WorldWideScience

Sample records for total che activity

  1. Cholinesterase (ChE) response and related mortality among birds fed ChE inhibitors

    Science.gov (United States)

    Ludke, J.L.; Hill, E.F.; Dieter, M.P.

    1975-01-01

    Patterns of mortality and inhibition of brain and plasma ChE in birds treated with ChE inhibitors were studied in an attempt to determine the validity of using ChE activity as a monitoring and diagnostic technique. Analysis of brain ChE activity proved to be reliable for diagnosing and monitoring effects of selected ChE inhibitors in birds. Brain ChE inhibition exceeding 20% indicated exposure, and inhibition greater than 50% was sufficient for diagnosing cause of death. Individuals that died from dietary exposure to parathion or carbofuran had brain ChE activities below 55% of normal; although individuals could survive with brain ChE activity lower than 50%. Problems associated with collection, storage, and analysis of tissues for ChE activity are discussed.

  2. Structural studies of conformational changes of proteins upon phosphorylation: Structures of activated CheY, CheY-N16-FliM complex, and AAA + ATPase domain of NtrC1 in both inactive and active states

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Seok-Yong [Univ. of California, Berkeley, CA (United States)

    2003-04-10

    Protein phosphorylation is a general mechanism for signal transduction as well as regulation of cellular function. Unlike phosphorylation in eukaryotic systems that uses Ser/Thr for the sites of modification, two-component signal transduction systems, which are prevalent in bacteria, archea, and lower eukaryotes, use an aspartate as the site of phosphorylation. Two-component systems comprise a histidine kinase and a receiver domain. The conformational change of the receiver domain upon phosphorylation leads to signal transfer to the downstream target, a process that had not been understood well at the molecular level. The transient nature of the phospho-Asp bond had made structural studies difficult. The discovery of an excellent analogue for acylphosphate, BeF3-, enabled structural study of activated receiver domains. The structure of activated Chemotaxis protein Y (CheY) was determined both by NMR spectroscopy and X-ray crystallography. These structures revealed the molecular basis of the conformational change that is coupled to phosphorylation. Phosphorylation of the conserved Asp residue in the active site allows hydrogen bonding of the T87 Oγ to phospho-aspartate, which in turn leads to the rotation of Y106 into the ''in'' position (termed Y-T coupling). The structure of activated CheY complexed with the 16 N-terminal residues of FliM (N16-FliM), its target, was also determined by X-ray crystallography and confirmed the proposed mechanism of activation (Y-T coupling). First, N16-FliM binds to the region on CheY that undergoes a significant conformational change. Second, the ''in'' position of Y106 presents a better binding surface for FliM because the sidechain of Y106 in the inactive form of CheY (''out'' position) sterically interferes with binding of N16-FliM. In addition to confirmation of Y-T coupling, the structure of the activated CheY-N16-FliM complex suggested that the

  3. El humanismo del Che Che's Humanism

    OpenAIRE

    Avelino Fernández Espert; Cristina Fernández Rivero

    2004-01-01

    Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che) en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profes...

  4. Natural gas prices in Italy. Tariffs geographical distribution; Metano. Paese che vai, prezzo che trovi

    Energy Technology Data Exchange (ETDEWEB)

    Marrocchelli, A. [ENEA, Rome (Italy). Centro Ricerche Casaccia

    2000-11-01

    The annual report on services and activity carries at some evaluations of data concerned the natural gas market: total consumption, costs and prices in Italy and comparative evaluations with other european countries. [Italian] La relazione annuale sullo stato dei servizi e sull'attivita' svolta, presentata dal Presidente dell'Autorita' per l'energia elettrica e il gas, porta ad alcune considerazioni sui dati che riguardano il mercato del gas naturale: i consumi totali, i costi e i prezzi in Italia, il confronto con i costi e i prezzi praticati negli altri paesi europei.

  5. Che Guevara

    DEFF Research Database (Denmark)

    Cristoffanini, Pablo Rolando

    2014-01-01

    made Che Guevara a political, religious and cultural icon and an object of consumption, despite his total political and military failure in Bolivia and his violent death. Finally the article contrasts the meanings of his image in the original context with new research that calls into question...... with the achievements and connotations of the Cuban Revolution in the context of the Cold War. The current meanings of the image must be read in the context of the global consumer culture. The article analyzes and explains how a conjunction of factors such as communication strategies and the connotations of his image...

  6. Structural Insight inot the low Affinity Between Thermotoga maritima CheA and CheB Compared to their Escherichia coli/Salmonella typhimurium Counterparts

    Energy Technology Data Exchange (ETDEWEB)

    S Park; B Crane

    2011-12-31

    CheA-mediated CheB phosphorylation and the subsequent CheB-mediated demethylation of the chemoreceptors are important steps required for the bacterial chemotactic adaptation response. Although Escherichia coli CheB has been reported to interact with CheA competitively against CheY, we have observed that Thermotoga maritima CheB has no detectable CheA-binding. By determining the CheY-like domain crystal structure of T. maritima CheB, and comparing against the T. maritima CheY and Salmonella typhimurium CheB structures, we propose that the two consecutive glutamates in the {beta}4/{alpha}4 loop of T. maritima CheB that is absent in T. maritima CheY and in E. coli/S. typhimurium CheB may be one factor contributing to the low CheA affinity.

  7. Serum Total Cholinesterase Activity on Admission Is Associated with Disease Severity and Outcome in Patients with Traumatic Brain Injury.

    Directory of Open Access Journals (Sweden)

    Qing-Hong Zhang

    Full Text Available Traumatic brain injury (TBI is one of the leading causes of neurological disability. In this retrospective study, serum total cholinesterase (ChE activities were analyzed in 188 patients for diagnostic as well as predictive values for mortality.Within 72 hours after injury, serum ChE activities including both acetylcholinesterase and butyrylcholinesterase were measured. Disease severity was evaluated with Acute Physiology and Chronic Health Evaluation (APACHE II score, Glasgow Coma Score, length of coma, post-traumatic amnesia and injury feature. Neurocognitive and functional scores were assessed using clinical records. Of 188 patients, 146 (77.7% survived and 42 (22.3% died within 90 days. Lower ChE activities were noted in the non-survivors vs. survivors (5.94±2.19 vs. 7.04±2.16 kU/L, p=0.023, in septic vs. non-infected patients (5.93±1.89 vs. 7.31±2.45 kU/L, p=0.0005 and in patients with extremely severe injury vs. mild injury (6.3±1.98 vs. 7.57±2.48 kU/L, p=0.049. The trajectories of serum ChE levels were also different between non-survivors and survivors, septic and non-infected patients, mild and severely injured patients, respectively. Admission ChE activities were closely correlated with blood cell counts, neurocognitive and functional scores both on admission and at discharge. Receiver operating characteristic analysis showed that the area under the curve for ChE was inferior to that for either APACHE II or white blood cell (WBC count. However, at the optimal cutoff value of 5 kU/L, the sensitivity of ChE for correct prediction of 90-day mortality was 65.5% and the specificity was 86.4%. Kaplan-Meier analysis showed that lower ChE activity (5 kU/L (p=0.04. After adjusting for other variables, ChE was identified as a borderline independent predictor for mortality as analyzed by Binary logistic regression (P=0.078.Lowered ChE activity measured on admission appears to be associated with disease severity and outcome for TBI patients.

  8. Dicty_cDB: CHE636 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE636 (Link to dictyBase) - - - Contig-U11696-1 CHE636P (Link... to Original site) CHE636F 174 CHE636Z 123 CHE636P 277 - - Show CHE636 Library CH (Link to library) Clone ID CHE636 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U11696-1 Original site URL http://dict...ne RP11-15H22, WORKING DRAFT SEQUENCE, 23 unordered pieces. 40 0.19 3 AC149612 |AC149612.1 Ictalurus punctat... %: cytoskeletal 4.0 %: mitochondrial >> prediction for CHE636 is nuc 5' end seq. ID CHE636F 5' end seq. >CH

  9. Introduzione. Donne che portano la parrucca

    Directory of Open Access Journals (Sweden)

    Claudia Mattalucci-Yılmaz

    2013-07-01

    Full Text Available Peruk takan kadınlar è l’opera che nel 1999 l’artista e cineasta turco Kutlug Ataman ha presentato alla Biennale di Venezia curata da Harald Szeemann. Quattro schermi giustapposti proiettano le testimonianze di donne che, per un periodo della loro vita, hanno portato una parrucca: un’attivista politica di sinistra che nel 1971, dopo il colpo di stato militare, utilizzava un nome in codice, una divisa delle Turkish Airlines e una parrucca per sfuggire al controllo della polizia; una giornalista, colpita da un tumore al seno, che ha portato una parrucca per mascherare gli effetti della chemioterapia; una studentessa musulmana che indossa una parrucca per frequentare l’università, in un contesto – quello turco – che in nome della laicità dello Stato, interdice l’uso nel foulard nelle scuole, nelle università e nella pubblica amministrazione; e infine un transessuale.

  10. Discovering Che-1/AATF: a new attractive target for cancer therapy

    Directory of Open Access Journals (Sweden)

    Simona eIezzi

    2015-04-01

    Full Text Available The transcriptional cofactor Che-1/AATF is currently emerging as an important component of the DNA damage response machinery, the complex signaling network that maintains genome integrity and prevents tumorigenesis. Moreover this protein is involved in a wide range of cellular pathways, regulating proliferation and survival in both physiological and pathological conditions. Notably, some evidence indicates that dysregulation of Che-1/AATF levels are associated with the transformation process and elevated levels of Che-1/AATF are required for tumor cell survival. It is for these reasons that Che-1/AATF has been regarded as an attractive, still theoretical, therapeutic target for cancer treatments. In this review, we will provide an updated overview of Che-1/AATF activities, from transcriptional regulation to DNA damage response.

  11. El humanismo del Che Che's Humanism

    Directory of Open Access Journals (Sweden)

    Avelino Fernández Espert

    2004-08-01

    Full Text Available Los autores, estudiosos de la raigal influencia del pensamiento y la obra del Comandante Dr. Ernesto Guevara de la Serna (Che en Cuba y América, proyectan la estampa humanista de este revolucionario médico, con el empleo de las más trascendentes pinceladas históricas de un amplia hoja de vida en distintas latitudes del mundo. El Che, joven estudiante, médico graduado con prometedoras dotes que sabe ubicar al ser humano y sus valores por encima de un promisorio futuro como científico y profesional de la medicina. El artículo dedica atención especial a sus conceptos sobre el hombre, su vida e historia y a su proverbial apego a una ética revolucionaria de elevado calibre. El artículo contribuye al enriquecimiento de los conocimientos sobre el desarrollo histórico del humanismo médico cubano, al proyectarlo en la figura de uno de sus más míticos modelosThe authors, studious of the extraordinary influence of Commandant and Dr. Ernesto Guevara de la Serna 's thought in Cuba and America, unveil the humanist perspective of this revolutionary doctor, through the most transcendental historical events in this man's life in different latitudes of the world. Che, young student, medicine doctor with promising gifts that knew how to place the human being and his values above his promissory future as scientific and medicine professional. The article dedicates special attention to his concepts about men, as well as his life and history and to his proverbial attachment to valuable revolutionary ethics. The article contributes to the enrichment of knowledge on the historical development of Cuban medical humanism, by reflecting this in the figure of one of its most mythical models

  12. Heterozygous Che-1 KO mice show deficiencies in object recognition memory persistence.

    Science.gov (United States)

    Zalcman, Gisela; Corbi, Nicoletta; Di Certo, Maria Grazia; Mattei, Elisabetta; Federman, Noel; Romano, Arturo

    2016-10-06

    Transcriptional regulation is a key process in the formation of long-term memories. Che-1 is a protein involved in the regulation of gene transcription that has recently been proved to bind the transcription factor NF-κB, which is known to be involved in many memory-related molecular events. This evidence prompted us to investigate the putative role of Che-1 in memory processes. For this study we newly generated a line of Che-1(+/-) heterozygous mice. Che-1 homozygous KO mouse is lethal during development, but Che-1(+/-) heterozygous mouse is normal in its general anatomical and physiological characteristics. We analyzed the behavioral characteristic and memory performance of Che-1(+/-) mice in two NF-κB dependent types of memory. We found that Che-1(+/-) mice show similar locomotor activity and thigmotactic behavior than wild type (WT) mice in an open field. In a similar way, no differences were found in anxiety-like behavior between Che-1(+/-) and WT mice in an elevated plus maze as well as in fear response in a contextual fear conditioning (CFC) and object exploration in a novel object recognition (NOR) task. No differences were found between WT and Che-1(+/-) mice performance in CFC training and when tested at 24h or 7days after training. Similar performance was found between groups in NOR task, both in training and 24h testing performance. However, we found that object recognition memory persistence at 7days was impaired in Che-1(+/-) heterozygous mice. This is the first evidence showing that Che-1 is involved in memory processes. Copyright © 2016 Elsevier Ireland Ltd. All rights reserved.

  13. A crèche on the Meyrin CERN site

    CERN Multimedia

    Association du personnel

    2013-01-01

    A few months ago (see Echo 175) we announced the opening, at the end of August, of a crèche at the CERN Staff Association’s nursery school. After a very active summer, where a new floor was added to the canteen building, the new school year started in excellent conditions and, as expected, the new crèche opened on Tuesday 27 August. This crèche, with 13 full-time equivalent places, can accept 18 children aged between three months and two years in a space fully refitted to care for the little ones. A specially designed space for breastfeeding helps mothers working on the site to respect their baby's rhythm. In compliance with the standards of supervision in the canton of Geneva six educators take care of the children in shifts. This new space is fully integrated in the nursery school so that now the crèche, Kindergarten and school of the CERN Staff Association can welcome children aged from three months to six years, from Monday to Friday, and...

  14. Notas sobre el che

    Directory of Open Access Journals (Sweden)

    Virginia Bertolotti

    2010-06-01

    Full Text Available In the present work, I review, in the first place, the bibliography that summarizes the discussion surrounding the etymology of the word che. Then, I analyze the uses of this term in the diachrony as in the synchrony of the Río de la Plata Spanish, which allows me to propose a classification of the uses of the word che in this region. In the third part of the article, I discuss the categorial adscrption of the word che. Finally, the categorial analysis of the diachronic and synchronic empirical evidence allows me to conclude that the vocative uses of the term are a loan from the nominal determinant of the guaraní language, and not a phonic change in the Spanish interjection, thus resolving the etymological issues.

  15. Dicty_cDB: CHE687 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available CH (Link to library) CHE687 (Link to dictyBase) - - - Contig-U16336-1 - (Link to Or...iginal site) CHE687F 622 - - - - - - Show CHE687 Library CH (Link to library) Clone ID CHE687 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16336-1 Original site URL http://dictycdb.b...KFINQCINEIKEELKGDMQKKTVAVQKLTYIQ MLGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICT...LGFDISWASFKIVEVMSCNKFSSKRIGYLAASQSFNEGTDVIVLATHQIRKDFLSSNQS EAYLALNCLSNICTTDLARELANDILTLLSTQKTHILKRAITVLYKIF

  16. Crèche and School

    CERN Multimedia

    EVE et École

    2018-01-01

    IMPORTANT DATES Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesd...

  17. Che cos’è l’antiziganismo?

    Directory of Open Access Journals (Sweden)

    Leonardo Piasere

    2012-01-01

    Full Text Available Abstract – IT Chi è zingaro? Colui che chiamo zingaro, che assegno a questa identità e che costituisco come "altro" dal resto della società. In questo senso, la storia degli zingari si confonde con quella dell'"antiziganismo", un neologismo che denota una pratica antica. Ma si può dire che la comparsa della nuova parola è legata agliodierni intrecci tra politiche multiculturali da un lato e politiche neoliberiste dall’altro?Abstract – FRQui est Tsigane? Celui que je nomme Tsigane, que j'assigne à cette identité et que je constitue en "autre" du reste de la société. Dans ce sens, l'histoire des Tsiganes se confond avec celle de l'"antitsiganisme", un néologisme qui recouvre une pratique ancienne. Mais peut-on dire que l'apparition de ce nouveau mot estliée aux croisements actuels entre les politiques multiculturelles d'une part, et les politiques néolibéralesde l'autre? Abstract – EN Who is Gypsy? The person I call Gypsy, to whom I assign this identity, is that I establish as "other" than the rest of society. In this sense, the history of Gypsies merges with that of "antigypsism", a neologism that denotes an ancient practice. But can it be said that the appearance ofthis new word is linked to the current entanglement between multi-cultural politics on one side and neo-liberalist politics on the other?

  18. Crystallization and preliminary X-ray crystallographic analysis of Thermotoga maritima CheA P3-P4-P5 domains in complex with CheW

    International Nuclear Information System (INIS)

    Park, SangYoun; Kim, Keon Young; Kim, Sunmin; Crane, Brian R.

    2012-01-01

    T. maritima CheA P3-P4-P5 domains were crystallized in complex with CheW. Low-resolution diffraction data were collected to ∼8 Å using synchrotron X-ray radiation. The CheA–CheW complex plays a key role in bacterial chemotaxis signal transduction by initiating phosphotransfer to response regulators via coupling to the chemoreceptors. CheA (P3-P4-P5 domains) and CheW from Thermotoga maritima were overexpressed in Escherichia coli and crystallized as a complex at 298 K using ammonium dihydrogen phosphate as a precipitant. X-ray diffraction data were collected to ∼8 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group I222 or I2 1 2 1 2 1 , with unit-cell parameters a = 184.2, b = 286.4, c = 327.7 Å. The asymmetric unit may contain six to ten CheA–CheW molecules

  19. The Azospirillum brasilense Che1 chemotaxis pathway controls swimming velocity, which affects transient cell-to-cell clumping.

    Science.gov (United States)

    Bible, Amber; Russell, Matthew H; Alexandre, Gladys

    2012-07-01

    The Che1 chemotaxis-like pathway of Azospirillum brasilense contributes to chemotaxis and aerotaxis, and it has also been found to contribute to regulating changes in cell surface adhesive properties that affect the propensity of cells to clump and to flocculate. The exact contribution of Che1 to the control of chemotaxis and flocculation in A. brasilense remains poorly understood. Here, we show that Che1 affects reversible cell-to-cell clumping, a cellular behavior in which motile cells transiently interact by adhering to one another at their nonflagellated poles before swimming apart. Clumping precedes and is required for flocculation, and both processes appear to be independently regulated. The phenotypes of a ΔaerC receptor mutant and of mutant strains lacking cheA1, cheY1, cheB1, or cheR1 (alone or in combination) or with che1 deleted show that Che1 directly mediates changes in the flagellar swimming velocity and that this behavior directly modulates the transient nature of clumping. Our results also suggest that an additional receptor(s) and signaling pathway(s) are implicated in mediating other Che1-independent changes in clumping identified in the present study. Transient clumping precedes the transition to stable clump formation, which involves the production of specific extracellular polysaccharides (EPS); however, production of these clumping-specific EPS is not directly controlled by Che1 activity. Che1-dependent clumping may antagonize motility and prevent chemotaxis, thereby maintaining cells in a metabolically favorable niche.

  20. CheMentor Software System by H. A. Peoples

    Science.gov (United States)

    Reid, Brian P.

    1997-09-01

    CheMentor Software System H. A. Peoples. Computerized Learning Enhancements: http://www.ecis.com/~clehap; email: clehap@ecis.com; 1996 - 1997. CheMentor is a series of software packages for introductory-level chemistry, which includes Practice Items (I), Stoichiometry (I), Calculating Chemical Formulae, and the CheMentor Toolkit. The first three packages provide practice problems for students and various types of help to solve them; the Toolkit includes "calculators" for determining chemical quantities as well as the Practice Items (I) set of problems. The set of software packages is designed so that each individual product acts as a module of a common CheMentor program. As the name CheMentor implies, the software is designed as a "mentor" for students learning introductory chemistry concepts and problems. The typical use of the software would be by individual students (or perhaps small groups) as an adjunct to lectures. CheMentor is a HyperCard application and the modules are HyperCard stacks. The requirements to run the packages include a Macintosh computer with at least 1 MB of RAM, a hard drive with several MB of available space depending upon the packages selected (10 MB were required for all the packages reviewed here), and the Mac operating system 6.0.5 or later.

  1. Che legend elab ka 40 aastat hiljem / Evelyn Kaldoja

    Index Scriptorium Estoniae

    Kaldoja, Evelyn, 1980-

    2007-01-01

    Ilmunud ka: Postimees : na russkom jazõke 9. okt. lk. 10. Argentinas sündinud ja 1967. aastal hukatud revolutsionääri Ernesto Che Guevara poliitikukarjäärist, tema panusest Kuuba revolutsiooni ja poliitikasse. Ernesto Che Guevara mälestamisest Ladina-Ameeerika riikides. Lisa: Kuuba revolutsioon; Che Guevara elu

  2. Crystallization and preliminary X-ray crystallographic analysis of CheW from Thermotoga maritima: a coupling protein of CheA and the chemotaxis receptor

    International Nuclear Information System (INIS)

    Park, SangYoun; Crane, Brian R.

    2011-01-01

    CheW from T. maritima has been crystallized (space group P6 3 , unit-cell parameters a = b = 61.265, c = 361.045 Å). Diffraction data have been collected to 3.1 Å resolution using synchrotron X-ray radiation. The CheW protein plays a key role in bacterial chemotaxis signal transduction by coupling CheA to chemotaxis receptors. CheW from Thermotoga maritima has been overexpressed in Escherichia coli and crystallized at 298 K using ammonium sulfate as a salt precipitant. X-ray diffraction data have been collected to 3.10 Å resolution at 100 K using synchrotron radiation. The crystal belonged to space group P6 3 , with unit-cell parameters a = b = 61.265, c = 361.045 Å. The asymmetric unit may contain four to six CheW molecules

  3. Overexpression, purification, crystallization and preliminary X-ray analysis of CheY4 from Vibrio cholerae O395

    International Nuclear Information System (INIS)

    Biswas, Maitree; Khamrui, Susmita; Sen, Udayaditya; Dasgupta, Jhimli

    2011-01-01

    The chemotaxis response regulator CheY4 from V. cholerae has been cloned, overexpressed, purified and crystallized in monoclinic and hexagonal space groups; the crystals diffracted to 1.67 and 1.9 Å resolution, respectively. Chemotaxis and motility greatly influence the infectivity of Vibrio cholerae, although the role of chemotaxis genes in V. cholerae pathogenesis is poorly understood. In contrast to the single copy of CheY found in Escherichia coli and Salmonella typhimurium, four CheYs (CheY1–CheY4) are present in V. cholerae. While insertional disruption of the cheY4 gene results in decreased motility, insertional duplication of this gene increases motility and causes enhanced expression of the two major virulence genes. Additionally, cheY3/cheY4 influences the activation of the transcription factor NF-κB, which triggers the generation of acute inflammatory responses. V. cholerae CheY4 was cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY4 grown in space group C2 diffracted to 1.67 Å resolution, with unit-cell parameters a = 94.4, b = 31.9, c = 32.6 Å, β = 96.5°, whereas crystals grown in space group P3 2 21 diffracted to 1.9 Å resolution, with unit-cell parameters a = b = 56.104, c = 72.283 Å, γ = 120°

  4. Crèche and School - Important dates

    CERN Multimedia

    Staff Association

    2018-01-01

    Enrolments 2018-2019 Enrolments to the Crèche and School for the school year 2018-2019 will take place on 5, 6 and 7 March 2018 from 10 am to 1 pm at the Crèche and School of the CERN Staff Association. Registration forms will be available from Thursday 1st March 2018. For more information, please visit the website: http://nurseryschool.web.cern.ch/. * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * * Saturday 3 March 2018 Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Friday 2 March 2018: htt...

  5. The Emotional Communication in Hearing Questionnaire (EMO-CHeQ): Development and Evaluation.

    Science.gov (United States)

    Singh, Gurjit; Liskovoi, Lisa; Launer, Stefan; Russo, Frank

    2018-06-11

    The objectives of this research were to develop and evaluate a self-report questionnaire (the Emotional Communication in Hearing Questionnaire or EMO-CHeQ) designed to assess experiences of hearing and handicap when listening to signals that contain vocal emotion information. Study 1 involved internet-based administration of a 42-item version of the EMO-CHeQ to 586 adult participants (243 with self-reported normal hearing [NH], 193 with self-reported hearing impairment but no reported use of hearing aids [HI], and 150 with self-reported hearing impairment and use of hearing aids [HA]). To better understand the factor structure of the EMO-CHeQ and eliminate redundant items, an exploratory factor analysis was conducted. Study 2 involved laboratory-based administration of a 16-item version of the EMO-CHeQ to 32 adult participants (12 normal hearing/near normal hearing (NH/nNH), 10 HI, and 10 HA). In addition, participants completed an emotion-identification task under audio and audiovisual conditions. In study 1, the exploratory factor analysis yielded an interpretable solution with four factors emerging that explained a total of 66.3% of the variance in performance the EMO-CHeQ. Item deletion resulted in construction of the 16-item EMO-CHeQ. In study 1, both the HI and HA group reported greater vocal emotion communication handicap on the EMO-CHeQ than on the NH group, but differences in handicap were not observed between the HI and HA group. In study 2, the same pattern of reported handicap was observed in individuals with audiometrically verified hearing as was found in study 1. On the emotion-identification task, no group differences in performance were observed in the audiovisual condition, but group differences were observed in the audio alone condition. Although the HI and HA group exhibited similar emotion-identification performance, both groups performed worse than the NH/nNH group, thus suggesting the presence of behavioral deficits that parallel self

  6. l'italiano che cambia: apocalisse o palingenesi? alcune riflessioni ...

    African Journals Online (AJOL)

    User

    idea that a real linguistic apocalypse is to be found on one hand, in what. Calvino ... nell'italiano contemporaneo da una prospettiva che, audacemente, definiamo ...... 'terrore semantico', cioè la fuga di fronte a ogni vocabolo che abbia di.

  7. A cheZ-Like Gene in Azorhizobium caulinodans Is a Key Gene in the Control of Chemotaxis and Colonization of the Host Plant.

    Science.gov (United States)

    Liu, Xiaolin; Liu, Wei; Sun, Yu; Xia, Chunlei; Elmerich, Claudine; Xie, Zhihong

    2018-02-01

    Chemotaxis can provide bacteria with competitive advantages for survival in complex environments. The CheZ chemotaxis protein is a phosphatase, affecting the flagellar motor in Escherichia coli by dephosphorylating the response regulator phosphorylated CheY protein (CheY∼P) responsible for clockwise rotation. A cheZ gene has been found in Azorhizobium caulinodans ORS571, in contrast to other rhizobial species studied so far. The CheZ protein in strain ORS571 has a conserved motif similar to that corresponding to the phosphatase active site in E. coli The construction of a cheZ deletion mutant strain and of cheZ mutant strains carrying a mutation in residues of the putative phosphatase active site showed that strain ORS571 participates in chemotaxis and motility, causing a hyperreversal behavior. In addition, the properties of the cheZ deletion mutant revealed that ORS571 CheZ is involved in other physiological processes, since it displayed increased flocculation, biofilm formation, exopolysaccharide (EPS) production, and host root colonization. In particular, it was observed that the expression of several exp genes, involved in EPS synthesis, was upregulated in the cheZ mutant compared to that in the wild type, suggesting that CheZ negatively controls exp gene expression through an unknown mechanism. It is proposed that CheZ influences the Azorhizobium -plant association by negatively regulating early colonization via the regulation of EPS production. This report established that CheZ in A. caulinodans plays roles in chemotaxis and the symbiotic association with the host plant. IMPORTANCE Chemotaxis allows bacteria to swim toward plant roots and is beneficial to the establishment of various plant-microbe associations. The level of CheY phosphorylation (CheY∼P) is central to the chemotaxis signal transduction. The mechanism of the signal termination of CheY∼P remains poorly characterized among Alphaproteobacteria , except for Sinorhizobium meliloti , which

  8. Che-1 gene silencing induces osteosarcoma cell apoptosis by inhibiting mutant p53 expression

    Energy Technology Data Exchange (ETDEWEB)

    Liu, Ming; Wang, Dan, E-mail: danwangwdd@163.com; Li, Ning

    2016-04-22

    The transcriptional cofactor Che-1 is an RNA polymerase II (Pol II) which is involved in tumorigenesis, such as breast cancer and multiple myeloma. Che-1 can also regulate mutant p53 expression, which plays roles in many types of cancer. In this study, we aimed to investigate the effects and specific mechanism of Che-1 in the regulation of osteosarcoma (OS) cell growth. We found that Che-1 is highly expressed in several kinds of OS cells compared with osteoblast hFOB1.19 cells. MTT and flow cytometry assays showed that Che-1 depletion by siRNA markedly suppressed MG-63 and U2OS cell proliferation and promoted apoptosis. The chromatin immunoprecipitation (ChIP) assay verified the presence of Che-1 on the p53 promoter in MG-63 and U2OS cells carrying mutant p53. Further studies showed that Che-1 depletion inhibited mutant p53 expression. Notably, our study showed that the loss of Che-1 inhibits proliferation and promotes apoptosis in MG-63 cells by decreasing the level of mutant p53. Therefore, these findings open the possibility that silencing of Che-1 will have therapeutic benefit in OS. - Highlights: • Che-1 is highly expressed in several kinds of OS cells. • Che-1 depletion suppressed MG-63 and U2OS cell growth. • Che-1 is existed in the p53 promoter in MG-63 and U2OS cells. • Che-1 depletion inhibited mutant p53 expression. • Che-1 depletion inhibits cell growth by decreasing the level of mutant p53.

  9. Perché io credo in colui che ha fatto il mondo

    CERN Document Server

    Zichichi, Antonino

    1999-01-01

    Fin troppo spesso si sente dire che il mondo della scienza e quello della religione sono in completa opposizione e che non condividono alcuna esperienza o caratteristica in comune. Nulla potrebbe essere più falso di queste affermazioni secondo Antonino Zichichi, che in quest'opera afferma come la ricerca scientifica e l'esperienza religiosa abbiano in comune molto più di quanto si possa pensare.

  10. Award ceremony for the "Crèche and School" competition

    CERN Multimedia

    Staff Association

    2018-01-01

    Whenever there is a competition, there are obviously participants – and especially winners! The awards ceremony for the competition to find a new name for the CERN Staff Association's Crèche and School took place on 15 May. During the ceremony, jointly led by Céline Grobon (President of the Crèche and School Steering Committee), Carole Dargagnon (Headmistress of the Crèche and School) and Jean-Baptiste Zenner (Staff Association delegate), the proposals selected by the jury were rewarded. The first place went to Marie-Luz Cavagna for her proposal "Le jardin des petits chercheurs", and the second place to Sarah Palluel for her proposal "Le Jardin des Zélectrons". Finally, Aude Mourey and Sandra Fleury tied for third place with their respective proposals "Les petits atomes" and "La crèche des particules". Can we find the winning name of the competition among...

  11. The Pseudomonas aeruginosa chemotaxis methyltransferase CheR1 impacts on bacterial surface sampling.

    Directory of Open Access Journals (Sweden)

    Juliane Schmidt

    Full Text Available The characterization of factors contributing to the formation and development of surface-associated bacterial communities known as biofilms has become an area of intense interest since biofilms have a major impact on human health, the environment and industry. Various studies have demonstrated that motility, including swimming, swarming and twitching, seems to play an important role in the surface colonization and establishment of structured biofilms. Thereby, the impact of chemotaxis on biofilm formation has been less intensively studied. Pseudomonas aeruginosa has a very complex chemosensory system with two Che systems implicated in flagella-mediated motility. In this study, we demonstrate that the chemotaxis protein CheR1 is a methyltransferase that binds S-adenosylmethionine and transfers a methyl group from this methyl donor to the chemoreceptor PctA, an activity which can be stimulated by the attractant serine but not by glutamine. We furthermore demonstrate that CheR1 does not only play a role in flagella-mediated chemotaxis but that its activity is essential for the formation and maintenance of bacterial biofilm structures. We propose a model in which motility and chemotaxis impact on initial attachment processes, dispersion and reattachment and increase the efficiency and frequency of surface sampling in P. aeruginosa.

  12. Los marcadores che y boludo: ¿un caso de rivalidad conversacional?

    Directory of Open Access Journals (Sweden)

    Markéta Šmídová

    2016-11-01

    Full Text Available It has been recently suggested that the Argentinian conversational marker che is being replaced by another typical expression, boludo. The purpose of the present paper is to provide a pilot comparative study of these two Argentinian markers in order to examine their free interchangeability and to refute it eventually. A commutation test has been used as a basic tool to compare the behavior and functions of che and boludo and the results have helped to reveal contexts in which it would be inadmissible or inappropriate to employ boludo instead of che due to the possible violation of politeness norms. In the article, che and boludo are considered mainly from the sociolinguistic and pragmatic approaches although some important cultural phenomena are discussed as well.

