultural traditions. The Asian Indian culture is rich in tradition, specifically during the perinatal period. To support the cultural beliefs and practices of Asian Indian women during this time, nurses need to be aware of and consider multiple factors. Many women are navigating the new role of motherhood while making sense of and incorporating important cultural rituals. The purpose of this article is to provide an overview of perinatal cultural practices and traditions specific to the Asian Indian culture that perinatal nurses may observe in the clinical setting. Cultural traditions and practices specific to the pregnancy and postpartum period are described together with symbolism and implications for nursing practice. It is important to note that information regarding perinatal customs is provided in an effort to promote culturally sensitive nursing care and may not pertain to all Asian Indian women living in the United States.
Post-secular religious practices entering traditional religion
Directory of Open Access Journals (Sweden)
Urszula Pękala
2012-01-01
Full Text Available Nowadays we can observe complex interactions between the religious and secular spheres. Several different processes take place simultaneously: the traditionally religious elements function in the secular sphere as if they were part of secular culture; elements of the secular sphere build a specific kind of post-secular religiosity; finally, this post-secular religiosity influences traditional religions. This article focuses on the last stage of these changes. The author's purpose is to describe and interpret the practices we can observe. Because of the complexity of this issue, the analyses are limited to examples taken from the Catholic Church in Germany, where this process seems to be as popular as it is paradoxical. Catholicism realises that the post-secular forms of religiosity are very popular and that many people choose them instead of the traditional Church. It could offer them spirituality based on ages of experience. But instead of making its own spiritual tradition competitive on the spiritual market, Catholicism seems to offer Christianised post-secular goods, or its own traditional elements represented in a secularised form. It seems difficult to predict how it will all end. However, we observe an interesting encounter and interaction between an ‘old’ religion and a new religiosity, which will certainly have impact on further presence of the Church in the society.
Martinez, Guadalupe; Naranjo, Francisco L.; Perez, Angel L.; Suero, Maria Isabel; Pardo, Pedro J.
2011-01-01
This study compared the educational effects of computer simulations developed in a hyper-realistic virtual environment with the educational effects of either traditional schematic simulations or a traditional optics laboratory. The virtual environment was constructed on the basis of Java applets complemented with a photorealistic visual output.…
MARKETING OF TRADITIONAL PRODUCT IN TRANSYLVANIA
M. MATIUTI; A. T. BOGDAN
2009-01-01
Transylvania and the Banat are two historical regions that gave birth to several domestic animal breeds. Over the last 15 years, number have sunken dramatically, because these local breeds have been greatly replaced by imported ones. Although very many so- called agrotouristic pensions are now on the market, only about 1% of them promote real traditional food products obtained from local animal breeds. Only few people, especially old people, know traditional recipes older than two or three hu...
Energy and non-traditional security (NTS) in Asia
Energy Technology Data Exchange (ETDEWEB)
Caballero-Anthony, Mely [Nanyang Technological Univ., Singapore (SG). Centre for Non-Traditional Security (NTS) Studies; Chang, Youngho [Nanyang Technological Univ., Singapore (Singapore). Division of Economics; Putra, Nur Azha (eds.) [National Univ. of Singapore (Singapore). Energy Security Division
2012-07-01
Traditional notions of security are premised on the primacy of state security. In relation to energy security, traditional policy thinking has focused on ensuring supply without much emphasis on socioeconomic and environmental impacts. Non-traditional security (NTS) scholars argue that threats to human security have become increasingly prominent since the end of the Cold War, and that it is thus critical to adopt a holistic and multidisciplinary approach in addressing rising energy needs. This volume represents the perspectives of scholars from across Asia, looking at diverse aspects of energy security through a non-traditional security lens. The issues covered include environmental and socioeconomic impacts, the role of the market, the role of civil society, energy sustainability and policy trends in the ASEAN region.
Oral tradition in African philosophical discourse: a critique of Sophie ...
African Journals Online (AJOL)
This paper seeks to discuss the place of oral tradition in African philosophical discourse. In doing this, the nature of oral tradition as well as its forms is critically discussed taking into cognizance Sophie Oluwole‟s scholarship on oral tradition in African philosophy. Oluwole defends the thesis that oral tradition almost ...
African Traditional Knowledge Systems and Biodiversity Management
African Journals Online (AJOL)
There is a link between African Traditional Knowledge Systems and the management of Biodiversity. These have been passed over from one generation to the next through oral tradition. The lack of documentation of these systems of managing biodiversity has led to the existence of a gap between the scientifi cally based ...
NICHE MARKETS FOR TRADITIONAL TRAVEL AGENCIES IN CHINA
Chen, Min
2014-01-01
Social media is becoming more and more important in our daily life as it influences the ways people live and how they think. For example, people no longer just rely on traditional travel agencies for travelling. Thus, how traditional travel agencies survive in such transformation is crucial. In order to find connections between social media and travel agencies marketing strategies, quantitative research was introduced to encourage and help the traditional travel agencies to find their niche m...
Directory of Open Access Journals (Sweden)
Kamal Moufid
2013-01-01
Conclusions: In our series, Perc-URS is a safe and efficient treatment option for proximal ureteral stone, especially when the stone size is superior to 15 mm with the presence of moderate or severe hydronephrosis.
Portfolio as a tool to evaluate clinical competences of traumatology in medical students
Santonja-Medina, Fernando; Garc?a-Sanz, M Paz; Mart?nez-Mart?nez, Francisco; B?, David; Garc?a-Esta?, Joaqu?n
2016-01-01
Fernando Santonja-Medina,1,2 M Paz García-Sanz,3 Francisco Martínez-Martínez,1,2 David Bó,1,2,4 Joaquín García-Estañ,5 1Faculty of Medicine, Department of Traumatology, 2Faculty of Medicine, University Hospital Virgen de la Arrixaca, 3Faculty of Medicine, Department of Education, 4Faculty of Medicine, University Hospital Morales Meseguer, 5Faculty of Medicine, Department of Physiology, University of Murcia, Murcia, S...
Contribution à étymologie de l' oronyme slovène Nanos
Directory of Open Access Journals (Sweden)
Anton Grad
1982-12-01
Full Text Available Pour ll' origine de l' oronyme slovène Nanos (a l' est de Trieste, obscure jusqu'ici, l' auteur propose, en se basant sur le nom italien de la montagne, à savoir Naso (= nez df M.onte Re, la base romane Nason (= gros nez, désignation populaire - supposée par l' auteur - de la montagne, d' où par metathèse s - n > n - s, en slovène Nanos.
Patrilineal traditional family: Examples of Serbia and Bulgaria
Directory of Open Access Journals (Sweden)
Rajković Ljubica
2014-01-01
Full Text Available The paper aims to investigate from comparative and sociological perspective the similarities between the roles of family and household in social development of Bulgaria and Serbia. The focus of the study is placed on the similarities and differences between the traditional phase of development and the industrial, modern one. Modern society as a whole is defined as untransformed and subject to re-traditionalization. The investigation rests on the assumption that within East European model, the traditional family/household is a phenomenon linked to the 19th and 20th centuries, but not to the 21st one. However, the Balkan extended family/household retains the influence it had in the traditional phase of development. In the traditional phase, the extended family commune (zadruga, characteristic of the Balkans, played an essential role for survival. In modern societies, it regains its importance for survival during social and economic crises; however, it also poses traditionally experienced risks concerning substantial deterioration of the position of women. [Projekat Ministarstva nauke Republike Srbije, br. 179035: The New Challenges Of Social Integration In Serbia - Challenges And Actors
Do the majority of South Africans regularly consult traditional healers?
Directory of Open Access Journals (Sweden)
Gabriel Louw
2016-12-01
Full Text Available Background The statutory recognition of traditional healers as healthcare practitioners in South Africa in terms of the Traditional Health Practitioners Act 22 of 2007 is based on various assumptions, opinions and generalizations. One of the prominent views is that the majority of South Africans regularly consult traditional healers. It even has been alleged that this number can be as high as 80 per cent of the South African population. For medical doctors and other health practitioners registered with the Health Professions Council of South Africa (HPCSA, this new statutory status of traditional health practitioners, means the required presence of not only a healthcare competitor that can overstock the healthcare market with service lending, medical claims and healthcare costs, but also a competitor prone to malpractice. Aims The study aimed to determine if the majority of South Africans regularly consult traditional healers. Methods This is an exploratory and descriptive study following the modern historical approach of investigation and literature review. The emphasis is on using current documentation like articles, books and newspapers, as primary sources to determine if the majority of South Africans regularly consult traditional healers. The findings are offered in narrative form. Results It is clear that there is no trustworthy statistics on the percentages of South Africans using traditional healers. A scientific survey is needed to determine the extent to which traditional healers are consulted. This will only be possible after the Traditional Health Practitioners Act No 22 has been fully enacted and traditional health practitioners have become fully active in the healthcare sector. Conclusion In poorer, rural areas no more than 11.2 per cent of the South African population regularly consult traditional healers, while the figure for the total population seems to be no more than 1.4 per cent. The argument that the majority of South
Patients Consulting Traditional Health Practioners In The Context Of ...
African Journals Online (AJOL)
Patients Consulting Traditional Health Practioners In The Context Of Hiv/Aids In Urban Areas In Kwazulu-Natal, South Africa. ... A number of HIV positive patients were using traditional medicine and ART concurrently, dropped out of ART because of side effects and were using traditional medicine for HIV. Keywords: Patients ...
Liking of traditional cheese and consumer willingness to pay
Directory of Open Access Journals (Sweden)
Ada Braghieri
2014-03-01
Full Text Available We review herein the relevance of credence and sensory attributes for cheese liking as a basis for subsequent discussion on attributes related to traditional dairy products such as place of origin, process characteristics, etc. Several studies suggest that place of origin may have a positive impact on consumer evaluation. In addition, protected designation of origin labels generally affects consumers’ purchasing decisions, with a premium price paid for traditional products. Some of the main dimensions of traditional food products are: familiarity of the product, processing through traditional recipes, sensory properties and origins. However, different dimensions can be relevant for consumers of different countries. Southern European regions frequently tend to associate the concept of traditional with broad concepts such as heritage, culture or history; whereas central and northern European regions tend to focus mainly on practical issues such as convenience, health or appropriateness. Sensitivity to traditional cheese attributes may also vary according to different groups of consumers with older, more educated and wealthier subjects showing higher willingness to pay and acceptance levels. Given that sensory properties play a central role in product differentiation, we can conclude that information about credence attributes, if reliable, positively perceived and directed to sensitive groups of consumers, is able to affect consumer liking and willingness to pay for traditional cheese. Thus, it provides a further potential tool for product differentiation to small-scale traditional farms, where husbandry is often based on extensive rearing systems and production costs tend to be higher.
Directory of Open Access Journals (Sweden)
Maria Isabel Suero
2011-10-01
Full Text Available This study compared the educational effects of computer simulations developed in a hyper-realistic virtual environment with the educational effects of either traditional schematic simulations or a traditional optics laboratory. The virtual environment was constructed on the basis of Java applets complemented with a photorealistic visual output. This new virtual environment concept, which we call hyper-realistic, transcends basic schematic simulation; it provides the user with a more realistic perception of a physical phenomenon being simulated. We compared the learning achievements of three equivalent, homogeneous groups of undergraduates—an experimental group who used only the hyper-realistic virtual laboratory, a first control group who used a schematic simulation, and a second control group who used the traditional laboratory. The three groups received the same theoretical preparation and carried out equivalent practicals in their respective learning environments. The topic chosen for the experiment was optical aberrations. An analysis of variance applied to the data of the study demonstrated a statistically significant difference (p value <0.05 between the three groups. The learning achievements attained by the group using the hyper-realistic virtual environment were 6.1 percentage points higher than those for the group using the traditional schematic simulations and 9.5 percentage points higher than those for the group using the traditional laboratory.
Optimal Stand Management: Traditional and Neotraditional Solutions
Karen Lee Abt; Jeffrey P. Prestemon
2003-01-01
The traditional Faustmann (1849) model has served as the foundation of economic theory of the firm for the forestry production process. Since its introduction over 150 years ago, many variations of the Faustmann have been developed which relax certain assumptions of the traditional model, including constant prices, risk neutrality, zero production and management costs...