  13. Molecular Interaction and Cellular Location of RecA and CheW Proteins in Salmonella enterica during SOS Response and Their Implication in Swarming.

    Science.gov (United States)

    Irazoki, Oihane; Aranda, Jesús; Zimmermann, Timo; Campoy, Susana; Barbé, Jordi

    2016-01-01

    In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  14. Molecular interaction and cellular location of RecA and CheW proteins in Salmonella enterica during SOS response and their implication in swarming

    Directory of Open Access Journals (Sweden)

    Oihane Irazoki

    2016-10-01

    Full Text Available In addition to its role in DNA damage repair and recombination, the RecA protein, through its interaction with CheW, is involved in swarming motility, a form of flagella-dependent movement across surfaces. In order to better understand how SOS response modulates swarming, in this work the location of RecA and CheW proteins within the swarming cells has been studied by using super-resolution microscopy. Further, and after in silico docking studies, the specific RecA and CheW regions associated with the RecA-CheW interaction have also been confirmed by site-directed mutagenesis and immunoprecipitation techniques. Our results point out that the CheW distribution changes, from the cell poles to foci distributed in a helical pattern along the cell axis when SOS response is activated or RecA protein is overexpressed. In this situation, the CheW presents the same subcellular location as that of RecA, pointing out that the previously described RecA storage structures may be modulators of swarming motility. Data reported herein not only confirmed that the RecA-CheW pair is essential for swarming motility but it is directly involved in the CheW distribution change associated to SOS response activation. A model explaining not only the mechanism by which DNA damage modulates swarming but also how both the lack and the excess of RecA protein impair this motility is proposed.

  15. Report to EuCheMS Division of Analytical Chemistry on CITAC Activity

    DEFF Research Database (Denmark)

    Andersen, Jens Enevold Thaulov; Wegsheider, Wolfhard

    Although the CITAC organisation [1] was founded on traceability, it embraces a variety of concepts allocated specifically to quality assurance. Collaboration with other organisations that promote practices and procedures of quality assurance is essential, and appointed liaison persons...... are encouraged to support this effort. In continuation of this aim a close contact to EuCheMS is desired together with contacts to IUPAC, ISO/REMCO, BIPM/CCQM, ILAC, EA, APLAC, EUROMET, SIM, APMP, AOACI, IAEA, IFCC and SADCMET....

  16. I sei numeri dell'universo le forze profonde che spiegano il cosmo

    CERN Document Server

    Rees, Martin

    2002-01-01

    È possibile che sei semplici numeri, sei costanti universali, diano conto dell'infinita varietà e della stupefacente complessità del cosmo? L'astrofisico Martin Rees ci mostra che non soltano ciò è possibile, ma in quei sei numeri sono scritti la storia, la struttura e il futuro dell'universo, e che perfino la comparsa della vita sulla terra, e dunque la nostra stessa esistenza, non sarebbe concepibile se uno solo di quei valori numerici, definiti nell'istante che segnò la nascita del mondo, fosse differente. I sei numeri dell'universo ci introducono così ad alcune delle questioni più profonde su cui si interroga oggi la scienza.

  17. Plasma B-esterase activities in European raptors.

    Science.gov (United States)

    Roy, Claudie; Grolleau, Gérard; Chamoulaud, Serge; Rivière, Jean-Louis

    2005-01-01

    B-esterases are serine hydrolases composed of cholinesterases, including acetylcholinesterase (AChE) and butyrylcholinesterase (BChE), and carboxylesterase (CbE). These esterases, found in blood plasma, are inhibited by organophosphorus (OP) and carbamate (CB) insecticides and can be used as nondestructive biomarkers of exposure to anticholinesterase insecticides. Furthermore, B-esterases are involved in detoxification of these insecticides. In order to establish the level of these enzymes and to have reference values for their normal activities, total plasma cholinesterase (ChE), AChE and BChE activities, and plasma CbE activity were determined in 729 European raptors representing 20 species, four families, and two orders. The diurnal families of the Falconiforme order were represented by Accipitridae and Falconidae and the nocturnal families of the Strigiforme order by Tytonidae and Strigidae. Intraspecies differences in cholinesterase activities according to sex and/or age were investigated in buzzards (Buteo buteo), sparrowhawks (Accipiter nisus), kestrels (Falco tinnunculus), barn owls (Tyto alba), and tawny owls (Strix aluco). Sex-related differences affecting ChE and AChE activities were observed in young kestrels (2-3-mo-old) and age-related differences in kestrels (ChE and AChE), sparrowhawks (AChE), and tawny owls (ChE, AChE, and BChE). The interspecies analysis yielded a negative correlation between ChE activity and body mass taking into account the relative contribution of AChE and BChE to ChE activity, with the exception of the honey buzzard (Pernis apivorus). The lowest ChE activities were found in the two largest species, Bonelli's eagle (Hieraaetus fasciatus) and Egyptian vulture (Neophron percnopterus) belonging to the Accipitridae family. The highest ChE activities were found in the relatively small species belonging to the Tytonidae and Strigidae families and in honey buzzard of the Accipitridae family. Species of the Accipitridae, Tytonidae, and

  18. Che: His Own Worst Enemy

    Science.gov (United States)

    2015-04-01

    comprised of Green Berets, to go to Bolivia and train a Ranger battalion 40 in counter-insurgency operations. Leading this 16-man team was Maj...York: Routledge & Kegan Ltd., 1987. Sinclair, Andrew. Che Guevara. New York: The Viking Press, 1970. Study of the “Diary of ‘Che’ Guevara in

  19. Novel activation domain derived from Che-1 cofactor coupled with the artificial protein Jazz drives utrophin upregulation.

    Science.gov (United States)

    Desantis, Agata; Onori, Annalisa; Di Certo, Maria Grazia; Mattei, Elisabetta; Fanciulli, Maurizio; Passananti, Claudio; Corbi, Nicoletta

    2009-02-01

    Our aim is to upregulate the expression level of the dystrophin related gene utrophin in Duchenne muscular dystrophy, thus complementing the lack of dystrophin functions. To this end, we have engineered synthetic zinc finger based transcription factors. We have previously shown that the artificial three-zinc finger protein named Jazz fused with the Vp16 activation domain, is able to bind utrophin promoter A and to increase the endogenous level of utrophin in transgenic mice. Here, we report on an innovative artificial protein, named CJ7, that consists of Jazz DNA binding domain fused to a novel activation domain derived from the regulatory multivalent adaptor protein Che-1/AATF. This transcriptional activation domain is 100 amino acids in size and it is very powerful as compared to the Vp16 activation domain. We show that CJ7 protein efficiently promotes transcription and accumulation of the acetylated form of histone H3 on the genomic utrophin promoter locus.

  20. à l'encoche sèche

    African Journals Online (AJOL)

    Chez Hevea brasiliensis, la production de latex est affectée par l'encoche sèche qui se manifeste par l'arrêt de l'écoulement de ... coagulation pour donner le caoutchouc naturel. ..... relationship between latex sugar content, the metabolic ...

  1. Che a 1: recombinant expression, purification and correspondence to the natural form.

    Science.gov (United States)

    Barderas, Rodrigo; Villalba, Mayte; Rodríguez, Rosalía

    2004-12-01

    Pollinosis to chenopods is one of the main causes of allergy in desertic regions and it is increasing in the South of Europe and Western USA. Che a 1 is a major allergen for chenopod-allergic subjects and belongs to the Ole-e-1-like family of proteins. Pichia pastoris yeast has been used as expression system to produce the recombinant form of Che a 1 (rChe a 1). The allergen was isolated using a gel permeation column and reverse-phase/high-performance liquid chromatography. Molecular characterization was performed using Edman degradation, mass spectrometry and concanavalin A staining. Sera from patients allergic to chenopod pollen, as well as polyclonal and monoclonal antibodies raised against Ole e 1, were used in immunoblotting, ELISA and inhibition assays for immunological characterization of rChe a 1. The allergen was purified to homogeneity with a final yield of 15 mg/l of cell culture and showed a glycosylated character. N-terminal amino acid sequence of rChe a 1 and molecular mass were according to those of the protein isolated from chenopod pollen. The recombinant allergen maintained the IgG and IgE epitopes of the natural allergen deduced from the immunological assays. Structural and in vitro immunological properties of rChe a 1 produced in P. pastoris were equivalent to those of the natural form of the allergen and, thus, it could be used in testing patients allergic to chenopods. 2004 S. Karger AG, Basel.

  2. His Excellency Professor Dr Che-Ho Wei, Chairman, National Science Council Executive Yuan, Republic of China

    CERN Multimedia

    Patrice Loïez

    2002-01-01

    Photo 01: Professor Dr. Che-Ho Wei signing the Guest Book with CERN Director-General, L. Maiani. Photo 02: Professor Dr. Che-Ho Wei. Photo 03::Professor Dr. Che-Ho Wei shaking hands with CERN Director-General, L. Maiani.

  3. Il fantasma dell'universo che cos'è il neutrino

    CERN Document Server

    Votano, Lucia

    2015-01-01

    Ben prima della luce, a un decimillesimo di secondo dal Big Bang, i neutrini sono apparsi nell'universo. Dopo un secondo il brodo primordiale si era raffreddato abbastanza da consentire loro di muoversi liberi e ancora oggi, dopo quasi quattordici miliardi di anni, sono numerosissimi. Ma che cosa sono i neutrini? Elusivi come fantasmi, camaleontici, viaggiano indenni attraverso la materia arrivando dritti sino a noi dagli angoli più remoti e nascosti dell'universo. Per saperne di più seguiremo i fisici che li studiano in laboratori sotterranei o in luoghi estremi come i ghiacciai polari o le profondità marine.

  4. The new Meyrin crèche takes its first steps

    CERN Multimedia

    2008-01-01

    The new Meyrin crèche was inaugurated on 10 October and already caters for 16 children of CERN personnel. Copyright: Laurent Barlier. Copyright: Robert Tillmann. At the end of August, the new Meyrin crèche in Champs-Fréchets, the Espace de Vie Enfantine (EVE), welcomed its first intake of infants. They included 16 children of members of the CERN personnel who are benefiting from the agreement signed in 2007 with the commune of Meyrin (see Bulletin n°43&44/2007). The crèche was officially inaugurated on 10 October with several CERN representatives in attendance, including HR Department Head, Enrico Chiaveri, and Head of the Relations with the Host States Service, Friedmann Eder. The following day, EVE held an open day for the inhabitants of Meyrin and interested members of the CERN personnel. The new 1516 m2 building ‘s spaces have very clean and ...

  5. Arylesterase Phenotype-Specific Positive Association Between Arylesterase Activity and Cholinesterase Specific Activity in Human Serum

    Directory of Open Access Journals (Sweden)

    Yutaka Aoki

    2014-01-01

    Full Text Available Context: Cholinesterase (ChE specific activity is the ratio of ChE activity to ChE mass and, as a biomarker of exposure to cholinesterase inhibitors, has a potential advantage over simple ChE activity. Objective: To examine the association of several potential correlates (serum arylesterase/paraoxonase activity, serum albumin, sex, age, month of blood collection, and smoking with plasma ChE specific activity. Methods: We analyzed data from 195 cancer-free controls from a nested case-control study, accounting for potential confounding. Results: Arylesterase activity had an independent, statistically significant positive association with ChE specific activity, and its magnitude was the greatest for the arylesterase phenotype corresponding to the QQ PON1192 genotype followed by phenotypes corresponding to QR and RR genotypes. Serum albumin was positively associated with ChE specific activity. Conclusions: Plasma arylesterase activity was positively associated with plasma ChE specific activity. This observation is consistent with protection conferred by a metabolic phenotype resulting in reduced internal dose.

  6. MSL Chemistry and Mineralogy X-Ray Diffraction X-Ray Fluorescence (CheMin) Instrument

    Science.gov (United States)

    Zimmerman, Wayne; Blake, Dave; Harris, William; Morookian, John Michael; Randall, Dave; Reder, Leonard J.; Sarrazin, Phillipe

    2013-01-01

    This paper provides an overview of the Mars Science Laboratory (MSL) Chemistry and Mineralogy Xray Diffraction (XRD), X-ray Fluorescence (XRF) (CheMin) Instrument, an element of the landed Curiosity rover payload, which landed on Mars in August of 2012. The scientific goal of the MSL mission is to explore and quantitatively assess regions in Gale Crater as a potential habitat for life - past or present. The CheMin instrument will receive Martian rock and soil samples from the MSL Sample Acquisition/Sample Processing and Handling (SA/SPaH) system, and process it utilizing X-Ray spectroscopy methods to determine mineral composition. The Chemin instrument will analyze Martian soil and rocks to enable scientists to investigate geophysical processes occurring on Mars. The CheMin science objectives and proposed surface operations are described along with the CheMin hardware with an emphasis on the system engineering challenges associated with developing such a complex instrument.

  7. Finally, a crèche at CERN!

    CERN Multimedia

    Anaïs Schaeffer

    2013-01-01

    After many years of discussion, the CERN Staff Association’s first crèche will open its doors in September to welcome up to 20 babies and toddlers.   A delicate operation: the installation of 11 modules above the Nursery's School canteen. Image: Sigrid Knoops. The CERN Staff Association’s Nursery School, which will soon turn 50, is pleased to announce the establishment of CERN’s first crèche. This project, which has come to fruition over the past academic year with the support of the CERN Management, meets an established and growing need among the Laboratory’s personnel and users. As a modular construction, the Nursery School’s new second floor was assembled above the existing canteen in a matter of days. Its 11 modules are ultra-modern – they’re even equipped with underfloor heating. “Thanks to this extension, we will be able to accept around twenty babies at the start of the academ...

  8. Care and education in the Danish Créche

    DEFF Research Database (Denmark)

    Broström, Stig; Hansen, Ole Henrik

    2010-01-01

    This article seeks to identify the relation between policy and lived life, for the small child in the Danish crèche. To accomplish this, the article integrates demography, traditions, national curriculum and psychological, educational, and recent developments in research. It is an attempt to reveal...... research articles. It is used in the exploration of meanings of political, social, and cultural phenomena as experienced by the involved individuals themselves, in their natural context. It is a presumption that the child’s development is a consequence of emotional and cognitive stimulation. To outline...... that, it is vital to emphasize the influence that policy causes on educational practice in the crèche, e.g., the conceptualization of education and care....

  9. LA LINGUA FILMATA: "L'UOMO CHE VERRÀ" DI GIORGIO DIRITTI

    Directory of Open Access Journals (Sweden)

    Marta Idini

    2016-02-01

    Full Text Available La lingua filmata appare oggi uno dei campi linguistici in cui il dialetto torna ad essere scelta registica e veicolo di nuove istanze comunicative, in stretta relazione con un nuovo modo di intendere e praticare il cinema. Il presente articolo introduce il lettore alla consuetudine cinematografica del dialetto, analizzandone la presenza e le funzioni che gli sono state attribuite nei decenni trascorsi e presenti, e guarda a L’Uomo che verrà quale espressione attuale di una nuova risorgenza dialettale all’interno delle pellicole nostrane. Attraverso un’analisi attenta dei fenomeni vernacolari in esso presenti, l’indagine si sofferma sulle motivazioni e l’efficacia comunicativa cui perviene l’uso del dialetto e si interroga su quale grado di realismo o mimesi linguistica Diritti abbia raggiunto. Language of film: "L’uomo che verrà" by Giorgio DirittiLanguage in films is one of the fields where dialect becomes a choice and a vehicle for new communicative demands, closely related the new way of understanding and practicing the cinema. This article introduces the reader to the use of dialect in films, analyzing the presence and functions that have been attributed to it in the past and present decades, and looks at L’Uomo che verrà as an expression of the new resurgence of dialect in Italian films. Through careful analysis of the vernacular, the paper focuses on the motivations and the communicative effectiveness of the use of dialect and questions the degree of realism or linguistic mimesis that Diritti was able to reach.

  10. A CheR/CheB fusion protein is involved in cyst cell development and chemotaxis in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Wu, Lixian; Cui, Yanhua; Hong, Yuanyuan; Chen, Sanfeng

    2011-12-20

    We here report the sequence and functional analysis of cstB of Azospirillum brasilense Sp7. The predicted cstB contains C-terminal two PAS domains and N-terminal part which has similarity with CheB-CheR fusion protein. cstB mutants had reduced swarming ability compared to that of A. brasilense wild-type strain, implying that cstB was involved in chemotaxis in A. brasilense. A microscopic analysis revealed that cstB mutants developed mature cyst cells more quickly than wild type, indicating that cstB is involved in cyst formation. cstB mutants were affected in colony morphology and the production of exopolysaccharides (EPS) which are essential for A. brasilense cells to differentiate into cyst-like forms. These observations suggested that cstB was a multi-effector involved in cyst development and chemotaxis in A. brasilense. Copyright © 2010 Elsevier GmbH. All rights reserved.

  11. A crèche for CERN staff The Staff Association project

    CERN Multimedia

    Association du personnel

    2006-01-01

    For many years, the Staff Association has supported the demand for the creation of a crèche for the children of CERN staff. Several studies have been carried out without leading to a concrete plan. The fact that the CERN population is getting younger and the shortage of local facilities have led to a more urgent demand for this type of social service over the past few years. Furthermore, the Equal Opportunities Panel had already recommended that crèche places be made available.

  12. Site-specific and synergistic stimulation of methylation on the bacterial chemotaxis receptor Tsr by serine and CheW

    Directory of Open Access Journals (Sweden)

    Weis Robert M

    2005-03-01

    Full Text Available Abstract Background Specific glutamates in the methyl-accepting chemotaxis proteins (MCPs of Escherichia coli are modified during sensory adaptation. Attractants that bind to MCPs are known to increase the rate of receptor modification, as with serine and the serine receptor (Tsr, which contributes to an increase in the steady-state (adapted methylation level. However, MCPs form ternary complexes with two cytoplasmic signaling proteins, the kinase (CheA and an adaptor protein (CheW, but their influences on receptor methylation are unknown. Here, the influence of CheW on the rate of Tsr methylation has been studied to identify contributions to the process of adaptation. Results Methyl group incorporation was measured in a series of membrane samples in which the Tsr molecules were engineered to have one available methyl-accepting glutamate residue (297, 304, 311 or 493. The relative rates at these sites (0.14, 0.05, 0.05 and 1, respectively differed from those found previously for the aspartate receptor (Tar, which was in part due to sequence differences between Tar and Tsr near site four. The addition of CheW generated unexpectedly large and site-specific rate increases, equal to or larger than the increases produced by serine. The increases produced by serine and CheW (added separately were the largest at site one, ~3 and 6-fold, respectively, and the least at site four, no change and ~2-fold, respectively. The rate increases were even larger when serine and CheW were added together, larger than the sums of the increases produced by serine and CheW added separately (except site four. This resulted in substantially larger serine-stimulated increases when CheW was present. Also, CheW enhanced methylation rates when either two or all four sites were available. Conclusion The increase in the rate of receptor methylation upon CheW binding contributes significantly to the ligand specificity and kinetics of sensory adaptation. The synergistic effect of

  13. Che cos'è la vita ?, Scienza e umanesimo

    CERN Document Server

    Schrödinger, Erwin

    1988-01-01

    A cento anni dalla nascita di Erwin Schrödinger (Viena 1887), il suo pensiero e il suo lavoro mantengono inalterati la loro attualità, come dimostra la nuova pubblicazione di molti dei suoi testi e i numerosi convegni che gli vengono dedicati.

  14. Serum cholinesterase activity in infantile and juvenile spinal muscular atrophy.

    Science.gov (United States)

    Niebroj-Dobosz, I; Hausmanowa-Petrusewicz, I

    1989-09-01

    Serum acetylcholinesterase (AChE) and pseudocholinesterase (ChE) activity in infantile and juvenile spinal muscular atrophy (SMA) was determined. The total AChE activity was either normal or decreased in the childhood SMA (Type 1), the other SMA groups and disease controls (ALS, X-linked SMA). In the majority of SMA Type 1 cases (6/7 tested) an absence of the asymmetric A12 form was found. This was accompanied by changes in the other asymmetric and globular forms. The latter was, however, not specific for SMA Type 1 cases. The ChE activity was increased in the majority of SMA cases as well as disease controls. The asymmetric A12 ChE form was increased in all SMA Type 3 cases, the values of this form in SMA Type 1 was variable. A change in the ChE globular forms in SMA Type 1 and SMA Type 2 was a frequent finding. It is suggested that the absence of the asymmetric A12 AChE form in SMA Type 1 arises because of muscle cell immaturity and undeveloped muscle-nerve interactions. The reason of ChE changes is obscure.

  15. Altruisti, cooperativi e morali: Perché è più facile esserlo domani che oggi

    NARCIS (Netherlands)

    Giacomantonio, M.; de Dreu, C.K.W.

    2013-01-01

    Un portafogli smarrito e ritrovato. Una donazione ad un ente che si occupa di ricerca sulle malattie degenerative. Una tangente non accettata. Un divorzio che si conclude senza il ricorso al tribunale. Alla base di tutti questi eventi vi è la tendenza umana a cooperare, ad essere altruisti e ad

  16. Inwentarz fary chełmińskiej i jej biblioteki z XV wieku

    Directory of Open Access Journals (Sweden)

    Mateusz Superczyński

    2017-07-01

    Full Text Available Artykuł niniejszy prezentuje edycję nieznanego szerzej dotychczas inwentarza fary chełmińskiej i wykazu księgozbioru biblioteki farnej z XV w., które znajdują się w księdze miejskiej Chełmna – kopiariuszu przywilejów i dokumentów, założonej przez pisarza Konrada Bitschina w 1431 r. Przekaz źródłowy daje obraz biblioteki fary chełmińskiej jako ośrodka kultury w XV-wiecznym Chełmnie. Pozwala także na porównanie trzech zachowanych spisów księgozbiorów średniowiecznego Chełmna, a więc z klasztoru Franciszkanów z XIII wieku, biblioteki farnej i zrekonstruowanego spisu biblioteki Braci Wspólnego Życia z końca XV stulecia, które pochodzą z różnych okresów i odzwierciedlają przemiany w duchowości, teologii i zainteresowaniach naukowych ówczesnych elit intelektualnych miasta. Podczas gdy księgozbiory biblioteki franciszkanów czy farnej oddają ducha średniowiecznej scholastyki czy nominalizmu, to wydania, które posiadali Bracia Wspólnego Życia, zwiastują nadejście humanizmu. Odnotowane przez pisarza miejskiego tytuły, mimo zniekształceń,pozwalają także na identyfikację i odnalezienie wśród nich fundamentalnych dla średniowiecznej teologii, liturgii, historii i filozofii dzieł.

  17. Changes of serum levels of prealbumin (PAB), cholinesterase (CHE), total bile acid (TBA) and ALT as related to the severity of inflammatory process and hepatic fibrosis in patients with chronic virus B hepatitis

    International Nuclear Information System (INIS)

    Chi Xiaoxia; Chen Jianxiong; Xiong Ying

    2005-01-01

    Objective: To study the correlationship between the serum levels of PAB, CHE, TBA, ALT and the severity of the disease process in patients with chronic virus B hepatitis. Methods: Serum levels of PAB, CHE, ALT (with biochemical methods) and TBA (with RIA) were examined in 93 patients with biopsy proven virus B hepatitis and 46 controls. Results: The 93 patients were of two groups: a less advanced group (n=51) and a more advanced group (n=42). Serum TBA, ALT levels were significnatly higher and serum PAB, CHE levels were significantly lower in the more advanced group than those in the less advanced group (P 0 to s 4 . Changes of levels of ALT were of no regular pattern, but serum levels of TBA regularly increased and levels of PAB, CHE regularly decreased as the fibrosis grading proceeded from s 0 to s 4 and the differences between the levels in s 4 and any other grading were significant (P<0.01). Conclusion: Combined determination of these serum markers might reflect the degree of inflammatory process and hepatic fibrosis in patients with virus B hepatitis, leading to earlier detection of cirrhosis. (authors)

  18. Il lungo freddo storia di Bruno Pontecorvo, lo scienziato che scelse l'URSS

    CERN Document Server

    Mafai, Miriam

    2012-01-01

    Nelle parole della grande giornalista recentemente scomparsa, la documentata narrazione della storia di Bruno Pontecorvo, fisico nucleare di fama mondiale che, nel pieno della Guerra fredda, scelse di abbandonare l'Occidente e di lavorare e vivere nell'Unione Sovietica. Grazie alla capacità della Mafai nel ricostruire gli eventi cruciali della vita di Pontecorvo in un nuovo quadro rivelatore, "Il lungo freddo" non offre solo un'inedita prospettiva sulla drammatica corsa alla bomba atomica - dalle decisive scoperte del Progetto Manhattan alla tragica esplosione di Hiroshima, dalla prima atomica sovietica alla bomba all'idrogeno - ma rappresenta soprattutto la memoria collettiva di una generazione che ha posto la politica al centro delle proprie scelte di vita. E svela i drammi umani di un conflitto che per più di quarant'anni ha diviso il mondo.

  19. Distinct Domains of CheA Confer Unique Functions in Chemotaxis and Cell Length in Azospirillum brasilense Sp7.

    Science.gov (United States)

    Gullett, Jessica M; Bible, Amber; Alexandre, Gladys

    2017-07-01

    Chemotaxis is the movement of cells in response to gradients of diverse chemical cues. Motile bacteria utilize a conserved chemotaxis signal transduction system to bias their motility and navigate through a gradient. A central regulator of chemotaxis is the histidine kinase CheA. This cytoplasmic protein interacts with membrane-bound receptors, which assemble into large polar arrays, to propagate the signal. In the alphaproteobacterium Azospirillum brasilense , Che1 controls transient increases in swimming speed during chemotaxis, but it also biases the cell length at division. However, the exact underlying molecular mechanisms for Che1-dependent control of multiple cellular behaviors are not known. Here, we identify specific domains of the CheA1 histidine kinase implicated in modulating each of these functions. We show that CheA1 is produced in two isoforms: a membrane-anchored isoform produced as a fusion with a conserved seven-transmembrane domain of unknown function (TMX) at the N terminus and a soluble isoform similar to prototypical CheA. Site-directed and deletion mutagenesis combined with behavioral assays confirm the role of CheA1 in chemotaxis and implicate the TMX domain in mediating changes in cell length. Fluorescence microscopy further reveals that the membrane-anchored isoform is distributed around the cell surface while the soluble isoform localizes at the cell poles. Together, the data provide a mechanism for the role of Che1 in controlling multiple unrelated cellular behaviors via acquisition of a new domain in CheA1 and production of distinct functional isoforms. IMPORTANCE Chemotaxis provides a significant competitive advantage to bacteria in the environment, and this function has been transferred laterally multiple times, with evidence of functional divergence in different genomic contexts. The molecular principles that underlie functional diversification of chemotaxis in various genomic contexts are unknown. Here, we provide a molecular

  20. Crèche and School: Open Day on Saturday, 3 March

    CERN Multimedia

    EVE et École

    2018-01-01

    Open Day at Crèche and School of the CERN Staff Association Are you considering enrolling your child to the Crèche and School of the CERN Staff Association? If you work at CERN, then this event is for you: come visit the school and meet the Management on Saturday 3 March 2018 from 10 to 12 am It will be our pleasure to present to you our structure, its projects and premises, and answer any questions you may have. Please sign up for one of the two sessions via Doodle before Wednesday 28 February 2018: https://doodle.com/poll/3qvrb6m73pktqbft

  1. Storie ‘vere’ ed eroine dei romanzi. Rappresentare la Somalia in 'Ilaria Alpi. La ragazza che voleva raccontare l’inferno' e 'Non dirmi che hai paura'

    Directory of Open Access Journals (Sweden)

    Simone Brioni

    2016-09-01

    Full Text Available ‘True’ Stories and Heroines in Novels: The Representation of Somalia in Ilaria Alpi: The Young Woman Who Wanted to Narrate Hell and Don’t Tell Me You Are AfraidThis article analyses Gigliola Alvisi’s Ilaria Alpi: La ragazza che voleva raccontare l’inferno [Ilaria Alpi: The Young Woman Who Wanted to Narrate the Hell] (2014 and Giuseppe Catozzella’s Non dirmi che hai paura [Don’t Tell Me You Are Afraid] (2014, two novels that deal with two recent events in Somali and Italian history, the killing of the journalist Ilaria Alpi in Mogadishu in 1994 and the death of Samia Yosuf Omar while she was trying to reach the Italian shores from Libya by boat. Alvisi’s text is analysed in comparison with other fictional and journalistic representations of Ilaria Alpi, while Non dirmi che hai paura is examined through what Catozzella considers the two constitutive dimensions of the novel: documentation and identification. Drawing on Stefano Jossa’s reflections on the construction of literary heroes, the article challenges Alvisi’s and Catozzella’s claims that they represent ‘true stories’. The article also argues that the main characters of these literary works are portrayed as heroines and role models for the emancipation of Muslim women.

  2. The new "Jardin de Capucine" crèche brings a breath of fresh air for young CERN parents

    CERN Multimedia

    HR Department

    2011-01-01

    On 19 January 2011, CERN's Director-General, Rolf Heuer, signed an agreement with the company "Le Jardin de Zébulon" for the provision of 40 places at the "Jardin de Capucine", a new private crèche due to open this autumn.   In 2008, the "Jardin de Zébulon", a private bilingual crèche for children aged 1 to 4, was opened by Ariane Boucheron at the Technoparc industrial estate in Saint-Genis Pouilly (France). The following year, the number of places was increased from 20 to 37 to meet demand. The "Jardin de Zébulon" has taken in a number of children of CERN personnel ever since it was created. With no let-up in the demand for new crèche places, Ariane Boucher is currently engaged in the construction of a new centre, the "Jardin de Capucine", next-door to the existing crèche. Forty places at the new crèche will...

  3. La Pubblica Amministrazione in uno scenario che cambia

    Directory of Open Access Journals (Sweden)

    Renzo Carlucci

    2009-03-01

    Full Text Available Questo numero, mirato alle implicazioni dell'utilizzo del dato territoriale nel contesto delle PA, le Pubbliche Amministrazioni, si arricchisce di un contenuto ulteriore, particolarmente spaziale; GEOmedia esce infatti in coincidenza con una manifestazione che possiamo considerare la vetrina mediterranea privilegiata per la promozione culturale, scientifica e commerciale delle istituzioni e del segmento dell’industria aerospaziale europea ed italiana.

  4. Efficient Computation of Sparse Matrix Functions for Large-Scale Electronic Structure Calculations: The CheSS Library.

    Science.gov (United States)

    Mohr, Stephan; Dawson, William; Wagner, Michael; Caliste, Damien; Nakajima, Takahito; Genovese, Luigi

    2017-10-10

    We present CheSS, the "Chebyshev Sparse Solvers" library, which has been designed to solve typical problems arising in large-scale electronic structure calculations using localized basis sets. The library is based on a flexible and efficient expansion in terms of Chebyshev polynomials and presently features the calculation of the density matrix, the calculation of matrix powers for arbitrary powers, and the extraction of eigenvalues in a selected interval. CheSS is able to exploit the sparsity of the matrices and scales linearly with respect to the number of nonzero entries, making it well-suited for large-scale calculations. The approach is particularly adapted for setups leading to small spectral widths of the involved matrices and outperforms alternative methods in this regime. By coupling CheSS to the DFT code BigDFT, we show that such a favorable setup is indeed possible in practice. In addition, the approach based on Chebyshev polynomials can be massively parallelized, and CheSS exhibits excellent scaling up to thousands of cores even for relatively small matrix sizes.

  5. La nascita imperfetta delle cose la grande corsa alla particella di Dio e la nuova fisica che cambierà il mondo

    CERN Document Server

    AUTHOR|(CDS)2068901

    2016-01-01

    In quel preciso momento, un centesimo di miliardesimo di secondo dopo il Big Bang, si è deciso il nostro destino. In un universo in cui materia e antimateria si equivalevano, e che quindi avrebbe potuto, in ogni istante, tornare a essere pura energia, può essere bastata una leggerissima preferenza del bosone di Higgs per la materia anziché per l'antimateria ed ecco che si è prodotto il mondo che abbiamo sotto gli occhi. "Ecco qua il minuscolo difetto, la sottile imperfezione da cui è nato tutto. Un'anomalia che dà origine a un universo che può evolvere per miliardi di anni." Se tutto nasce da lì, dobbiamo capire in ogni dettaglio quel momento cruciale, ricostruirlo fotogramma per fotogramma, al rallentatore e da diverse angolature. Per questo al Cern di Ginevra è stato realizzato Lhc, l'acceleratore di particelle più potente del mondo, il posto più simile al primo istante di vita dell'universo che l'uomo sia stato in grado di costruire. Per questo da anni i migliori fisici del mondo lavorano giorno...