African Journal of Traditional, Complementary and Alternative ...
African Journals Online (AJOL)
The present study was aimed to evaluate the wound healing activity of extract of bark part of Mimusops elengi. It is well-known plant in Indian traditional medicines. On the basis of traditional use and literature references, this plant was selected for wound healing potential. A methanolic extract of bark parts of Mimusops ...
Backpacking with a Prayer: Tradition and Modernity
Davidovitch, Nitza
2016-01-01
This study focuses on the phenomenon of Israeli backpacking as a function of traditional, observant, and secular population segments. We explored whether and to what degree backpacking features are related to the affinity of backpackers with the Jewish tradition and faith. Our study was based on a sample of 120 Israeli backpackers who had returned…
Exploring traditional and cyberbullying among Irish adolescents.
Callaghan, Mary; Kelly, Colette; Molcho, Michal
2015-02-01
This study aimed to explore the associations of traditional and cyberbullying victimisation with self-reported health and life satisfaction, and to examine whether involvement in risk behaviours contributes to these health outcomes. We asked questions on involvement in traditional and cyberbullying, risk behaviours, self-reported health and life satisfaction to school children. In total, 318 students aged from 15 to 18 years old in 8 post-primary schools in Ireland completed the survey. Children who were victims of bullying were more likely to report poor health, low life satisfaction and engaging in risky behaviours. Although not statistically significant, we found that cyber victimisation was positively associated with increased reporting of poor health and low life satisfaction. Traditional bullying is the most common type of bullying among school children in Ireland, and overall, seems to have a stronger association with poor health. However, a sizable proportion of children are victims of cyberbullying or of both cyberbullying and traditional bullying. It is, therefore, important to acknowledge, identify and address all types of bullying to improve the health outcomes of children.
Traditional Bullying as a Potential Warning Sign of Cyberbullying
Kowalski, Robin M.; Morgan, Chad A.; Limber, Susan P.
2012-01-01
Although traditional bullying and cyberbullying share features in common, they differ in important ways. For example, cyberbullying is often characterized by perceived anonymity and can occur any time of the day or night. Conversely, perpetrators of traditional bullying are known to the victim, and most traditional bullying occurs at school. Yet,…
Yu, Ming; Cao, Qi-chen; Su, Yu-xi; Sui, Xin; Yang, Hong-jun; Huang, Lu-qi; Wang, Wen-ping
2015-08-01
Malignant tumor is one of the main causes for death in the world at present as well as a major disease seriously harming human health and life and restricting the social and economic development. There are many kinds of reports about traditional Chinese medicine patent prescriptions, empirical prescriptions and self-made prescriptions treating cancer, and prescription rules were often analyzed based on medication frequency. Such methods were applicable for discovering dominant experience but hard to have an innovative discovery and knowledge. In this paper, based on the traditional Chinese medicine inheritance assistance system, the software integration of mutual information improvement method, complex system entropy clustering and unsupervised entropy-level clustering data mining methods was adopted to analyze the rules of traditional Chinese medicine prescriptions for cancer. Totally 114 prescriptions were selected, the frequency of herbs in prescription was determined, and 85 core combinations and 13 new prescriptions were indentified. The traditional Chinese medicine inheritance assistance system, as a valuable traditional Chinese medicine research-supporting tool, can be used to record, manage, inquire and analyze prescription data.
Obadina, Adewale O; Oyewole, Olusola B; Williams, Oluwasolabomi E
2013-07-01
This study was carried out to investigate and improve the traditional processing method and nutritional quality of the traditional cassava snack (Ajogun). Cassava root (Manihot esculenta Crantz L.) of TME 419 variety was processed into mash (40% moisture content). The cassava mash was mixed into different blends to produce fried traditional "Ajogun", fried and baked extrudates (modified Ajogun) as snacks. These products were analyzed to determine the proximate composition including carbohydrate, fat, protein, fiber, ash, and moisture contents and functional properties such as bulk density. The results obtained for the moisture, fat, protein, and ash contents showed significant difference (P extrudates. However, there was no significant difference (P > 0.05) in the carbohydrate and fiber contents between the three samples. There was no significant difference (P > 0.05) in the bulk density of the snacks. Also, sensory evaluation was carried out on the cassava-based snacks using the 9-point hedonic scale to determine the degree of acceptability. Results obtained showed significant difference (P extrudates and control sample in terms of appearance, taste, flavor, color, aroma, texture, and overall acceptability. The highest acceptability level of the product was at 8.04 for the control sample (traditional Ajogun). This study has shown that "Ajogun", which is a lesser known cassava product, is rich in protein and fat.
Criteria of ‘authenticity’ in traditional Georgian musical performance
Directory of Open Access Journals (Sweden)
Gabisonia Tamaz
2014-01-01
Full Text Available Today we often use term ‘authentic’ in relation to different appearances of Georgian folk music. Along with the unambiguous meaning ‘real’ this term also has other meanings: ‘ethnic’, ‘rural’, ‘old’, ‘function of usual environment’, ‘traditional-stylistic’, ‘authoritative’, or ‘reproductive’. In spite of some interconnections that arise from the term ‘authentic’ and its other meanings, the most relevant way to apply this popular term for performers and audiences of ‘real folklore’ is traditionality. This factor is manifested in the following contexts: a performer (receiver and distributor of tradition, unobtrusively and orally, b motivation/function (representative and spontaneous function, hereditary, utilitarian and aesthetic-daily motivation, c repertoire (compliance of musical and verbal text’s sample with its social function, eluding canonized versions, d expression (adequate articulation, performing regulation which is not determined by the stage, traditional instrument etc.. The problem of authenticity is more successfully regulated in traditional Georgian church music than in folk music. For the latter, in this regard the special difficulty is caused by identification of modern trends that contain folk motifs. The most popular among them is distinctive, with its stylistic reminiscent layer from the Eastern Georgian Mountains, which we refer as ‘para-folkore’. Notwithstanding the fact that Georgian folklore is not centrally authorized, modernization of folklore samples and also those manifestations of post-folklore that are further away from the traditional motifs attract a wide range of listeners. Essentially, the meaning of ‘authentic’ in the Georgian ethno-musical context is presented as performance of the traditional rural repertoire with traditional articulation. However, we think that it is convenient for the criteria of traditional, usual environment to be added to this
Polanyi and the Role of Tradition in Scientific Inquiry
Mitchell, Mark T.
2011-01-01
A characteristic of the modern mind is a disdain for tradition. Polanyi argues that neglecting the role of tradition leads to philosophical incoherence as well as moral and political chaos. Polanyi's postcritical philosophy represents an attempt to show how tradition plays a vital role in the process of discovery. Ultimately, a coherent account of…
Twelve Girls' Band' A Modern Miracle of Traditional Music
Institute of Scientific and Technical Information of China (English)
YaoZhanxiong
2004-01-01
Twelve antique traditional instruments. Twelve spirited, pretty girls. "Twelve Girls' Band" is a traditional instrument orchestra playing well-known folk music in the form of pop. Besides age-old traditional instruments peculiar to China, such as zheng (ancient 21 to 25-stringed plucked instrument), qin (seven-stringed plucked instrument) and erhu (two-stringed Chinese fiddle),
Insomnia in Iranian Traditional Medicine
Feyzabadi, Zohre; Jafari, Farhad; Feizabadi, Parvin Sadat; Ashayeri, Hassan; Esfahani, Mohammad Mahdi; Badiee Aval, Shapour
2014-01-01
Context: Insomnia is one of the most prevalent sleep disorders characterized by sleep difficulty that impairs daily functioning and reduces quality of life. The burden of medical, psychiatric, interpersonal, and societal consequences of insomnia expresses the importance of diagnosing and treatment of insomnia. The aim of study was to investigate causes of insomnia from the viewpoint of Iranian traditional medicine. Evidence Acquisition: In this review study, we searched insomnia in a few of the most famous ancient textbooks of Iranian traditional medicine from different centuries. This books includeThe Canon of Medicine by Avicenna (the first version of Beirut), Zakhire Kharazmshahi by Jurjani (the scanned version of Bonyade Farhang-e Iran), Malfaregh by Razes (the first version of Iran University of Medical Sciences), and Aqili’s cure by Aqili (the first version of Iran University of Medical Sciences). Results: This study found that in Iranian traditional medicine manuscripts, insomnia was called sahar and even though many factors induce insomnia, most of them act through causing brain dystemperament. Conclusions: The brain dystemperament is considered one of the main causes of insomnia and insomnia can be well managed with an organized line of treatment, by correcting the brain dystemperament through elimination of causes. This study helps to find new solutions to treat insomnia. PMID:24829786
Traditional Therapies for Skin Wound Healing.
Pereira, Rúben F; Bártolo, Paulo J
2016-05-01
Significance: The regeneration of healthy and functional skin remains a huge challenge due to its multilayer structure and the presence of different cell types within the extracellular matrix in an organized way. Despite recent advances in wound care products, traditional therapies based on natural origin compounds, such as plant extracts, honey, and larvae, are interesting alternatives. These therapies offer new possibilities for the treatment of skin diseases, enhancing the access to the healthcare, and allowing overcoming some limitations associated to the modern products and therapies, such as the high costs, the long manufacturing times, and the increase in the bacterial resistance. This article gives a general overview about the recent advances in traditional therapies for skin wound healing, focusing on the therapeutic activity, action mechanisms, and clinical trials of the most commonly used natural compounds. New insights in the combination of traditional products with modern treatments and future challenges in the field are also highlighted. Recent Advances: Natural compounds have been used in skin wound care for many years due to their therapeutic activities, including anti-inflammatory, antimicrobial, and cell-stimulating properties. The clinical efficacy of these compounds has been investigated through in vitro and in vivo trials using both animal models and humans. Besides the important progress regarding the development of novel extraction methods, purification procedures, quality control assessment, and treatment protocols, the exact mechanisms of action, side effects, and safety of these compounds need further research. Critical Issues: The repair of skin lesions is one of the most complex biological processes in humans, occurring throughout an orchestrated cascade of overlapping biochemical and cellular events. To stimulate the regeneration process and prevent the wound to fail the healing, traditional therapies and natural products have been used
Marriage ceremony: The clash between traditional marriage rites ...
African Journals Online (AJOL)
Marriage ceremony: The clash between traditional marriage rites and ... and a woman who has agreed to marry, be socially described as a married couple ... People agreed that traditional marriage rites should be compulsory but performance ...
[Research progress on potential liver toxic components in traditional Chinese medicine].
Wu, Hao; Zhong, Rong-Ling; Xia, Zhi; Huang, Hou-Cai; Zhong, Qing-Xiang; Feng, Liang; Song, Jie; Jia, Xiao-Bin
2016-09-01
In recent years, the proportion of traditional Chinese medicine in scientific research and its clinical use increased gradually. The research result also becomes more and more valuable, but in the process of using traditional Chinese medicine, it also needs to pay more attention. With the gradual deepening of the toxicity of traditional Chinese medicine, some traditional Chinese medicines have also been found to have the potential toxicity, with the exception of some traditional toxicity Chinese medicine. Traditional Chinese medicine in the growth, processing, processing, transportation and other aspects of pollution or deterioration will also cause the side effects to the body. Clinical practice should be based on the theory of traditional Chinese medicine to guide rational drug use and follow the symptomatic medication, the principle of proper compatibility. The constitution of the patients are different, except for a few varieties of traditional Chinese medicines are natural herbs with hepatotoxicity, liver toxicity of most of the traditional Chinese medicine has idiosyncratic features. The liver plays an important role in drug metabolism. It is easy to be damaged by drugs. Therefore, the study of traditional Chinese medicine potential liver toxicity and its toxic components has become one of the basic areas of traditional Chinese medicine research. Based on the review of the literatures, this paper summarizes the clinical classification of liver toxicity, the pathogenesis of target cell injury, and systematically summarizes the mechanism of liver toxicity and toxic mechanism of traditional Chinese medicine. This paper provided ideas for the study of potential liver toxicity of traditional Chinese medicine and protection for clinical safety of traditional Chinese medicine. Copyright© by the Chinese Pharmaceutical Association.