  6. Demonstrating the Open Data Repository's Data Publisher: The CheMin Database

    Science.gov (United States)

    Stone, N.; Lafuente, B.; Bristow, T.; Pires, A.; Keller, R. M.; Downs, R. T.; Blake, D.; Dateo, C. E.; Fonda, M.

    2018-04-01

    The Open Data Repository's Data Publisher aims to provide an easy-to-use software tool that will allow researchers to create and publish database templates and related data. The CheMin Database developed using this framework is shown as an example.

  7. Antibiofilm activity of coconut (Cocos nucifera Linn.) husk fibre extract

    Science.gov (United States)

    Viju, N.; Satheesh, S.; Vincent, S.G.P.

    2012-01-01

    In this study, antibiofilm activity of coconut husk extract (CHE) was tested by various assays in the laboratory. The effects of CHE on extracellular polymeric substance (EPS) production, hydrophobicity and adhesion ability of Pseudomonas sp., Alteromonas sp. and Gallionella sp. and the antimicrobial activity of the extract against these bacteria were assessed. CHE was found to possess antibacterial activity against all the bacterial strains and affected the EPS production. The CHE affected the growth of the biofilm-forming bacteria in a culture medium. The hydrophobicity of the bacterial cells was also changed due to the CHE treatment. The active compound of the CHE was characterised by thin-layer chromatography (TLC), high performance liquid chromatography (HPLC) and fourier transform infrared (FT-IR) analysis. HPLC spectrum showed a single peak and the FT-IR spectrum indicated the presence of an OH-group-containing compound in the extract. In conclusion the CHE could be used as a source for the isolation of antifouling compounds. PMID:23961225

  8. LE SOLUTRÉEN ANCIEN EN ARDÈCHE (FRANCE: UNE RÉVISION CRITIQUE DES INDUSTRIES LITHIQUES

    Directory of Open Access Journals (Sweden)

    Sophie Guegan

    2013-11-01

    Full Text Available S’inscrivant dans un travail de Doctorat sur les peuplements des deux rives de la vallée du Rhône au Maximum Glaciaire, cet article propose un état des connaissances sur la phase ancienne du Solutréen en Ardèche (rive droite du Rhône, donnant lieu à une révision critique des industries lithiques s’y rapportant. En effet, depuis les travaux de P.E.L. Smith et J. Combier, et plus récemment le travail d’A. Barbiero consacré aux pointes à face plance et pointes à cran d’une collection ancienne à la Baume d’Oullins (Gard-Ardèche, France, aucun réexamen global n’avait été entrepris. Trois gisements de référence pour cette phase ancienne, ont ainsi été sélectionnés: les grottes d’Oullins (Gard-Ardèche, France, de Chabot (Gard, France et de Granouly (Ardèche, France. Nous présentons ici les réslutats préliminaires à cette étude. En premier lieu, une approche typologique a été menée principalement autour de la pointe à face plane, objet emblématique de cette phase, permettant d’en préciser les principaux caractères. Dans un deuxième temps, une approche technologique a permis de confirmer l’homogénéité dans les choix techniques des Solutréens entre l’Ardèche et les régions du Sud-Ouest et du Bassin Parisien. Enfin, une étude des matières premières, a révélé pour l’heure des choix économiques étonnants pour le contexte paléo-climatique, avec des déplacements vers le nords et un franchissement du Rhône.In the frame of a doctoral dissertation on the Late Glacial Maximum occupations of both sides of the Rhône valley, this paper presents a state of the art and a critical reappraisal of the lithic assemblages from the early phases of the Solutrean in Ardeche (right bank of the Rhône river. Indeed, since the works of P.E.L. Smith and J. Combier, except the work of A. Barbiero, on the unifacial leaf-points and shouldered points from Baume d'Oullins, no complete study of these

  9. CheShift-2 resolves a local inconsistency between two X-ray crystal structures

    International Nuclear Information System (INIS)

    Vila, Jorge A.; Sue, Shih-Che; Fraser, James S.; Scheraga, Harold A.; Dyson, H. Jane

    2012-01-01

    Since chemical shifts provide important and relatively accessible information about protein structure in solution, a Web server, CheShift-2, was developed for structure interrogation, based on a quantum mechanics database of 13 C α chemical shifts. We report the application of CheShift-2 to a local inconsistency between two X-ray crystal structures (PDB IDs 1IKN and 1NFI) of the complex between the p65/p50 heterodimer of NFκB and its inhibitor IκBα. The availability of NMR resonance assignments that included the region of the inconsistency provided an opportunity for independent validation of the CheShift-2 server. Application of the server showed that the 13 C α chemical shifts measured for the Gly270-Pro281 sequence close to the C-terminus of IκBα were unequivocally consistent with the backbone structure modeled in the 1IKN structure, and were inconsistent with the 1NFI structure. Previous NOE measurements had demonstrated that the position of a tryptophan ring in the region immediately N-terminal in this region was not consistent with either structure. Subsequent recalculation of the local structure in this region, based on the electron density of the deposited structure factors for 1IKN, confirmed that the local backbone structure was best modeled by 1IKN, but that the rotamer of Trp258 is consistent with the 1NFI structure, including the presence of a hydrogen bond between the ring NεH of Trp258 and the backbone carbonyl group of Gln278. The consensus between all of these measures suggests that the CheShift-2 server operates well under circumstances in which backbone chemical shifts are available but where local plasticity may render X-ray structural data ambiguous.

  10. Divergent effects of postmortem ambient temperature on organophosphorus- and carbamate-inhibited brain cholinesterase activity in birds

    Science.gov (United States)

    Hill, E.F.

    1989-01-01

    Time- and temperature-dependent postmortem changes in inhibited brain cholinesterase (ChE) activity may confound diagnosis of field poisoning of wildlife by anticholinesterase pesticide. Carbamate-inhibited ChE activity may return to normal within 1 to 2 days of exposure of intact carcass to moderate ambient temperature (18-32C). Organophosphorus-inhibited ChE activity becomes more depressed over the same time. Uninhibited ChE activity was resilient to above freezing temperature to 32C for 1 day and 25C for 3 days. Carbamate- and organophosphorus-inhibited ChE can be separated by incubation of homogenate for 1 hour at physiological temperatures; carbamylated ChE can be readily reactivated while phosphorylated ChE cannot.

  11. [The activity of blood cholinesterase in rats exposed to dimehypo].

    Science.gov (United States)

    Wan, Weiguo; Xu, Mailing; Zou, Hejian; Lu, Ailing; Shen, Xinyu; Chen, Yuming

    2002-12-01

    To determine whether and to what degree the activity of cholinesterase(ChE) is inhibited by dimehypo at different doses of dimehypo [scientific name: 2-dimethylamine-1,3-bi(sodium hyposulfit)]. Rats were dosed with dimehypo or methamidophos orally, and were randomly divided into four subgroups according to the pesticide doses, which were 1/16, 1/8, 1/4 and 1/2 of LD50 respectively(the LD50 of dimethypo and methamidophos is 342 mg/kg and 20 mg/kg respectively). The activity of ChE in blood was determined before and 30 min, 1, 2, 4 and 24 h after exposure. The modified Ellman Method was employed to measure the activity of ChE. 1/16 LD50 dose of dimehypo did not affect the activity of ChE. When the dose increased, the activity of ChE decreased accordingly. 1/2 LD50 dose of dimehypo inhibited the activity of ChE by 35.9% compared with that of control group(P dimehypo at various doses was significantly lower than that in the rats dosed with corresponding doses of methamidophos(P dimehypo may inhibit the activity of ChE. However, as compared with methamidophos, dimehypo is a weaker inhibitor of ChE.

  12. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d'Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean-François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d'Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d'Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey.

  13. X-Ray Diffraction on Mars: Scientific Discoveries Made by the CheMin Instrument

    Science.gov (United States)

    Rampe, E. B.; Blake, D. F.; Ming, D. W.; Bristow, T. F.

    2017-01-01

    The Mars Science Laboratory Curiosity landed in Gale crater in August 2012 with the goal to identify and characterize habitable environments on Mars. Curiosity has been studying a series of sedimentary rocks primarily deposited in fluviolacustrine environments approximately 3.5 Ga. Minerals in the rocks and soils on Mars can help place further constraints on these ancient aqueous environments, including pH, salinity, and relative duration of liquid water. The Chemistry and Mineralogy (CheMin) X-ray diffraction and X-ray fluorescence instrument on Curiosity uses a Co X-ray source and charge-coupled device detector in transmission geometry to collect 2D Debye-Scherrer ring patterns of the less than 150 micron size fraction of drilled rock powders or scooped sediments. With an angular range of approximately 2.52deg 20 and a 20 resolution of approximately 0.3deg, mineral abundances can be quantified with a detection limit of approximately 1-2 wt. %. CheMin has returned quantitative mineral abundances from 16 mudstone, sandstone, and aeolian sand samples so far. The mineralogy of these samples is incredibly diverse, suggesting a variety of depositional and diagenetic environments and different source regions for the sediments. Results from CheMin have been essential for reconstructing the geologic history of Gale crater and addressing the question of habitability on ancient Mars.

  14. Sulle ipotesi che stanno alla base della geometria e altri scritti scientifici e filosofici

    CERN Document Server

    Riemann, Bernhard

    1994-01-01

    Il volume raccoglie, oltre al testo della lezione del 1854 che dà il titolo all'opera, alcuni scritti di carattere scientifico e filosofico di Riemann. A saggi di argomento scientifico si affiancano scritti di argomento più direttamente metodologico. La concezione della scienza che ci viene offerta da questi scritti è assai significativa del personaggio e della sua epoca. Per Riemann la matematica non è un mero strumento esteriore da applicare, appunto dall'esterno, ai fenomeni. Al contrario, essa consente di spingersi con il rigore necessario oltre alla superficie dei fenomeni e di penetrare sempre più a fondo nella realtà, nell'ottica di un sistema unitario e quasi metafisico del sapere scientifico.

  15. Cloning, overexpression, purification, crystallization and preliminary X-ray analysis of CheY3, a response regulator that directly interacts with the flagellar ‘switch complex’ in Vibrio cholerae

    International Nuclear Information System (INIS)

    Khamrui, Susmita; Biswas, Maitree; Sen, Udayaditya; Dasgupta, Jhimli

    2010-01-01

    A chemotaxis response regulator CheY3 from V. cholerae has been cloned, overexpressed, purified and crystallized. The crystals of CheY3 diffracted to 1.86 Å resolution. Vibrio cholerae is the aetiological agent of the severe diarrhoeal disease cholera. This highly motile organism uses the processes of motility and chemotaxis to travel and colonize the intestinal epithelium. Chemotaxis in V. cholerae is far more complex than that in Escherichia coli or Salmonella typhimurium, with multiple paralogues of various chemotaxis genes. In contrast to the single copy of the chemotaxis response-regulator protein CheY in E. coli, V. cholerae contains four CheYs (CheY1–CheY4), of which CheY3 is primarily responsible for interacting with the flagellar motor protein FliM, which is one of the major constituents of the ‘switch complex’ in the flagellar motor. This interaction is the key step that controls flagellar rotation in response to environmental stimuli. CheY3 has been cloned, overexpressed and purified by Ni–NTA affinity chromatography followed by gel filtration. Crystals of CheY3 were grown in space group R3, with a calculated Matthews coefficient of 2.33 Å 3 Da −1 (47% solvent content) assuming the presence of one molecule per asymmetric unit

  16. Crew Health Care System (CHeCS) Design Research, Documentations, and Evaluations

    Science.gov (United States)

    CLement, Bethany M.

    2011-01-01

    The Crew Health Care System (CHeCS) is a group within the Space Life Science Directorate (SLSD) that focuses on the overall health of astronauts by reinforcing the three divisions - the Environmental Maintenance System (EMS), the Countermeasures System (CMS), and the Health Maintenance System (HMS). This internship provided opportunity to gain knowledge, experience, and skills in CHeCS engineering and operations tasks. Various and differing tasks allowed for occasions to work independently, network to get things done, and show leadership abilities. Specific exercises included reviewing hardware certification, operations, and documentation within the ongoing Med Kit Redesign (MKR) project, and learning, writing, and working various common pieces of paperwork used in the engineering and design process. Another project focused on the distribution of various pieces of hardware to off-site research facilities with an interest in space flight health care. The main focus of this internship, though, was on a broad and encompassing understanding of the engineering process as time was spent looking at each individual step in a variety of settings and tasks.

  17. Finally a crèche at CERN, thanks to the Staff Association

    CERN Multimedia

    Staff Association

    2013-01-01

    Setting up at CERN a collective structure to mind children younger than two years, a so-called “crèche”, has been discussed at least since the early 1990s. Then, in February 2001, the Equal Opportunities Advisory Panel produced a memo to the Director of Administration in which it “invites the CERN Management to re-consider the possibility of creating a crèche at CERN”. As a result an ad hoc task force (“Bethléem”) was set up, which based its work on an informal questionnaire sent to CERN families with small children. Its study came up with some relevant parameters for “should CERN Management intend to undertake a minimal effort toward solving the crèche problem for its staff members”. Nothing was undertaken at that time. In the framework of the 2005 five yearly review “Working Group 6: Crèche” made another study of public and private  cr&a...

  18. The structure and dynamic properties of the complete histidine phosphotransfer domain of the chemotaxis specific histidine autokinase CheA from Thermotoga maritima

    International Nuclear Information System (INIS)

    Vu, Anh; Hamel, Damon J.; Zhou Hongjun; Dahlquist, Frederick W.

    2011-01-01

    The bacterial histidine autokinase CheA contains a histidine phosphotransfer (Hpt) domain that accepts a phosphate from the catalytic domain and donates the phosphate to either target response regulator protein, CheY or CheB. The Hpt domain forms a helix-bundle structure with a conserved four-helix bundle motif and a variable fifth helix. Observation of two nearly equally populated conformations in the crystal structure of a Hpt domain fragment of CheA from Thermotoga maritima containing only the first four helices suggests more mobility in a tightly packed helix bundle structure than previously thought. In order to examine how the structures of Hpt domain homologs may differ from each other particularly in the conformation of the last helix, and whether an alternative conformation exists in the intact Hpt domain in solution, we have solved a high-resolution, solution structure of the CheA Hpt from T. maritima and characterized the backbone dynamics of this protein. The structure contains a four-helix bundle characteristic of histidine phosphotransfer domains. The position and orientation of the fifth helix resembles those in known Hpt domain crystal and solution structures in other histidine kinases. The alternative conformation that was reported in the crystal structure of the CheA Hpt from T. maritima missing the fifth helix is not detected in the solution structure, suggesting a role for the fifth helix in providing stabilizing forces to the overall structure.

  19. A 36,000-Year-Old Volcanic Eruption Depicted in the Chauvet-Pont d’Arc Cave (Ardèche, France)?

    Science.gov (United States)

    Nomade, Sébastien; Genty, Dominique; Sasco, Romain; Scao, Vincent; Féruglio, Valérie; Baffier, Dominique; Guillou, Hervé; Bourdier, Camille; Valladas, Hélène; Reigner, Edouard; Debard, Evelyne; Pastre, Jean–François; Geneste, Jean-Michel

    2016-01-01

    Among the paintings and engravings found in the Chauvet-Pont d’Arc cave (Ardèche, France), several peculiar spray-shape signs have been previously described in the Megaloceros Gallery. Here we document the occurrence of strombolian volcanic activity located 35 km northwest of the cave, and visible from the hills above the cave entrance. The volcanic eruptions were dated, using 40Ar/39Ar, between 29 ± 10 ka and 35 ± 8 ka (2σ), which overlaps with the 14C AMS and thermoluminescence ages of the first Aurignacian occupations of the cave in the Megaloceros Gallery. Our work provides the first evidence of an intense volcanic activity between 40 and 30 ka in the Bas-Vivarais region, and it is very likely that Humans living in the Ardèche river area witnessed one or several eruptions. We propose that the spray-shape signs found in the Chauvet-Pont d’Arc cave could be the oldest known depiction of a volcanic eruption, predating by more than 34 ka the description by Pliny the Younger of the Vesuvius eruption (AD 79) and by 28 ka the Çatalhöyük mural discovered in central Turkey. PMID:26745626

  20. El Che - más que médico

    Directory of Open Access Journals (Sweden)

    Natalia I. Osorio Curbelo

    2015-12-01

    Full Text Available Revolucionario, dirigente político, comandante guerrillero, intelectual y médico.  Uno de los íconos del siglo XX.  Nació en Rosario, Argentina, el 14 de junio de 1928. En 1938, con apenas 10 años, el padre le enseñó a jugar Ajedrez en el transcurso del año, deporte que no dejaría de practicar nunca más y lo estudiaría por siempre. En 1939 supo de la existencia de Cuba, pues teniendo 11 años, cuando vivía en Alta Gracia, en Buenos Aires se desarrollaba la VII Olimpiada de Ajedrez y el más conocido de los ajedrecistas cubanos José Raúl Capablanca, obtuvo la medalla de Oro en el primer tablero, convirtiéndose en noticia mundial. La gran pasión por el juego ciencia  se puso de manifiesto durante toda su vida, jugó Ajedrez cuando estaba viajando en un avión, cuando  estuvo detenido en alguna estación policial o, simplemente, a las tres de la madrugada recibía una delegación mexicana para jugar una partida después de conversar sobre los temas generales comunes. Ernesto Guevara, eternamente Che, revolucionario integral y multifacético, sintió gran afición por los deportes y aunque por lo general se le cita como amante del ajedrez y el fútbol, también, desde niño, practicó con derroche de coraje y voluntad otros no tan divulgados. A sus prácticas deportivas también se entregó con la voluntad, coraje y pasión que lo caracterizaron a lo largo de su vida. Luego del triunfo de la Revolución cubana, en la que ganó  los grados de Comandante, hubo  un deporte priorizado  en la vida del Che: el Ajedrez.  Dos veces ganó en los campeonatos patrocinados por el Ministerio de Industria, que él presidía,  y participó, además, en los Torneos del INDER donde ascendió, por los resultados alcanzados, a la primera categoría. Se enfrentó en partidas simultáneas a varios de los mejores jugadores de esos días, entre ellos los grandes maestros soviéticos Victor Korchnoi y Mijail Tal y el argentino Miguel Najdorf, d

  1. Il museo che non c’è. Note sulla dispersione del patrimonio in Gran Bretagna

    Directory of Open Access Journals (Sweden)

    Caroline Patey

    2011-03-01

    Full Text Available Indifferente alla loro recente moltiplicazione come al sodalizio che vi si celebra con l’architettura di grido, un fantasma si aggira per i musei. Sordo al nome di Jean Nouvel (Reina Sofia, Louvre quanto a quelli di Herzog & De Meuron (Tate Modern, impermeabile ai fasti del British Museum (Norman Foster come ai restauri della Tate Britain (James Stirling, disinteressato alle fortune del ‘nuovo’ Victoria and Albert Museum e malinconico come si addice alla sua natura, il fantasma invita a interrogare tanta luccicante spettacolarità e forse a non dimenticare che, per quanto custode di memoria e guardiano di culture, il museo è anche il luogo dove vengono consumate, direttamente o meno, amnesie e damnatio memoriae e in nome del quale continuano a perpetrarsi non poche violazioni e disseminazioni.

  2. The chemotaxis-like Che1 pathway has an indirect role in adhesive cell properties of Azospirillum brasilense.

    Science.gov (United States)

    Siuti, Piro; Green, Calvin; Edwards, Amanda Nicole; Doktycz, Mitchel J; Alexandre, Gladys

    2011-10-01

    The Azospirillum brasilense chemotaxis-like Che1 signal transduction pathway was recently shown to modulate changes in adhesive cell surface properties that, in turn, affect cell-to-cell aggregation and flocculation behaviors rather than flagellar-mediated chemotaxis. Attachment to surfaces and root colonization may be functions related to flocculation. Here, the conditions under which A. brasilense wild-type Sp7 and che1 mutant strains attach to abiotic and biotic surfaces were examined using in vitro attachment and biofilm assays combined with atomic force microscopy and confocal microscopy. The nitrogen source available for growth is found to be a major modulator of surface attachment by A. brasilense and could be promoted in vitro by lectins, suggesting that it depends on interaction with surface-exposed residues within the extracellular matrix of cells. However, Che1-dependent signaling is shown to contribute indirectly to surface attachment, indicating that distinct mechanisms are likely underlying flocculation and attachment to surfaces in A. brasilense. © 2011 Federation of European Microbiological Societies. Published by Blackwell Publishing Ltd. All rights reserved.

  3. Reading Strategies: Issues in the Computerization of Machiavelli's "Il demonio che prese moglie".

    Science.gov (United States)

    Morgan, Leslie Zarker

    1994-01-01

    The ideal computer-based foreign language reading program must include cognitive background, a learning taxonomy, sound computer design, and knowledge of what is needed for the specific language. Machiavelli's "Il demonia che prese moglie" is chosen for study due to its historical interest. (63 references) (CK)

  4. Open Day at Crèche and School of the CERN Staff Association

    CERN Multimedia

    Staff Association

    2018-01-01

    In the morning of Saturday, 3 March 2018, the Crèche and School of the CERN Staff Association opened its doors for parents who wished to visit the establishment. Once again, the Open Day was a great success and brought together more than 50 families for two information sessions, which included: a general presentation of the establishment by the Headmistress, and a visit of the facilities led by the Headmistress and her deputy. At the end of the visit, parents were invited for a drink. This was an opportunity for both parents and professionals to have interesting discussions regarding the general conditions of the establishment and the pedagogical approach applied in the crèche and the school. The management team was delighted to offer the parents the opportunity to participate in this event, where everyone could express their views, ask questions and find answers in a friendly and relaxed atmosphere.

  5. Astrobiological Significance of Definitive Mineralogical Analysis of Martian Surface Samples Using the CheMin XRD/XRF Instrument

    Science.gov (United States)

    Feldman, S. M.; Blake, D. F.; Sarrazin, P.; Bish, D. L.; Chipera, S. J.; Vaniman, D. T.; Collins, S.

    2004-01-01

    The search for evidence of habitability, or of extant or extinct life on Mars, will initially be a search for evidence of past or present conditions supportive of life. The three key requirements for the emergence of life are thought to be liquid water; a suitable energy source; and chemical building blocks. CheMin is a miniaturized XRD/XRF (X-Ray diffraction / X-ray fluorescence) instrument which has been developed for definitive mineralogic analysis of soils and rocks on the Martian surface. The CheMin instrument can provide information that is highly relevant to each of these habitability requirements as summarized below.

  6. Trent'anni che sconvolsero la fisica la storia della teoria dei quanti

    CERN Document Server

    Gamow, George

    1993-01-01

    Gli anni dal 1900 al 1930 hanno portato un profondo mutamento nella visione che l'uomo aveva dell'universo: tra la prima idea di Max Planck dei quanti di luce nel 1900, e la previsione dell'esistenza delle antiparticelle formulata da P. A. M. Dirac nel 1929, corre un periodo di emozionanti progressi nel campo della fisica teorica.

  7. La chiesa che si fa presepe: visita al Presepe della Chiesa del Rosario di Mottola

    Directory of Open Access Journals (Sweden)

    Susy Bigontina

    2012-01-01

    Full Text Available Abstract – IT In occasione del Natale, la vie della città di Mottola (Ta, Italia fioriscono di presepi, che i visitatori possono liberamente ammirare. Quella del presepe è una tradizione molto sentita dagli abitanti della cittadina pugliese, nella quale viene allestito un grande presepe che occupa e cela l’intera navata della Chiesa del Ss. Sacramento e Rosario. Gli allestitori, appartenenti ad una storica Confraternita locale dedicano settimane a costruire un presepe plastico della Betlemme nella notte di Natale, che mescola icone della tradizione italiana della Natività – alcuni pezzi, ad esempio, sono preziosi manufatti di scuola napoletana – ed elementi naturali tipici della terra delle gravine. Il presepe del Rosario, inoltre, mostra un’interessante ricerca dell’effetto prospettico e forse un ancor più interessante cornice di ciclicità, ottenuta tramite l’alternanza del giorno e della notte, musica ed effetti sonori, che proietta la scena verso un orizzonte atemporale. Questo articolo nasce dalla visita degli autori a Mottola, in occasione della presentazione del libro La Settimana Santa a Mottola, di cui essi sono stati co-autori, e quindi rappresenta il frutto di un nuovo capitolo di lavoro con la viva comunità mottolese ed i suoi riti. Abstract – FR Pour l'occasion de Noël, les rues de la villes de Mottola (Ta, Italie sont embellies de crèches que les visiteurs peuvent admirer en toute liberté. La tradition de la crèche est une tradition très ressentie par les habitants de la petite ville pugliaise, dans laquelle on prépare une grande crèche qui occupe et cache tout le nef de l'église du très Ss. Sacramento e Rosario. Les préparateurs qui appartiennent à une Confrérie historique locale dédient plusieurs semaines pour la construction d'une crèche comme celle de Betleemme de la nuit de Noël - certaines pièces, par exemple, sont de précieux produits manufacturés provenant de l'école napolitaine - et

  8. Data from the Mars Science Laboratory CheMin XRD/XRF Instrument

    Science.gov (United States)

    Vaniman, David; Blake, David; Bristow, Tom; DesMarais, David; Achilles, Cherie; Anderson, Robert; Crips, Joy; Morookian, John Michael; Spanovich, Nicole; Vasavada, Ashwin; hide

    2013-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity uses a Co tube source and a CCD detector to acquire mineralogy from diffracted primary X-rays and chemical information from fluoresced X-rays. CheMin has been operating at the MSL Gale Crater field site since August 5, 2012 and has provided the first X-ray diffraction (XRD) analyses in situ on a body beyond Earth. Data from the first sample collected, the Rocknest eolian soil, identify a basaltic mineral suite, predominantly plagioclase (approx.An50), forsteritic olivine (approx.Fo58), augite and pigeonite, consistent with expectation that detrital grains on Mars would reflect widespread basaltic sources. Minor phases (each XRD. This amorphous component is attested to by a broad rise in background centered at approx.27deg 2(theta) (Co K(alpha)) and may include volcanic glass, impact glass, and poorly crystalline phases including iron oxyhydroxides; a rise at lower 2(theta) may indicate allophane or hisingerite. Constraints from phase chemistry of the crystalline components, compared with a Rocknest bulk composition from the APXS instrument on Curiosity, indicate that in sum the amorphous or poorly crystalline components are relatively Si, Al, Mg-poor and enriched in Ti, Cr, Fe, K, P, S, and Cl. All of the identified crystalline phases are volatile-free; H2O, SO2 and CO2 volatile releases from a split of this sample analyzed by the SAM instrument on Curiosity are associated with the amorphous or poorly ordered materials. The Rocknest eolian soil may be a mixture of local detritus, mostly crystalline, with a regional or global set of dominantly amorphous or poorly ordered components. The Rocknest sample was targeted by MSL for "first time analysis" to demonstrate that a loose deposit could be scooped, sieved to <150 microns, and delivered to instruments in the body of the rover. A drilled sample of sediment in outcrop is anticipated. At the time of writing this abstract, promising outcrops are

  9. European analytical column No. 36 from the Division of Analytical Chemistry (DAC) of the European Association for Chemical and Molecular Sciences (EuCheMS)

    DEFF Research Database (Denmark)

    Karlberg, Bo; Emons, Hendrik; Andersen, Jens Enevold Thaulov

    2008-01-01

    European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)......European analytical column no. 36 from the division of analytical chemistry (DAC) of the European association for chemical and molecular sciences (EuCheMS)...

  10. [The activity of blood cholinesterase in rats exposed to dimethypo after drug intervention].

    Science.gov (United States)

    Wan, Weiguo; Xu, Mailing; Zou, Hejian; Lu, Ailing; Shen, Xinyu; Chen, Yuming

    2002-12-01

    To investigate the activity of ChE in rats poisoned by dimehypo and then treated with pralidoxime methylchloride or unithiol. Rats were divided into control group (dimehypo); intervention groups [dimehypo plus pralidoxime methylchloride or dimehypo plus unithiol (sodium dimercaptopropanesulphonate)]. Rats were dosed with 4 different doses of dimehypo: 1/16, 1/8, 1/4 and 1/2 of LD50 respectively(the LD50 of dimehypo is 342 mg/kg). After being poisoned with dimehypo orally, rats were immediately injected intramuscularly with pralidoxime methylchloride or unithiol. The activity of ChE in blood was detected before and 1/2, 1, 2, 4 and 24 h after poisoning in dimehypo and intervention groups. The ChE activity of four dose subgroups at 1 h after poisoning were (1.04 +/- 0.21), (0.84 +/- 0.12), (0.71 +/- 0.12), (0.66 +/- 0.07) U/ml respectively; the ChE activity of pralidoxime methylchloride intervention groups were (1.01 +/- 0.18), (1.17 +/- 0.11), (1.01 +/- 0.04), (1.03 +/- 0.12) U/ml respectively; and the ChE activity of unithiol intervention groups were (1.15 +/- 0.15), (1.26 +/- 0.27), (1.08 +/- 0.08), (1.04 +/- 0.12) U/ml respectively. The inhibited ChE in blood was recovered by either treatment with pyraldoxime methylchloride or unithiol. These two drugs had similar effects of recovering the activity of ChE(P > 0.05), but at higher doses(1/4 and 1/2 of LD50) the effects of both were not so good. Pralidoxime methylchloride and unithiol could partly recover the activity of ChE inhibited by dimehypo.

  11. Il mito della precarietà: quando la precarietà è un valore che decostruisce l’immaginario della precarietà

    Directory of Open Access Journals (Sweden)

    Antonio Casillo

    2011-07-01

    Full Text Available Oggi la ricerca del posto “fisso” sembra essere il sogno irraggiungibile di molti giovani precari e la “flessibilità”, una parola d’ordine con cui si aspirava a riformare il mondo del lavoro e che tanto in voga sembrava essere negli anni ’90, è diventata sinonimo di incertezza, precarietà, se non addirittura sfruttamento. Ma c’era chi proprio nel lavoro che oggi definiremo precario, vedeva l’unica possibilità per restare libero dalle leggi di mercato e dai potenti poteri editoriali Newyorkesi. In questo articolo proviamo a gettare uno sguardo al mito letterario con cui, il rifiutare un posto fisso, significava rivendicare la propria libertà, un mito romantico certo, e sicuramente distante dalla realtà, ma che ha affascinato un’intera generazione di scrittori, poeti, musicisti. Da Jack London, passando attraverso la San Francisco Renaissance e la Beat Generation, fino ad arrivare al fenomeno della così detta generazione Hippy, il sogno americano sembrava essere quello di una frontiera mobile in cui, la strada, sembrava non avere mai fine.

  12. A technician monitors the CHeX, a USMP-4 experiment which will be flown on STS-87, in the SSPF

    Science.gov (United States)

    1997-01-01

    United States Microgravity Payload-4 (USMP-4) experiments are prepared to be flown on Space Shuttle mission STS-87 in the Space Station Processing Facility at Kennedy Space Center (KSC). Here, a technician is monitoring the Confined Helium Experiment, or CHeX, that will use microgravity to study one of the basic influences on the behavior and properties of materials by using liquid helium confined between silicon disks. CHeX and several other experiments are scheduled for launch aboard STS-87 on Nov. 19 from KSC.

  13. Regional cholinesterase activity in white-throated sparrow brain is differentially affected by acephate (Orthene®)

    Science.gov (United States)

    Vyas, N.B.; Kuenzel, W.J.; Hill, E.F.; Romo, G.A.; Komaragiri, M.V.S.

    1996-01-01

    Effects of a 14-day dietary exposure to an organophosphorus pesticide, acephate (acetylphosphoramidothioic acid O,S-dimethyl ester), were determined on cholinesterase activity in three regions (basal ganglia, hippocampus, and hypothalamus) of the white-throated sparrow, Zonotrichia albicollis, brain. All three regions experienced depressed cholinesterase activity between 0.5–2 ppm acephate. The regions exhibited cholinesterase recovery at 2–16 ppm acephate; however, cholinesterase activity dropped and showed no recovery at higher dietary levels (>16 ppm acephate). Evidence indicates that the recovery is initiated by the magnitude of depression, not the duration. In general, as acephate concentration increased, differences in ChE activity among brain regions decreased. Three terms are introduced to describe ChE response to acephate exposure: 1) ChE resistance threshold, 2) ChE compensation threshold, and 3) ChE depression threshold. It is hypothesized that adverse effects to birds in the field may occur at pesticide exposure levels customarily considered negligible.