Students Awareness towards Traditional Cultural Dances in Sarawak, Malaysia
Directory of Open Access Journals (Sweden)
Ahmad R. Albattat
2016-07-01
Full Text Available Malaysia has many ethnic groups, and each ethnic group has own custom and tradition that most Malaysians are not aware, especially traditional dances. Among the Malaysian states, Sabah and Sarawak, situated in the Borneo Island have the most diverse ethnic groups in Sarawak. It has more than 30 ethnic groups. Each of the ethnic groups has its own language, cultures and lifestyle. In this regards, this research focuses on the main ethnic groups of Sarawak which are Orang Ulu, Malays, Melanau, Bidayuh, Chinese and Ibans. The aim of this study is to investigate the level of awareness among the Management and Science University (MSU students regarding their level of awareness and knowledge about traditional dances of Sarawak. The data were gathered by distributing questionnaires among MSU students. The data were then analysed using SPSS system version 18.0. Results concluded that, most of MSU students have limited knowledge about Sarawak traditional dances. Interests, internet, performing arts clubs and family background are the independent variable factors to learn and gain knowledge about Sarawak traditional dances. The level of awareness among MSU students towards Sarawak traditional dances can be enhanced through events and special occasions to increase level of awareness towards Sarawak cultures. The government plays a major role in introducing Sarawak cultures to the whole of Malaysia. Future studies could focus on factors that influence the level of awareness towards Sarawak traditional dances, and the contribution of Sarawak’s traditional dances to Malaysia’s cultural and heritage tourism.
Traditional versus internet bullying in junior high school students.
Gofin, Rosa; Avitzour, Malka
2012-11-01
To examine the prevalence of traditional and Internet bullying and the personal, family, and school environment characteristics of perpetrators and victims. Students (12-14 years old) in 35 junior high schools were randomly selected from the Jerusalem Hebrew (secular and religious) and Arab educational system (n = 2,610). Students answered an anonymous questionnaire, addressing personal, family, and school characteristics. Traditional bullying and Internet bullying for perpetrators and victims were categorized as either occurring at least sometimes during the school year or not occurring. Twenty-eight percent and 8.9 % of students were perpetrators of traditional and Internet bullying, respectively. The respective proportions of victims were 44.9 and 14.4 %. Traditional bullies presented higher Odds Ratios (ORs) for boys, for students with poor social skills (those who had difficulty in making friends, were influenced by peers in their behavior, or were bored), and for those who had poor communication with their parents. Boys and girls were equally likely to be Internet bullies and to use the Internet for communication and making friends. The OR for Internet bullying victims to be Internet bullying perpetrators was 3.70 (95 % confidence interval 2.47-5.55). Victims of traditional bullying felt helpless, and victims of traditional and Internet bullying find school to be a frightening place. There was a higher OR of Internet victimization with reports of loneliness. Traditional bully perpetrators present distinctive characteristics, while Internet perpetrators do not. Victims of traditional and Internet bullying feel fear in school. Tailored interventions are needed to address both types of bullying.
Use of Traditional Botanical Medicines During Pregnancy in Rural Rwanda.
Beste, Jason; Asanti, Daniel; Nsabimana, Damien; Anastos, Kathryn; Mutimura, Eugene; Merkatz, Irwin; Sirotin, Nicole; Nathan, Lisa M
To evaluate the perceptions of healthcare and traditional medicine providers regarding the type, indications, side effects, and prevalence of traditional medicine use amongst pregnant women in a rural Rwandan population. Six focus groups with physicians, nurses, and community health workers and four individual in-depth interviews with traditional medicine providers were held. Qualitative data was gathered using a structured questionnaire querying perceptions of the type, indications, side effects, and prevalence of use of traditional medicines in pregnancy. The healthcare provider groups perceived a high prevalence of traditional botanical medicine use by pregnant women (50-80%). All three groups reported similar indications for use of the medicines and the socioeconomic status of the pregnant women who use them. The traditional medicine providers and the healthcare providers both perceived that the most commonly used medicine is a mixture of many plants, called Inkuri. The most serious side effect reported was abnormally bright green meconium with a poor neonatal respiratory drive. Thirty-five traditional medicines were identified that are used during pregnancy. Perceptions of high prevalence of use of traditional medicines during pregnancy with possible negative perinatal outcomes exist in areas of rural Rwanda.
Bennett, Kelly J; Olsen, Jennifer M; Harris, Sara; Mekaru, Sumiko; Livinski, Alicia A; Brownstein, John S
2013-12-16
Hurricane Isaac made landfall in southeastern Louisiana in late August 2012, resulting in extensive storm surge and inland flooding. As the lead federal agency responsible for medical and public health response and recovery coordination, the Department of Health and Human Services (HHS) must have situational awareness to prepare for and address state and local requests for assistance following hurricanes. Both traditional and non-traditional data have been used to improve situational awareness in fields like disease surveillance and seismology. This study investigated whether non-traditional data (i.e., tweets and news reports) fill a void in traditional data reporting during hurricane response, as well as whether non-traditional data improve the timeliness for reporting identified HHS Essential Elements of Information (EEI). HHS EEIs provided the information collection guidance, and when the information indicated there was a potential public health threat, an event was identified and categorized within the larger scope of overall Hurricane Issac situational awareness. Tweets, news reports, press releases, and federal situation reports during Hurricane Isaac response were analyzed for information about EEIs. Data that pertained to the same EEI were linked together and given a unique event identification number to enable more detailed analysis of source content. Reports of sixteen unique events were examined for types of data sources reporting on the event and timeliness of the reports. Of these sixteen unique events identified, six were reported by only a single data source, four were reported by two data sources, four were reported by three data sources, and two were reported by four or more data sources. For five of the events where news tweets were one of multiple sources of information about an event, the tweet occurred prior to the news report, press release, local government\\emergency management tweet, and federal situation report. In all circumstances where
A systems approach to traditional oriental medicine
DEFF Research Database (Denmark)
Kim, Hyun Uk; Ryu, Jae Yong; Lee, Jong Ok
2015-01-01
Analyzing structural similarities between compounds derived from traditional oriental medicine and human metabolites is a systems-based approach that can help identify mechanisms of action and suggest approaches to reduce toxicity.......Analyzing structural similarities between compounds derived from traditional oriental medicine and human metabolites is a systems-based approach that can help identify mechanisms of action and suggest approaches to reduce toxicity....
Precision medicine and traditional chinese medicine of dialogue
Directory of Open Access Journals (Sweden)
Lou Xin
2017-01-01
Full Text Available The precision medicine is more precise individualized medicine, based on the patient’s genes or physiological to formulate the specific treatment plan, for the realization of individualized treatment of various diseases to provide valuable information.But with the progress of modern science and technology, modern medicine dependence on medical instruments are too serious, traditional ways are gradually forgotten.If the machine depends on the instrument test results too serious which don’t combined with the actual diagnosis, the cause of misdiagnosis, so we should pay attention to the overall analysis of diseases and systematic diagnosis and examination, use of the overall treatment concept traced back to find the cause of Traditional Chinese Medicine, finally decide to select a best treatment plan.We should use the dialectical attitude to look at the precise medical. Not blindly requirements according to the road of precision medicine of Traditional Chinese Medicine to go, to shine in himself field, form of self characteristic of Traditional Chinese Medicine.Can learn some of the advantages of accurate concept, the good and rejecting the bad, hope the Traditional Chinese Medicine in the modern environment more walk more far.
New rurality, traditional music and tourist experience
Directory of Open Access Journals (Sweden)
Margarida Vaz
2017-03-01
Full Text Available Fernando Lopes-Graça, a prolific Portuguese composer, joined the French musicologist Michel Giacometti (1929-1990 in the effort of collecting and cataloguing popular songs, culminating in a collection of recordings, unique in Europe, which covered all Portugal. In the context of this paper we intend to show how the work of Lopes-Graça, challenging the traditional music, can allow a touring through traditions, while allowing design a cultural environment for the most demanding tourists. The purpose of this research is to develop a tourism product in the near future based on Lopes-Graça and Giacometti’s (musical and spatial journey through Portuguese traditional music, which portray a rural Portugal in all its dimensions including beliefs, uses and activities.
Directory of Open Access Journals (Sweden)
I Made Netra
2015-01-01
Full Text Available This is the study of traditional rice planting ritual discourse of the traditional farming community of Bayan, North Lombok in an ethno-pragmatic perspective. It is specifically aimed at describing the cultural norms and their meaning configurations. The theory used in the study is the cultural scripts developed by Wierzbicka (2002a considering that cultural norms constitute rules and regulations in social interaction practices. They can be investigated from the use of grammatical aspects of language and linguistic routines which are context-bound. They can be configured by paraphrasing in simple and mini language using single space. The results of the study showed that there were some cultural norms found on the traditional rice planting ritual discourse of the traditional farming community of Bayan, North Lombok. They included: (1 asserting thought and hope, (2 respecting other entities, (3 apologizing, (4 promising, and (5 giving advice. The configuration of these cultural norms was in accordance with the understanding of local cultural scripts and wisdom in terms of rituals of the local farming system. The configuration is constructed in low-level script with components of “when” and “if”. It contains the aspects of thinking, speaking, and doing. It is derived from the semantic primes of both evaluation and perception.
Nitrogen-doped carbon nanotubes as a metal catalyst support
CSIR Research Space (South Africa)
Mabena, LF
2011-05-01
Full Text Available ., which are among the most commonly used heterogeneous catalyst supports (Mart??nez-Me?ndez et al. 2006). Catalyst activity depends on the particle size and appropriate dis- tance between each particle. These catalysts deposited on a support... supported Pt electrodes. Appl Catal B Environ 80:286?295 Maldonado S, Morin S, Stevenson KJ (2006) Structure, composition, and chemical reactivity of carbon nanotubes by selective nitrogen doping. Carbon 44:1429?1437 Mart??nez-Me?ndez S, Henr??quez Y...
Confucianism and the Asian Martial Traditions
Directory of Open Access Journals (Sweden)
C. Alexander Simpkins
2012-07-01
Full Text Available Confucianism has been foundational in the political and social life of many Asian countries. Its influence pervades institutions and practices at every level of human activity. Martial arts have also benefited from this philosophy, as the traditional Confucian legacy continues to influence modern practices. This article briefly highlights some key figures and events, describes relevant core concepts of Confucian philosophy, and then shows exemplary applications to martial arts today. Modern martial artists can gain understanding of the traditional Confucian insights that deepen the significance of contemporary martial arts.
An Analysis of the Impact of Traditional Chinese Culture on Chinese Education
Mingyuan, Gu
2006-01-01
The educational tradition of China has developed from traditional Chinese culture. Without an understanding of the cultural impact on traditional education, it is impossible to comprehend the educational tradition of China and to change its traditional educational ideas. There are fine traditions and feudal remains in Chinese culture which ought…
Implementation of Traditional Malay Design Values in Contemporary Malay Houses
Elham Hosseini; Gurupiah Mursib; Raja Nafida Raja Shahminan
2016-01-01
Traditional houses are the most essential architectural experience that is in harmony with the people's culture, beliefs, environment and lifestyles. The development of design values in contemporary architecture by tracking traditional design values in architecture paves the way for arguments concerning the implementation of authentic Malay traditional house design values in contemporary Malay houses. In addition, it is hypothesized that the Malay traditional houses theoretically provide a co...
Comparison of pressure-driven membrane processes and traditional ...
African Journals Online (AJOL)
In this article a comparison is made between drinking water production from surface water using pressure-driven membrane processes and using traditional surface water treatment systems. Three alternatives are considered: Traditional treatment using coagulation/flocculation, sand filtration, physicochemical softening, ...
Traditional formwork system sustainability performance: experts’ opinion
Taher Al-ashwal, Mohammed; Abdullah, Redzuan; Zakaria, Rozana
2017-11-01
The traditional formwork system is one of the commonly used systems in concrete construction. It is considered as one of the least observed activities in term of sustainability performance. In this paper, the sustainability performance of the traditional formwork has been assessed by using a multi-criteria assessment tool to facilitate the decision on the sustainability performance measurement. A quantitative five Likert scale survey study using judgemental sampling is employed in this study. A sample of 93 of engineering construction experts, with different fields including contractors, developers, and consultants in the Malaysian context has made the body of the collected primary data. The results show variety in the distribution of the respondents’ working experience. The sustainability performance is considered moderately sustainable by the experts with only given 40.24 % of the overall total score for the three sustainable categories namely environmental, social and economic. Despite the finding that shows that the economic pillar was rated as the most sustainable aspect in comparison to the environmental and social pillars the traditional formwork system sustainability still needs enhancement. Further incorporation of the social and environmental pillars into the concrete construction the sustainability performance of traditional formwork system could be improved.
The British Royal Family’s Circumcision Tradition
Directory of Open Access Journals (Sweden)
Robert Darby
2013-10-01
Full Text Available The birth of Prince William’s son in July 2013 was the occasion for an outpouring of media speculation about the fate of the royal baby’s foreskin. The possibility that he might be circumcised was connected to a purported tradition of circumcision within the British royal family, said to be have been initiated either by Queen Victoria or by George I. In this article, we trace the origins and evolution of these stories and assess their validity. Our conclusion is that belief in a royal circumcision tradition derives from the reported circumcision of Prince Charles by the mohel Jacob Snowman in 1948, and the efforts of the British Israelite movement to concoct a “lost tribes of Israel” origin for the British race. These elements merged into a fully developed narrative that was widely disseminated from the late 1990s. The initially separate claim that the tradition was imported from Hanover by George I can be sourced precisely to 2012. We further show that these stories are inventions, and that the royal family circumcision tradition should be regarded as a classic instance of a contemporary legend or urban myth.
Blending traditional and digital marketing
Directory of Open Access Journals (Sweden)
Raluca Dania TODOR
2016-07-01
Full Text Available It is a matter of fact that we are in the digital era and internet marketing and social media have a significant impact on the way consumers behave, companies do business and it is a must for companies to adapt to the new reality. Due to the fast evolution of the technology, the continuous increase in demand and supply, the supply chain elongation and the big amount of date, the only solution to face the major changes is the automation of all the processes. But even though the new era of communication is here, specialist suggest that companies should not ignore traditional methods, and to try to blend digital marketing with traditional campaigns in order to achieve their goals.
[Hygiene between tradition and implementation].
Hansis, M L
2004-04-01
The basis of evidence for hygiene rules implemented in hospitals is traditionally small. This is not only because there is little theoretical knowledge on the reciprocal influence between a single hygienic mistake/a single microbial input and the manifestation of a nosocomial infection. There are also not enough clinical studies, especially on complex hygiene questions, to determine whether special measures (e.g., septic rooms)can compensate for deficits in hygiene practice. Furthermore, it would be necessary to designate security buffers distinctly. In-house traditions are able to stabilize hygienic behavior in an excellent manner. They should be fostered and not disparaged as myths. Discussions of experts should not be conducted in public; that is disastrous for the everyday work of physicians in hospitals.
Communicating new ideas to traditional villagers (an Indonesian case).
Muis, A
1984-01-01
Recent cases derived from a series of communication research projects conducted in remote villages on the island of Sulawesi, Indonesia, are presented. These cases, which indicate the tremendously complex problem of communicating new ideas to traditional villages, also reflect the equally complex problem of social marketing. Indonesian, villagers remain very traditional, but their communication environment has been undergoing marked changes over the past decade or so. Overwhelming media exposure has pushed these people towards a modern environment filled with new knowledge and experiences. In view of the importance of changing attitudes and behavior of traditional villagers -- to realize modernization for the rural society -- the government of Indonesia has been using a host of communication means and channels. These include all the viable traditional or indigenous communication systems, but mainly face-to-face communication. Traditional dances, story-telling, and music are no longer interesting to the rural people themselves, and, apparently, no real developmental message can be transmitted by traditional "mass media." Among the 50 respondents randomly selected from the isolated village of Gelang (Case I), only 17% claimed to have listened to news in addition to music and songs. 67% of the respondents explained that information carrying novel ideas or methods usually attract them, but they are always reluctant to accept the new ideas for real application. Case II is about the effect of movie exposure on traditional villagers. As many as 73% of 50 respondents explained that the knowledge of the peasant-fisherman has increased considerably with regard to the urban way of life, as a result of movie attendance. The informants indicated that many villagers were disgusted by feature films or theatrical ones and that 62% of the villagers had yet to go to a movie. Case III involved the communication of new methods of medication to rural societies, including traditional
Indian Traditional Ayurvedic System of Medicine and Nutritional Supplementation
Directory of Open Access Journals (Sweden)
M. M. Pandey
2013-01-01
Full Text Available Food is the major source for serving the nutritional needs, but with growing modernization some traditional ways are being given up. Affluence of working population with changing lifestyles and reducing affordability of sick care, in terms of time and money involved, are some of the forces that are presently driving people towards thinking about their wellness. There has been increased global interest in traditional medicine. Efforts to monitor and regulate traditional herbal medicine are underway. Ayurveda, the traditional Indian medicine, remains the most ancient yet living traditions. Although India has been successful in promoting its therapies with more research and science-based approach, it still needs more extensive research and evidence base. Increased side effects, lack of curative treatment for several chronic diseases, high cost of new drugs, microbial resistance and emerging, diseases are some reasons for renewed public interest in complementary and alternative medicines. Numerous nutraceutical combinations have entered the international market through exploration of ethnopharmacological claims made by different traditional practices. This review gives an overview of the Ayurvedic system of medicine and its role in translational medicine in order to overcome malnutrition and related disorders.
Management of Breast Milk Oversupply in Traditional Persian Medicine.
Kabiri, Marya; Kamalinejad, Mohammad; Sohrabvand, Farnaz; Bioos, Soodabeh; Babaeian, Mohammad
2017-10-01
Comprehensive explanation about milk oversupply is not available in the current literature because few studies have been done on this topic. In traditional Persian medicine, milk oversupply and its management have been described. The aim of this study was to investigate milk oversupply from the perspective of medieval Persian practitioners. In this study, some main medical resources of traditional Persian medicine such as Al-Havi and the Canon of Medicine were studied to extract valuable information about milk oversupply. Etiology of milk overproduction according to traditional Persian medicine is based on humors theory and cannot be easily compared with current medical concepts. Diet modifications and natural remedies have been applied for managing this condition but the majority of traditional Persian medicine interventions for reducing milk oversupply have not been scientifically investigated in modern medicine. The knowledge of milk oversupply in traditional Persian medicine may be helpful to conduct further related studies.
Certainty, leaps of faith, and tradition: rethinking clinical interventions.
Dzurec, L C
1998-12-01
Clinical decision making requires that clinicians think quickly and in ways that will foster optimal, safe client care. Tradition influences clinical decision making, enhancing efficiency of resulting nursing action; however, since many decisions must be based on data that are either uncertain, incomplete, or indirect, clinicians are readily ensnared in processes involving potentially faulty logic associated with tradition. The author addresses the tenacity of tradition and then focuses on three processes--consensus formation, the grounding of certainty in inductive reasoning, and affirming the consequent--that have affected clinical decision making. For some recipients of care, tradition has had a substantial and invalid influence on their ability to access care.
Picrorhiza scrophulariiflora, from traditional use to immunomodulatory activity
Smit, Hobbe Friso
2000-01-01
Natural products have been an important resource for the maintenance of life for ages. Evaluation of traditionally used medicines, keeping into account the traditional principles that are applied in drug therapy, may supply leads towards effective drug discovery. This thesis deals with the
Bernard of Clairvaux and the Cistercian Mystical Tradition
DEFF Research Database (Denmark)
McGuire, Brian Patrick
2013-01-01
Bernard of Clairvaux and the Cistercian mystical tradition; Bernard's hagiography, the Vita prima; Bernard, sharing with audience, perceptions of God's advent as the divine Word; Brothers of the New Monastery in 1098, less interest in the mystical; Medieval mystics and mystical traditions; Sensuous...
Lifescience Database Archive (English)
Full Text Available entage concerning shoot regeneration 2 ME10-141 ... Chr07 19.51 6.84 ... 10.1186/1471-2229-11-140 22014149 ... QT73653 Solanum lycopersicum Solanaceae SpRg-7 In vitro plant regeneraion bud perc
The ′Guslar′: Individual identity and tradition
Directory of Open Access Journals (Sweden)
Lajić-Mihajlović Danka
2007-01-01
Full Text Available The subject of this paper is the relation between individual and collective identity within the folk-music tradition, from the perspective of ethnomusicology. Solo folk musicians have more latitude than those who perform in ensembles. They are more independent in developing their own style. As an example of this intermingling of individual and traditional styles, we have chosen Branko Perović, ′guslar′ (a singer of epic songs who accompanies himself on the ′gusle′ - currently one of the very best. Both his extraordinary vocal qualities and his unique combination of temperament and emotions have enabled Perović to develop an original performing style. By comparing the regional, Montenegrin style of gusle-playing (of which Perović is a representative with his personal style, we have established certain corresponding structures regarding a few basic analytical parameters: musical form at the macro-level, tonal structure, and harmonic structure. Individual characteristics are to be found in melodic patterns, dynamics, agogics and ornaments, and to a certain extent, in rhythm. Although Perović is considered to be an ′innovator′ among folk musicians, taking a dynamic approach to tradition, he is, however, well received and highly rated in folk music circles, which is proof of his successful communication with his audience. His reputation and influence on other gusle-players makes him a worthy link in the chain of epic tradition. His performance underlines the importance of the connection between traditional music and society, within which he develops his own style according to his capacities and inclinations, although constantly referring to the functional and aesthetic criteria of his cultural environment in which he performs. This is how adopted models are being reshaped by both individual artistic style and the current cultural pattern of a given community. The individual identity (of the musician is in constant interaction with
Perception of Alzheimer Disease in Iranian Traditional Medicine.
Saifadini, Rostam; Tajadini, Haleh; Choopani, Rasool; Mehrabani, Mitra; Kamalinegad, Mohamad; Haghdoost, Aliakbar
2016-03-01
Alzheimer disease (AD) is the most common cause of dementia. In regards to the world's aging population, control and treatment of AD will be one of the major concerns of global public health in the next century. Alzheimer disease was not mentioned with the same phrase or its equivalent in traditional medical texts. The main of present paper was to investigate symptoms and causes of alzheimer disease from the view point of Iranian traditional medicine. In this qualitative study, we searched reliable sources of Iranian traditional medicine such as Canon of Medicide by Avicenna (Al-Quanon fi- tibb), Aghili cure by Aghili's (Molajat-E-aghili), Tib-E-Akbari, Exire -E-Aazam and Sharh-E-Asbab and some reliable resources of neurology were probed base on keywords to find a disease that had the most overlap in terms of symptoms with alzheimer disease. By taking from the relevant materials, the extracted texts were compared and analyzed. Findings showed that alzheimer disease has the most overlap with Nesyan (fisad-e-zekr, fisad-e-fekr and fisad-e-takhayol) symptoms in Iranian traditional medicine. Although this is not a perfect overlap and there are causes, including coldness and dryness of the brain or coldness and wetness that could also lead to alzheimer disease according to Iranian traditional medicine. According to Iranian traditional medicine, The brain dystemperement is considered the main causes of alzheimer disease. By correcting the brain dystemperement, alzheimer can be well managed. This study helps to suggest a better strategy for preventing and treating alzheimer in the future.
Traditional Chinese medicine information digitalization discussion.
Xie, Qi; Cui, Meng; Wu, Zhen-Dou; Zhao, Hong
2010-11-01
With the rapid development of information science, the ancient Traditional Chinese Medicine is combining with it rapidly, and forming a new discipline: Traditional Chinese Medicine (TCM) Informatics. TCM information digitalization is the process of digital processing, which uses modern information technology to obtain, process, store, and analyze TCM-related data, information, and knowledge. It gathers research, application development, and service in an integrated whole. This article systematically analyzes the key research issues of TCM informatics (e.g., on data resources, data standard, data system construction). Also, the methodology and technology of TCM information digitalization research are thoroughly discussed. The starting point of the research on traditional Chinese medical information digitalization was in question. The research from the current study research was drawn from collected information that was stored, transferred, and utilized. This process helped to place an emphasis on the topic, as well as extending its research areas. In addition, an innovative TCM information virtual study center was set up to support a great deal of fundamental work.