  14. Pretreatment with P-Nitrophenyl Phosphoramides: Spontaneous Reactivation of Blood ChE after Oral Administration to Guinea Pigs

    National Research Council Canada - National Science Library

    Polhuijs, M

    1997-01-01

    ... and of the reference compounds pyridostigmine and physostigmine has been studied in the guinea pig, as determined by measuring spontaneous reactivation of blood ChE inhibited by these pretreatment compounds...

  15. RESISTENCIA MICROBIANA EN EL CARDIOCENTRO ERNESTO CHE GUEVARA. ESTUDIO DE 5 AÑOS / Microbial resistance at the “Ernesto Che Guevara” Cardiology Hospital. A five year study

    Directory of Open Access Journals (Sweden)

    Nérida Rodríguez Oliva

    2009-06-01

    Full Text Available Introduction and Objectives: The appearance of nosocomial bacterial resistance represents a problem of growing concern because it largely affects the evolution of patients and the health resources devoted to it. The objective of this work was to determine the most common germs and their microbial resistance. Methods: A descriptive retrospective study was carried out analyzing the result of the isolation of germs from all type of secretions and from the blood cultures of a group ofpatients hospitalized at the Ernesto Che Guevara Cardiology Hospital in a five year period. Results: A total of 397 strains were isolated, 77 Staphylococcus aureus and 320 Enterobacteriaceae. The former presented 100% resistance to penicillin. The Staphylococcus sensitive to methicillin presented 4.9 % resistance to cotrimoxazole and gentamicin. The strains resistant to methicillin or oxacillin had a high resistance to gentamicin (87.5 % and ciprofloxacin (81.2 %, a medium resistance to cefazolin and oxacilline (20.5 %, and just 12.5 percent resistance to cotrimoxazole. Conclusions: the Staphylococcus aureus and the Enterobacteriaceae were the most common germs. The preoperative prophylaxis in these patients must not be done with cefazolin as a routine because the staphylococci resistant to methicillin or oxacillin have influence on other antimicrobials.

  16. Characterizing biological variability in livestock blood cholinesterase activity for biomonitoring organophosphate nerve agent exposure

    Energy Technology Data Exchange (ETDEWEB)

    Halbrook, R.S.; Shugart, L.R.; Watson, A.P.; Munro, N.B.; Linnabary, R.D. (Environmental Sciences Division, Oak Ridge National Laboratory, TN (United States))

    1992-09-01

    A biomonitoring protocol, using blood cholinesterase (ChE) activity in livestock as a monitor of potential organophosphate nerve agent exposure during the planned destruction of US unitary chemical warfare agent stockpiles, is described. The experimental design included analysis of blood ChE activity in individual healthy sheep, horses, and dairy and beef cattle during a 10- to 12-month period. Castrated and sexually intact males, pregnant and lactating females, and adult and immature animals were examined through at least one reproductive cycle. The same animals were used throughout the period of observation and were not exposed to ChE-inhibiting organophosphate or carbamate compounds. A framework for an effective biomonitoring protocol within a monitoring area includes establishing individual baseline blood ChE activity for a sentinel group of 6 animals on the bases of blood samples collected over a 6-month period, monthly collection of blood samples for ChE-activity determination during monitoring, and selection of adult animals as sentinels. Exposure to ChE-inhibiting compounds would be suspected when all blood ChE activity of all animals within the sentinel group are decreased greater than 20% from their own baseline value. Sentinel species selection is primarily a logistical and operational concern; however, sheep appear to be the species of choice because within-individual baseline ChE activity and among age and gender group ChE activity in sheep had the least variability, compared with data from other species. This protocol provides an effective and efficient means for detecting abnormal depressions in blood ChE activity in livestock and can serve as a valuable indicator of the extent of actual plume movement and/or deposition in the event of organophosphate nerve agent release.

  17. La macchina che cerca Dio. Nasce LHC forse scoprira' Higgs elusiva particella della creazione

    CERN Multimedia

    Bianucci, P

    2003-01-01

    "LEON Lederman, premio Nobel per la fisica, l'ha misticamente definita la particella di Dio perche' sarebbe il pilastro sul quale si appoggia tutta la materia dell'universo che conosciamo. Piu' tecnicamente, e' la "particella di Higgs", un bosone previsto dal Modello Standard del microcosmo la cui esistenza sarebbe necessaria per giustificare, anche quantitativamente, la massa di tutte le particelle" (1/2 page).

  18. Animals′ Role in Proper Behaviour: Cheŵa Women′s Instructions in South-Central Africa

    Directory of Open Access Journals (Sweden)

    Leslie F Zubieta

    2016-01-01

    Full Text Available The most common role of animals in the Cheŵa culture of south-central Africa is twofold: they are regarded as an important source of food, and they also provide raw materials for the creation of traditional medicines. Animals, however, also have a nuanced symbolic role that impacts the way people behave with each other by embodying cultural protocols of proper — and not so proper — behaviour. They appear repeatedly in storytelling and proverbs to reference qualities that people need to avoid or pursue and learn from the moral of the story in which animals interplay with each other, just as humans do. For example, someone who wants to prevent the consequences of greed is often advised to heed hyena stories and proverbs. My contribution elaborates on Brian Morris's instrumental work in south-central Africa, which has permitted us to elucidate the symbolism of certain animals and the perception of landscape for Indigenous populations in this region. I discuss some of the ways in which animals have been employed to teach and learn proper behaviour in a particular sacred ceremony of the Cheŵa people which takes place in celebration of womanhood: Chinamwali.

  19. L’immaginazione al lavoro. Che cosa e come conosciamo dal romanzo

    Directory of Open Access Journals (Sweden)

    Gianluca Consoli

    2011-12-01

    Full Text Available L’articolo delinea i fondamenti di un’epistemologia del romanzo, rispondendo alle domande di base: che cosa e come possiamo conoscere attraverso il romanzo. A partire dalla definizione del romanzo come racconto di finzione, viene sviluppata  una posizione di cognitivismo radicale, per la quale il romanzo (a produce conoscenza modale; (b giustifica questa conoscenza in base al principio della verosimiglianza; (c favorisce l’apprendimento per esperienza in virtù dell’esemplificazione immaginativa. Le tesi proposte vengono corroborate in riferimento ai recenti dati sperimentali ottenuti dalle scienze cognitive, in particolare dalla psicologia cognitiva, sull’immaginazione, la finzione, la simulazione.

  20. TOTAL 2003 activities report in brief

    International Nuclear Information System (INIS)

    2004-01-01

    This activities report presents the activities of the petroleum industry Group Total for the year 2003. The following topics are detailed: the corporate social responsibility with the environment stewardship, the energy future management, the safety enhancing, the human resources and the ethics and local development; the shareholder information with the Total share and the share-holding structure; the activities with informations on the Group, the main events, the upstream exploration and production,, the downstream refining, marketing, trading and shipping, the chemicals with overview 2003, base chemical and polymers, performance and specialities. (A.L.B.)

  1. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi.

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus-host interaction was conducted by the same assay. CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes with viral entry process in the host cell and acts directly on the viral

  2. In vitro Cytotoxicity and Anti-herpes Simplex Virus Type 1 Activity of Hydroethanolic Extract, Fractions, and Isolated Compounds from Stem Bark of Schinus terebinthifolius Raddi

    Science.gov (United States)

    Nocchi, Samara Requena; de Moura-Costa, Gislaine Franco; Novello, Claudio Roberto; Rodrigues, Juliana; Longhini, Renata; de Mello, João Carlos Palazzo; Filho, Benedito Prado Dias; Nakamura, Celso Vataru; Ueda-Nakamura, Tânia

    2016-01-01

    Background: Herpes simplex virus type 1 (HSV-1) is associated with orofacial infections and is transmitted by direct contact with infected secretions. Several efforts have been expended in the search for drugs to the treatment for herpes. Schinus terebinthifolius is used in several illnesses and among them, for the topical treatment of skin wounds, especially wounds of mucous membranes, whether infected or not. Objective: To evaluate the cytotoxicity and anti-HSV-1 activity of the crude hydroethanolic extract (CHE) from the stem bark of S. terebinthifolius, as well as its fractions and isolated compounds. Materials and Methods: The CHE was subjected to bioguided fractionation. The anti-HSV-1 activity and the cytotoxicity of the CHE, its fractions, and isolated compounds were evaluated in vitro by SRB method. A preliminar investigation of the action of CHE in the virus–host interaction was conducted by the same assay. Results: CHE presented flavan-3-ols and showed anti-HSV-1 activity, better than its fractions and isolated compounds. The class of substances found in CHE can bind to proteins to form unstable complexes and enveloped viruses, as HSV-1 may be vulnerable to this action. Our results suggest that the CHE interfered with virion envelope structures, masking viral receptors that are necessary for adsorption or entry into host cells. Conclusion: The plant investigated exhibited potential for future development treatment against HSV-1, but further tests are necessary, especially to elucidate the mechanism of action of CHE, as well as preclinical and clinical studies to confirm its safety and efficacy. SUMMARY Crude hydroethanolic extract (CHE) presents promising activity against herpes simplex virus type 1 (HSV 1), with selectivity index (SI) = 22.50CHE has flavan-3-ols in its composition, such as catechin and gallocatechinThe fractions and isolated compounds obtained from CHE by bioguided fractionation are less active than the CHE against HSV-1CHE interferes

  3. Tempi che cambiano, luoghi che si trasformano: i mutamenti nei nuraghi fra l’età del Bronzo ed il Primo Ferro

    Directory of Open Access Journals (Sweden)

    Mauro Perra

    2017-01-01

    Full Text Available Riassunto: Il lungo percorso della Civiltà Nuragica, compreso fra XVII e X-IX secolo a.C., si caratterizza come un’epoca di grandi trasformazioni che si susseguono nel tempo e lasciano visibili tracce in un paesaggio mutevole, come in un succedersi di macroscopiche unità stratigrafiche. Si trasformano profondamente così non solo i monumenti ed il paesaggio, ma anche le stesse strutture sociali e politiche delle comunità nuragiche fino alla trasfigurazione del ricordo in mito nei centri cerimoniali o santuari. Abstract: The long trajectory of the Nuragic civilisation (17th - 10th/9th centuries B.C. is characterised by a succession of dramatic changes leaving visible traces in a varying landscape, like stratigraphy on a regional scale. These changes affect not only the Nuragic monuments and landscape but also the social and political institutions of Nuragic communities, culminating in a transfiguration of memory and a new mythology apparent in ceremonial centres and sanctuaries.

  4. Effects of Kapton Sample Cell Windows on the Detection Limit of Smectite: Implications for CheMin on the Mars Science Laboratory Mission

    Science.gov (United States)

    Achilles, C. N.; Ming, Douglas W.; Morris, R. V.; Blake, D. F.

    2012-01-01

    The CheMin instrument on the Mars Science Laboratory (MSL) rover Curiosity is an X-ray diffraction (XRD) and X-ray fluorescence (XRF) instrument capable of providing the mineralogical and chemical compositions of rocks and soils on the surface of Mars. CheMin uses a microfocus X-ray tube with a Co target, transmission geometry, and an energy-discriminating X-ray sensitive CCD to produce simultaneous 2-D XRD patterns and energy-dispersive X-ray histograms from powdered samples. CheMin has two different window materials used for sample cells -- Mylar and Kapton. Instrument details are provided elsewhere. Fe/Mg-smectite (e.g., nontronite) has been identified in Gale Crater, the MSL future landing site, by CRISM spectra. While large quantities of phyllosilicate minerals will be easily detected by CheMin, it is important to establish detection limits of such phases to understand capabilities and limitations of the instrument. A previous study indicated that the (001) peak of smectite at 15 Ang was detectable in a mixture of 1 wt.% smectite with olivine when Mylar is the window material for the sample cell. Complications arise when Kapton is the window material because Kapton itself also has a diffraction peak near 15 Ang (6.8 deg 2 Theta). This study presents results of mineral mixtures of smectite and olivine to determine smectite detection limits for Kapton sample cells. Because the intensity and position of the smectite (001) peak depends on the hydration state, we also analyzed mixtures with "hydrated" and "dehydrated"h smectite to examine the effects of hydration state on detection limits.

  5. Il mondo secondo la fisica quantistica segreti e meraviglie della scienza che sta cambiando la nostra vita

    CERN Document Server

    Fracas, Fabio

    2017-01-01

    Questo libro è un'avventura esclusiva e affascinante. Un viaggio, anche nel tempo, alla scoperta di qualcosa di nuovo e di straordinario: la Fisica Quantistica, nelle sue logiche, nelle sue potenzialità, nelle sue applicazioni e nei suoi possibili sviluppi. All'interno del volume vengono ricostruiti passo dopo passo i momenti fondamentali del pensiero quantistico, le questioni su cui si sono interrogati i più grandi scienziati degli ultimi decenni, e i diversi contesti nei quali si sono evoluti i principali modelli della Meccanica Quantistica. Sullo sfondo delle ricerche più attuali - come per esempio quella sulle onde gravitazionali che ha portato al Nobel per la Fisica 2017 -, vengono indagati anche i rapporti esistenti fra Fisica Quantistica, Relatività Einsteiniana e Teoria delle Stringhe. Inoltre, fra i tanti temi trattati nelle sue pagine, trovano spazio persino le incredibili ricadute che gli studi sulla Fisica Quantistica stanno avendo negli ambiti della medicina e delle ricerche sul cervello e s...

  6. Rachunek dochodów i wydatków budżetu jednostki samorządu terytorialnego na przykładzie gminy Chełmiec w latach 2011-2013

    OpenAIRE

    Rodak, Anna

    2015-01-01

    Przedłożona praca ma na celu wskazanie źródeł i struktury dochodów budżetowych oraz charakteru wydatkowania środków budżetowych gminy Chełmiec, a także dokonanie rzetelnej oceny sytuacji finansowej wymienionej powyżej jednostki. Analiza budżetu obejmuje zakres czasowy od 2011 do 2013 roku. Szczegółowe pytania, na które starano się w niniejszej pracy odpowiedzieć są następujące: Czy gmina Chełmiec jest gospodarna w wykorzystywaniu środków budżetowych? oraz jak gmina Chełmiec mając do dyspozycj...

  7. Physical activity of elderly patients after total hip arthroplasty.

    Science.gov (United States)

    Cukras, Zbigniew; Praczko, Katarzyna; Kostka, Tomasz; Jegier, Anna

    2007-01-01

    Total hip arthroplasty (THA) is the most common method of treatment of severe hip osteoarthritis. There is little data concerning the physical activity of total hip arthroplasty patients in Poland and investigations to explore this area are useful. The aim of the study was to describe the post-operative physical activity of total hip arthroplasty patients. A total of 146 adult people were examined, among which 28 men and 41 women had undergone total hip arthroplasty due to primary osteoarthritis of the hip, while another 32 men and 41 women matched for age who had not undergone hip surgery for osteoarthritis served as controls. The physical activity of study participants was assessed with the 7-Day Physical Activity Recall Questionnaire. All participants were also asked about the type and amount of physical activity they engaged in to maintain good health. Physical activity measured as the total amount of calories expended through physical activity per week was similar in the post-THA patients compared to the controls. The only differences were a smaller amount of calories expended during low-intensity physical activity by men after total hip arthroplasty compared to men who had not undergone surgery for osteoarthritis and a smaller amount of calories expended through high-intensity physical activity by women after total hip arthroplasty compared to female controls. The kinds of recreational physical activity most commonly practised by patients a mean of two years after total hip arthroplasty were marching, bicycling and general body conditioning exercises (usually the continuation of exercises recommended during post-operative rehabilitation). The percentage of post-THA patients undertaking physical activity for the prevention of non-communicable diseases was low. Physical activity should be more effectively encouraged in patients after total hip arthroplasty.

  8. Long term exposure to low dose neurotoxic pesticides affects hatching, viability and cholinesterase activity of Artemia sp.

    Science.gov (United States)

    Gambardella, Chiara; Nichino, Daniela; Iacometti, Camillo; Ferrando, Sara; Falugi, Carla; Faimali, Marco

    2018-03-01

    The brine shrimp Artemia was used as a model organism to test toxicity of several neuroactive pesticides (chlorpyrifos (CLP), chlorpyrifos oxon (CLP ox), diazinon (DZN), carbaryl (CBR)) following exposure to far below than lethal doses. Cysts were exposed to the pesticides in order to test a scenario similar to actual coastal environment contamination, by analyzing different responses. Cysts were rehydrated in water containing the pesticides at concentrations ranging from 10 -11 to 10 -5  M, for 72, 96 and 192 h, respectively. For these exposure times, morpho-functional and biochemical parameters, such as hatching speed and viability were investigated in the larvae together with cholinesterase (ChE) activity quantification and histochemical localization. Finally, ChE inhibition was also compared with conventional selective ChE inhibitors. Results showed that CLP ox and CBR caused a significant dose-dependent decrease in hatching speed, followed by high percentages of larval death, while CLP and DZN were responsible for irregular hatching patterns. In addition, the pesticides mostly caused larval death some days post-hatching, whereas this effect was negligible for the specific ChE inhibitors, suggesting that part of pesticide toxicity may be due to molecules other than the primary target. ChE activity was observed in the protocerebrum lobes, linked to the development of pair eyes. Such activity was inhibited in larvae exposed to all pesticides. When compared to conventional selective inhibitors of ChE activities, this inhibition demonstrated that the selected pesticides mainly affect acetylcholinesterase and, to a lesser extent, pseudocholinesterases. In conclusion, the brine shrimp is a good model to test the environmental toxicity of long term exposure to cholinergic pesticides, since changes in hatching speed, viability and ChE activity were observed. Copyright © 2018 Elsevier B.V. All rights reserved.

  9. SYM1, l’ortologo di lievito del gene umano MPV17, codifica per una proteina indotta da stress che modula lo stato bioenergetico e morfogenetico del mitocondrio

    OpenAIRE

    Dallabona, Cristina

    2010-01-01

    Mutazioni nel gene MPV17 causano l’insorgenza di una forma epatocerebrale della sindrome da deplezione del DNA mitocondriale. MPV17 codifica per una piccola proteina idrofobica localizzata nella membrana mitocondriale interna con funzione sconosciuta. Per cercare di chiarire le basi molecolari che causano la patologia, abbiamo utilizzato il lievito S. cerevisiae come organismo modello grazie alla presenza di un ortologo di MPV17: SYM1. Abbiamo dimostrato che la proteina Sym1 è essenziale per ...

  10. “Nell’occhio che riscopre la luce”: tempo, Storia e memoria nella poesia di Salvatore Quasimodo

    OpenAIRE

    Alessandro Martini

    2015-01-01

    La riflessione sul rapporto dell’uomo con il tempo e con la storia percorre senza soluzione di continuità l’opera poetica di Salvatore Quasimodo. Spesso a disagio in una dimensione temporale fissa e definita, schiacciato tra dolore dell’esilio, insensatezza della guerra e crisi del dopoguerra, il poeta interroga gli evi passati e le ere future in cerca di un’armonia che appare il più delle volte sfuggente.

  11. Crèche and School of the Staff Association: a programme for children from 2 to 4 year old

    CERN Multimedia

    Staff Association

    2018-01-01

    Find out how children between the ages of two to four and their families can benefit from the Staff Association Crèche and School programme. Classes for children aged between two and four years have been set-up to ensure the initial transition from home to school is as smooth as possible. Children attend mornings only and are welcomed by the same group of teaching staff throughout the week, allowing the children to establish a link between their home life and the crèche/school. The challenge of these classes is to offer the children a happy environment where they can feel emotionally secure, and the teaching staff can create a harmonious atmosphere allowing them to learn by moving, manipulating, exchanging, making mistakes… playing. Creativity takes a central role as it enables the child to express him or herself and increase their ability to handle their emotions constructively. According to Albert Einstein ‘Play is the highest form of research’. &nbs...

  12. Lessons Learned from the Crew Health Care System (CHeCS) Rack 1 Environmental Control and Life Support (ECLS) Design

    Science.gov (United States)

    Williams, David E.

    2006-01-01

    This paper will provide an overview of the International Space Station (ISS) Environmental Control and Life Support (ECLS) design of the Crew Health Care System (CHeCS) Rack 1 and it will document some of the lessons that have been learned to date for the ECLS equipment in this rack.

  13. Substitution of the burning PRIOR SSB 10 for SSB7 in the Furnace 10 of the Company Major Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Ivett María Ramírez-Pérez

    2017-01-01

    Full Text Available One of the fundamental causes of massive destruction of chambers and vaults in the Furnace of Reduction at the Ernesto Che Guevara Factory is due to operate the combustion chambers with excess of contribution of heat, causing that the flame of very high temperature penetrates into the homes, affecting the throats of the chambers, the vaults, teeth and arms. The burners current are Prior SSB10. In this paper is demonstrated that the burning Prior SSB 10 have double productivity that the SSB 7 with the same quantity of air to the burner. It is evaluated the substitution of the burning Prior SSB 10 by SSB 7 on the operation of the Furnace of Reduction No. 10 at the Ernesto Che Guevara (ECG Factory. Demonstrating that the change not produce variations in the operation.

  14. Changes in total carbohydrate and total antioxidant activity induced by gamma irradiation of wheat flour

    International Nuclear Information System (INIS)

    Manupriya, B.R.; Shenoy, K. Bhasker; Patil, Shrikant L.; Somashekarappa, H.M.

    2015-01-01

    Wheat is a staple food grain in India after rice and occupies number one position in the world. The wheat crop not only gives food grains but also gives fodder for animals. Among many preservation methods irradiation is a current technique used to overcome infestation, contamination and spoilage of stored grains. The present study is aimed to check the changes in composition of irradiated wheat flour. Wheat flour was exposed to five different irradiation doses (0.25 KGy, 0.5KGy, 1KGy, 5KGy and 10 KGy) by using 60 Co gamma-irradiation chamber. Irradiated flour was stored in air sealed polyethylene pouch and plastic container at room temperature for different time intervals (0 th day, 1 month and 3 months). The stored flour was checked for total antioxidant activity by phosphomolybdate method and total carbohydrates concentration by phenol-sulphuric acid method. On 0 th day total antioxidant activity and total carbohydrate concentration was found to be increased at 0.5KGy (0.113 mg/ml and 0.045 mg/ml respectively) when compared to control (0.79 mg/ml and 39.5 mg/ml). Similarly for 1 month stored samples of air sealed polyethylene pouch total antioxidant activity and total carbohydrate concentration was observed to be increased at 0.5KGy (0.117 mg/ml and 0.045mg/ml respectively) when compared to control (0.096 mg/ml and 0.035 mg/ml). But in case of stored samples of plastic container total antioxidant activity increased at 0.25KGy (0.060 mg/ml) and total carbohydrate increased at 5KGy (0.051 mg/ml). Increased and decreased values were found in both factors for 3 months stored samples of air sealed polyethylene pouch and plastic container. Total antioxidant activity increased at 5KGy (0.072 mg/ml) for polyethylene bag samples and at 0.5KGy (0.137 mg/ml) for plastic container sample. Same way total carbohydrate concentration increased at 0.25KGy (0.046 mg/ml) and at 1KGy (0.045 mg/ml) respectively. This increase is due to affects of γ-irradiation on biomolecules by

  15. Cherenkov and scintillation light separation on the CheSS experiment

    Science.gov (United States)

    Caravaca, Javier; Land, Benjamin; Descamps, Freija; Orebi Gann, Gabriel D.

    2016-09-01

    Separation of the scintillation and Cherenkov light produced in liquid scintillators enables outstanding capabilities for future particle detectors, the most relevant being: particle directionality information in a low energy threshold detector and improved particle identification. The CheSS experiment uses an array of small, fast photomultipliers (PMTs) and state-of-the-art electronics to demonstrate the reconstruction of a Cherenkov ring in liquid scintillator using two techniques: based on the photon density and using the photon hit time information. A charged particle ionizing a scintillation medium produces a prompt Cherenkov cone and late isotropic scintillation light, typically delayed by several ns. The fast response of our PMTs and DAQ provides a precision well below the ns level, making possible the time separation. Furthermore, the usage of the new developed water-based liquid scintillators (WbLS) enhances the separation since it allows tuning of the Cherenkov/Scintillation ratio. Latest results on the separation for pure liquid scintillators and WbLS will be presented.

  16. Antileishmanial, antimalarial and antimicrobial activities of the extract and isolated compounds from Austroplenckia populnea (Celastraceae).

    Science.gov (United States)

    Andrade, Sérgio F; da Silva Filho, Ademar A; de O Resende, Dimas; Silva, Márcio L A; Cunha, Wilson R; Nanayakkara, N P Dhammika; Bastos, Jairo Kenupp

    2008-01-01

    Austroplenckia populnea (Celastraceae), known as "marmelinho do campo", is used in Brazilian folk medicine as antimicrobial, anti-inflammatory, and antitumoural agent. The aim of the present work was to evaluate the antimicrobial, antileishmanial and antimalarial activities of the crude hydroalcoholic extract of A. populnea (CHE) and some of its isolated compounds. The phytochemical study of the CHE was carried out affording the isolation of methyl populnoate (1), populnoic acid (2), and stigmast-5-en-3-O-beta-(D-glucopyranoside) (3). This is the first time that the presence of compound 3 in A. populnea is reported. The results showed that the CHE presents antifungal and antibacterial activities, especially against Candida glabrata and Candida albicans, for which the CHE showed IC50 values of 0.7 microg mL(-1) and 5.5 microg mL(-1), respectively, while amphotericin B showed an IC50 value of 0.1 microg mL(-1) against both microorganisms. Compounds 1-3 were inactive against all tested microorganisms. In the antileishmanial activity test against Leishmania donovani, the CHE showed an IC50 value of 52 microg mL(-1), while compounds 2 and 3 displayed an IC50 value of 18 microg mL(-1) In the antimalarial assay against Plasmodium falciparum (D6 and W2 clones), it was observed that all evaluated samples were inactive. In order to compare the effect on the parasites with the toxicity to mammalian cells, the cytotoxicity activity of the isolated compounds was evaluated against Vero cells, showing that all evaluated samples exhibited no cytotoxicity at the maximum dose tested.

  17. Méthodes de levée de dormance de la noix de cola fraîche ( Cola ...

    African Journals Online (AJOL)

    Cette étude avait pour objectif de proposer une méthode efficace de germination de la noix de cola fraîche, en vue d'une réduction significative du délai de germination à travers un test comparatif de traitement de la noix par blessure, humidification et chaleur. Méthodologie et résultats: L'étude a été mise en place selon un ...

  18. CheD: chemical database compilation tool, Internet server, and client for SQL servers.

    Science.gov (United States)

    Trepalin, S V; Yarkov, A V

    2001-01-01

    An efficient program, which runs on a personal computer, for the storage, retrieval, and processing of chemical information, is presented, The program can work both as a stand-alone application or in conjunction with a specifically written Web server application or with some standard SQL servers, e.g., Oracle, Interbase, and MS SQL. New types of data fields are introduced, e.g., arrays for spectral information storage, HTML and database links, and user-defined functions. CheD has an open architecture; thus, custom data types, controls, and services may be added. A WWW server application for chemical data retrieval features an easy and user-friendly installation on Windows NT or 95 platforms.

  19. A Drosophila protein family implicated in pheromone perception is related to Tay-Sachs GM2-activator protein.

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W

    2009-01-02

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons.

  20. A Drosophila Protein Family Implicated in Pheromone Perception Is Related to Tay-Sachs GM2-Activator Protein*

    Science.gov (United States)

    Starostina, Elena; Xu, Aiguo; Lin, Heping; Pikielny, Claudio W.

    2009-01-01

    Low volatility, lipid-like cuticular hydrocarbon pheromones produced by Drosophila melanogaster females play an essential role in triggering and modulating mating behavior, but the chemosensory mechanisms involved remain poorly understood. Recently, we showed that the CheB42a protein, which is expressed in only 10 pheromone-sensing taste hairs on the front legs of males, modulates progression to late stages of male courtship behavior in response to female-specific cuticular hydrocarbons. Here we report that expression of all 12 genes in the CheB gene family is predominantly or exclusively gustatory-specific, and occurs in many different, often non-overlapping patterns. Only the Gr family of gustatory receptor genes displays a comparable variety of gustatory-specific expression patterns. Unlike Grs, however, expression of all but one CheB gene is sexually dimorphic. Like CheB42a, other CheBs may therefore function specifically in gustatory perception of pheromones. We also show that CheBs belong to the ML superfamily of lipid-binding proteins, and are most similar to human GM2-activator protein (GM2-AP). In particular, GM2-AP residues involved in ligand binding are conserved in CheBs but not in other ML proteins. Finally, CheB42a is specifically secreted into the inner lumen of pheromone-sensing taste hairs, where pheromones interact with membrane-bound receptors. We propose that CheB proteins interact directly with lipid-like Drosophila pheromones and modulate their detection by the gustatory signal transduction machinery. Furthermore, as loss of GM2-AP in Tay-Sachs disease prevents degradation of GM2 gangliosides and results in neurodegeneration, the function of CheBs in pheromone response may involve biochemical mechanisms critical for lipid metabolism in human neurons. PMID:18952610

  1. Electron microscopical study of non-specific cholinesterase activity in simple lamellar corpuscles of glabrous skin from cat rhinarium: a histochemical evidence for the presence of collagenase-sensitive molecular forms and their secretion.

    Science.gov (United States)

    Dubový, P

    1989-01-01

    The distribution of nCHE activity was studied histochemically in simple lamellar corpuscles (SLCs) of glabrous skin from cat rhinarium. The Schwann cells forming myelin sheaths in preterminal part of SCLs exhibited no positive reaction for nCHE activity. Prevalent reaction product was localized extracellularly in the inne core enveloping terminal portion of unmyelinated sensory axon. A dot-like shaped reaction product was deposited in the basal lamina of the inner core cells and their cytoplasmic lamellae or was scattered in enlarged interlamellar spaces. Only small amount of fine end product was found to be associated with the plasma membrane of inner core lamellae. Fine reaction product for nCHE activity was consistently localized in perinuclear and rER cisternae and saccules of the Golgi apparatus of inner core cells. Some vesicles around rER and the Golgi apparatus, ones beneath the plasma membrane, and tubular-like cisternal profiles oriented towards the surface contained nCHE end product, as well. The intracellular and extracellular localization of nCHE reaction product suggests that this enzyme behaves in cat SLCs as a secreted rather than as an integral membrane protein. A large amount of dot-like reaction product in the interlamellar spaces disappeared if the skin sections were treated with collagenase before incubation in the medium for histochemical detection of nCHE activity. The decrease of nCHE end product in SLCs of the skin sections after collagenase digestion was corroborated by means of light microdensitometer and electrometrical measurement. The histochemical detection and electrometrical measurement revealed that the majority of the reaction product in the interlamellar spaces of inner core corresponds with the nCHE molecules sensitive to collagenase treatment and they are probably counted among asymmetrical molecular forms.

  2. Fractional derivatives. An introduction; Derivate frazionarie. Che cosa sono, a cosa servono

    Energy Technology Data Exchange (ETDEWEB)

    Dattoli, G. [ENEA, Div. Fisica Applicata, Centro Ricerche Frascati, Rome (Italy)

    2001-07-01

    In this item is presented a brief survey of fractional calculus and of the relevant applications. In the work are discussed different points of view of the operation of fractional derivative and present a unifying definition. The role played by fractional derivatives and integrals within the framework of integral transform is analyzed. [Italian] In questo articolo si traccia un profilo del cosidetto calcolo frazionario e delle relative applicazioni a problemi di matematica pura ed applicata. Si discutono varie definizioni dell'operazione di derivata frazionaria, non tutte coincidenti fra loro, e si mostra come sia possibile proporre una definizione univoca che inglobi tutte le altre. Si analizza infine il ruolo giocato dalle derivate e dagli integrali frazionari e, piu' in generale, quello degli operatori differenziali ad esponente frazionario, nell'ambito della teoria delle rappresentazioni integrali.

  3. Rock shelter occupation during isotopic stage 5: level D of the site of Payre (Ardèche, France. Territorial organisation and intra-site activities

    Directory of Open Access Journals (Sweden)

    Moncel, Marie-Hélène

    2007-06-01

    Full Text Available This paper presents the results obtained from an interdisciplinary study of the level D archaeological assemblages from Payre (Ardèche, France. This site is dated to the final of OIS 6 and the beginning of OIS 5. The combined analysis of the lithic and faunal assemblages accumulated and their management “into” and “out of” the site gives a better understanding of the behaviour of the Neanderthal groups that inhabited it. This study has allowed us to correlate the territorial exploitation for game hunting and for raw material procurement, within the context of seasonal short term occupations probably during the end of autumn and the beginning of winter.  

    Este artículo presenta los resultados obtenidos a través del estudio multidisciplinar del registro arqueológico del nivel D del yacimiento de Payre (Ardèche, Francia datado entre el final del OIS 6 y el comienzo del OIS 5. El análisis conjunto de la industria lítica y de los restos óseos recuperados en el yacimiento y de la gestión de dichos recursos dentro y fuera de él, ha hecho posible la comprensión de los comportamientos humanos de los grupos neandertales que lo ocuparon. Dicho estudio nos ha permitido poner en relación el tipo de explotación del territorio de caza y de captación de materias primas, dentro del marco de ocupaciones estacionales de corta duración desarrolladas probablemente entre el final del otoño y el principio del invierno.  

  4. Total phenolics and antioxidant activity of five medicinal plant

    International Nuclear Information System (INIS)

    Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H.

    2007-01-01

    This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 ±8,2 to 763,63 ±13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC 50 value of 27.59 ± 0.82 μg/mL, was comparable to rutin (EC 50 = 27.80 ± 1.38) and gallic acid (EC 50 = 24.27 ± 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

  5. The Drosophila gene CheB42a is a novel modifier of Deg/ENaC channel function.

    Directory of Open Access Journals (Sweden)

    Yehuda Ben-Shahar

    2010-02-01

    Full Text Available Degenerin/epithelial Na(+ channels (DEG/ENaC represent a diverse family of voltage-insensitive cation channels whose functions include Na(+ transport across epithelia, mechanosensation, nociception, salt sensing, modification of neurotransmission, and detecting the neurotransmitter FMRFamide. We previously showed that the Drosophila melanogaster Deg/ENaC gene lounge lizard (llz is co-transcribed in an operon-like locus with another gene of unknown function, CheB42a. Because operons often encode proteins in the same biochemical or physiological pathway, we hypothesized that CHEB42A and LLZ might function together. Consistent with this hypothesis, we found both genes expressed in cells previously implicated in sensory functions during male courtship. Furthermore, when coexpressed, LLZ coprecipitated with CHEB42A, suggesting that the two proteins form a complex. Although LLZ expressed either alone or with CHEB42A did not generate ion channel currents, CHEB42A increased current amplitude of another DEG/ENaC protein whose ligand (protons is known, acid-sensing ion channel 1a (ASIC1a. We also found that CHEB42A was cleaved to generate a secreted protein, suggesting that CHEB42A may play an important role in the extracellular space. These data suggest that CHEB42A is a modulatory subunit for sensory-related Deg/ENaC signaling. These results are consistent with operon-like transcription of CheB42a and llz and explain the similar contributions of these genes to courtship behavior.

  6. Phytochemical screening, total phenolic, total flavonoids contents and antioxidant activity of cinchona ledgeriana leaves ethanol extract

    Science.gov (United States)

    Sundowo, Andini; Artanti, Nina; Hanafi, M.; Minarti, Primahana, Gian

    2017-11-01

    C ledgeriana is a medicinal plant that contains alkaloids, especially on the barks for commercial production of quinine as antimalarial. The main alkaloids in this plant are cinchonine, cinchonidine, quinine and quinidine. Besides for antiamalarial this plant is also commonly used to treat whooping cough, influenza and dysentery. Compare to other medicinal plants, nowadays only very few studies were conducted in Cinchona species. Our current study aims to determine the content of phytochemical, total phenol and total flavonoids from C. ledgeriana leaves 70% ethanol extract. The extraction was performed by maceration method using 70% ethanol solvent and then fractionated into hexane, ethylacetate and butanol. Phytochemical screening was performed to determine the content of alkaloids, flavonoids, terpenoids, tannins and saponins. Total phenol and flavonoid contents of the extract were determined by Folin-Ciocalteu and alumunium chloride colorimetric methods using gallic acid and quercetin as standards. The antioxidant activity was determined by using 2, 2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity. The results of phytochemical screening showed that the 70% ethanol extract of C. ledgeriana leaves contained alkaloids, flavonoids, terpenoids, tannins and saponins. The total phenol and total flavonoids analysis showed that ethyl acetate fraction had the highest total phenol (40.23%) and total flavonoids (65.34%).

  7. Antioxidant Activities of Total Pigment Extract from Blackberries

    Directory of Open Access Journals (Sweden)

    Jiechao Liu

    2005-01-01

    Full Text Available Total pigment has been extracted from blackberries and its antioxidant activity against lipid peroxidation and scavenging capacities towards superoxide anion radicals, hydroxyl radicals and nitrite in different in vitro systems have been investigated. The total pigment extract from blackberries (TPEB exhibited strong antioxidant activity against lipid peroxidation in a linoleic acid model system and scavenging capacities towards superoxide anion radicals, generated by a pyrogallol autoxidation system or by an illuminating riboflavin system, hydroxyl radicals generated by Fenton reaction, and nitrite. Furthermore, the antioxidant activities were correlated with the concentrations of the TPEB. In the test concentration range, the maximum inhibition percentage against linoleic acid peroxidation was 98.32 % after one week’s incubation, and the maximum scavenging percentages for the free radicals and nitrite inhibition in the above reactive systems reached 90.48, 96.48, 93.58 and 98.94 %, respectively. The TPEB is a natural, edible colorant with excellent antioxidant activities and health benefits and it seems to be applicable in both healthy food and medicine.

  8. Serum cholinesterase polymorphism (CHE1 and CHE2 loci) among several Indian groups from Amazon region of Brazil, and segregation of the C5 variant in families.

    Science.gov (United States)

    Guerreiro, J F; Santos, S E; Aguiar, G F

    1989-04-01

    Eight Indian tribes from the Amazon region of Brazil (Araweté, Arara, Yamamadi, Kararaô, Karitiana, Waiampi, Surui and Cinta Larga) were studied for the distribution of the atypical and C5 variants of serum cholinesterase. None of them presented the CHE1*A allele, but the C5 variant was found in the Araweté (20.4%), Kararaô (15.6%), Karitiana (50.5%), Surui (12.3%) and Cinta Larga (19.6%) tribes. The frequency of the C5+ phenotype in the Karitiana is the highest reported thus far in human populations. Segregation studies considering the C5 variant were made among the Karitiana, and also among the Urubu-Kaapor and Munduruku tribes previously studied by Guerreiro et al [1987a, 1987b]. Most of the data were in agreement with the genetic hypothesis, but they also revealed a significant lack of the C5+ phenotype in offspring from C5+ X C5+ matings, as well as the occurrence of two C5+ children from C5- X C5- unions, in the Urubu-Kaapor tribe.

  9. Noi siamo quello che ricordiamo - Le frazze di Crucoli: il teatro, il rito, il riscatto sociale

    Directory of Open Access Journals (Sweden)

    Tonia Mingrone

    2012-01-01

    Full Text Available Abstract - IT Questo lavoro nasce da una ricerca di campo sulle frazze, termine dialettale che indica le farse di Carnevale che si rappresentavano fino a cinquant’anni fa in molti paesi calabresi, tra cui il mio, Crucoli, in provincia di Crotone. Lo scopo di questo lavoro non è fare un resoconto esaustivo di tutto ciò che accadeva a Crucoli durante la celebrazione del Carnevale, impresa assai difficile dal momento che non ci sono documenti scritti e quindi bisogna affidarsi ai racconti orali delle persone intervistate, spesso non fedeli alla realtà, perché modificati dal tempo e dalla memoria. L’approccio con cui ho intrapreso questa ricerca è sicuramente legato all’aspetto teatrale e performativo dell’evento, senza trascurarne la rilevanza antropologica. Il materiale raccolto è frutto di interviste e colloqui con la gente del posto unito ad un grande lavoro di ricerca bibliografica di autori che avevano trattato di questo argomento in relazione ai loro paesi di origine.Lo scopo è quello di delineare l’organizzazione e lo svolgimento delle frazze, cercando di ricostruire la sua durata e le ripercussioni sulla comunità, nonché dimostrare ancora una volta come il teatro, messo a disposizione di alcuni eventi, diventi un mezzo forte di liberazione e di contestazione. Abstract - FR Cet article prend sa naissance par une recherche sur champ concernant les frazze, terme dialectal qui dénote les farces du Carnaval mises en scène jusqu'à il y a cinquante ans dans plusieurs villages en Calabria, entre eux le mien, Crucoli, dans la province de Crotone. La raison de ce travail n'est pas d'accomplir un compte rendu exhaustif de tout ce qui avait lieu à Crucoli pendant la célébration du Carnaval, l'exploit étant très difficile, du moment qu'aucun document écrit a été parvenu et par conséquence il est nécessaire de se remettre aux contes des témoins interviewés, souvent pas fidèles au réel, parce-que détournés par les

  10. Characterization of the In Vitro Kinetic Interaction of Chlorpyrifos-Oxon with Rat Salivary Cholinesterase: A Potential Biomonitoring Matrix

    Energy Technology Data Exchange (ETDEWEB)

    Kousba, Ahmed A.(BATTELLE (PACIFIC NW LAB)); Poet, Torka S.(BATTELLE (PACIFIC NW LAB)); Timchalk, Charles (Pacific Northwest National Laboratory)

    2003-02-12

    Chlorpyrifos (CPF) is a commonly used organophosphate insecticide (OP). The primary mechanism of action for CPF involves the inhibition of acetylcholinesterase (AChE) by the active metabolite, CPF-oxon, with subsequent accumulation of acetylcholine (ACh) resulting in a wide range of neutotoxicity. CPF-oxon, can likewise inhibit other non-target cholinesterases (ChE) such as butyrylcholinesterase (BuChE), which represents a detoxification mechanism and a potential biomarker of exposure/response. Biological monitoring for OPs has focused on measuring parent chemical or metabolite in blood and urine or blood ChE inhibition. Salivary biomonitoring has recently been explored as a practical method for examination of chemical exposure; however, there are a limited number of studies exploring its use for OPs. To evaluate the use of salivary ChE as a biological monitor for OP exposure, the current study characterized salivary ChE activity in Sprague-Dawley rats through its comparison with brain and plasma ChE using BW284C51 and iso-OMPA as selective inhibitors of AChE and BuChE, respectively. The study also estimated the kinetic constants describing BuChE interaction with CPF-oxon. A modified Ellman assay in conjunction with pharmacodynamic (PD) modeling was used to characterize the in vitro titration of diluted rat salivary ChE enzyme with CPF-oxon. The results indicated that, more than 95% of rat salivary ChE activity was associated with BuChE activity, total BuChE active site concentration was 0.0012 0.00013 nmol/ml saliva, reactivation rate constant (Kr) was 0.068 0.008 h-1 and inhibitory (Ki) rate constant of 8.825 and 9.80 nM-1h-1 determined experimentally and using model optimization respectively. These study results would be helpful for further evaluating the potential utility of salivary ChE as a practical tool for biological monitor of OP exposures.

  11. Effect of extraction solvent on total phenol content, total flavonoid content, and antioxidant activity of Limnophila aromatica

    Directory of Open Access Journals (Sweden)

    Quy Diem Do

    2014-09-01

    Full Text Available Limnophila aromatica is commonly used as a spice and a medicinal herb in Southeast Asia. In this study, water and various concentrations (50%, 75%, and 100% of methanol, ethanol, and acetone in water were used as solvent in the extraction of L. aromatica. The antioxidant activity, total phenolic content, and total flavonoid content of the freeze-dried L. aromatica extracts were investigated using various in vitro assays. The extract obtained by 100% ethanol showed the highest total antioxidant activity, reducing power and DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging activity. The same extract also exhibited the highest phenolic content (40.5 mg gallic acid equivalent/g of defatted L. aromatica and the highest flavonoid content (31.11 mg quercetin equivalent/g of defatted L. aromatica. The highest extraction yield was obtained by using 50% aqueous acetone. These results indicate that L. aromatica can be used in dietary applications with a potential to reduce oxidative stress.

  12. Physical education in schools, sport activity and total physical activity in adolescents

    Directory of Open Access Journals (Sweden)

    Priscila Missaki Nakamura

    2013-07-01

    Full Text Available Less than half of adolescents reach the recommended300 minutes per week of physical activity (PA. Physical educationclasses and sports participation provideopportunities for adolescents to accumulate moretime for PA practice; however, littleis known about the influence of these variables onthe level of total physical activity ofadolescents. The aim of this study was toinvestigate the association between the practiceof physical education (PE in schools and sportsactivities (SA with the practice oftotal PA of adolescents. The study wascross-sectional and involved 467 adolescents ofhigh school (15.8 ± 0.9 years-old from the city ofRio Claro, in the State of São Paulo. Participants completed the Physical ActivityQuestionnaire to Older Children (PAQ-Cand questions related to the practice of PE and SAin schools. We performed a logisticregression with p<0.05 using SPSS. Girls hadlower prevalence of PA than boys, 9.4% and26.8%, respectively. Boys who did not participateof PE classes (OR=0.25, CI95%=0.09-0.66 and SA in schools (OR=0.34, CI95%=0.12-0.95were less likely to be active in PAthan boys who practiced these activities. Theparticipation in PE classes or engagementin some SA were positively associated with thepractice of total PA in boys.

  13. The Crèche and School structure of the CERN Staff Association is looking for a new name

    CERN Multimedia

    Staff Association

    2018-01-01

    The CERN Staff Association is launching a competition to find a new name to replace the current acronym EVEE (Espace de Vie Enfantine et École). The competition is open to everyone from Thursday, 1 February 2018 to Thursday, 15 March. All participants can send their name suggestions via the form available on the websites of the Staff Association and the Crèche and School. Good luck to all – may the best one win! P.S. The Rules of the Competition are available on both websites

  14. Review: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven (2012

    Directory of Open Access Journals (Sweden)

    Geert Castryck

    2015-01-01

    Full Text Available Review of the edited volume: Thomas Bierschenk and Eva Spies (eds, 50 Jahre Unabhängigkeit in Afrika: Kontinuitäten, Brüche, Perspektiven, Cologne: Rüdiger Köppe Verlag, 2012, ISBN 9783896458292, 572 pages

  15. Activity patterns of the stone marten Martes foina Erxleben, 1777, in relation to some environmental factors

    Directory of Open Access Journals (Sweden)

    Mario Posillico

    1995-12-01

    significantly correlated to any food category, except reptiles, a spring and summer prey. Coleoptera and Orthoptera, the main invertebrate food, and fruits, correlated poorly to activity. Surprisingly, food does not seem to be the primary factor responsible for variation in activity patterns. Riassunto Attività della faina Martes foina Erxleben, 1777, in relazione a alcuni parametri ambientali - Tre faine (2 maschi, 1 femmina Martes foina Erxleben, 1777, sono state studiate con tecniche radiotelemetriche per 4, 2,5 e 12 mesi rispettivamente, in un'area rurale della provincia di Siena. L'alimentazione è stata valutata tramite analisi fecali, come frequenza di comparsa e volume stimato. L'attività totale, notturna, diurna e crepuscolare sono state misurate come proporzione di rilevamenti attivi e elaborate quindicinalmente. La variazione stagionale dell'attività è stata correlata a T°C media, fotoperiodo, piovosità, alimentazione e ampiezza di nicchia trofica. L'attività totale è stata ripartita in fasce orarie e comparata tra le stagioni. La frutta costituisce la base dell'alimentazione, il suo uso è massimo in estate e autunno, seguito da vertebrati e invertebrati, che invece costituiscono la principale fonte di cibo in inverno e primavera. Non sono state riscontrate differenze significative tra i tre animali per quantità e ripartizione dell'attività in fasce orarie. L'attività totale è massima in estate e decresce significativamente nel resto dell'anno. L'attività notturna (massima in autunno e in inverno differisce significativamente tra le stagioni, tranne che per l'estate rispetto alla primavera e per l'inverno rispetto all'autunno. Anche l'attività diurna differisce significativamente tra le stagioni, tranne che per la primavera rispetto all'estate (quando è massima e per l'autunno rispetto all'inverno (quando raggiunge un minimo. L'attività crepuscolare resta costante per l'intero periodo di studio. La

  16. Method to determine the activity concentration and total activity of radioactive waste

    International Nuclear Information System (INIS)

    Angeles C, A.

    2001-02-01

    A characteristic system of radioactive waste is described to determine the concentration of radionuclides activity and the total activity of bundles of radioactive waste. The system this integrated by three subsystems: - Elevator of drums. - Electromechanics. - Gamma spectroscopy. In the system it is analyzed waste of issuing gamma specifically, and this designed for materials of relative low density and it analyzes materials of cylindrical recipients

  17. Inhibition of total oxygen uptake by silica nanoparticles in activated sludge

    Energy Technology Data Exchange (ETDEWEB)

    Sibag, Mark [Department of Environment and Energy, Sejong University, 98 Gunja-Dong, Gwangjin-Gu, Seoul 143-747 (Korea, Republic of); Choi, Byeong-Gyu [School of Civil, Environmental and Architectural Engineering, Korea University, 145, Anam-ro, Sungbuk-ku, Seoul 136-701 (Korea, Republic of); Suh, Changwon [Energy Lab, Environment Group, Samsung Advanced Institute of Technology, 130 Samsung-ro, Yeongtong-gu, Suwon-si, Gyeonggi-do 443-803 (Korea, Republic of); Lee, Kwan Hyung; Lee, Jae Woo [Department of Environmental Engineering and Program in Environmental Technology and Policy, Korea University, Sejong 339-700 (Korea, Republic of); Maeng, Sung Kyu [Department of Civil and Environmental Engineering, Sejong University, 98 Gunja-Dong, Gwangjin-Gu, Seoul 143-747 (Korea, Republic of); Cho, Jinwoo, E-mail: jinwoocho@sejong.edu [Department of Environment and Energy, Sejong University, 98 Gunja-Dong, Gwangjin-Gu, Seoul 143-747 (Korea, Republic of)

    2015-02-11

    Highlights: • Silica nanoparticles (SNP) inhibit total oxygen uptake in activated sludge. • Relatively smaller SNP are inhibitorier than larger SNP. • SNP alters C15:0, C16:0 and C18:0 in activated sludge fatty acid methyl ester profile. - Abstract: Nanoparticle toxicity to biological activities in activated sludge is largely unknown. Among the widely used nanoparticles, silica nanoparticles (SNP) have a limited number of studies associated with inhibition to the activated sludge process (ASP). We demonstrated SNP inhibition of activated sludge respiration through oxygen uptake rate (OUR) measurement. Based on the percentage inhibition of total oxygen consumption (I{sub T}), we observed that smaller SNPs (12 nm, I{sub T} = 33 ± 3%; 151 nm, I{sub T} = 23 ± 2%) were stronger inhibitors than larger SNPs (442 and 683 nm, I{sub T} = 5 ± 1%). Transmission electron micrographs showed that some of the SNPs were adsorbed on and/or apparently embedded somewhere in the microbial cell membrane. Whether SNPs are directly associated with the inhibition of total oxygen uptake warrants further studies. However, it is clear that SNPs statistically significantly altered the composition of microbial membrane lipids, which was more clearly described by principal component analysis and weighted Euclidian distance (PCA-ED) of the fatty acid methyl ester (FAME) data. This study suggests that SNPs potentially affect the biological activity in activated sludge through the inhibition of total oxygen uptake.

  18. La normativa italiana sui contratti di lavoro a tempo determinato nel settore della scuola è contraria al diritto dell’Unione: la Corte di Giustizia UE apre al risarcimento per i docenti che abbiano svolto supplenze annuali per la copertura di posti vacanti

    Directory of Open Access Journals (Sweden)

    Arando Plaia

    2015-01-01

    Full Text Available La Corte di Giustizia UE con sentenza 26 novembre 2014, cause riunite C-22/13, C-61/13, C-62/13, C-63/13, C-418/13, Mascolo, ha ritenuto che la normativa europea sul lavoro a tempo determinato, applicabile anche al settore pubblico della scuola (casi Rosado Santana, Marrosu Sardino e Adelener, osta ad un sistema di assunzione per svolgere “supplenze annuali” nelle scuole pubbliche che non prevede almeno una delle seguenti “misure di prevenzione”: l’indicazione delle “ragioni oggettive” che giustificano il rinnovo dei contratti; la determinazione della “durata massima totale dei contratti” o del “numero dei loro rinnovi”, in assenza peraltro di una misura sanzionatoria proporzionata, effettiva e dissuasiva, da applicarsi in caso di utilizzo abusivo di successione di contratti a tempo determinato (clausola 5 dell’accordo quadro 18 marzo 1999 allegato dir. 1999/70/CE. Sebbene dunque il settore dell’insegnamento implichi inevitabilmente una certa “flessibilità”, e la normativa europea non enunci un obbligo generale degli Stati membri di prevedere la sanzione della trasformazione dei contratti di lavoro a tempo determinato in contratti a tempo indeterminato (CGUE 3 luglio 2014, Fiamingo, causa C-362/13, la normativa italiana non prevede misure atte a “prevenire” o “sanzionare” l’utilizzo abusivo di successione di contratti a tempo determinato. Questo (e non altro il principio di diritto affermato dalla Corte di giustizia: la sentenza ribadisce l’assenza di misure di prevenzione imposte dalla disciplina europea nonché di una sanzione risarcitoria rispetto al ricorso abusivo ai contratti a tempo determinato nel settore scolastico.

  19. Physical education in schools, sport activity and total physical activity in adolescents

    Directory of Open Access Journals (Sweden)

    Priscila Missaki Nakamura

    2013-06-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2013v15n5p517 Less than half of adolescents reach the recommended300 minutes per week of physical activity (PA. Physical educationclasses and sports participation provideopportunities for adolescents to accumulate moretime for PA practice; however, littleis known about the influence of these variables onthe level of total physical activity ofadolescents. The aim of this study was toinvestigate the association between the practiceof physical education (PE in schools and sportsactivities (SA with the practice oftotal PA of adolescents. The study wascross-sectional and involved 467 adolescents ofhigh school (15.8 ± 0.9 years-old from the city ofRio Claro, in the State of São Paulo. Participants completed the Physical ActivityQuestionnaire to Older Children (PAQ-Cand questions related to the practice of PE and SAin schools. We performed a logisticregression with p<0.05 using SPSS. Girls hadlower prevalence of PA than boys, 9.4% and26.8%, respectively. Boys who did not participateof PE classes (OR=0.25, CI95%=0.09-0.66 and SA in schools (OR=0.34, CI95%=0.12-0.95were less likely to be active in PAthan boys who practiced these activities. Theparticipation in PE classes or engagementin some SA were positively associated with thepractice of total PA in boys.

  20. Chapter 4: Measurements of total beta-activity in the fallout

    International Nuclear Information System (INIS)

    Duggleby, J.C.; Johannessen, J.C.; Kotler, L.H.; Stewart, F.M.

    1974-01-01

    In order to provide information on fresh fission products in fallout reaching Australia from nuclear tests being conducted by France in Polynesia, measurements were made of total beta activity in daily fallout deposition of 25 Australian sampling stations covering a three month period from 25 July to 23 October 1973. The methods employed to measure the radioactivity of the samples are described and the data on total beta-activity, and the calculated external gamma radiation doses from fresh fallout are presented. (R.L.)

  1. Species-specific patterns of swimming escape performance and cholinesterase activity in a guild of aquatic insects exposed to endosulfan

    International Nuclear Information System (INIS)

    Trekels, Hendrik; Van de Meutter, Frank; Stoks, Robby

    2012-01-01

    Next to imposing direct lethal effects, pollutants may also indirectly impose mortality by making prey organisms more vulnerable to predation. We report that four water boatmen species differed strongly in direct endosulfan-imposed mortality, and only the species that suffered highest mortality, Sigara iactans, also showed a reduction in escape swimming speed. While head AChE activity was inhibited in all four species, body ChE was only inhibited in S. iactans where it covaried with escape swimming speed, indicating a mechanistic link between body ChE and swimming speed. Our study underscores the need for risk assessment to consider sublethal pollutant effects, which may considerably affect survival rates under natural conditions, also when testing concentrations of a pesticide that cause direct mortality. Such sublethal effects may generate discrepancies between laboratory and field studies and should be considered when designing safety factors for toxicants where the risk assessment is solely based on LC50 values. - Highlights: ► Endosulfan, even at lethal levels, did not affect swimming propensity when attacked. ► Endosulfan reduced escape swimming in one out of four tested corixid species. ► Lower body ChE levels were associated with a slower escape speed in one species. ► Head AChE activity was more sensitive to endosulfan than body ChE. ► Endosulfan had strongly different effects on the closely related species. - Endosulfan only detectably reduced escape swimming speed in one of the four studied water boatmen species and this was associated with an inhibition of body ChE.

  2. In vitro antioxidant, antibacterial and anti-tumor activities of total ...

    African Journals Online (AJOL)

    Purpose: To investigate the in vitro antioxidant, antibacterial and anti-tumor activities of total flavonoids from Elsholtzia densa Benth of Sichuan Province, China. Methods: The total flavonoids of Elsholtzia densa Bent were extracted utilizing the ultrasonic extraction method, and purified by D101 macroporous adsorption resin ...

  3. Nouvelles fonctions de l'agriculture et dynamiques des exploitations: une analyse chorématique dans les monts d'Ardèche

    Directory of Open Access Journals (Sweden)

    Muriel Bonin

    2001-06-01

    Full Text Available Les modèles spatiaux sont utilisés pour l'analyse des trajectoires d'exploitations agricoles pour mettre en évidence les liens entre les transformations socio-économiques et les dynamiques de territoires. Les traits de dynamiques spatiales sont identifiés et utilisés pour analyser l'impact de l'introduction de l'agritourisme dans les exploitations dans le Parc naturel régional des monts d'Ardèche.

  4. Serum aspirin esterase is strongly associated with glucose and lipids in healthy subjects: different association patterns in subjects with type 2 diabetes mellitus

    Directory of Open Access Journals (Sweden)

    Kotani Kazuhiko

    2010-07-01

    Full Text Available Abstract Background Aspirin esterase (AE activity can account for part of aspirin pharmacokinetics in the circulation, possibly being associated with the impairment of aspirin effectiveness as an inhibitor of platelet aggregation. Aims The study was aimed at investigating the correlations of serum AE activity with cholinesterase (ChE and metabolic variables in healthy subjects in comparison to subjects with type 2 diabetes mellitus (T2DM. Methods In cardiovascular disease-free T2DM subjects and healthy controls, the AE activity levels and/or the correlation patterns between AE and the other variables were analyzed. Results Neither AE nor ChE activities were higher in the subjects with T2DM. Serum AE activity strongly correlated with ChE as well as glucose/lipids variables such as total cholesterol and triglyceride in healthy subjects, while the correlations between AE and glucose/lipids variables were not present in T2DM subjects. Conclusions These data may reflect the pathophysiological changes between healthy and T2DM subjects. Our data may thus provide the basis for future studies to unravel the mechanisms.

  5. Effects of energetic restriction diet on butyrylcholinesterase in obese women from southern Brazil - A longitudinal study.

    Science.gov (United States)

    Santos, Willian Dos; Tureck, Luciane Viater; Saliba, Louise Farah; Schenknecht, Caroline Schovanz; Scaraboto, Débora; Souza, Ricardo Lehtonen R; Furtado-Alle, Lupe

    2017-01-01

    Butyrylcholinesterase (BChE) activity has been associated with obesity, lipid concentrations, and CHE2 locus phenotypes. This, the aim of this study was to evaluate the effects of an energetic restriction diet intervention on anthropometrical and biochemical variables and on absolute and relative BChE activity in CHE2 C5+ and CHE2 C5- individuals. One hundred eleven premenopausal obese women from Southern Brazil participated in an energetic restriction diet intervention (deficit of 2500 kJ/day) for 8 weeks. Their anthropometric and biochemical parameters were evaluated before and after the intervention. Plasma BChE activity was measured, and BChE bands in plasma and CHE2 locus phenotypes were detected by electrophoresis. The dietetic intervention decreased anthropometric and biochemical parameters as well as absolute BChE activity and relative activity of the G4 band. The CHE2 C5+ phenotype presented a different effect when compared with the CHE2 C5- phenotype. The CHE2 C5+ phenotype showed an effect in absolute BChE activity and in the relative activity of the G4 form, maintaining higher BChE activity regardless of the metabolic changes. In our study, 8 weeks was not sufficient time to lower the body mass index to normal, but it was enough to significantly reduce the absolute BChE activity, which became similar to the levels in nonobese individuals. CHE2 C5+ individuals were resistant to the decrease in BChE activity compared to CHE2 C5- individuals. This shows that the diet did not affect the CHE2 and G4 fraction complex and that the products of the CHE2 locus in association with BChE have a role in energy metabolism, maintaining high levels of enzymatic activity even after dietary intervention.

  6. Start of enrolment for the Champs-Fréchets crèche (EVE)

    CERN Multimedia

    HR Department

    2008-01-01

    As announced in Bulletin 43/2007, CERN signed an agreement with the commune of Meyrin on 17 October 2007 under which 20 places will be reserved for the children of CERN personnel in the Champs-Fréchets day care centre (EVE), which will open on Monday, 25 August, and CERN will contribute to the funding. This agreement allows members of the CERN personnel (employees and associates) access to the crèche, for children aged between 4 months and 4 years, irrespective of where they are living. Applications for the school year starting autumn 2008 will be accepted from Monday 17 March until Monday 30 June 2008. Members of the personnel must complete the enrolment formalities with the Meyrin infant education service themselves: Mairie de Meyrin Service de la Petite Enfance 2 rue des Boudines Case postale 367 - 1217 Meyrin 1 - Tel. + 41 (0)22 782 21 21 mailto:meyrin@meyrin.ch http://www.meyrin.ch/petiteenfance Application forms (in PDF) can be downloaded from the website of the com...

  7. Chemical Composition of the Essential Oil, Total Phenolics, Total Flavonoids and Antioxidant Activity of Methanolic Extracts of Satureja montana L.

    Directory of Open Access Journals (Sweden)

    Avni Hajdari

    2016-05-01

    Full Text Available Aerial parts of Satureja montana L. (Lamiaceae were collected from seven growing wild populations (four populations in Kosovo, two in Albania and one in Montenegro in 2013 with the aim of assessing the natural variation in the chemical composition of the essential oils, total flavonoids, total phenolics and the antioxidant activity of their methanolic extracts. Essential oils were obtained by steam distillation and analysed using GC-FID and GC-MS, whereas total flavonoids, total phenolics and antioxidant activities were determined using spectrophotometric methods. Sixty-one volatile constituents were identified. The main constituents were myrcene, p-cymene, γ-terpinene, linalool, thymol, carvacrol and viridiflorol. Total phenolics ranged from 68.1 to 102.6 mg/g dry mass, the total flavonoid content ranged from 38.3 to 67.0 mg/g dm, and the antioxidant activity according to the DPPH assay ranged from 253.3 to 342.9 mg TE/g dm and according to the FRAP assay ranged from 8.9 to 11.4 mg TE/g dm. Hierarchical cluster analysis and principal component analyses were used to assess the geographical variations in the essential oil composition. Statistical analysis revealed that the analysed populations are grouped into four main clusters that appear to reflect the environmental impact on the chemical composition, which is influenced by differences in habitat composition, altitude and microclimatic conditions.

  8. Activity and Quality of Life after Total Hip Arthroplasty.

    Science.gov (United States)

    Świtoń, Anna; Wodka-Natkaniec, Ewa; Niedźwiedzki, Łukasz; Gaździk, Tadeusz; Niedźwiedzki, Tadeusz

    2017-10-31

    Coxarthrosis is a chronic musculoskeletal condition that causes severe pain and considerable limi-tation of the patient's motor performance. Total hip arthroplasty is one of the most common and effective methods used in the treatment of advanced degenerative changes. The aim of the present study was to evaluate the activity and quality of life of patients after unilateral total hip arthroplasty. The study was conducted in a group of 189 patients who had undergone unilateral total hip arthroplasty. Goniometry was used to determine the range of motion of both hip joints. Patients' physical ability and pain severity were assessed based on the Harris Hip Score (HHS) questionnaire. The examination of the range of motion in the lower extremities revealed statistically significant diffe-rences in flexion (p<0.01), abduction (p=<0.01), adduction (p<0.01) and external rotation (p<0.01) between the operated and the healthy extremity. The greatest limitation of motion was demonstrated for external rotation (<14°). Approximately 14% of the patients were not able to perform this motion in their healthy hip joint, while 17.5% of them could not do so in the affected hip joint. Analysis of HHS results (mean = 79 pts) revealed that more than 50% of the patients described their functional ability and quality of life as good and excellent. It was demonstrated that 54% of patients did not suffer from pain, whereas minor or mild pain was noted in 35%. 1. A subjective clinical assessment of patients after total hip arthroplasty showed that their quality of life had improved. 2. It is necessary to perform physiotherapy after total hip arthroplasty, on both the operated and healthy side. 3. Exacerbation of pain and impaired activity in patients after total hip arthroplasty were associated with the female sex to a considerable extent.