Energy Technology Data Exchange (ETDEWEB)
Lenio, Martha A.T. [REC Technology US, Inc., 1159 Triton Dr., Foster City, CA 94301 (United States); Lennon, A.J.; Ho-Baillie, A.; Wenham, S.R. [ARC Photovoltaics Centre of Excellence, University of NSW, Sydney, NSW 2052 (Australia)
2010-12-15
Many existing and emerging solar cell technologies rely on plated metal to form the front surface contacts, and aluminium to form the rear contact. Interactions between the metal plating solutions and the aluminium rear can have a significant impact on cell performance. This paper describes non-uniform nickel deposition on the sintered aluminium rear surface of passivated emitter and rear contacted (PERC) cells patterned using an inkjet printing technique. Rather than being plated homogeneously over the entire rear surface as is observed on an alloyed aluminium rear, the nickel is plated only in the vicinity of the point openings in the rear surface silicon dioxide dielectric layer. Furthermore, this non-uniform nickel deposition was shown to increase the contact resistance of the rear point contacts by an order of magnitude, resulting in higher series resistance values for these fabricated PERC cells. (author)
Profile and birthing practices of Maranao traditional birth attendants
Directory of Open Access Journals (Sweden)
Maghuyop-Butalid R
2015-10-01
Full Text Available Roselyn Maghuyop-Butalid, Norhanifa A Mayo, Hania T Polangi College of Nursing, Mindanao State University-Iligan Institute of Technology, Iligan City, Philippines Abstract: This study determined the profile and birthing practices in both modern and traditional ways among Maranao traditional birth attendants (TBAs in Lanao del Norte, Philippines. It employed a descriptive research design. The respondents were 50 Maranao TBAs selected through the snowball sampling technique. A questionnaire was developed by the researchers to identify the respondents’ modern birthing practices utilizing the Essential Intrapartum and Newborn Care (EINC Protocol. To determine their profile and traditional birthing practices, items from a previous study and the respondents’ personal claims were adapted. This study shows that Maranao TBAs have less compliance to the EINC Protocol and they often practice the traditional birthing interventions, thus increasing the risk of complications to both mother and newborn. Keywords: intrapartum and newborn care, modern birthing practices, traditional birthing practices
EXPLORING CONTEXTUAL CHARACTERISTICS OF TRADITIONAL MEDINAS IN NORTH AFRICA
Directory of Open Access Journals (Sweden)
Huyam Hadi Abudib
2016-04-01
Full Text Available In an age of globalization and standardization, cities around the world are losing their historical and cultural identity. Traditional cities of the Muslim world, in particular, are witnessing an increased transformation in their urban fabric, which is extremely different from their original one, and not necessarily better. This paper explores the historical precedents of three traditional medinas in North Africa, which are Tripoli, Tunis and Fez, from a comparative perspective. The aim of this study is to analyse key contextual characteristics of these cities in an attempt to derive key principles that are capable of improving the contemporary built environment and safeguarding the cultural identity of traditional medinas. The paper concludes with a number of lessons learned from the visual form, urban pattern and land-use of traditional medinas, and sets out challenges that face decision makers and designers in manifesting the essence of traditional medinas in contemporary urban form.
Nancy C. Ratner; Davin L. Holen
2007-01-01
Traditional ecological knowledge within specific cultural and geographical contexts was explored during an interactive session at the 8th World Wilderness Congress to identify traditional principles of sustainability. Participants analyzed the traditional knowledge contained in ten posters from Canada and Alaska and identified and discussed the traditional principles...
Driver response to the TetraStar Navigation Assistance System by age and sex
1997-07-01
This study is part of the evaluation of the FAST-TRAC operational test of an Intelligent Transportation System (ITS) in Michigan and is concerned with user perceptions and behaviors with Advanced Traveler Information Systems (ATIS). The use and perce...
Profile and birthing practices of Maranao traditional birth attendants.
Maghuyop-Butalid, Roselyn; Mayo, Norhanifa A; Polangi, Hania T
2015-01-01
This study determined the profile and birthing practices in both modern and traditional ways among Maranao traditional birth attendants (TBAs) in Lanao del Norte, Philippines. It employed a descriptive research design. The respondents were 50 Maranao TBAs selected through the snowball sampling technique. A questionnaire was developed by the researchers to identify the respondents' modern birthing practices utilizing the Essential Intrapartum and Newborn Care (EINC) Protocol. To determine their profile and traditional birthing practices, items from a previous study and the respondents' personal claims were adapted. This study shows that Maranao TBAs have less compliance to the EINC Protocol and they often practice the traditional birthing interventions, thus increasing the risk of complications to both mother and newborn.
Horton Revisited: African Traditional Thought and Western Science ...
African Journals Online (AJOL)
Over the years Robin Horton has argued for what he refers to as the 'continuity thesis' according to which there are theoretical similarities between African traditional thought and modern Western science. Horton's thesis stands in contrast to the standard Western anthropological appraisal of traditional African thought.
CB Soyapi REGULATING TRADITIONAL JUSTICE IN SOUTH AFRICA
African Journals Online (AJOL)
10332324
ANALYSIS OF SELECTED ASPECTS OF THE TRADITIONAL COURTS BILL ... Customary law1 is without doubt the oldest system of law in most African societies. ... traditional leaders.2 Within such a structure, a feature which was predominant in ...... Harper E Customary Justice: From Program Design to Impact Evaluation.
EDITORIAL Traditional medicine: Reawakening a “pending agendum”.
African Journals Online (AJOL)
admin
that show the workforce represented by practitioners of traditional medicine ... sector to health, wellness and people-centered health care; and ... J. Health Dev. and supervised use of traditional medicine practitioners in strengthening and expanding primary health care services. Furthermore, both the Health Policy (13) and ...
Knowledge, Attitude And Perception Of Epilepsy Among Traditional ...
African Journals Online (AJOL)
The poor knowledge of epilepsy among traditional healers is due to cultural prejudices and environment. The resultant deep-rooted misconceptions and myths negatively affect the attitudes and encourage traditional care with high morbidity and mortality. The objectives of the study were to assess knowledge of epilepsy ...
Ethnobotanical knowledge and practices of traditional healers in ...
African Journals Online (AJOL)
The study was conducted to reveal and document ethnobotanical knowledge and practices of traditional healers in selected sites of Eastern Hararghie. Ethnobotanical data were collected using semi-structured interviews and field observation from 9 traditional healers in 4 study sites of Eastern Hararghie. Data were ...
Trust and Traditions in Transitions
DEFF Research Database (Denmark)
McQuaid, Sara Dybris
On New Year’s Eve 2013, months of talks on ‘Dealing with the past’, ‘Flags’ and ‘Parades’ ended without agreement on how to move towards a reconciliation of positions in Northern Ireland. The failure of the talks illustrates the importance of culture and (mis)trust in divided societies, where...... politics often pivot around whose culture shall be official and whose subordinated, whose history shall be remembered and whose forgotten (Jordan and Weedon 1995). These struggles are particularly intense in times of transition where traditions, power relations and frames of relevant remembrance...... are reconfigured. Historically, parading traditions have been important cultural carriers of identity in Northern Ireland. (Jarman 1997). Correspondingly, the marching season has been an arena for politico-cultural struggles and resistance, indexing relations of trust between communities, between society...
Mold Flora of Traditional Cheeses Produced in Turkey
Directory of Open Access Journals (Sweden)
Musa Yalman
2016-11-01
Full Text Available In our country, there are many cheese types that are produced traditionally. Cheeses which produced from cows, sheep and goat milk that matured with spontaneous growth of molds present in livestock skins, pots and similar environments are among them. They are produced traditionally in Mediterrian, Central and Eastern Anatolia regions. Molds that grow spontaneously in cheeses could create public health risk because of their secondary metabolites. Penicillium spp. are the most isolated mold from these cheeses and Penicillium roqueforti is determined as the dominant species. Furthermore, Aspergillus, Alternaria, Mucor, Geotrichum, Cladosporium species have been isolated. It is very important to control the ripening conditions and starter strain selection since some strains were reported as mycotoxin producers. In this review, it has been tried to give general information about traditional production of mold-ripened cheese in Turkey and the mold flora found in traditional cheeses. In addition, public health risk of these cheeses is reported.
What Constitutes Traditional and Modern Eating? The Case of Japan
Directory of Open Access Journals (Sweden)
Gudrun Sproesser
2018-01-01
Full Text Available Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1 comprehensively compile and systematize the various facets of traditional and modern eating; and (2 investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health.
What Constitutes Traditional and Modern Eating? The Case of Japan.
Sproesser, Gudrun; Imada, Sumio; Furumitsu, Isato; Rozin, Paul; Ruby, Matthew B; Arbit, Naomi; Fischler, Claude; Schupp, Harald T; Renner, Britta
2018-01-25
Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1) comprehensively compile and systematize the various facets of traditional and modern eating; and (2) investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health.
What Constitutes Traditional and Modern Eating? The Case of Japan
Imada, Sumio; Furumitsu, Isato; Rozin, Paul; Ruby, Matthew B.; Arbit, Naomi; Fischler, Claude; Schupp, Harald T.; Renner, Britta
2018-01-01
Traditional Japanese dietary culture might be a factor contributing to the high life expectancy in Japan. As little is known about what constitutes traditional and modern eating in Japan, the aims of the current study were to (1) comprehensively compile and systematize the various facets of traditional and modern eating; and (2) investigate whether these facets also apply to traditional and modern eating in Japan. In Study 1, an extensive international literature review was performed. Forty-five facets of traditional and modern eating were compiled and systematized into the dimensions of what and how people eat, and into eleven separate subdimensions. In Study 2, 340 adults from Japan answered a questionnaire. Results showed that traditional and modern eating in Japan is reflected in both what and how people eat. Within these two dimensions, ten subdimensions were found: the ingredients, processing, temporal origin, spatial origin, and variety of consumed foods, as well as temporal, spatial, and social aspects, appreciation, and concerns when eating. This study provides a broad compilation of facets of traditional and modern eating in Japan. Future research should investigate how these facets are related to life expectancy and health. PMID:29370081
The overlap between cyberbullying and traditional bullying.
Waasdorp, Tracy E; Bradshaw, Catherine P
2015-05-01
Cyberbullying appears to be on the rise among adolescents due in part to increased access to electronic devices and less online supervision. Less is known about how cyberbullying differs from traditional bullying which occurs in person and the extent to which these two forms overlap. Our first aim was to examine the overlap of traditional bullying (relational, verbal, and physical) with cyberbullying. The second aim examined student- and school-level correlates of cyber victimization as compared to traditional victims. The final aim explored details of the cyberbullying experience (e.g., who sent the message, how was the message sent, and what was the message about). Data came from 28,104 adolescents (grades, 9-12) attending 58 high schools. Approximately 23% of the youth reported being victims of any form of bullying (cyber, relational, physical, and verbal) within the last month, with 25.6% of those victims reporting being cyberbullied. The largest proportion (50.3%) of victims reported they were victimized by all four forms, whereas only 4.6% reported being only cyberbullied. Multilevel analyses indicated that as compared to those who were only traditionally bullied, those who were cyberbullied were more likely to have externalizing (odds ratio = 1.44) and internalizing symptoms (odds ratio = 1.25). Additional analyses examined detailed characteristics of the cyberbullying experiences, indicating a relatively high level of overlap between cyber and traditional bullying. Implications for preventive interventions targeting youth involved with cyberbullying and its overlap with other forms of bullying are discussed. Copyright © 2015 Society for Adolescent Health and Medicine. Published by Elsevier Inc. All rights reserved.
A historical overview of traditional medicine practices and policy in ...
African Journals Online (AJOL)
Background: Although traditional medicine plays an important role in Ethiopian society, knowledge about the extent and characteristics of traditional healing practices and practitioners is limited and has frequently been ignored in the national health system. Objective: To review history of practices and policies on traditional ...