  9. Antioxidant activity, total phenols and flavonoids of lichens from Venezuelan Andes.

    Directory of Open Access Journals (Sweden)

    Claudia M. Plaza

    2014-10-01

    Full Text Available Context:The biological potential of lichens has been documented through their use in traditional medicine. Secondary lichen metabolites exert a wide variety of biological actions, including their use as antioxidants. Aims:To evaluate the antioxidant activity, total phenol content, and flavonoids of four lichen fungal taxa collected in Mérida (Venezuela, and statistically evaluate the correlation between the antioxidant activity and the amount of phenols and flavonoids in the samples. Methods: Extracts were prepared with water, ethanol and dichloromethane from Cladonia aff. rappii, Cora aff. glabrata, Peltigera laciniata and Thamnolia vermicularis. The antioxidant capacity assessment was determined using DPPH• radical method and reducing power, with ascorbic acid as control. Total phenols were determined by means of the Folin-Ciocalteu method with gallic acid. Total flavonoids were estimated according to the modified Dowd method, using quercetin as standard. Results:The ethanolic extracts of the tested lichens showed the highest scavenging activity and reducing power compared to water and dichloromethane extracts at 4 mg/mL. The highest antiradical power value was found in ethanolic extract of Peltigera laciniata (2.28 mL/mgand the lowest in dichloromethane extract of Cora aff. glabrata (0.30 mL/mg. The correlation between antioxidant activity and total phenolic content was moderate. The flavonoids content of ethanolic extracts was highly significant but negative (p < 0.05. There was good correlation in dichloromethane extracts. The ethanolic extract of P. laciniata exhibited the highest antiradical activity despite showing the lowest flavonoid content. Conclusions: The ethanolic extracts of lichens tested showed to have the higher antioxidant activity and may be used as natural sources of new antioxidants.

  10. Response of total phenolic content and antioxidant activities of bush ...

    African Journals Online (AJOL)

    The positive health benefits associated with tea are made possible by the antioxidant activity of phenolic compounds present in tea. The total phenolic content and antioxidant activity of bush tea (Athrixia phylicoides DC.) and special tea (Monsonia burkeana) were studied. The extractions were done in triplicate using cold ...

  11. The Effect of Structured Exercise Intervention on Intensity and Volume of Total Physical Activity

    Directory of Open Access Journals (Sweden)

    Niko Wasenius

    2014-12-01

    Full Text Available This study aimed to investigate the effects of a 12-week structured exercise intervention on total physical activity and its subcategories. Twenty-three overweight or obese middle aged men with impaired glucose regulation were randomized into a 12-week Nordic walking group, a power-type resistance training group, and a non-exercise control group. Physical activity was measured with questionnaires before the intervention (1–4 weeks and during the intervention (1–12 weeks and was expressed in metabolic equivalents of task. No significant change in the volume of total physical activity between or within the groups was observed (p > 0.050. The volume of total leisure-time physical activity (structured exercises + non-structured leisure-time physical activity increased significantly in the Nordic walking group (p 0.050 compared to the control group. In both exercise groups increase in the weekly volume of total leisure-time physical activity was inversely associated with the volume of non-leisure-time physical activities. In conclusion, structured exercise intervention did not increase the volume of total physical activity. Albeit, endurance training can increase the volume of high intensity physical activities, however it is associated with compensatory decrease in lower intensity physical activities. To achieve effective personalized exercise program, individuality in compensatory behavior should be recognised.

  12. Assessment of total flavonoid content and antioxidant activity of Mullein (Verbascum songaricum ecotypes

    Directory of Open Access Journals (Sweden)

    2017-11-01

    Full Text Available Background and objectives: The Mullein genus is the largest genus of Scrophulariaceae family which has extensive natural habitat in southwest of Iran. Mullein contains compounds such as phenolic compounds, mucilage, saponins and anthocyanin. The aim of this study was to evaluate the total flavonoid content and antioxidant activity of mullein ecotypes in Iran. Methods: Six ecotypes of the Verbascum songaricum were evaluated. Determination of total flavonoid content was performed bythealuminium chloride colourimetric method. The antioxidant activity of the flower extracts was measured using the DPPH method. Results: The results showed that total flavonoid content and antioxidant activity were different among ecotypes.  The highest and lowest amounts of total flavonoidwas obtained  from Shermard ecotype (13.42 mg rutin /g DW and Klar ecotypes(10.10 mg rutin /g DW, respectively. The highest amounts of antioxidant activity were obtained from the Shermard ecotype (IC50 246.35 μg/mL. The correlation analysis showed that a significant relation between flavonoid, antioxidant activity and habitat elevation. Conclusion: Total flavonoid content and antioxidant activity of the samples were affected by habitat climatic.  The present data indicated that the highest antioxidant activity may be due to higher flavonoid content and the habitat elevation was effective on the flavonoid content. Due to the high amounts of flavonoid and antioxidant activity of mullein extract, it seems to be a good herbal option as an antioxidant in complementary therapies.

  13. Plasma Cholinesterase Activity in Female Green Turtles Chelonia mydas Nesting in Laguna de Terminos, Mexico Related to Organochlorine Pesticides in Their Eggs.

    Science.gov (United States)

    Rivas-Hernández, Gerardo; May-Uc, Yaneli; Noreña-Barroso, Elsa; Cobos-Gasca, Víctor; Rodríguez-Fuentes, Gabriela

    2018-01-01

    The inhibition of cholinesterase (ChE) activity has been used as a biomarker of exposure to organophosphate and carbamate insecticides. ChE of nesting female green turtles (Chelonia mydas) were biochemically characterized using two substrates, acetylthiocholine iodide and butyrylthiocholine iodide, and three ChE inhibitors (eserine sulfate, BW284C51 and iso-OMPA). The results indicated that BChE is the predominant plasma ChE in female C. mydas, but with atypical properties that differ from those found in human BChE. Eggs from green turtles nesting at two sites in Laguna de Terminos contained µg g -1 (wet weight) quantities of organochlorine (OC) pesticides. Drins (aldrin, dieldrin, endrin, endrin ketone, endrin aldehyde) were found at the highest concentrations with no significant differences in the concentrations in eggs collected at the two sampling sites. A negative relationship was found between levels of OC pesticides in eggs and BChE activity in the plasma of female turtles laying the eggs. Since OC pesticides are not cholinesterase inhibitors, we hypothesized that this inverse relationship may be related to an antagonistic effect between OCs and organophosphate pesticides and mobilization of OCs from the fatty tissues of the female turtles into their eggs. However, further study is required to verify the hypothesis. It is also possible that other contaminants, such as petroleum hydrocarbons are responsible for the modulation of cholinesterase activity in female turtles.

  14. Total phenol content and antioxidant activity of water solutions of plant extracts

    Directory of Open Access Journals (Sweden)

    Mirela Kopjar

    2009-01-01

    Full Text Available Water solutions of extracts were investigated for total phenol content, flavonoid content and antioxidant activity. Susceptibility to degradation of water solutions of plant extracts, under light and in the dark, during storage at room temperature was investigated in order to determine their stability prior to their application for fortification of food products. Large dispersion of total phenol (TP content in the investigated model solutions of selected extracts (olive leaves, green tea, red grape, red wine, pine bark PE 5:1, pine bark PE 95 %, resveratrol, ranging from 11.10 mg GAE/100 mL to 92.19 mg GAE/100 mL was observed. Consequently, large dispersion of total flavonoids (TF content (8.89 mg to 61.75 mg CTE/100 mL was also observed. Since phenols have been mostly responsible for antioxidant activity of extracts, in most cases, antioxidant activity followed the TP content. That was proven by estimation of correlation coefficient between the total phenol content and antioxidant activity. Correlation coefficients between investigated parameters ranged from 0.5749 to 0.9604. During storage of 5 weeks at room temperature loss of phenols and flavonoids occurred. Antioxidant activity decreased with the decrease of TP and TF content. Degradations of phenols and flavonoids were more pronounced in samples stored at light.

  15. Determination of esterase activity and characterization of cholinesterases in the reef fish Haemulon plumieri.

    Science.gov (United States)

    Leticia, Alpuche-Gual; Gerardo, Gold-Bouchot

    2008-11-01

    White grunt (Haemulon plumieri) has been proposed by the Mesoamerican Barrier Reef System (MBRS) Synoptic Monitoring Program as a bioindicator species. It is in this sense that the present study has a main goal to evaluate this organism's suitability as an indicator species. Individuals were captured during three seasons at the port of Sisal, Yucatan, Mexico which is located in an area that is considered to be weakly impacted by human activities such as agriculture or industry. Both cholinesterase (ChE) and carboxylesterase (CbE) activities were measured in brain, muscle, liver and eye of sampled individuals. Results indicated that ChE and CbE activities were greatest in the brain (256.3 ± 43) and in the liver (191 ± 21), respectively. Furthermore, ChEs detected in brain, liver and muscle were characterized, and results suggested that the acetylcholinesterase (AChE) type was more abundant relative to pseudocholinesterase (BChE) which was rare. In addition, K(m) and V(max) and IC(50) values were calculated from the Michaelis-Menten equation. Finally, an additional experiment in vitro showed a significant decrease in both ChE and CbE activities when different tissues were exposed to model xenobiotics, such as benzo[a]pyrene and Chlorpyrifos. In conclusion, findings from this study confirm the potential suitability of H. plumieri as an organic pollution bioindicator species, and thus of practical use for environmental biomonitoring purposes.

  16. Metabolite Profiling of Eastern Teaberry (Gaultheria procumbens L. Lipophilic Leaf Extracts with Hyaluronidase and Lipoxygenase Inhibitory Activity

    Directory of Open Access Journals (Sweden)

    Piotr Michel

    2017-03-01

    Full Text Available The phytochemical profile and anti-inflammatory activity of Gaultheria procumbens dry lipophilic leaf extracts were evaluated. Forty compounds were identified by GC-MS, representing 86.36% and 81.97% of the petroleum ether (PE and chloroform (CHE extracts, respectively, with ursolic acid (28.82%, oleanolic acid (10.11%, methyl benzoate (10.03%, and methyl salicylate (6.88% dominating in CHE, and methyl benzoate (21.59%, docosane (18.86%, and octacosane (11.72% prevailing in PE. Three components of CHE were fully identified after flash chromatography isolation and spectroscopic studies as (6S,9R-vomifoliol (4.35%, 8-demethyl-latifolin (1.13%, and 8-demethylsideroxylin (2.25%. Hyaluronidase and lipoxygenase inhibitory activity was tested for CHE (IC50 = 282.15 ± 10.38 μg/mL and 899.97 ± 31.17 μg/mL, respectively, PE (IC50 = 401.82 ± 16.12 μg/mL and 738.49 ± 15.92 μg/mL, and nine of the main constituents versus heparin (IC50 = 366.24 ± 14.72 μg/mL and indomethacin (IC50 = 92.60 ± 3.71 μg/mL as positive controls. With the best activity/concentration relationships, ursolic and oleanolic acids were recommended as analytical markers for the extracts and plant material. Seasonal variation of both markers following foliar development was investigated by UHPLC-PDA. The highest levels of ursolic (5.36–5.87 mg/g DW of the leaves and oleanolic (1.14–1.26 mg/g DW acids were observed between August and October, indicating the optimal season for harvesting.

  17. LA DIAGNOSI DELLE COMPETENZE LINGUISTICHE IN UN CONTESTO MULTILINGUE: UN PROCESSO CONTINUO CHE FAVORISCE L’INSEGNAMENTO E L’APPRENDIMENTO INDIVIDUALIZZATO

    Directory of Open Access Journals (Sweden)

    Drorit Lengyel

    2011-07-01

    Full Text Available Il presente studio affronta il problema della valutazione diagnostica delle competenze linguistiche in contesti educativi multilingui, con particolare attenzione ai bisogni dei bambini e degli adolescenti immigrati. Vengono brevemente esposti gli obiettivi, le funzioni e i principi della valutazione diagnostica e della valutazione formativa considerate parte integrante di una educazione linguistica continua che prevede un insegnamento-apprendimento individualizzato. Sul piano teorico le procedure della valutazione diagnostica delle competenze linguistiche in contesti multilingui fanno riferimento all’apprendimento delle lingue inteso come attività socio-culturale.     Language diagnostics in multilingual settings with respect to continuous procedures as accompaniment of individualized learning and teaching   This study provides an introduction to language diagnostics in multilingual educational settings, with particular reference to the needs of children and adolescents from migrant backgrounds. It summarises the objectives and functions of language diagnostics and the principles that govern diagnostics including formative assessment, considered to be an integral part of continuous language education that emphasises individualised teaching and learning. From a theoretical perspective, diagnostic procedures in multilingual settings treat language learning as a socio-cultural activity.  

  18. Total. Group dynamics and activities. Competitive environment and strategic perspectives. Release - July 2017

    International Nuclear Information System (INIS)

    2017-07-01

    After a synthesis which notably proposes a SWOT analysis of the Total group, this report proposes a presentation of the Total Group (general overview, presentation of activities, human resources, shareholder structure and stock market data, competitive environment). It gives an overview of the Total group dynamics and of its activities through a presentation of an environment analysis (world oil demand, refining-chemistry activity, hydrocarbon prices), a presentation of the group activity (turnover, turnover per segment, operational income and financial results of competitors). It comments important events and development axes: four strategic orientations, strengthening of the upstream pole, restructuring of refining and chemical activities, widening of the energy provision, consolidation of positions in the marketing and services sector. Financial data are presented along with the main economic and financial indicators. Important statistical data are provided

  19. Mineralogy of an active eolian sediment from the Namib dune, Gale crater, Mars

    Science.gov (United States)

    Achilles, C. N.; Downs, R. T.; Ming, D. W.; Rampe, E. B.; Morris, R. V.; Treiman, A. H.; Morrison, S. M.; Blake, D. F.; Vaniman, D. T.; Ewing, R. C.; Chipera, S. J.; Yen, A. S.; Bristow, T. F.; Ehlmann, B. L.; Gellert, R.; Hazen, R. M.; Fendrich, K. V.; Craig, P. I.; Grotzinger, J. P.; Des Marais, D. J.; Farmer, J. D.; Sarrazin, P. C.; Morookian, J. M.

    2017-11-01

    The Mars Science Laboratory rover, Curiosity, is using a comprehensive scientific payload to explore rocks and soils in Gale crater, Mars. Recent investigations of the Bagnold Dune Field provided the first in situ assessment of an active dune on Mars. The Chemistry and Mineralogy (CheMin) X-ray diffraction instrument on Curiosity performed quantitative mineralogical analyses of the history of the dune material and offers an important opportunity for ground truth of orbital observations. CheMin's analysis of the mineralogy and phase chemistry of modern and ancient Gale crater dune fields, together with other measurements by Curiosity's science payload, provides new insights into present and past eolian processes on Mars.

  20. How much locomotive activity is needed for an active physical activity level: analysis of total step counts

    Directory of Open Access Journals (Sweden)

    Ohkawara Kazunori

    2011-11-01

    Full Text Available Abstract Background Although physical activity recommendations for public health have focused on locomotive activity such as walking and running, it is uncertain how much these activities contribute to overall physical activity level (PAL. The purpose of the present study was to determine the contribution of locomotive activity to PAL using total step counts measured in a calorimeter study. Methods PAL, calculated as total energy expenditure divided by basal metabolic rate, was evaluated in 11 adult men using three different conditions for 24-hour human calorimeter measurements: a low-activity day (L-day targeted at a low active level of PAL (1.45, and a high-frequency moderate activity day (M-day or a high-frequency vigorous activity day (V-day targeted at an active level of PAL (1.75. These subjects were permitted only light activities except prescribed activities. In a separate group of 41 adults, free-living PAL was evaluated using doubly-labeled water (DLW. In both experiments, step counts per day were also measured using an accelerometer. Results In the human calorimeter study, PAL and step counts were 1.42 ± 0.10 and 8,973 ± 543 steps/d (L-day, 1.82 ± 0.14 and 29,588 ± 1,126 steps/d (M-day, and 1.74 ± 0.15 and 23,755 ± 1,038 steps/d (V-day, respectively. In the DLW study, PAL and step counts were 1.73 ± 0.15 and 10,022 ± 2,605 steps/d, and there was no significant relationship between PAL and daily step counts. Conclusions These results indicate that an enormous number of steps are needed for an active level of PAL if individuals extend physical activity-induced energy expenditure by only locomotive activity. Therefore, non-locomotive activity such as household activity should also play a significant role in increasing PAL under free-living conditions.

  1. Study on Total Quality Management Activities in Taiwan Tourism Factories

    Directory of Open Access Journals (Sweden)

    Yi-Chan Chung

    2016-08-01

    Full Text Available As competition becomes increasingly fierce, how to integrate the concept of information technology involvement into total quality management activities and better serve the customers, thus increasing the effectiveness of their services, has become an important focus for many tourism factories in their selection of an appropriate operational strategy. With the tourism factories in Taiwan as the subjects, this study was therefore set out to investigate the impact of operational strategies, information technology involvement and motivation on the executive degree of total quality management (TQM activities, as well as the correlation between the executive degree of TQM activities and operational performance. This research was conducted from March to April 2016 using 56 effective questionnaires through a questionnaire survey method. According to the research findings, the higher the executive degree of TQM activities was, the more significant a positive impact it would have on operational performance; the execution of differentiation strategies would have a positive impact on the execution of TQM activities; the more a company was involved in information technology, the more significant a positive impact it would have on the execution of TQM activities; the higher the intrinsic motivation was, the more significant a positive impact it would have on the executive degrees of TQM activities. It is therefore advisable for tourism factories to implement TQM activities, adopt differentiation strategies, seek greater information technology involvement and become more strongly motivated toward TQM implementation in order to improve operational performance.

  2. Determination of the Index of Consumption of Petroleum of the Calcining Kiln of the Ernesto Che Guevara Commander Undertaking

    Directory of Open Access Journals (Sweden)

    Yarilys Gaínza-Delgado

    2016-07-01

    Full Text Available This work presents the results obtained in carrying out the mass and energy balances in the calcining kiln of the company commander Ernesto Che Guevara, for determining the consumption index of petroleum used for obtaining nickel oxide through thermal decomposition of the basic nickel carbonate. It was shown that for a production of basic nickel carbonate of              12 t / h with 69% moisture, it is necessary to feed about 1100 kg / h of fuel, for an consumption index of 91.67 kg of fuel per ton of load.

  3. Potential anti-cholinesterase and β-site amyloid precursor protein cleaving enzyme 1 inhibitory activities of cornuside and gallotannins from Cornus officinalis fruits.

    Science.gov (United States)

    Bhakta, Himanshu Kumar; Park, Chan Hum; Yokozawa, Takako; Tanaka, Takashi; Jung, Hyun Ah; Choi, Jae Sue

    2017-07-01

    Cholinesterase (ChE) and β-site amyloid precursor protein cleaving enzyme 1 (BACE1) inhibitors are promising agents for the treatment of Alzheimer's disease (AD). In the present study, we examined the inhibitory activity of seven compounds isolated from the fruits of Cornus officinalis, cornuside, polymeric proanthocyanidins, 1,2,3-tri-O-galloyl-β-D-glucose, 1,2,3,6-tetra-O-galloyl-β-D-glucose, tellimagrandin I, tellimagrandin II, and isoterchebin, against acetylcholinesterase (AChE), butyrylcholinesterase (BChE), and BACE1. All of the compounds displayed concentration-dependent in vitro inhibitory activity toward the ChEs and BACE1. Among them, tellimagrandin II exhibited the best inhibitory activity toward ChEs, whereas the best BACE1 inhibitor was 1,2,3,6-tetra-O-galloyl-β-D-glucose. Isoterchebin and polymeric proanthocyanidins were also significant ChE inhibitors. The kinetic and docking studies demonstrated that all compounds interacted with both the catalytic active sites and the peripheral anionic sites of the ChEs and BACE1. Tellimagrandin II, isoterchebin, and the polymeric proanthocyanidins exhibited concentration-dependent inhibition of peroxynitrite-mediated protein tyrosine nitration. In conclusion, we identified significant ChE and BACE1 inhibitors from Corni Fructus that could have value as new multi-targeted compounds for anti-AD agents.

  4. Change in active travel and changes in recreational and total physical activity in adults: longitudinal findings from the iConnect study

    Science.gov (United States)

    2013-01-01

    Background To better understand the health benefits of promoting active travel, it is important to understand the relationship between a change in active travel and changes in recreational and total physical activity. Methods These analyses, carried out in April 2012, use longitudinal data from 1628 adult respondents (mean age 54 years; 47% male) in the UK-based iConnect study. Travel and recreational physical activity were measured using detailed seven-day recall instruments. Adjusted linear regression models were fitted with change in active travel defined as ‘decreased’ (15 min/week) as the primary exposure variable and changes in (a) recreational and (b) total physical activity (min/week) as the primary outcome variables. Results Active travel increased in 32% (n=529), was maintained in 33% (n=534) and decreased in 35% (n=565) of respondents. Recreational physical activity decreased in all groups but this decrease was not greater in those whose active travel increased. Conversely, changes in active travel were associated with commensurate changes in total physical activity. Compared with those whose active travel remained unchanged, total physical activity decreased by 176.9 min/week in those whose active travel had decreased (adjusted regression coefficient −154.9, 95% CI −195.3 to −114.5) and was 112.2 min/week greater among those whose active travel had increased (adjusted regression coefficient 135.1, 95% CI 94.3 to 175.9). Conclusion An increase in active travel was associated with a commensurate increase in total physical activity and not a decrease in recreational physical activity. PMID:23445724

  5. Chelerythrine induced cell death through ROS-dependent ER stress in human prostate cancer cells

    Directory of Open Access Journals (Sweden)

    Wu S

    2018-05-01

    Full Text Available Songjiang Wu, Yanying Yang, Feiping Li, Lifu Huang, Zihua Han, Guanfu Wang, Hongyuan Yu, Haiping Li Department of Urology, Enze Hospital of Taizhou Enze Medical Center (Group, Taizhou, China Introduction: Prostate cancer is the most common noncutaneous cancer and the second leading cause of cancer-related mortality worldwide and the third in USA in 2017. Chelerythrine (CHE, a naturalbenzo[c]phenanthridine alkaloid, formerly identified as a protein kinase C inhibitor, has also shown anticancer effect through a number of mechanisms. Herein, effect and mechanism of the CHE-induced apoptosis via reactive oxygen species (ROS-mediated endoplasmic reticulum (ER stress in prostate cancer cells were studied for the first time. Methods: In our present study, we investigated whether CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a dose-dependent manner in PC-3 cells. In addition, we showed that CHE increases intracellular ROS and leads to ROS-dependent ER stress and cell apoptosis. Results: Pre-treatment with N-acetyl cysteine, an ROS scavenger, totally reversed the CHE-induced cancer cell apoptosis as well as ER stress activation, suggesting that the ROS generation was responsible for the anticancer effects of CHE. Conclusion: Taken together, our findings support one of the anticancer mechanisms by which CHE increased ROS accumulation in prostate cancer cells, thereby leading to ER stress and caused intrinsic apoptotic signaling. The study reveals that CHE could be a potential candidate for application in the treatment of prostate cancer. Keywords: chelerythrine, reactive oxygen species, endoplasmic reticulum stress, apoptosis, prostate cancer

  6. Time course of cholinesterase inhibition in adult rats treated acutely with carbaryl, carbofuran, formetanate, methomyl, methiocarb, oxamyl or propoxur

    International Nuclear Information System (INIS)

    Padilla, S.; Marshall, R.S.; Hunter, D.L.; Lowit, A.

    2007-01-01

    To compare the toxicity of seven N-methyl carbamates, time course profiles for brain and red blood cell (RBC) cholinesterase (ChE) inhibition were established for each. Adult, male, Long Evans rats (n = 4-5 dose group) were dosed orally with either carbaryl (30 mg/kg in corn oil); carbofuran (0.5 mg/kg in corn oil); formetanate HCl (10 mg/kg in water); methomyl (3 mg/kg in water); methiocarb (25 mg/kg in corn oil); oxamyl (1 mg/kg in water); or propoxur (20 mg/kg in corn oil). This level of dosing produced at least 40% brain ChE inhibition. Brain and blood were taken from 0.5 to 24 h after dosing for analysis of ChE activity using two different methods: (1) a radiometric method which limits the amount of reactivation of ChE activity, and (2) a spectrophotometric method (Ellman method using traditional, unmodified conditions) which may encourage reactivation. The time of peak ChE inhibition was similar for all seven N-methyl carbamate pesticides: 0.5-1.0 h after dosing. By 24 h, brain and RBC ChE activity in all animals returned to normal. The spectrophotometric method underestimated ChE inhibition. Moreover, there was a strong, direct correlation between brain and RBC ChE activity (radiometric assay) for all seven compounds combined (r 2 = 0.73, slope 1.1), while the spectrophotometric analysis of the same samples showed a poor correlation (r 2 = 0.09). For formetanate, propoxur, methomyl, and methiocarb, brain and RBC ChE inhibitions were not different over time, but for carbaryl, carbofuran and oxamyl, the RBC ChE was slightly more inhibited than brain ChE. These data indicate (1) the radiometric method is superior for analyses of ChE activity in tissues from carbamate-treated animals (2) that animals treated with these N-methyl carbamate pesticides are affected rapidly, and recover rapidly, and (3) generally, assessment of RBC ChE is an accurate predictor of brain ChE inhibition for these seven pesticides

  7. Cytotoxicity, Total Phenolic Contents and Antioxidant Activity of the ...

    African Journals Online (AJOL)

    The leaves of Annona muricata were extracted using ethanol and the extracts were evaluated for cytotoxicity using Brine Shrimp Lethality Assay, total phenolic content (TPC) and antioxidant activity using DPPH radical scavenging assay. The crude extract showed 73.33 % mortality at 1000 μg/mL concentration and its ...

  8. Total phenolic content, antioxidant and antimicrobial activities of Blepharis edulis extracts

    Directory of Open Access Journals (Sweden)

    Mohaddese Mahboubi

    2013-02-01

    Full Text Available Blepharis edulis is traditionally used as an antiseptic, purgative, aphrodisiac and anti-inflammatory agent. The extractsof plant aerial parts were screened for total phenolic content (TPC gallic acid equivalents (GAE, total flavonoid compound(TFC quercetin equivalents (QE, antioxidant capacity and its antimicrobial activity by micro broth dilution assay. The 50%-inhibition values of BHT and 70% (v/v aqueous ethanol, 70% (v/v aqueous methanol, methanol, and water extracts of B.edulis according to the DPPH method were found to be 19.6, 71.2, 73.7, 81.4, and 218.4 g/ml, respectively. TPC ranged from38.9 to 102.7 mg GAE/g dry extracts. The antimicrobial activity showed that yeast and fungi were sensitive and resistantmicroorganisms to the extracts. The 70%-methanol extract showed more drastic antimicrobial activity than the others. Theantimicrobial activity of ethanolic extract is the same as of the methanolic extract; water extract had the weakest antimicrobialactivity.

  9. Method to determine the activity concentration and total activity of radioactive waste; Metodo para determinar la concentracion de actividad y actividad total de desechos radiactivos

    Energy Technology Data Exchange (ETDEWEB)

    Angeles C, A

    2001-02-15

    A characteristic system of radioactive waste is described to determine the concentration of radionuclides activity and the total activity of bundles of radioactive waste. The system this integrated by three subsystems: - Elevator of drums. - Electromechanics. - Gamma spectroscopy. In the system it is analyzed waste of issuing gamma specifically, and this designed for materials of relative low density and it analyzes materials of cylindrical recipients.

  10. Anti-oxidant and hepatoprotective activities of total flavonoids of Indocalamus latifolius

    Directory of Open Access Journals (Sweden)

    Juan Tan

    2015-12-01

    Full Text Available The total flavonoids of Indocalamus latifolius were evaluated in term of their anti-oxidant and hepatoprotective activities. The results showed that in vitro hepatoprotective and anti-oxidant activities of total flavonoids at doses of 200 and 400 mg/kg and 100 mg/kg, respectively, were comparable to those of the known hepatoprotective drug silymarin at 100 mg/kg. These data were supplemented with histopathological studies of rat liver sections. Seven of the main flavonoid compounds purified by column chromatography using silica gel, sephadex LH-20 and develosil ODS, and determined to be vitexin, orientin, isovitexin, homoorientin, tricin, tricin-7-O-β-D-glucopyranoside and quercetin-3-O-glucopyranoside.

  11. Automatización del control del cálculo de extracciones en la mina de la empresa niquelera Ernesto Che Guevara

    Directory of Open Access Journals (Sweden)

    Arístides A. Legrá-Lobaina

    2010-03-01

    Full Text Available En el artículo se muestran los elementos fundamentales de un algoritmo cuyo objetivo es establecer el contenido y el orden de los procedimientos necesarios para realizar el control del cálculo de extracciones en la mina de la empresa Ernesto Che Guevara que explota, a cielo abierto, yacimientos lateríticos ferroniquelíferos en la región de Moa, Cuba. Asimismo se presenta el diseño de los diálogos informáticos que han automatizado el algoritmo en la aplicación informática Tierra.

  12. Ultrasound-Assisted Extraction of Total Flavonoids from Corn Silk and Their Antioxidant Activity

    Directory of Open Access Journals (Sweden)

    Ling-Li Zheng

    2016-01-01

    Full Text Available Object. Ultrasound-assisted extraction of total flavonoids from corn silk and their antioxidant activities were studied. Methods. Response surface methodology was adopted to optimize the extraction conditions and antioxidant activities of the extracted total flavonoids were detected through ferric reducing antioxidant power (FRAP assay. Results. Through a three-level, three-variable Box-Behnken design of response surface methodology (RSM adopting yield as response, the optimal conditions were determined as follows: ultrasonic power 500 W, extraction time 20 min, material solvent ratio 1 : 20, and ethanol concentration 30%. Under the optimum conditions, the extraction yield of total flavonoids was 1.13%. FRAP value of total flavonoids extracted from corn silk was 467.59 μmol/L. Conclusion. The total flavonoids of corn silk could be developed as food natural antioxidant reagents.

  13. Ultrasound-Assisted Extraction of Total Flavonoids from Corn Silk and Their Antioxidant Activity

    OpenAIRE

    Zheng, Ling-Li; Wen, Guan; Yuan, Min-Yong; Gao, Feng

    2016-01-01

    Object. Ultrasound-assisted extraction of total flavonoids from corn silk and their antioxidant activities were studied. Methods. Response surface methodology was adopted to optimize the extraction conditions and antioxidant activities of the extracted total flavonoids were detected through ferric reducing antioxidant power (FRAP) assay. Results. Through a three-level, three-variable Box-Behnken design of response surface methodology (RSM) adopting yield as response, the optimal conditions we...

  14. Family Planning - A Priority Social and Health Action Programme for ...

    African Journals Online (AJOL)

    personal identity and value, make connections wich ancestors and descendants" ... which promote che use of safe and effective modern mechods of contraception which ... ety as a whole. FP services, on the other hand, are motivated ... you cannot fail to have noticed che almost total collapse of che economies of many ...

  15. [Spectrum-effect Relationship Between Total Antioxidant Activity and HPLC Fingerprint of Arctium lappa Root].

    Science.gov (United States)

    Wang, Xiao-juan; Jiang, Lin

    2014-12-01

    To explore the spectrum-effect relationship between the HPLC fingerprint of Arctium lappa root methanol extract and the total antioxidant activity. The experiment was carried out with Gemini C18 110A (250 mm x 4.6 mm, 5 µm) column using methanol-0.04% phosphoric acid as gradient mobile phase at the flow rate of 1.0 mL/min, detection wavelength of 320 nm. The total antioxidant activity was determined by measuring the absorbance of each sample after being reacted with ammonium molybdate reagent. The spectrum-effect relationship was investigated using canonical correlation analysis (CCA). The spectrum-effect relationship between the HPLC fingerprint of Arctium lappa root methanol extract and the total antioxidant activity were established, the similarity of fingerprint of all samples was above 0.9. Peaks 1, 6, 9, 12 and 14 were principle components of Arctium lappa root for the total antioxidant activity. This method contributes to the fast comprehensive evaluation of quality of Arctium lappa root.

  16. Rosemary tea consumption results to anxiolytic- and anti-depressant-like behavior of adult male mice and inhibits all cerebral area and liver cholinesterase activity; phytochemical investigation and in silico studies.

    Science.gov (United States)

    Ferlemi, Anastasia-Varvara; Katsikoudi, Antigoni; Kontogianni, Vassiliki G; Kellici, Tahsin F; Iatrou, Grigoris; Lamari, Fotini N; Tzakos, Andreas G; Margarity, Marigoula

    2015-07-25

    Our aim was to investigate the possible effects of regular drinking of Rosmarinus officinalis L. leaf infusion on behavior and on AChE activity of mice. Rosemary tea (2% w/w) phytochemical profile was investigated through LC/DAD/ESI-MS(n). Adult male mice were randomly divided into two groups: "Rosemary-treated" that received orally the rosemary tea for 4weeks and "control" that received drinking water. The effects of regular drinking of rosemary tea on behavioral parameters were assessed by passive avoidance, elevated plus maze and forced swimming tests. Moreover, its effects on cerebral and liver cholinesterase (ChE) isoforms activity were examined colorimetricaly. Phytochemical analysis revealed the presence of diterpenes, flavonoids and hydroxycinnamic derivatives in rosemary tea; the major compounds were quantitatively determined. Its consumption rigorously affected anxiety/fear and depression-like behavior of mice, though memory/learning was unaffected. ChE isoforms activity was significantly decreased in brain and liver of "rosemary treated" mice. In order to explain the tissue ChE inhibition, principal component analysis, pharmacophore alignment and molecular docking were used to explore a possible relationship between main identified compounds of rosemary tea, i.e. rosmarinic acid, luteolin-7-O-glucuronide, caffeic acid and known AChE inhibitors. Results revealed potential common pharmacophores of the phenolic components with the inhibitors. Our findings suggest that rosemary tea administration exerts anxiolytic and antidepressant effects on mice and inhibits ChE activity; its main phytochemicals may function in a similar way as inhibitors. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  17. Activities Contributing to Total Energy Expenditure in the United States: Results from the NHAPS Study

    Directory of Open Access Journals (Sweden)

    Block Gladys

    2004-02-01

    Full Text Available Abstract Background Physical activity is increasingly recognized as an important factor influencing health and disease status. Total energy expenditure, both low-intensity and high-intensity, contributes to maintenance of healthy body weight. This paper presents the results of a quantitative approach to determining the activities that contribute to total energy expenditure in the United States. Methods Data from the National Human Activity Pattern Survey (NHAPS were used. In 1992–1994 the NHAPS sampled 4,185 females and 3,330 males, aged 18 years and over, weighted to be representative of the 48 contiguous United States. A detailed report of each activity performed in the previous 24 hours was obtained. A score was created for each activity, by multiplying duration and intensity for each individual and summing across individuals. This score was then used to rank each activity according to its contribution to total population energy expenditure, for the total sample and separately for each gender, race, age, region, and season. Results This analysis reveals our society to be primarily sedentary; leisure time physical activity contributed only approximately 5% of the population's total energy expenditure. Not counting sleeping, the largest contributor to energy expenditure was "Driving a car", followed by "Office work" and "Watching TV". Household activities accounted for 20.1% and 33.3% of energy expenditure for males and females respectively. Conclusion The information presented in this paper may be useful in identifying common activities that could be appropriate targets for behavioral interventions to increase physical activity.

  18. Antioxidant activity, total phenolic, and total flavonoid of extracts from stems of Jasminum nervosum Lour

    Directory of Open Access Journals (Sweden)

    Wei, Xiangyong

    2011-06-01

    Full Text Available Guangxi traditional Chinese Medical University Universidad de Medicina Tradicional China de Guangxi This study evaluated the antioxidant activities of the extracts of Jasminum nervosum Lour. stems along with the effects of different extract solvents on total phenolics (TP, total flavonoids (TF, and antioxidant potential. The antioxidant activity of the extracts was assessed using the following methods: DPPH, ABTS+ both free radicals scavenging assays, and reducing assays. TP and TF were detected by spectrophotometric and HPLC methods. In former methods, the highest amount of TP content was ethy lacetate extract (EAE, expressed as gallic acid equivalents. The greatest TF content was in the n-butanol extract (BE, expressed as lutin equivalents. No significant difference was observed in the TP/TF content between these two extracts. The antioxidant activity and TP/TF content of three extracts seemed to follow the same trend. This implied that there is a good correlation between antioxidant activities and TP/TF content. But in HPLC methods, EAE contained the highest content of lutin and gallic acid, which decreased in the same order of EAE > BE > PE, the rank order of TP/TF content of EAE and BE were different according to antioxidant ability. The overall results showed that the EAE and BE were richer in phenolics and flavonoids than petroleum ether extract (PE, and may represent a good source of antioxidants.Este estudio evaluó las actividades antioxidantes de extractos de tallos de Jasminum nervosum Lour., y el efecto de diferentes disolventes de extracción en los fenoles totales (TP y flavonoides totales (TF, y su potencial antioxidante. La actividad antioxidante de los extractos fue evaluada usando los siguientes métodos: DPPH, ABTS+ y ensayos reductores. TP y TF fueron detectados por métodos espectroscópicos y por HPLC. Con el primer método, el contenido más alto de TP se obtuvo en el extracto con acetato de etilo (EAE, expresado como

  19. Comparative Effects of Oral Chlorpyrifos Exposure on Cholinesterase Activity and Muscarinic Receptor Binding in Neonatal and Adult Rat Heart

    Science.gov (United States)

    Howard, Marcia D.; Mirajkar, Nikita; Karanth, Subramanya; Pope, Carey N.

    2010-01-01

    Organophosphorus (OP) pesticides elicit acute toxicity by inhibiting acetylcholinesterase (AChE), the enzyme responsible for inactivating acetylcholine (ACh) at cholinergic synapses. A number of OP toxicants have also been reported to interact directly with muscarinic receptors, in particular the M2 muscarinic subtype. Parasympathetic innervation to the heart primarily regulates cardiac function by activating M2 receptors in the sinus node, atrial-ventricular node and conducting tissues. Thus, OP insecticides can potentially influence cardiac function in a receptor–mediated manner indirectly by inhibiting acetylcholinesterase and directly by binding to muscarinic M2 receptors. Young animals are generally more sensitive than adults to the acute toxicity of OP insecticides and age related differences in potency of direct binding to muscarinic receptors by some OP toxicants have been reported. We thus compared the effects of the common OP insecticide chlorpyrifos (CPF) on functional signs of toxicity and cardiac ChE activity and muscarinic receptor binding in neonatal and adult rats. Dosages were based on acute lethality (i.e., 0.5 and 1 × LD10: neonates, 7.5 and 15 mg/kg; adults, 68 and 136 mg/kg). Dose- and time-related changes in body weight and cholinergic signs of toxicity (involuntary movements) were noted in both age groups. With 1 × LD10, relatively similar maximal reductions in ChE activity (95%) and muscarinic receptor binding (≈ 30%) were noted, but receptor binding reductions appeared earlier in adults and were more prolonged in neonates. In vitro inhibition studies indicated that ChE in neonatal tissues was markedly more sensitive to inhibition by the active metabolite of chlorpyrifos (i.e., chlorpyrifos oxon, CPO) than enzyme in adult tissues (IC50 values: neonates, 17 nM; adults, 200 nM). Chelation of free calcium with EDTA had relatively little effect on in vitro cholinesterase inhibition, suggesting that differential A-esterase activity was not

  20. The CheMin XRD on the Mars Science Laboratory Rover Curiosity: Construction, Operation, and Quantitative Mineralogical Results from the Surface of Mars

    Science.gov (United States)

    Blake, David F.

    2015-01-01

    The Mars Science Laboratory mission was launched from Cape Canaveral, Florida on Nov. 26, 2011 and landed in Gale crater, Mars on Aug. 6, 2012. MSL's mission is to identify and characterize ancient "habitable" environments on Mars. MSL's precision landing system placed the Curiosity rover within 2 km of the center of its 20 X 6 km landing ellipse, next to Gale's central mound, a 5,000 meter high pile of laminated sediment which may contain 1 billion years of Mars history. Curiosity carries with it a full suite of analytical instruments, including the CheMin X-ray diffractometer, the first XRD flown in space. CheMin is essentially a transmission X-ray pinhole camera. A fine-focus Co source and collimator transmits a 50µm beam through a powdered sample held between X-ray transparent plastic windows. The sample holder is shaken by a piezoelectric actuator such that the powder flows like a liquid, each grain passing in random orientation through the beam over time. Forward-diffracted and fluoresced X-ray photons from the sample are detected by an X-ray sensitive Charge Coupled Device (CCD) operated in single photon counting mode. When operated in this way, both the x,y position and the energy of each photon are detected. The resulting energy-selected Co Kalpha Debye-Scherrer pattern is used to determine the identities and amounts of minerals present via Rietveld refinement, and a histogram of all X-ray events constitutes an X-ray fluorescence analysis of the sample.The key role that definitive mineralogy plays in understanding the Martian surface is a consequence of the fact that minerals are thermodynamic phases, having known and specific ranges of temperature, pressure and composition within which they are stable. More than simple compositional analysis, definitive mineralogical analysis can provide information about pressure/temperature conditions of formation, past climate, water activity and the like. Definitive mineralogical analyses are necessary to establish

  1. Association of total daily physical activity with disability in community-dwelling older persons: a prospective cohort study

    Directory of Open Access Journals (Sweden)

    Shah Raj C

    2012-10-01

    Full Text Available Abstract Background Based on findings primarily using self-report measures, physical activity has been recommended to reduce disability in old age. Collecting objective measures of total daily physical activity in community-dwelling older adults is uncommon, but might enhance the understanding of the relationship of physical activity and disability. We examined whether greater total daily physical activity was associated with less report of disability in the elderly. Methods Data were from the Rush Memory and Aging Project, a longitudinal prospective cohort study of common, age-related, chronic conditions. Total daily physical activity was measured in community-dwelling participants with an average age of 82 using actigraphy for approximately 9 days. Disability was measured via self-reported basic activities of daily living (ADL. The odds ratio and 95% Confidence Interval (CI were determined for the baseline association of total daily physical activity and ADL disability using a logistic regression model adjusted for age, education level, gender and self-report physical activity. In participants without initial report of ADL disability, the hazard ratio and 95% CI were determined for the relationship of baseline total daily physical activity and the development of ADL disability using a discrete time Cox proportional hazard model adjusted for demographics and self-report physical activity. Results In 870 participants, the mean total daily physical activity was 2. 9 × 105 counts/day (range in 105 counts/day = 0.16, 13. 6 and the mean hours/week of self-reported physical activity was 3.2 (SD = 3.6. At baseline, 718 (82.5% participants reported being independent in all ADLs. At baseline, total daily physical activity was protective against disability (OR per 105 counts/day difference = 0.55; 95% CI = 0.47, 0.65. Of the participants without baseline disability, 584 were followed for 3.4 years on average. Each 105 counts/day additional total

  2. [Smoked sausages and food additives: evaluation of total mutagenic activity].

    Science.gov (United States)

    Dugan, A M; Tkacheva, D L

    2011-01-01

    The paper deals with the evaluation of the total mutagenic activity of samples of the inorganic and organic fractions of three technology smoked sausages (boiled-smoked, semi-smoked, and raw-smoked) and some food additives used to manufacture the above sausages. Their mild and moderate mutagenic effects were recorded in a Salmonella typhimurium bacterial test system with a metabolic activation system. Physicochemical analysis of the fractions of the smoked sausages has shown that their study samples are substantially contaminated with heavy metals and representatives of polycyclic aromatic hydrocarbons, partially causing the mutagenic effects observed.

  3. Sports activity after total joint arthroplasty: recommendations for the counseling physician.

    Science.gov (United States)

    Buza, John A; Fink, Leslie A; Levine, William N

    2013-02-01

    Sports activity after total joint arthroplasty (TJA) has become an increasingly important topic, as many younger patients seeking TJA have higher postoperative expectations with regard to return to athletic activity. Our current knowledge of this area is largely based on retrospective clinical studies and surveys of surgeon recommendations. The decision to participate in sports after TJA depends on the patient's general health, prior athletic experience, type of TJA, and desired sporting activity. Ultimately, patients should discuss these factors with their physician in order to make an educated decision regarding sports activity after TJA. This article summarizes the best available evidence to help guide physicians in their conversation with patients regarding safe and appropriate sports activity after TJA.

  4. Evaluation of antibacterial and anthelmintic activities with total phenolic contents of Piper betel leaves

    Directory of Open Access Journals (Sweden)

    Kazi Akter

    2014-09-01

    Full Text Available Objective: The study was conducted to investigate the antibacterial and anthelmintic activities and to determine total phenolic contents of methanolic extract of Piper betel leaves. Materials and Methods: The extract was subjected to assay for antibacterial activity using both gram positive and gram negative bacterial strains through disc diffusion method; anthelmintic activity with the determination of paralysis and death time using earthworm (Pheritima posthuma at five different concentrations and the determination of total phenolic contents using the Folin-ciocalteau method. Results: The extract showed significant (p

  5. Differential sensitivity of total and active soil microbial communities to drought and forest management.

    Science.gov (United States)

    Bastida, Felipe; Torres, Irene F; Andrés-Abellán, Manuela; Baldrian, Petr; López-Mondéjar, Rubén; Větrovský, Tomáš; Richnow, Hans H; Starke, Robert; Ondoño, Sara; García, Carlos; López-Serrano, Francisco R; Jehmlich, Nico

    2017-10-01

    Climate change will affect semiarid ecosystems through severe droughts that increase the competition for resources in plant and microbial communities. In these habitats, adaptations to climate change may consist of thinning-that reduces competition for resources through a decrease in tree density and the promotion of plant survival. We deciphered the functional and phylogenetic responses of the microbial community to 6 years of drought induced by rainfall exclusion and how forest management affects its resistance to drought, in a semiarid forest ecosystem dominated by Pinus halepensis Mill. A multiOMIC approach was applied to reveal novel, community-based strategies in the face of climate change. The diversity and the composition of the total and active soil microbiome were evaluated by 16S rRNA gene (bacteria) and ITS (fungal) sequencing, and by metaproteomics. The microbial biomass was analyzed by phospholipid fatty acids (PLFAs), and the microbially mediated ecosystem multifunctionality was studied by the integration of soil enzyme activities related to the cycles of C, N, and P. The microbial biomass and ecosystem multifunctionality decreased in drought-plots, as a consequence of the lower soil moisture and poorer plant development, but this decrease was more notable in unthinned plots. The structure and diversity of the total bacterial community was unaffected by drought at phylum and order level, but did so at genus level, and was influenced by seasonality. However, the total fungal community and the active microbial community were more sensitive to drought and were related to ecosystem multifunctionality. Thinning in plots without drought increased the active diversity while the total diversity was not affected. Thinning promoted the resistance of ecosystem multifunctionality to drought through changes in the active microbial community. The integration of total and active microbiome analyses avoids misinterpretations of the links between the soil microbial

  6. Evaluation of antibacterial and anthelmintic activities with total phenolic contents of Piper betel leaves

    Science.gov (United States)

    Akter, Kazi Nahid; Karmakar, Palash; Das, Abhijit; Anonna, Shamima Nasrin; Shoma, Sharmin Akter; Sattar, Mohammad Mafruhi

    2014-01-01

    Objective: The study was conducted to investigate the antibacterial and anthelmintic activities and to determine total phenolic contents of methanolic extract of Piper betel leaves. Materials and Methods: The extract was subjected to assay for antibacterial activity using both gram positive and gram negative bacterial strains through disc diffusion method; anthelmintic activity with the determination of paralysis and death time using earthworm (Pheritima posthuma) at five different concentrations and the determination of total phenolic contents using the Folin-ciocalteau method. Results: The extract showed significant (pbetel leaves extract, therefore it may be processed for further drug research. PMID:25386394

  7. AKTIVITAS ANTIOKSIDAN DAN KADAR FENOLIK TOTAL DARI GANGGANG MERAH (Gracilaria verrucosa L. [Antioxidant Activity and Total Phenolic Content of Red Sea Weed (Gracilaria verrucosa L.

    Directory of Open Access Journals (Sweden)

    Lydia Ninan Lestario*

    2008-12-01

    Full Text Available The aims of this study were to compare the antioxidant activity and the total phenolic content of red sea weed (Gracilaria verrucosa L. from extract of methanol, ethanol, acetone, chloroform and hexane; and the correlation between total phenolic content and the antioxidant activity of each extract; then to determine the chlorophyll a, chlorophyll b, and carotene content of each extract and their correlation with the free radical scavenging activity as well. The antioxidant activity were measured by free radical scavenging method with DPPH and by reducing power method with K4Fe(CN6 as standard, whereas the total phenolic content was measured by Folin Ciocalteu method with gallic acid as standard. Chlorophyll a, chlorophyll b, and carotene were determined by spectrophotometric method based on Lambert-Beer law. The data of antioxidant activity and total phenolic content were statistically analyzed by Randomized Completely Block Design (RCBD with five kinds of solvents as treatments and five replications. Honestly Significant Difference Test (HSDT was used to compare the difference of treatments; whereas the chlorophyll a, chlorophyll b, and carotene content were not statistically analyzed since they were only supplement data. The results showed that the highest of the antioxidant activity by free radical scavenging method was found in acetone extract : 43.43% (BHT: 84.15%; whereas by reducing power method was found in chloroform extract : 0.1756 meq K4Fe(CN6/g extract (BHT : 6.1767 meq K4Fe(CN6/g extract; and the highest of the total phenolic content was also found in acetone extract : 45.29 mg /g extract. There were close correlation between phenolic content and antioxidant activity both by free radical scavenging method and by reducing power method with r (coefficient correlation respectivelly 0.89 and 0.91.Chlorophyll a and carotene had also close correlation with the free radical scaveging activity, but not for chlorophyll b.

  8. Reconstruction of the Chemotaxis Receptor-Kinase Assembly

    International Nuclear Information System (INIS)

    Park, S.; Borbat, P.; Gonzalez-Bonet, G.; Bhatnagar, J.; Pollard, A.; Freed, J.; Bilwes, A.; Crane, B.

    2006-01-01

    In bacterial chemotaxis, an assembly of transmembrane receptors, the CheA histidine kinase and the adaptor protein CheW processes environmental stimuli to regulate motility. The structure of a Thermotoga maritima receptor cytoplasmic domain defines CheA interaction regions and metal ion-coordinating charge centers that undergo chemical modification to tune receptor response. Dimeric CheA-CheW, defined by crystallography and pulsed ESR, positions two CheWs to form a cleft that is lined with residues important for receptor interactions and sized to clamp one receptor dimer. CheW residues involved in kinase activation map to interfaces that orient the CheW clamps. CheA regulatory domains associate in crystals through conserved hydrophobic surfaces. Such CheA self-contacts align the CheW receptor clamps for binding receptor tips. Linking layers of ternary complexes with close-packed receptors generates a lattice with reasonable component ratios, cooperative interactions among receptors and accessible sites for modification enzymes

  9. ANTIOXIDANT ACTIVITY, TOTAL PHENOLIC AND FLAVONOID CONTENT OF MORINDA CITRIFOLIA FRUIT EXTRACTS FROM VARIOUS EXTRACTION PROCESSES

    Directory of Open Access Journals (Sweden)

    PRAVEEN K. RAMAMOORTHY

    2007-04-01

    Full Text Available Soxhlet, Ultrasonic extract of Morinda citrifolia L. fruit and four extracts from high pressure extraction at 10 MPa using ethanol, ethyl acetate as solvent and dried by vacuum oven and spray dryer were analyzed for their antioxidant activity by peroxide value method and diphenylpicrylhydrazyl radical scavenging method. The five extracts along with the reference samples, butylated hydroxyl toluene and tannic acid were further analyzed to determine their total phenolic content by Folin-Ciocalteau method and total flavonoid content by Dowd method. The M. citrifolia extract by high pressure extraction with ethyl acetate as solvent and spray dried was found to exhibit highest antioxidant activity and total flavonoid content. High total phenolic content was determined in the high pressure extract using ethyl acetate as solvent and vacuum dried. It was interesting to note that ultrasonic extract exhibited significant antioxidant activity, total phenolic and flavonoid content. High pressure extracted M. citrifolia in ethanol was found to express lesser values comparatively. The significant difference in activity among the high pressure extracts was found to be due to the polarity of the solvents used for extraction as M. citrifolia fruit contains relatively larger quantity of non-polar antioxidant compounds. It was also found that the drying methods had significant impact on the antioxidant activity, total phenolic and flavonoid content of the extracts.

  10. Metabolic Profiling of Total Physical Activity and Sedentary Behavior in Community-Dwelling Men.

    Directory of Open Access Journals (Sweden)

    Kota Fukai

    Full Text Available Physical activity is known to be preventive against various non-communicable diseases. We investigated the relationship between daily physical activity level and plasma metabolites using a targeted metabolomics approach in a population-based study.A total of 1,193 participants (male, aged 35 to 74 years with fasting blood samples were selected from the baseline survey of a cohort study. Information on daily total physical activity, classified into four levels by quartile of metabolic equivalent scores, and sedentary behavior, defined as hours of sitting per day, was collected through a self-administered questionnaire. Plasma metabolite concentrations were quantified by capillary electrophoresis mass spectrometry method. We performed linear regression analysis models with multivariable adjustment and corrected p-values for multiple testing in the original population (n = 808. The robustness of the results was confirmed by replication analysis in a separate population (n = 385 created by random allocation.Higher levels of total physical activity were associated with various metabolite concentrations, including lower concentrations of amino acids and their derivatives, and higher concentrations of pipecolate (FDR p <0.05 in original population. The findings persisted after adjustment for age, body mass index, smoking, alcohol intake, and energy intake. Isoleucine, leucine, valine, 4-methyl-2-oxoisopentanoate, 2-oxoisopentanoate, alanine, and proline concentrations were lower with a shorter sitting time.Physical activity is related to various plasma metabolites, including known biomarkers for future insulin resistance or type 2 diabetes. These metabolites might potentially play a key role in the protective effects of higher physical activity and/or less sedentary behavior on non-communicable diseases.

  11. ‘Unkind and cruel, to deceive your Son | In borrow’d Shapes, and his Embrace to shun’: Mother-son love in T. S. Eliot’s ‘La Figlia Che Piange’

    Directory of Open Access Journals (Sweden)

    Matthew Geary

    2015-01-01

    Full Text Available T. S. Eliot's "La Figlia Che Piange" (1916 is a curious anomaly in his early works. It stands out as a love poem of outstanding grace portraying a more positive relationship to the feminine compared to other poems contemporaneous with its writing such as "The Love Song of St. Sebastian" (1914 and "Hysteria" (1915. This essay shows the import of Eliot's chosen epigraph for "La Figlia" taken from Virgil's Aeneid to have been largely neglected or misread by critics. As a consequence, it argues that critical readings have crucially missed the presence of a shrouded maternal aspect within the poem. Through the lens of Lacanian psychoanalysis and the work of adherents to Lacanian theory — such as Bruce Fink, Shoshana Felman and Slavoj Zizek — this paper newly argues that the poem's meditation on the issues of union and separation between two lovers is in fact a screen for deeper unconscious ambivalent feelings between mother and son. That is to say, Eliot's "La Figlia Che Piange" shows a failed attempt to reconstruct, traverse and separate from the "fundamental fantasy" unconsciously orientating the male speaker of the poem and his desire.

  12. Essential oils chemical composition, antioxidant activities and total phenols of Astrodaucus persicus

    Directory of Open Access Journals (Sweden)

    Saeid Goodarzi

    2016-02-01

    Full Text Available Objective(s:Astrodaucus persicus, Apiaceae, is used as vegetable or food additive in some parts of Iran. The essential oils of different parts of Astrodaucus persicus from Kordestan province were analyzed for the first time and compared with other regions. In this study, antioxidant activities and total phenols determination of aerial parts essential oils and root fractions of A. persicus were investigated. Materials and Methods: The essential oils were obtained by hydro-distillation from flowers/fruits, leaves/stems, ripe fruits and roots of plant and analyzed by GC-MS. Crude root extract was fractionated with hexane, chloroform, ethyl acetate and methanol. Antioxidant activities by DPPH and FRAP methods and total phenols by Folin-ciocalteu assay were measured. Results: The abundant compounds of flowers/fruits blue essential oil were α-thujene, β-pinene and α-pinene. The predominant components of blue leaves/stems essential oil were α-thujene, α-pinene and α-fenchene. The major volatiles of ripe fruits blue essential oil were β-pinene, α-thujene and α-pinene. The chief compounds of root yellow essential oil were trans-caryophyllene, bicycogermacrene and germacrene-D. Total root extract and ethyl acetate fraction showed potent antioxidant activities and high amount of total phenols in comparison to other samples. Among volatile oils, the flowers/fruits essential oil showed potent reducing capacity. Conclusion: The major compounds of aerial parts essential oils were hydrocarbon monoterpenes while the chief percentage of roots essential oil constituents were hydrocarbon sesquiterpenes. α-Eudesmol and β-eudesmol were identified as responsible for creation of blue color in aerial parts essential oils. A. persicus was known as a potent antioxidant among Apiaceae.

  13. Essential oils chemical composition, antioxidant activities and total phenols of Astrodaucus persicus.

    Science.gov (United States)

    Goodarzi, Saeid; Hadjiakhoondi, Abbas; Yassa, Narguess; Khanavi, Mahnaz; Tofighi, Zahra

    2016-02-01

    Astrodaucus persicus, Apiaceae, is used as vegetable or food additive in some parts of Iran. The essential oils of different parts of Astrodaucus persicus from Kordestan province were analyzed for the first time and compared with other regions. In this study, antioxidant activities and total phenols determination of aerial parts essential oils and root fractions of A. persicus were investigated. The essential oils were obtained by hydro-distillation from flowers/fruits, leaves/stems, ripe fruits and roots of plant and analyzed by GC-MS. Crude root extract was fractionated with hexane, chloroform, ethyl acetate and methanol. Antioxidant activities by DPPH and FRAP methods and total phenols by Folin-ciocalteu assay were measured. The abundant compounds of flowers/fruits blue essential oil were α-thujene, β-pinene and α-pinene. The predominant components of blue leaves/stems essential oil were α-thujene, α-pinene and α-fenchene. The major volatiles of ripe fruits blue essential oil were β-pinene, α-thujene and α-pinene. The chief compounds of root yellow essential oil were trans-caryophyllene, bicycogermacrene and germacrene-D. Total root extract and ethyl acetate fraction showed potent antioxidant activities and high amount of total phenols in comparison to other samples. Among volatile oils, the flowers/fruits essential oil showed potent reducing capacity. The major compounds of aerial parts essential oils were hydrocarbon monoterpenes while the chief percentage of roots essential oil constituents were hydrocarbon sesquiterpenes. α-Eudesmol and β-eudesmol were identified as responsible for creation of blue color in aerial parts essential oils. A. persicus was known as a potent antioxidant among Apiaceae.

  14. Conditions of concentration and composition of suspended load in the Vistula River between Wyszogród and Chełmno

    Science.gov (United States)

    Kaszubski, Michal

    2014-05-01

    The main objective of the study is to explain causes of variations of concentration, particle size distribution and composition of suspended load in the riverbed of the lower Vistula between Wyszogród and Chełmno. The study was conducted in seven bridge cross-sections (three above and four below the Włocławek reservoir). In each cross-section, three water samples were collected in the characteristic parts of the riverbed. Since July 2012 fifteen measurement series were carried out. During each measurement series 22 samples of water were collected. In each sample the overall concentration of suspended load, the proportion of the organic matter and particle size distribution of the mineral fraction were measured. Variation of concentration and characteristics of suspended load were studied both in the cross-sections of the Vistula riverbed and along its longitudinal profile. The study focus primarily on determining the qualitative and quantitative variation in the properties of suspended load in the cross-sections located in different morphological riverbed type, various level of its hydrotechnical management, including the operation on the Włocławek reservoir, and the diversity of the water flow conditions. The author tested the correlation occurring between the size of suspended load concentration as well as the flow rate and flow velocity at the water sampling sites. Moreover, the author determined the effect of morphological variation of the Vistula riverbed (the riverbed depth and the location of points of collecting water samples relative to the riverbed mesoforms) on the concentration size, composition structure and the particle size distribution of suspended load. Measurement sessions were chosen in such a way as to cover the widest possible spectrum of the water flow conditions in the riverbed of the Vistula. In addition to the low and medium flow the variability in concentration during flood flows of various types (ice jam, snowmelt and rainfall) were

  15. Drivers shaping the diversity and biogeography of total and active bacterial communities in the South China Sea

    Science.gov (United States)

    Zhang, Yao; Zhao, Zihao; Dai, Minhan; Jiao, Nianzhi; Herndl, Gerhard J

    2014-01-01

    To test the hypothesis that different drivers shape the diversity and biogeography of the total and active bacterial community, we examined the bacterial community composition along two transects, one from the inner Pearl River estuary to the open waters of the South China Sea (SCS) and the other from the Luzon Strait to the SCS basin, using 454 pyrosequencing of the 16S rRNA and 16S rRNA gene (V1-3 regions) and thereby characterizing the active and total bacterial community, respectively. The diversity and biogeographic patterns differed substantially between the active and total bacterial communities. Although the composition of both the total and active bacterial community was strongly correlated with environmental factors and weakly correlated with geographic distance, the active bacterial community displayed higher environmental sensitivity than the total community and particularly a greater distance effect largely caused by the active assemblage from deep waters. The 16S rRNA vs. rDNA relationships indicated that the active bacteria were low in relative abundance in the SCS. This might be due to a high competition between active bacterial taxa as indicated by our community network models. Based on these analyses, we speculate that high competition could cause some dispersal limitation of the active bacterial community resulting in a distinct distance-decay relationship. Altogether, our results indicated that the biogeographic distribution of bacteria in the SCS is the result of both environmental control and distance decay. PMID:24684298

  16. Normal levels of total body sodium and chlorine by neutron activation analysis

    International Nuclear Information System (INIS)

    Kennedy, N.S.J.; Eastell, R.; Smith, M.A.; Tothill, P.

    1983-01-01

    In vivo neutron activation analysis was used to measure total body sodium and chlorine in 18 male and 18 female normal adults. Corrections for body size were developed. Normalisation factors were derived which enable the prediction of the normal levels of sodium and chlorine in a subject. The coefficient of variation of normalised sodium was 5.9% in men and 6.9% in women, and of normalised chlorine 9.3% in men and 5.5% in women. In the range examined (40-70 years) no significant age dependence was observed for either element. Total body sodium was correlated with total body chlorine and total body calcium. Sodium excess, defined as the amount of body sodium in excess of that associated with chlorine, also correlated well with total body calcium. In females there was a mean annual loss of sodium excess of 1.2% after the menopause, similar to the loss of calcium. (author)

  17. Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

    International Nuclear Information System (INIS)

    Collange, B.; Wheelock, C.E.; Rault, M.; Mazzia, C.; Capowiez, Y.; Sanchez-Hernandez, J.C.

    2010-01-01

    Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg -1 chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (≤1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

  18. Inhibition, recovery and oxime-induced reactivation of muscle esterases following chlorpyrifos exposure in the earthworm Lumbricus terrestris

    Energy Technology Data Exchange (ETDEWEB)

    Collange, B. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Wheelock, C.E. [Division of Physiological Chemistry II, Department of Medical Biochemistry and Biophysics, Karolinska Institutet, SE 171 77, Stockholm (Sweden); Rault, M.; Mazzia, C. [Universite d' Avignon et des Pays de Vaucluse, UMR 406 Abeilles et Environnement, Site AGROPARC, F-84914, Avignon Cede 09 (France); Capowiez, Y. [INRA, Unite PSH, Site AGROPARC, F-84914 Avignon Cedex 09 (France); Sanchez-Hernandez, J.C., E-mail: juancarlos.sanchez@uclm.e [Laboratory of Ecotoxicology, Faculty of Environmental Science, University of Castilla-La Mancha, Avda. Carlos III s/n, 45071, Toledo (Spain)

    2010-06-15

    Assessment of wildlife exposure to organophosphorus (OP) pesticides generally involves the measurement of cholinesterase (ChE) inhibition, and complementary biomarkers (or related endpoints) are rarely included. Herein, we investigated the time course inhibition and recovery of ChE and carboxylesterase (CE) activities in the earthworm Lumbricus terrestris exposed to chlorpyrifos, and the ability of oximes to reactivate the phosphorylated ChE activity. Results indicated that these esterase activities are a suitable multibiomarker scheme for monitoring OP exposure due to their high sensitivity to OP inhibition and slow recovery to full activity levels following pesticide exposure. Moreover, oximes reactivated the inhibited ChE activity of the earthworms exposed to 12 and 48 mg kg{sup -1} chlorpyrifos during the first week following pesticide exposure. This methodology is useful for providing evidence for OP-mediated ChE inhibition in individuals with a short history of OP exposure (<=1 week); resulting a valuable approach for assessing multiple OP exposure episodes in the field. - Esterase inhibition combined with oxime reactivation methods is a suitable approach for monitoring organophosphate contamination

  19. Mineralogy of an Active Eolian Sediment from the Namib Dune, Gale Crater, Mars

    OpenAIRE

    Achilles, C. N.; Downs, R. T.; Ming, D. W.; Rampe, E. B.; Morris, R. V.; Treiman, A. H.; Morrison, S. M.; Blake, D. F.; Vaniman, D. T.; Ewing, R. C.; Chipera, S. J.; Yen, A. S.; Bristow, T. F.; Ehlmann, B. L.; Gellert, R.