Research on the Application of Traditional Embroidery Technology in Modern Jewelry Creation
Directory of Open Access Journals (Sweden)
Min Li
2017-10-01
Full Text Available Tradition and modernity are the eternal topics of art, especially in the age of information.Efficient mechanical production methods to improve the traditional jewelry production process, which achieved the demand for mass production of jewelry.However, with the development of society and the progress of science and technology, many traditional arts and crafts are lost.From the traditional culture, this paper analyzes the work of embroidery jewelry by studying the traditional Chinese embroidery culture and technique, summarizes the traditional embroidery technology and modern jewelry design techniques combined approach to guide the creative practice.On the basis of studying the theoretical method of combining traditional embroidery technology with modern jewelry, this paper focuses on the application of traditional embroidery techniques in jewelry creation, inspire the potential of traditional craft, to provide reference for modern jewelry design rich Chinese characteristics and attract the attention of Chinese jewelry industry and inherit the traditional arts.
[Advances on pharmacokinetics of traditional Chinese medicine under disease states].
Gong, Zi-peng; Chen, Ying; Zhang, Rui-jie; Yang, Qing; Zhu, Xiao-xin
2015-01-01
In recent years, more and more research shows that the pharmacokinetic parameter of traditional Chinese medicine can be affected by the disease states. It's possible that drug metabolic enzymes, transporters, cell membrane permeability and the change of microbes group could be interfered with physiological and pathological changes, which enables the pharmacokinetics of traditional Chinese medicine in the body to be altered, including the process of absorption, distribution, metabolism and excretion, and then the pharmacokinetic parameters of traditional chinese medicine are altered. It's found that investigating the pharmacokinetic of traditional Chinese medicine in the pathological state is more useful than that of in normal state because the great part of traditional Chinese medicine is mainly used to treat disease. This article reflects the latest research on the pharmacokinetic of traditional Chinese medicine in the disease state such as diabete, cerebral ischemia, liver injury, inflammatory disease, nervous system disorders and fever in order to provide certain reference for clinicians designing reasonable administration dose.
Physiopathology of dementia from the perspective of traditional Persian medicine.
Seifaddini, Rostam; Tajadini, Haleh; Choopani, Rasool
2015-07-01
The most common cognitive disorder that is disabling is dementia. During the medieval period, traditional Persian medicine was an outstanding source of medicine that was used as standard references in medical schools of in the West and Middle East. In ancient manuscripts of traditional Persian medicine, a condition has been introduced similar to dementi (raoonat and homgh). In this article, by collecting materials of traditional medicine texts on dementia, we aim to provide theories for further studies on this topics, as there is an obvious difference between traditional Persian medicine and modern medicine with regard to dementia; however, since modern medicine has not found a suitable response to treatment for all diseases, reviewing traditional Persian medicine for finding better treatment strategies is wise. Use of all medical potentials approved by the World Health Organization beside classic medicine like traditional medicine and considering the availability and acceptability among people is recommended. © The Author(s) 2015.
Conflicto de identidad : indefinición sexual en tres poetas de la Edad de Plata
Gómez Garrido, Marta
2013-01-01
Artículo sobre la presencia de un conflicto identitario relacionado con el género en la obra de tres poetas de la llamada Edad de Plata Española: Lucía Sánchez Saornil, Ana María Martínez Sagi y Carmen Conde. Article about the existence of a gender-related identity conflict in three female poets of the Silver Age of Spanish Literature: Lucía Sánchez Saornil, Ana María Martínez Sagi and Carmen Conde.
El acortamiento de los isquiosurales
Miguel Vidal Barbier; Tania Vidal Almiñana; Mercedes Almela Zamorano; Miguel Vidal Almiñana
2011-01-01
El acortamiento de los isquiosurales, según varios autores (Bado, 1977; Jordà, 1971; Lambrinudi, 1934; Latorre & Hernández, 2003; López, Ferragut, Alacid, Yuste, & García, 2008; Santonja, Andújar, & Martínez, 1994; Santonja, Ferrer, & Martínez, 1995), puede producir alteraciones en la estática del raquis que pueden desencadenar anomalías en su estructura y procesos álgidos. Estos hechos hacen que la detección temprana de un acortamiento en estos músculos sea importante para prevenir posibles ...
Bidding model for sustainable projects using the traditional ...
African Journals Online (AJOL)
The traditional procurement method (TPM) is still widely used in construction because of some advantages it offers over other methods. Contractor selection in the traditional procurement method can no longer be overlooked- being a vital process that influences project success in terms of cost, quality, function, and ...
Traditional wrestling in Niger: between state voluntarism and ...
African Journals Online (AJOL)
Traditional wrestling occupies pride of place in Niger, compared to other sports and cultural activities. Interest in traditional wrestling is widespread among Nigériens from all walks of life: young men, adults, senior citizens, young women, mature women, adult men, handicapped persons, prisoners, peasant farmers, civil ...
Traditional medicine development for medical and dental primary ...
African Journals Online (AJOL)
The gradual extinction of the forests and the inevitable disappearance of the aged Traditional Medical Practitioner should pose an impending deadline for us to learn, acquire and document our medical cultural endowment for the benefit of all Africans and indeed the entire mankind. Key Words: Traditional African Medicine ...
Chieftaincy succession disputes and the challenge to traditional ...
African Journals Online (AJOL)
Two succession disputes at the provincial and the sub-provincial level of the traditional political hierarchy are analysed in detail. Both cases represented a challenge to traditional authority and are an indication of the changing relationship between chiefs and their subjects in Mamprusi society and throughout Northern ...
The Zulu traditional birth attendant
African Journals Online (AJOL)
Some of the important practices of Zulu traditional birth attendants ... the people as regards pregnancy and labour. This article docu- .... into account previous perinatal deaths. ... They were either widows or married to husbands unable to work.
Yanagida, Takuya; Gradinger, Petra; Strohmeier, Dagmar; Solomontos-Kountouri, Olga; Trip, Simona; Bora, Carmen
2016-01-01
Many large-scale cross-national studies rely on a single-item measurement when comparing prevalence rates of traditional bullying, traditional victimization, cyberbullying, and cyber-victimization between countries. However, the reliability and validity of single-item measurement approaches are highly problematic and might be biased. Data from…
Does Online Marketing Truly Replace Traditional Marketing?
Gunawan, Emilia Margareth
2013-01-01
This review explains the way how online marketing has been replacing traditional marketing in terms of marketing mix. This replacement might happen, because online marketing can give advantages, i.e., offering on-time delivery, increasing effectiveness of two way interactions between buyer and seller, and creating online communities (Szmigin, et al, 2005). The transition of atoms to bits format reflects that tangible products in traditional marketing is being digitalized. The marketing strate...
The Intersection of Culture and Science in South African Traditional ...
African Journals Online (AJOL)
Traditional African medicine often carries with it a perception and stigma of being irrational and ungrounded in scientific method in academia. One reason for this common prejudicial view of traditional African medicine is the failure to effectively interpret African traditional medicine concepts, as these are often metaphorical ...
Eboh and Traditional Medicine in Pre-Colonial Apana Social Systems
African Journals Online (AJOL)
The paper extols the significance of traditional medicine in the social systems of pre-colonial Apana. Traditional medicine and its practitioners maintained their popularity in the socio-cultural development of Apana. The Apana word, eboh, which exists in the plural form, refers to the practitioners of traditional medicine.
Existing roles of traditional healers (mor baan) in southern Thailand.
Suwankhong, Dusanee; Liamputtong, Pranee; Rumbold, Bruce
2011-06-01
Traditional healers (mor baan) played an important role in Thai health long before the introduction of Western medicine. Although modern health professional play a key role of health care provider of Thai health care system, traditional healers and their practice still exist in most rural areas of Thailand. In this article, we address the roles and practices of traditional healers in southern Thailand. An ethnographic method was employed. This approach is the hallmark method used to describe the role and the practice of traditional healers and to grasp in-depth understanding of their everyday life. Participation observation and unstructured interview with 18 traditional healers were conducted. Thematic analysis method was used to analyse the data. Most of the traditional healers chose their role because they were influenced by their ancestors, although a few others chose it because of individual interests and a desire to help ill people. All are trained in multiple skills, using supernatural spirits, ceremonies and natural plant products as resources for counteracting various health problems. They refer patients to modern hospitals or other healers if they cannot adequately manage illness themselves. Their service provision is flexible and based on a holistic approach that suits people's lifestyles and needs. The role of traditional healer tends not to attract the interest of younger generations, although traditional healers have contributed greatly to people's health. Their presence improves people's access to healthcare and offers an alternative to modern medicine, which often has a limited role. We conclude that the services of traditional healers should be incorporated into contemporary healthcare provision of Thai health care system.
Conflicting discourses of church youths on masculinity and sexuality ...
African Journals Online (AJOL)
However, a small number of participants challenged current gender norms and ... sexuality, young churchgoers, HIV prevention, gender equality, DR Congo ... Les garc¸ons ont e´te´ perc¸us comme des personnes qui ont des rapports sexuels ...
Parental deceptive information: A case of traditional uvulectomy ...
African Journals Online (AJOL)
Traditional uvulectomy (TU) is a partial or radical removal of the uvula by traditional practitioners. Therapeutic uvulectomy is performed as a remedy for various ailments usually; persistent cough, sore throat, dry throat, vomiting, diarrhea, anorexia, rejection of breast by a child and growth retardation. In Tanzania, TU is done ...
Home Economics Archive: Research, Tradition and History (HEARTH)
Click here to go to the Mann Library Home Page Click here to return to the HEARTH Home Page Click , Tradition and History HEARTH is a core electronic collection of books and journals in Home Economics and Archive: Research, Tradition and History (HEARTH). Ithaca, NY: Albert R. Mann Library, Cornell University
Traditional Ethics and Social Stability: The African experience ...
African Journals Online (AJOL)
Traditional ethics in this paper refers to the norms, precepts, principles and moral codes, which regulate the conduct and actions of individuals in African societies. The paper provides a clear understanding of African Ethics and morality. It shows how traditional ethical principles helped to maintain and ensure social order ...
Concepts and treatment modalities for hypertension by traditional ...
African Journals Online (AJOL)
Clinical experiences and some research findings indicate that traditional and faith healers play a role in the management of hypertension in Africa. Therefore, the purpose of the study was to assess the concepts and treatment modalities for hypertension among traditional and faith healers in the Northern Province in South ...
Rural Indonesia women’s traditional beliefs about antenatal care
Directory of Open Access Journals (Sweden)
Agus Yenita
2012-10-01
Full Text Available Abstract Background The Indonesia Maternal Mortality Rate (MMR of 420/100.00 live births remains among the highest in East Asia while coverage of births assisted by skilled providers is still low. Traditional beliefs have been a key factor associated with the choice between midwives or traditional birth attendants (TBA and the low number of antenatal care visits in rural West Sumatra. Methods We conducted three focus groups with 16 women from rural West Java to describe their perception regarding issues related to traditional beliefs. Focus group discussions provided data for the content analysis. Results The majority of the 16 women interviewed was from Village Dago, West Java and had only an elementary school education. Their ages ranged from 19 to 40 years. Most were multiparous housewives with an income of IDR 918.750 per month, which was lower than the monthly income in West Java (IDR. 1.172.060. Emerging from the focus group discussion were four main themes regarding their pregnancy and traditional beliefs: 1 pregnancy was a normal cycle in women’s life (pregnancy is a natural phenomena, not a sickness; no recognition of danger signs during pregnancy and death of baby or mother during pregnancy was brought about by God’s will; 2 women followed the traditional beliefs (positive motivation to follow the traditional beliefs and fear of not following the traditional beliefs; 3 relying on TBA called paraji rather than midwife (parajis are kind, tolerant and patient and have more experience than midwives; more accessibility than midwives and encouragement of natural birth and 4 midwives are more secure than paraji; (they use a medical standard of care. Conclusions Women’s beliefs grounded in religion and tradition permeated the village culture making it difficult to counter their long held health practices with practices based on recent advances in health care. Use of TBA in this village was still dominant and women believed that following
Investigating Knowledge and Attitude of Nursing Students Towards Iranian Traditional Medicine
Khorasgani, Sahar Rabani; Moghtadaie, Leila
2014-01-01
The present study aimed at Investigating the knowledge and attitude of Nursing Students towards Iranian Traditional Medicine in universities of Tehran in 2012-2013. 300 students of nursing studying at different universities in Tehran participated in this descriptive, cross-sectional study. The data was collected through a standard questionnaire with an acceptable validity and reliability. The questionnaire was made of five sections including demographic, general knowledge of the Iranian traditional medicine, general attitude towards it, resources of the Iranian traditional medicine and the barriers to it. The results revealed that general knowledge of the students about Iranian traditional medicine and complementary medicine is low. The attitude of the students towards including Iranian traditional medicine and complementary medicine in their curriculum is positive. General attitude of students towards Iranian traditional medicine is positive too. The majority of the participants had not passed any course on Iranian traditional medicine. There was no relationship between participants’ attitude towards Iranian traditional medicine and the number of semesters they had passed. Considering the participants’ positive attitude and their low level of knowledge, it seems necessary for the university policy makers to provide nursing students with different training courses on Iranian traditional medicine and complementary medicine in order to increase their knowledge. PMID:25363119
Directory of Open Access Journals (Sweden)
Juan Pedro Rojas Pichardo
2011-04-01
Full Text Available Normal 0 21 false false false ES X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Tabla normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0cm 5.4pt 0cm 5.4pt; mso-para-margin-top:0cm; mso-para-margin-right:0cm; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0cm; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;} Se trata de reseña de Casas Gómez, M. e I. Penadés Martínez (Coords., M. T. Díaz Hormigo (ed. (1998, Estudios sobre el Diccionario de uso del español de María Moliner, Cádiz, Universidad de Cádiz.
[Investigation, collation and research of traditional Dai medicine of China].
Zhang, Li-Xia; Zhang, Zhong-Lian; Li, Hai-Tao; Niu, Ying-Fen; Guan, Yan-Hong; Ma, Xiao-Jun
2016-08-01
In order to find out the composition, characteristics and traditional utilization characteristics of Dai medicine and promote the rational protection, inheritance and utilization of the resources and traditional knowledge of Dai medicine in China, the resources of traditional Dai medicine have been investigated systematically and the traditional knowledge of Dai medicine have been analyzed in the article. We found out that there were altogether 1 077 kinds of traditional Dai medicine in China and among which 272 were the first time recorded in the condition of Dai folk medical uses. There were 1 053 plant medicines which belong to 169 family and 694 genus. These plant medicines mainly distributed in the southern, west southern and east southern area of Yunnan province, the southern area of Guangxi, Guangdong, Guizhou, Sichuan, Fujian province and tropical, subtropical district as Taiwan, and more than 94.49% plant medicines could be found in Yunnan province. From the point of plant life form, they were major herbaceous or shrubby plants; When it is used as medicinal part, root and rhizome of plants account for the highest proportion, the next were whole plant and leaves. From nature, flavor and channel tropism points of view, the largest proportion of Dai medicines were cool, bitter-tasted and possesses water element. In terms of treatment of disease types, most of the drugs can treat gastrointestinal diseases, next were drugs that could be used to treat upper respiratory infection, traumatological and rheumatic diseases, urinary infection, gynecological diseases, hepatopathy, puerperium fever and diseases caused by poisonous insects and beast of prey bite. The study revealed that the resources of traditional Dai medicine and traditional knowledge of application were abundant in China, but the resources of traditional Dai medicine and traditional knowledge of application were faced with the risk of gradually reduce and loss. The article suggested that we should
Traditional Chinese Medicine: An Introduction
... Resources CME/CEU and Online Lectures Online Continuing Education Series Distinguished Lecture Series Integrated Medicine Research Lecture ... TCM, it is important to separate questions about traditional theories and ... of modern science-based medicine and health promotion practices. The ...
Traditional Medicine Through the Filter of Modernity: A brief historical analysis
Directory of Open Access Journals (Sweden)
R. Rabarihoela Razafimandimby
2014-12-01
Full Text Available Traditional medicines still prevail in current Malagasy context. A careful historical analysis shows however that Malagasy traditional medicine has been screened through many filters before being accepted in a global context. Traditional medicine in its authentic form has been more or less rejected with the advent of modern medicine – although not without reaction. This paper will retrace the historical encountering of the modern and traditional to determine the extent to which traditional medicine is acknowledged and used in the current prevailing modern, rational and scientific global context.
Traditional Chinese Celebrations: Continuity and Change in Taiwan.
Wong, Wendy L.
This teaching unit is designed to introduce elementary school students to traditional Chinese celebrations in Taiwan. An introductory activity asks students to distinguish between various kinds of celebrations (traditional or modern; religious or secular), and to identify U.S. and Chinese examples of each kind. The body of the unit concerns four…
HIV/AIDS: Awareness and Practice Among Traditional Birth ...
African Journals Online (AJOL)
Ebonyi State has an HIV prevalence rate of 11.1%. The state has 2.1 million inhabitants, who are mainly rural dwellers where traditional birth attendants play pivotal role in healthcare delivery. This study assesses the awareness of HIV infection and its route of transmission among the traditional birth attendants in Ebonyi ...
Oral Transmission: A Marriage of Music, Language, Tradition, and Culture
Directory of Open Access Journals (Sweden)
Emma E. Patterson
2015-06-01
Full Text Available There are a number of misunderstandings about ancient oral transmission that negatively affect the way musicians view music history but also the process of how music was and currently is conceived, recorded, and shared. A common misconception is that oral transmission of music is an ancient practice that occurred before written notation of music was developed. However, I seek to prove that there is a false dichotomy between oral transmission and written notation and I focus on the changing definition and importance of oral tradition. Firstly, I discuss the misconceptions of ancient oral transmission. Secondly, I examine the continuing development of research and definitions of oral transmission—which is changing our concept of ancient as well contemporary oral traditions. Thirdly, I demonstrate how these traditions are still relevant in present, late modern times. Thoughout this discussion I examine and engage with the pivotal specialists and research that has developed our view of oral tradition through time. To better understand these scholars’ commentary as well as my own, it is important to note the combined concepts of oral and aural tradition. Oral culture refers to what is spoken and sung, and aural culture refers to what is heard and comprehended. Both are necessary for effective transmission to occur, and oral and aural methods are almost always simultaneously present in most societies. When aural culture is discussed here, it refers to the combination of both elements and is closely related to aural tradition. The most notable terms to differentiate are oral transmission and oral tradition. Typically oral transmission refers to the basic action of passing information, in this case music, through oral and aural means. Oral tradition, however, is the more general concept that synthesizes oral transmission, tradition, and culture. Despite misconceptions that music was primitive before composers started documenting it, oral
The traditional knowledge and the intellectual property
International Nuclear Information System (INIS)
Calle Vasquez, Rosangela
1999-01-01
This article seeks to describe the state of the art in the international context of the traditional knowledge, its content, its recognition, and its valuation. The prosperous results of the biotechnical industry in the scientific and commercial field, has had a great impact in the valuation of the intellectual property, in the context of the globalization of the market. Traditionally the ancestral knowledge of the ethnic communities in the relative thing to the appropriation of the nature for their survival, it has not been considered neither valued in the same terms that the scientific knowledge and therefore, neither it has been analyzed as intellectual property, just as the western right it has structured this special form of property. The convention of the biodiversity, put in undoubtedly the traditional knowledge should be protected and valued, for this reason starting from 1992, the commercial agreements consecrate and they recognize this theme
Historical tradition in Serbian genre literature
Directory of Open Access Journals (Sweden)
Đorđević Ivan
2008-01-01
Full Text Available This paper discusses two Serbian science-fiction stories with a special emphasis on the motives in their narrative structure; the motive analysis is focused on those motives that represent a transposition of 'historical tradition' elements. The key words connecting images appearing in this context are: fear of losing (national identity and a strategy of resistance towards those, who presumably, want to 'take over' the identity. In this sense, a return to 'the historical tradition', in the analyzed texts, aims to reassess certain past models indicating at the same time those that have successfully served and endured as historical models in this discourse.
Heart Palpitation From Traditional and Modern Medicine Perspectives
Ershadifar, Tabassom; Minaiee, Bagher; Gharooni, Manouchehr; Isfahani, Mohammad Mahdi; Nikbakht Nasrabadi, Alireza; Nazem, Esmaiel; Gousheguir, Ashraf Aldin; Kazemi Saleh, Davod
2014-01-01
Background: Palpitation is a sign of a disease and is very common in general population. For this purpose we decided to explain it in this study. Objectives: The purpose of this study was to describe the palpitation in both modern and traditional medicine aspect. It may help us to diagnose and cure better because the traditional medicine view is holistic and different from modern medicine. Materials and Methods: We addressed some descriptions to the articles of traditional medicine subjects which have published recently. Palpitation in modern medicine was extracted from medical books such as Braunwald, Harrison and Guyton physiology and some related articles obtained from authentic journals in PubMed and Ovid and Google scholar between1990 to 2013. Results: According to modern medicine, there are many causes for palpitation and in some cases it is cured symptomatically. In traditional medicine view, palpitation has been explained completely and many causes have been described. Its aspect is holistic and it cures causatively. The traditional medicine scientists evaluated the body based on Humors and temperament. Temperament can be changed to dis-temperament in diseases. Humors are divided in 4 items: sanguine, humid or phlegm, melancholy and bile. Palpitation is a disease, it is heart vibration and is caused by an abnormal substance in the heart itself or its membrane or other adjacent organs that would result in the heart suffering. Conclusions: Our data of this article suggests that causes of palpitation in the aspect of traditional medicine are completely different from modern medicine. It can help us to approach and treat this symptom better and with lower side effects than chemical drugs. According to this article we are able to detect a new approach in palpitation. PMID:24719741
Initiatives: Nigeria. Traditional healers and PPFN in wedlock.
Adejo, A A
1996-04-01
The Planned Parenthood Federation of Nigeria (PPFN) runs a program to integrate modern contraception into the practice of traditional medicine. Under the project, traditional healers, largely male, are trained on the ideals of nonprescriptive contraceptives such as condoms, the oral contraceptive pill, and foaming tablets, and how to offer such services to their clients. They participate in a two-week, highly participatory training course which confers a comprehensive introduction to basic and integrated reproductive health care service delivery, simple human anatomy and physiology, and human reproduction. The benefits of modern contraception are reviewed along with community mobilization and counseling. Simple communication techniques such as songs, drama, and role play are discussed. Information on maternal and child health and child survival, basic hygiene, nutrition, and AIDS is also incorporated into the course. 136 traditional healers have thus far been trained in three local government areas (LGAs) of Lagos State and 150 in six other LGAs in Benue State. The project has resulted in strong referral linkages between traditional healers, modern practitioners, and PPFN.
Between Tradition and Modernity: Marriage Dynamics in Kyrgyzstan.
Nedoluzhko, Lesia; Agadjanian, Victor
2015-06-01
The demographic literature on union formation in post-communist Europe typically documents retreat from marriage and increase in cohabitation. However, sociological and anthropological studies of post-Soviet Central Asia often point to a resurgence of various traditional norms and practices, including those surrounding marriage, that were suppressed under Soviet rule. We engage these two perspectives on union formation by analyzing transition to first marriage in Kyrgyzstan both before and after the collapse of the USSR. We use uniquely detailed marriage histories from a nationally representative survey conducted in the period 2011-2012 to examine the dynamics of traditional marital practices among that country's two main ethnic groups-Kyrgyz and Uzbeks-focusing on trends in arranged marriages and in marriages involving bride kidnapping. The analysis reveals instructive ethnic and period differences but also indicates an overall decline in the risks of both types of traditional marriage practices in the post-Soviet era. In fact, although the decline has characterized all marriage types, it was more substantial for traditional marriages. We interpret these trends as evidence of continuing modernization of nuptiality behavior in the region.
International Nuclear Information System (INIS)
Blenden, M.L.; Osborne, R.S.; Kucera, P.A.
1996-01-01
For the second consecutive year, the Nez Perce Tribe, in conjunction with the Fish Passage Center, participated in the smolt monitoring program in the Imnaha River. A rotary screw trap was used to collect emigrating wild and hatchery chinook salmon (Oncorhynchus tshawytscha) and steelhead trout (Oncorhynchus mykiss) smolts from February 6 to June 20, 1995. We PIT tagged and released 421 wild chinook salmon smolts, 747 hatchery chinook salmon smolts (445 HxW and 302 HxH), 227 wild steelhead trout smolts and 1,296 hatchery steelhead trout smolts. Cumulative interrogation rates at mainstem Snake and Columbia River dams were 78.4% for wild chinook salmon, 58.9% for hatchery chinook salmon (HxW), 56.6% for hatchery chinook salmon (HxH), 76.2% for wild steelhead trout, and 69.2% for hatchery steelhead trout. Peak outmigration of NPT tagged wild Imnaha River chinook salmon smolts occurred from early to mid-May at Lower Granite, Little Goose, and Lower Monumental Dams. Median and 90% passage dates for wild chinook salmon smolts at Lower Granite Dam were May 1 and May 11, respectively. Continuous spill at Lower Granite Dam was initiated on May 3 and lasted for 51 days. The 90% passage date of wild chinook salmon smolts at Lower Granite Dam (May 11) preceded peak Snake River and Lower Granite (June 6) flows by 26 days. Although hatchery chinook salmon exhibited a shorter outmigration period through the Snake River than their wild counterparts, peak arrival for both groups occurred at approximately the same time. Median and 90% passage dates at Lower Granite Dam for other PIT tagged groups were: hatchery chinook salmon (NPT-HxW) - May 2 and May 13; hatchery chinook salmon (FPC-HxH) - May 8 and May 15; wild steelhead trout - May 2 and May 9; and hatchery steelhead trout (NPT and FPC) - May 31 and June 16. Hatchery steelhead trout displayed small peaks in arrival timing at Lower Granite and Little Goose Dams in mid-May to mid-June
Non-traditional medicinal species include velvetleaf (Abutilon theophrasti Medik.), Desmodium species, Termanus labialis (L.f.) Spreng. and the traditional species consists of roselle (Hibiscus sabdariffa L.). There is a need to identify plant sources of flavonoids and anthocyanins since they have s...
A review of the role of African traditional medicine in the ...
African Journals Online (AJOL)
A review of the role of African traditional medicine in the management of oral diseases. ... traditional healers include herbalism, psychotherapy, simple surgical procedures, ... Some practices of traditional healers included tooth extractions with ...
Traditional leadership and independent bantustans of south africa ...
African Journals Online (AJOL)
The object of this article is to explore and discuss the legal position and the role of the politics of the traditional leaders in the independent Bantustans or homelands of apartheid South Africa. As a point of departure, this article gives a brief account of the status of the traditional leaders before the inception of apartheid.
CULTURAL CAPITAL AS TOURISM DEVELOPMENT BASIS IN TRADITIONAL VILLAGE OF KUTA
Directory of Open Access Journals (Sweden)
Ketut Sumadi
2012-11-01
Full Text Available Tourism is a favourite sector in improving Bali revenue and kind of tourismdeveloped is cultural one. In cultural tourism, it takes place meaning modification ofcultural practice by krama (member of traditional village in order to cultural capitalcan survive in the middle of tourism dynamic condition. This research entitled“Cultural capital as tourism development basis in traditional village of Kuta”, byproposing three problems, namely how is the process of cultural capital as tourismdevelopment basis, what factors can motivate tourism capital as tourism developmentbasis, and what is the meaning of cultural capital as tourism development basis.The research is conducted using qualitative method and cultural studiesapproach, so data analysis is conducted in descriptive qualitative and interpretativeones. Selection of traditional village of Kuta as research location based onconsideration that traditional village of Kuta having integrated tourism facilities forfacilities addressed to member of traditional village. The review about culturalcapital as the tourism development basis in this traditional village of Kuta, eclecticstheories consisting of Hegemonic theory of Gramsci, co-modification theory of KarlMarx and Adorno, discourse-power/knowledge and truth theory of Foucoult anddeconstruction theory of Derrida.Based on the research output, it can be known: (1 Cultural capital process astourism development basis in traditional village of Kuta is inseparable fromforeigners arrival in traditional village of Kuta, the entrance of Military (TheCooperative Center of Arm Force in managing Kuta beach and the occurrence ofBali bombing tragedy on October 12th, 2002; (2 The factors that motivate culturalcapital as the tourism development basis in traditional village of Kuta, such asmotivation and the necessity of tourists visiting traditional village of Kuta, tourismhegemony, changing of life philosophy of member of traditional village fromidealism into
Directory of Open Access Journals (Sweden)
Gonzalo Cerda Brintrup
1988-06-01
Full Text Available El Hotel Luxor, era un edificio de madera construido por Don Luis Jiménez, de varios pisos: el más alto de Castro. Situado entre la plaza y calle Serrano, acogía a los viajeros y junto a él, en la planta baja, la antigua casa donde funcionaba el único estudio fotográfico del pueblo: Foto Provoste. Don Gilberto Provoste había aprendido el arte de la imagen de su amigo Don Lucho Jiménez, a su llegada a Castro en 1934.
Feldman, Jonathan
2016-01-01
Fil: Feldman, Jonathan. Universidad Nacional de las Artes. Área Transdepartamental de Crítica de Artes. Instituto de Investigación y Experimentación en Arte y Crítica; Argentina Fil: Feldman, Jonathan. Universidad Nacional de Tres de Febrero. Instituto de Investigación en Arte y Cultura “Dr. Norberto Griffa”; Argentina Fil: Dámaso Martínez, Carlos. Universidad de Buenos Aires. Facultad de Filosofía y Letras; Argentina Fil: Dámaso Martínez, Carlos. Universidad Nacional de las Artes. Á...
Ana Merino
2010-01-01
Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: Mafalda de Quino, Paracuellos de Carlos Jiménez y Socorro de Miguel Rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrando una dimensión comprometida que interpela al lector. This article analyzes the representation of childhood in several Latin American comics: Mafalda by Quino, Paracuellos by Carlos Jiménez, and Socorro by Miguel Rep. In these comics, infancy...
Merino, Ana
2010-01-01
Este artículo analiza la representación de la niñez en varios cómics iberoamericanos: mafalda de quino, paracuellos de carlos jiménez y socorro de miguel rep. En ellos se articula la infancia desde una perspectiva adulta y crítica con la sociedad mostrand This article analyzes the representation of childhood in several latin american comics: mafalda by quino, paracuellos by carlos jiménez, and socorro by miguel rep. In these comics, infancy is articulated from an adult angle critical with ...
Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato
García Giménez, María; Martínez Llácer, Azahara
2011-01-01
Este proyecto pretende establecer un sistema de comunicación que permita difundir los valores, productos e imagen de la empresa Marangoni Cioccolato, enmarcada en la región italiana Le Marche dónde destaca por su tradición artesanal pero aún no es todo lo conocida que pretende ser. García Giménez, M.; Martínez Llácer, A. (2011). Estrategia de marketing y comunicación de la empresa Marangoni Cioccolato. http://hdl.handle.net/10251/13399. Archivo delegad...
105-116 Effect of Winged Subsoiler and Traditional Tillage ...
African Journals Online (AJOL)
3) compared to traditional tillage (Qs = 34 mm-season-. 1, T = 49 ... Maresha plow that cuts soil deeper than achieved with the traditional .... Data Processing and Analysis. Statistical ... soil compaction and shallow depth could be addressed.
Stressors of college: a comparison of traditional and nontraditional students.
Dill, P L; Henley, T B
1998-01-01
Perceived stress and stressors of nontraditional (returning-adult) and traditional college students were compared. Forty-seven nontraditional students 24-54 years old and 47 traditional students, matched for demographics, completed the Adolescent Perceived Events Scale (Compas, Davis, Forsythe, & Wagner, 1987) for college students. They rated 210 life events according to the desirability, impact, and frequency of the events. Significant differences were found between the nontraditional and traditional students for events in the following categories: academics, peer and social relations, family and network, autonomy and responsibility, and intimacy. Nontraditional students enjoyed going to classes and doing homework more, whereas traditional students worried more about school performance. Peer events, including social activities, had much more impact on traditional students, whereas nontraditional students reported much more responsibility in the home. The results suggest that there are significant differences between the groups in their perceptions of stressors.
Comparative pharmacology of a new recombinant FSH expressed by a human cell line
DEFF Research Database (Denmark)
Koechling, Wolfgang; Plaksin, Daniel; Croston, Glenn E.
2017-01-01
Recombinant FSH proteins are important therapeutic agents for the treatment of infertility, including follitropin alfa expressed in Chinese Hamster Ovary (CHO) cells and, more recently, follitropin delta expressed in the human cell line PER.C6. These recombinant FSH proteins have distinct glycosy...
Sarmiento, Iván; Zuluaga, Germán; Andersson, Neil
2016-01-01
Objectives Examine factors associated with use of traditional medicine during childbirth and in management of childhood diarrhoea. Design Cross-sectional cluster survey, household interviews in a stratified last stage random sample of 90 census enumeration areas; unstructured interviews with traditional doctors. Setting Oil-rich Cross River State in south-eastern Nigeria has 3.5 million residents, most of whom depend on a subsistence agriculture economy. Participants 8089 women aged 15–49 years in 7685 households reported on the health of 11 305 children aged 0–36 months in July–August 2011. Primary and secondary outcome measures Traditional medicine used at childbirth and for management of childhood diarrhoea; covariates included access to Western medicine and education, economic conditions, engagement with the modern state and family relations. Cluster-adjusted analysis relied on the Mantel-Haenszel procedure and Mantel extension. Results 24.1% (1371/5686) of women reported using traditional medicine at childbirth; these women had less education, accessed antenatal care less, experienced more family violence and were less likely to have birth certificates for their children. 11.3% (615/5425) of young children with diarrhoea were taken to traditional medical practitioners; these children were less likely to receive BCG, to have birth certificates, to live in households with a more educated head, or to use fuel other than charcoal for cooking. Education showed a gradient with decreasing use of traditional medicine for childbirth (χ2 135.2) and for childhood diarrhoea (χ2 77.2). Conclusions Use of traditional medicine is associated with several factors related to cultural transition and to health status, with formal education playing a prominent role. Any assessment of the effectiveness of traditional medicine should anticipate confounding by these factors, which are widely recognised to affect health in their own right. PMID:27094939
Enhancing the role of traditional leaders in African governance ...
International Development Research Centre (IDRC) Digital Library (Canada)
2011-07-14
Jul 14, 2011 ... ... which brought Jerry Rawlings to power, "I saw examples where the grassroots ... over the Internet via the Traditional Authority Applied Research Network ... In this study, the research team is focusing on traditional leaders ...
Goddess Traditions in Tantric Hinduism
DEFF Research Database (Denmark)
Hinduism cannot be understood without the Great Goddess and the goddess-orientated Śākta traditions. The Goddess pervades Hinduism at all levels, from aniconic village deities to high-caste pan-Hindu goddesses to esoteric, tantric goddesses. Nevertheless, the highly influential tantric forms...
Metaphysical and value underpinnings of traditional medicine in West Africa.
Omonzejele, Peter F; Maduka, Chukwugozie
2011-02-01
This study investigated the extent to which recourse to traditional healers depended on biometric variables; ways of knowing in good time what ailments were more likely to be better handled by traditional healers; rationale behind traditional healing methodologies. On the whole, four research questions were engaged. The sample for the study included residents in urban (Benin City) and rural (Ehime Mbano) communities in Nigeria. The instruments comprised of two questionnaires. The traditional healers were also interviewed in addition. The findings of the research included the following: in both rural and urban areas, women and more elderly persons had more recourse than other groups to traditional medicine; Christians, less educated persons, self-employed persons and women affirmed most strongly to the efficacy of traditional medicine over Western medicine with respect to certain ailments; ways for averting spiritual illnesses included obeying instructions from ancestors and offering regular sacrifices to the gods; methods used by traditional healers to determine whether an ailment was "spiritual" or as a result of home problems included diagnosis linked to divination, interpretation of dreams particularly those involving visits by ancestors, interpretation of nightmares and omens such as the appearance of owls; methods for curing patients included use of herbs particularly those believed to have magical powers, offering of sacrifices, use of incantations and wearing of protective medicine.