    2017-01-01

    The Mars Science Laboratory rover, Curiosity, is using a comprehensive scientific payload to explore rocks and soils in Gale crater, Mars. Recent investigations of the Bagnold Dune Field provided the first in situ assessment of an active dune on Mars. The Chemistry and Mineralogy (CheMin) X-ray diffraction instrument on Curiosity performed quantitative mineralogical analyses of the

  20. The determinants of total entrepreneurial activity : a spatial approach / by Albertus Jacobus Meintjes

    OpenAIRE

    Meintjes, Albertus Jakobus

    2006-01-01

    Various bodies and governments from around the world have recognised the importance of entrepreneurship in economic growth and job creation. The rate of start-up businesses and entrepreneurial activity is crucial in every country. The Global Entrepreneurship Monitor (GEM) recognises the contribution of entrepreneurial activity to economic growth and measures it by means of the total entrepreneurial activity (TEA) index. Most recent evidence suggests that regional (or spatial...

  1. Total sitting time, leisure time physical activity and risk of hospitalization due to low back pain

    DEFF Research Database (Denmark)

    Balling, Mie; Holmberg, Teresa; Petersen, Christina B

    2018-01-01

    AIMS: This study aimed to test the hypotheses that a high total sitting time and vigorous physical activity in leisure time increase the risk of low back pain and herniated lumbar disc disease. METHODS: A total of 76,438 adults answered questions regarding their total sitting time and physical...... activity during leisure time in the Danish Health Examination Survey 2007-2008. Information on low back pain diagnoses up to 10 September 2015 was obtained from The National Patient Register. The mean follow-up time was 7.4 years. Data were analysed using Cox regression analysis with adjustment...... disc disease. However, moderate or vigorous physical activity, as compared to light physical activity, was associated with increased risk of low back pain (HR = 1.16, 95% CI: 1.03-1.30 and HR = 1.45, 95% CI: 1.15-1.83). Moderate, but not vigorous physical activity was associated with increased risk...

  2. La spirale dell’azzardo: una subcultura del gioco che “evapora” le relazioni / La spirale du jeu de hasard : une sous-culture qui empêche toute relation / The gambling: a subculture of game that “burns” the relationships

    Directory of Open Access Journals (Sweden)

    Molin Valentina

    2011-07-01

    Full Text Available In this paper I have analysed the characteristics of what I define the “gambling subculture”, which is detectable in certain gaming environments and in subgroups of particularly “rabid” players. Within these subcultures there have been identified rules and sanctions, values, consolidate behaviours, characterization of relationships and interactions, and the conclusion is that what is built within the gambling environment is a separate universe, an “outer reality”, in which the values of the world “outside” change. It was also possible to conclude that, to join the gambling world for a gambler – learning its rules, sharing its values, developing relations inside it – represents a stimulus for gambling habits, as it allows to consider as “normal” their behaviour thanks to positive feedback from their groups of fellow players, and to the neutralization of possible negative feedback from “non-players”.Nel presente contributo vengono analizzate le caratteristiche di quella che ho definito “subcultura dell'azzardo”, rilevabile in determinati ambienti ludici e in sotto-gruppi di giocatori particolarmente “accaniti”. Di queste forme di subcultura sono state individuate norme e sanzioni, valori, comportamenti consolidati, caratterizzazione delle relazioni e delle interazioni, giungendo alla conclusione che quello che viene costruito negli spazi di gioco rappresenta un universo separato, un “extraluogo”, nel quale vengono scritte nuove regole e nel quale cambiano i valori rispetto al mondo “esterno”. È stato possibile inoltre concludere che l'adesione all'“universo gioco” – l'interiorizzazione delle sue norme, la condivisione dei suoi valori, lo sviluppo di relazioni al suo interno – rappresenta un fattore di mantenimento della condotta ludica, poiché permette di considerare “normale” il proprio comportamento grazie ai rinforzi positivi che giungono dal gruppo dei compagni-giocatori e alla

  3. Physical Activity and Adherence to Mediterranean Diet Increase Total Antioxidant Capacity: The ATTICA Study

    Directory of Open Access Journals (Sweden)

    Stavros A. Kavouras

    2011-01-01

    Full Text Available We studied the association of physical activity and adherence to the Mediterranean diet, in total antioxidant capacity (TAC. A random sample of 1514 men and 1528 women was selected from Attica region. Physical activity was assessed with a translated version of the validated “International Physical Activity Questionnaire” (iPAQ, and dietary intake through a validated Food Frequency Questionnaire (FFQ. Adherence to the Mediterranean diet was assessed by the MedDietScore that incorporated the inherent characteristics of this diet. TAC was positively correlated with the degree of physical activity (P<.05. TAC was also positively correlated with MedDietScore (r=0.24, P<.001. Stratified analysis by diet status revealed that the most beneficial results were observed to highly active people as compared to inactive, who also followed the Mediterranean diet (288  ±  70 μmol/L, 230  ±  50 μmol/L, resp., after adjusting for various confounders. Increased physical activity and greater adherence to the Mediterranean diet were associated with increased total antioxidant capacity.

  4. Measurement of total body chlorine by prompt gamma in vivo neutron activation analysis

    International Nuclear Information System (INIS)

    Beddoe, A.H.; Streat, S.J.; Hill, G.L.

    1987-01-01

    A method of measuring total body chlorine (TBCl) by prompt gamma in vivo neutron activation analysis is described depending on the same NaI(Tl) spectra used for determinations of total body nitrogen. Ratios of chlorine to hydrogen are derived and TBCl determined using a model of body composition depending on measured body weight, total body water (by tritium dilution) and protein (6.25 x nitrogen) as well as estimated body minerals and glycogen. The precision of the method based on scanning an anthropomorphic phantom is approximately 9% (SD), for a patient dose equivalent of less than 0.30 mSv. Spectra collected from 67 normal volunteers (32 male, 35 female) yielded mean values of TBCl of 72 +- 19 (SD) g in males and 53.6 +- 15 g in females, in broad agreement with values reported by workers using delayed gamma methods. Results are presented for two human cadavers analysed by neutron activation and conventional chemical analysis; the ratios of TBCl (neutron activation) to TBCl (chemical) were 0.980 +- 0.028 (SEM) and 0.91 +- 0.09. It is suggested that an improvement in precision will be achieved by increasing the scanning time (thereby increasing the radiation dose equivalent) and by adding two more detectors. (author)

  5. Daily total physical activity level and total cancer risk in men and women: results from a large-scale population-based cohort study in Japan.

    Science.gov (United States)

    Inoue, Manami; Yamamoto, Seiichiro; Kurahashi, Norie; Iwasaki, Motoki; Sasazuki, Shizuka; Tsugane, Shoichiro

    2008-08-15

    The impact of total physical activity level on cancer risk has not been fully clarified, particularly in non-Western, relatively lean populations. The authors prospectively examined the association between daily total physical activity (using a metabolic equivalents/day score) and subsequent cancer risk in the Japan Public Health Center-based Prospective Study. A total of 79,771 general-population Japanese men and women aged 45-74 years who responded to a questionnaire in 1995-1999 were followed for total cancer incidence (4,334 cases) through 2004. Compared with subjects in the lowest quartile, increased daily physical activity was associated with a significantly decreased risk of cancer in both sexes. In men, hazard ratios for the second, third, and highest quartiles were 1.00 (95% confidence interval (CI): 0.90, 1.11), 0.96 (95% CI: 0.86, 1.07), and 0.87 (95% CI: 0.78, 0.96), respectively (p for trend = 0.005); in women, hazard ratios were 0.93 (95% CI: 0.82, 1.05), 0.84 (95% CI: 0.73, 0.96), and 0.84 (95% CI: 0.73, 0.97), respectively (p for trend = 0.007). The decreased risk was more clearly observed in women than in men, especially among the elderly and those who regularly engaged in leisure-time sports or physical exercise. By site, decreased risks were observed for cancers of the colon, liver, and pancreas in men and for cancer of the stomach in women. Increased daily physical activity may be beneficial in preventing cancer in a relatively lean population.

  6. Effect of different cooking methods on total phenolic contents and antioxidant activities of four Boletus mushrooms.

    Science.gov (United States)

    Sun, Liping; Bai, Xue; Zhuang, Yongliang

    2014-11-01

    The influences of cooking methods (steaming, pressure-cooking, microwaving, frying and boiling) on total phenolic contents and antioxidant activities of fruit body of Boletus mushrooms (B. aereus, B. badius, B. pinophilus and B. edulis) have been evaluated. The results showed that microwaving was better in retention of total phenolics than other cooking methods, while boiling significantly decreased the contents of total phenolics in samples under study. Effects of different cooking methods on phenolic acids profiles of Boletus mushrooms showed varieties with both the species of mushroom and the cooking method. Effects of cooking treatments on antioxidant activities of Boletus mushrooms were evaluated by in vitro assays of hydroxyl radical (OH·) -scavenging activity, reducing power and 1, 1-diphenyl-2-picrylhydrazyl radicals (DPPH·) -scavenging activity. Results indicated the changes of antioxidant activities of four Boletus mushrooms were different in five cooking methods. This study could provide some information to encourage food industry to recommend particular cooking methods.

  7. Fabrication and Optimization of ChE/ChO/HRP-AuNPs/c-MWCNTs Based Silver Electrode for Determining Total Cholesterol in Serum

    Directory of Open Access Journals (Sweden)

    Kusum Lata

    2016-01-01

    Full Text Available The developed method used three enzymes comprised of cholesterol esterase, cholesterol oxidase, and peroxidase for fabrication of amperometric biosensor in order to determine total cholesterol in serum samples. Gold nanoparticles (AuNPs and carboxylated multiwall carbon nanotubes (cMWCNTs were used to design core of working electrode, having covalently immobilized ChO, ChE, and HRP. Polyacrylamide layer was finally coated on working electrode in order to prevent enzyme leaching. Chemically synthesised Au nanoparticles were subjected to transmission electron microscopy (TEM for analysing the shape and size of the particles. Working electrode was subjected to FTIR and XRD. The combined action of AuNP and c-MWCNT showed enhancement in electrocatalytic activity at a very low potential of 0.27 V. The pH 7, temperature 40°C, and response time of 20 seconds, respectively, were observed. The biosensor shows a broad linear range from 0.5 mg/dL to 250 mg/dL (0.01 mM–5.83 mM with minimum detection limit being 0.5 mg/dL (0.01 mM. The biosensor showed reusability of more than 45 times and was stable for 60 days. The biosensor was successfully tested for determining total cholesterol in serum samples amperometrically with no significant interference by serum components.

  8. TOTAL PHENOLIC CONTENT, ANTIOXIDANT AND ANTIBACTERIAL ACTIVITIES OF THE EXTRACT OF EPHEDRA PROCERA FISCH. ET MEY.

    Science.gov (United States)

    Dehkordi, Naser Vahed; Kachouie, Mehrdad Ataie; Pirbalouti, Abdollah Ghasemi; Malekpoor, Fatemeh; Rabei, Mohammad

    2015-01-01

    Ephedra prcera belonging to the family Ephedraceae is a poison and medicinal plant. The main aim of present study was to determine total phenolic content and antioxidant and antibacterial activities of ethanolic extract from the aerial parts of E. procera collected from a natural habitat in Chaharmahal va Bakhtiari province, Southwestern Iran. The total phenolic content of the extract by Folin-Ciocalteu method and the antioxidant activity using DPPH assay were determined. The antibacterial activity, minimum inhibitory concentration (MIC), and minimum bactericidal concentration (MBC) of the extract were evaluated against five bacteria, including Proteus vulgaris, Pseudomonas aeruginosa, Enteobacter aeogenes, Bacillus ceirus and Staphylococcus aureus. Total phenolic content in the extract of E. procera was 0.718 mg tannic acid/g dry weight extract. The results indicated that the ethanolic extract of E. piocera exhibited radical scavenging activity. In addition, the results of this study confirmed that the ethanolic extract of E. procera exhibited antibacterial activity. In conclusion, the extract of E. piocera could be an important source of phenolic components with antioxidant capacity and antibacterial activity.

  9. The Antioxidant Activities and Total Phenolic of Artemisia Martima, Achillea Millefolium and Matricaria Recutica

    Directory of Open Access Journals (Sweden)

    A Mirzaei

    2010-10-01

    Full Text Available Introduction & Objective: Consumption of plant derived antioxidant contributes to reducing risks of certain chronic and degenerative diseases. The aim of the present study was to study the antioxidant activities and total phenolic of Artemisia Martima, Achillea Millefolium and Matricaria Recutica Materials & Methods: The present study was conducted at Yasuj University of Medical Sciences in 2009. The Stem and flower sample of plants were air-dried, and then grinded and were finally extracted by ethanol: water (70: 30 for 48 h in room temperature. Extracts were filtered and dried under vacuum system. The antioxidant activity of three ethanol extract of the medicinal plants, Artemisia martima, Achillea millefolium and Matricaria recutica, were analyzed by five different methods (1,1-diphenyl-2-picrylhydrazyl (DPPH radical, 2, 20azinobis- (3-ethylbenzthiazoline -6-sulphonic acid (ABTS radical cation,Ferric-reducing antioxidant power assay (FRAP, phosphomolybdenum (PMB and reducing power ( RP. In addition, for determination of antioxidant components, the total phenolic content was also analyzed. The collected data was analyzed by SPSS software. Results: For all antioxidant activity assays, Artemisia martima had the highest antioxidant activity value and also total phenol content. Antioxidant capacity analyses revealed that the FRAP and DPPH had comparable results. Antioxidant activity at 1 mg/mL, in ABTS were in the order Artemisia martima> Achillea millefolium> Matricaria recutica. Similar trend was observed for PMB content. RP, FRAP and DPPH were in the order Artemisia martima> Matricaria recutica > Achillea millefolium . Conclusion: The extracts showed a variety of antioxidant activities in all antioxidant assay system. This study demonstrated that Artemisia martima crude extract exhibit significant antioxidant activity.

  10. Total body-calcium measurements: comparison of two delayed-gamma neutron activation facilities

    International Nuclear Information System (INIS)

    Ma, R.; Ellis, K.J.; Shypailo, R.J.; Pierson, R.N. Jr.

    1999-01-01

    This study compares two independently calibrated delayed-gamma neutron activation (DGNA) facilities, one at the Brookhaven National Laboratory (BNL), Upton, New York, and the other at the Children's Nutrition Research Center (CNRC), Houston, Texas that measure total body calcium (TBCa). A set of BNL phantoms was sent to CNRC for neutron activation analysis, and a set of CNRC phantoms was measured at BNL. Both facilities showed high precision (<2%), and the results were in good agreement, within 5%. (author)

  11. Qualità totale e mobilità totale Total Quality and Total Mobility

    Directory of Open Access Journals (Sweden)

    Giuseppe Trieste

    2010-05-01

    Full Text Available FIABA ONLUS (Italian Fund for Elimination of Architectural Barriers was founded in 2000 with the aim of promoting a culture of equal opportunities and, above all, it has as its main goal to involve public and private institutions to create a really accessible and usable environment for everyone. Total accessibility, Total usability and Total mobility are key indicators to define quality of life within cities. A supportive environment that is free of architectural, cultural and psychological barriers allows everyone to live with ease and universality. In fact, people who access to goods and services in the urban context can use to their advantage time and space, so they can do their activities and can maintain relationships that are deemed significant for their social life. The main aim of urban accessibility is to raise the comfort of space for citizens, eliminating all barriers that discriminate people, and prevent from an equality of opportunity. “FIABA FUND - City of ... for the removal of architectural barriers” is an idea of FIABA that has already affected many regions of Italy as Lazio, Lombardy, Campania, Abruzzi and Calabria. It is a National project which provides for opening a bank account in the cities of referring, in which for the first time, all together, individuals and private and public institutions can make a donation to fund initiatives for the removal of architectural barriers within its own territory for a real and effective total accessibility. Last February the fund was launched in Rome with the aim of achieving a Capital without barriers and a Town European model of accessibility and usability. Urban mobility is a prerequisite to access to goods and services, and to organize activities related to daily life. FIABA promotes the concept of sustainable mobility for all, supported by the European Commission’s White Paper. We need a cultural change in management and organization of public means, which might focus on

  12. A gravimetric method for the measurement of total spontaneous activity in rats.

    Science.gov (United States)

    Biesiadecki, B J; Brand, P H; Koch, L G; Britton, S L

    1999-10-01

    Currently available methods for the measurement of spontaneous activity of laboratory animals require expensive, specialized equipment and may not be suitable for use in low light conditions with nocturnal species. We developed a gravimetric method that uses common laboratory equipment to quantify the total spontaneous activity of rats and is suitable for use in the dark. The rat in its home cage is placed on a top-loading electronic balance interfaced to a computer. Movements are recorded by the balance as changes in weight and transmitted to the computer at 10 Hz. Data are analyzed on-line to derive the absolute value of the difference in weight between consecutive samples, and the one-second average of the absolute values is calculated. The averages are written to file for off-line analysis and summed over the desired observation period to provide a measure of total spontaneous activity. The results of in vitro experiments demonstrated that: 1) recorded weight changes were not influenced by position of the weight on the bottom of the cage, 2) values recorded from a series of weight changes were not significantly different from the calculated values, 3) the constantly decreasing force exerted by a swinging pendulum placed on the balance was accurately recorded, 4) the measurement of activity was not influenced by the evaporation of a fluid such as urine, and 5) the method can detect differences in the activity of sleeping and waking rats over a 10-min period, as well as during 4-hr intervals recorded during active (night-time) and inactive (daytime) periods. These results demonstrate that this method provides an inexpensive, accurate, and noninvasive method to quantitate the spontaneous activity of small animals.

  13. A study of extraction process and in vitro antioxidant activity of total ...

    African Journals Online (AJOL)

    The study investigated the extraction method of Rhizoma Imperatae and its antioxidant activity, and provided a basis for its rational development. The extraction method of Rhizoma Imperatae was determined using orthogonal design test and by total phenol content, its hydroxyl radical scavenging ability was measured by ...

  14. Quantitation of the degree of osteoporosis by measure of total-body calcium employing neutron activation

    International Nuclear Information System (INIS)

    Cohn, S.H.; Zanzi, I.; Vaswani, A.; Wallach, S.; Aloia, J.; Ellis, K.J.

    1975-01-01

    Two techniques for measuring the amount of Ca in the total skeleton were employed: total-body neutron activation analysis (TBNAA) and the determination of the mineral content of a bone of the appendicular skeleton (absorptiometric measurement of the radius, BMC). (U.S.)

  15. [Effects of total glucosides of paeony on enhancing insulin sensitivity and antagonizing nonalcoholic fatty liver in rats].

    Science.gov (United States)

    Zheng, Lin-Ying; Pan, Jing-Qiang; Lv, Jun-Hua

    2008-10-01

    To study the pathological changes of blood glucose, serum lipid, insulin resistance, liver function, liver cell denaturalization of total glucosides of paeony on nonalcoholic fatty liver rats caused by insulin resistance and discuss the acting mechanism. Adult SD rats were maintained on high-fat-sugar-salt diet for 56 days. In the 57th day, their fasting blood glucose (FBG) and 2-hours blood glucose after oral glucose tolerance test (OGTT-2 hBG) were mensurated, according to which and the weight the rats were divided randomly into nonalcoholic fatty liver model group, metformin group (0.2 g x kg(-1)) and total glucosides of paeony group (high dosage 0.15 g x kg(-1), low dosage 0.05 g x kg(-1)). All the rats were still administered the same diet and given different drugs by intragastric administration for 28 days. In the 29th day, all of them were killed and the blood was sampled to measure the levels of blood glucose [FBG, OGTT-2 hBG, fasting insulin (Fins)] and serum lipid [free fatty acids (FFA), triglyceride (TG), total cholesterol (TC), low-density lipoprotein cholesterol (LDL-C) and high-density lipoprotein cholesterol (HDL-C)], then the HOMA insulin resistance index (HOMA-IRI, fasting glucosexinsulin) and insulin sensitivity index (ISI) were counted. The activities of aspartate aminotransferase (AST), alanine aminotransferase (ALT), cholinesterase (ChE), superoxide dismutase (SOD) and the contents of malondialdehyde (MDA) were measured also. Livers were weighed and collected to be observed the pathological changes. Compared with normal group, in nonalcoholic fatty liver model group the levels of Fins and IRI were increased obviously (P insulin resistence were resisted (P insulin resistance, and its action mechanism may be concerned with enhancing insulin sensitivity and antioxidative ability, decreasing serum lipid.

  16. Total phenolic content, antioxidant and antimicrobial activity of Equisetum arvense L.

    Directory of Open Access Journals (Sweden)

    Kukrić Zoran

    2013-01-01

    Full Text Available The antioxidant and antimicrobial activity of Equisetum arvense L. harvested in a polluted urban area were investigated. The total phenolic content determined by a modified Folin-Ciocalteu method was 335.8 mg of GEA/g of the dried ethanol extract. Antioxidant activity determined by FRAP method was 28.7 mM Fe(II/g of extract, whereas antioxidant activity index for stable DPPH free radicals was 3.86. The results were compared with control antioxidants (gallic acid, vitamin C, BHA and BHT. Antimicrobial activity was tested by monitoring the impact of different extract concentrations through measuring the change in optical density of bacterial suspension over time and by determining MIC and MBC using macrodilution method. E. arvense extract has been effective on the tested microorganisms depending on the concentration and exposure time. The extract had the strongest antibacterial activity on Staphylococcus aureus, with MIC and MBC of 11.14 mg/mL and 22.28 mg/mL respectively, and the weakest effect on Bacillus cereus, with MIC of 89.10 mg/mL.

  17. Precise shape reconstruction by active pattern in total-internal-reflection-based tactile sensor.

    Science.gov (United States)

    Saga, Satoshi; Taira, Ryosuke; Deguchi, Koichiro

    2014-03-01

    We are developing a total-internal-reflection-based tactile sensor in which the shape is reconstructed using an optical reflection. This sensor consists of silicone rubber, an image pattern, and a camera. It reconstructs the shape of the sensor surface from an image of a pattern reflected at the inner sensor surface by total internal reflection. In this study, we propose precise real-time reconstruction by employing an optimization method. Furthermore, we propose to use active patterns. Deformation of the reflection image causes reconstruction errors. By controlling the image pattern, the sensor reconstructs the surface deformation more precisely. We implement the proposed optimization and active-pattern-based reconstruction methods in a reflection-based tactile sensor, and perform reconstruction experiments using the system. A precise deformation experiment confirms the linearity and precision of the reconstruction.

  18. Sexual activity after total hip replacement in Korean patients: how they do, what they want, and how to improve.

    Science.gov (United States)

    Yoon, Byung-Ho; Lee, Kyung-Hag; Noh, Serae; Ha, Yong-Chan; Lee, Young-Kyun; Koo, Kyung-Hoi

    2013-12-01

    Concerns of patients on sexual activity after total hip arthroplasty have not been well studied in Asian patients. This study aimed to determine the following: (1) what are the concerns of patients related to sexual activity after total hip arthroplasty? (2) what are the changes in sexual activity after total hip replacement in Korean patients? Details of sexual activity and concerns were obtained using a questionnaire designed specifically for the study. The questionnaire was administered to 64 patients in a face-to-face interview at an outpatient clinic. Preoperatively, 53.1% of patients experienced difficulties, primarily due to hip pathology and limitations of motion. The median time to the resumption of sexual activity was 3 months postoperatively, and most patients had no increase in the frequency of sexual activity after the total hip replacement. In 39.1% of patients were seen having difficulties with leg positioning following total hip replacement, and they were likely to change coital positions. The most common concern regarding sexual activity of patients was the fear of dislocation. Furthermore, patients with a higher stress level had lower satisfaction rates. Most patients were unable to obtain information on sexual activity following the total hip arthroplasty, and they did not consult with a physician due to the private nature of the topic. Dislocation was the most common concern of patients during sexual activity following a total hip arthroplasty, and a higher stress level was found to be associated with a lower satisfaction rate. Because most patients were unprepared to consult a physician, the provision of appropriate information before a consultation might be beneficial.

  19. Reconocimiento Mapu-Che de Chile: Tratado ante Constitución, Historia frente a Derecho

    Directory of Open Access Journals (Sweden)

    Bartolomé CLAVERO SALVADOR

    2011-04-01

    Full Text Available Desde el año 1991, el compromiso adquirido por los sucesivos gobiernos chilenos para reconocer a nivel constitucional la presencia indígena en el ordenamiento del Estado ha puesto de manifiesto el desconocimiento académico y jurídico mutuo por parte de Chile con respecto a las evidencias para una reposición de Mapu-Che. El presente trabajo hace un recorrido histórico y jurídico por las formas de relación entre el Estado chileno y el Estado Mapu, que hasta la conquista chilena de Mapu en la década de los ochenta del siglo XIX se manifestaron a través de Tratados y Parlamentos que implicaban un reconocimiento mutuo de ambas entidades en una esfera internacional. Las comisiones de estudios, informes oficiales e invocaciones de verdad para un nuevo trato, primero de las Naciones Unidas, y después de la República de Chile, han observado estas evidencias de la significación constitucional e internacional de los Tratados, pero Chile ha convertido su peculiar forma de reconocimiento constitucional de la presencia indígena en un alarde de unidad e indivisibilidad nacional. Este encubrimiento nace del deseo de mantener una Constitución exclusiva, al que se une la certeza de que otra forma de reconocimiento obligaría a un replanteamiento de las propias raíces de los fundamentos constitucionales de la República de Chile.

  20. In vitro anthelmintic activity of Barleria buxifolia on Indian adult earthworms and estimation of total flavonoid content

    Directory of Open Access Journals (Sweden)

    Purna A. Chander

    2014-02-01

    Full Text Available Objective: To study the anthelmintic activity of Barleria buxifolia leaf and to estimate the total flavonoid content. Methods: The aqueous and ethanolic leaf extracts were prepared and these were analyzed for total flavonoid content by aluminium chloride colorimetric method and Pheretima posthuma was used for anthelmintic activity by using the different concentrations (10, 20, 40, 80 and 100 mg/mL. Results: All the investigational extracts showed an anthelmintic activity at concentration of 10 mg/mL. The ethanolic extract of 100 mg/mL has produced an significant effect (P<0.001 when compared to aqueous extract. The total flavonoid content was found to be 5.67 mg QE/100 g. Conclusions: From the above study, the leaf extract has shown a good anthelmintic activity.

  1. Athletes’ Selected Micro-Activities on Turf Fields: Utilizing Extant Videography for Quantification of Events During Soccer, American Football, and Field Hockey Play

    Science.gov (United States)

    Concerns have been recently raised about the potential exposures of athletes to chemicals when playing on synthetic turf fields. Previous research has shown that micro-activities (i.e., hand-to mouth and skin-to-surface contacts) are important factors in people’s exposures to che...

  2. [Evaluation of the total biological activity and allergenic composition of allergenic extracts].

    Science.gov (United States)

    Lombardero, M; González, R; Duffort, O; Juan, F; Ayuso, R; Ventas, P; Cortés, C; Carreira, J

    1986-01-01

    In the present study, a complete procedure is presented in order to standardize allergenic extracts, the meaning of which is the measurement of the total allergenic activity and the determination of the allergenic composition. The measurement of the biological activity comprises 2 steps: Preparation of Reference Extracts and determination of their "in vivo" activity. Evaluation of the total allergenic activity of extracts for clinical use. Reference extracts were prepared from the main allergens and their "in vivo" biological activity was determined by a quantitative skin prick test in a sample of at least 30 allergic patients. By definition, the protein concentration of Reference Extract that produces, in the allergic population, a geometric mean wheal of 75 mm.2 has an activity of 100 biological units (BUs). The determination of the biological activity of a problem extract is made by RAST inhibition. The sample is compared with the corresponding Reference Extract by this technique and, from this comparison, it is possible to quantify the activity of the problem extract in biologic units (BUs) with clinical significance. Likewise, different techniques have been used to determine the allergenic composition of extracts. These techniques comprise 2 steps: Separation of the components of the extract. Identification of the components that bind specific human IgE. The separation of the components of the extract has been carried out by isoelectric focusing (IEF) and electrophoresis in the presence of sodium dodecyl sulphate (SDS-PAGE). In order to identify the allergenic components, an immunoblotting technique has been employed. The separated components in the IEF gel or SDS-PAGE gel are transferred to a nitrocellulose sheet and later on, this membrane is overlaid with a serum pool from allergic patients and a mouse monoclonal anti-human IgE, labelled with 125I. Finally, the autoradiography of the nitrocellulose membrane is obtained. In this way it is possible to compare

  3. To total amount of activity ..... and beyond: Perspectives on measuring physical behaviour

    Directory of Open Access Journals (Sweden)

    Johannes B.J. Bussmann

    2013-07-01

    Full Text Available The aim of this paper is to describe and discuss some perspectives on definitions, constructs and outcome parameters of physical behaviour. The paper focuses on the following constructs: Physical activity & active lifestyle vs. sedentary behaviour & sedentary lifestyle; Amount of physical activity vs. amount of walking; Detailed body posture & movement data vs. overall physical activity data; Behavioural context of activities; Quantity vs. quality; Physical behaviour vs. physiological response.Subsequently, the following outcome parameters provided by data reduction procedures are discussed: Distribution of length of bouts; Variability in bout length; Time window; Intensity and intensity threshold.The overview indicates that physical behaviour is a multi-dimensional construct, and it stresses the importance and relevance of constructs and parameters other than total amount of physical activity.It is concluded that the challenge for the future will be to determine which parameters are most relevant, valid and responsive. This is a matter for physical behaviour researchers to consider, that is critical to multi-disciplinary collaboration.

  4. The active and passive kinematic difference between primary reverse and total shoulder prostheses

    NARCIS (Netherlands)

    Alta, T.D.; de Toledo, J.S.; Veeger, H.E.J.; Janssen, T.W.J.; Willems, W.J.

    2014-01-01

    Background: Reverse shoulder arthroplasty (RSA) and total shoulder arthroplasty (TSA) effectively decrease pain and improve clinical outcome. However, indications and biomechanical properties vary greatly. Our aim was to analyze both active and passive shoulder motion (thoracohumeral [TH],

  5. Patient reported activities after reverse total shoulder arthroplasty in rotator cuff arthropathy patients.

    Science.gov (United States)

    Alcobía-Díaz, B; Lópiz, Y; García-Fernández, C; Rizo de Álvaro, B; Marco, F

    Reverse total shoulder arthroplasty in rotator cuff arthropathy patients, improves anteversion and abduction, but not rotational, outcomes. The main aim of this study is to determine its repercussions on daily life activities in our patients. Between 2009 and 2011 we implanted 210 shoulder arthroplasties, 126 of them were reverse total shoulder arthroplasty in a rotator cuff arthropathy context. About 88% were women, with a mean age at time of surgery of 81 years, 95% were retired. The mean follow up was 53 months. The Constant scale, Visual Analogue Scale, Charlson Comorbidity Index, range of motion were measured for each patient and whether they could manage 40 daily life activities by means of a new questionnaire, classifying them according toshoulder functional demand. Mean normalized by sex and age Constant value was 81.2%. Mean Visual Analogue Scale and Charlson Index were 3.56 and 1.69 respectively. Improvement in anteversion and abduction, not in rotational range of motion. Limitation was found in low and high functional demand activities in 20% and 51% respectively, especially those which involved internal rotation. Reverse total shoulder arthroplasty treatment for RCA in the elderly, achieves adequate pain management and good functional outcomes. Nevertheless, an important risk of DLA limitation must be accepted in those which involve internal rotation or shoulder high functional demand. Copyright © 2017 SECOT. Publicado por Elsevier España, S.L.U. All rights reserved.

  6. Determination of chemical composition, total phenolic content and antioxidant activity of xylanthemum macropodum

    International Nuclear Information System (INIS)

    Samiullah, A.; Tareen, R.B.; Khan, N.; Akber, A.; Ali, I.; Khan, A.K.

    2017-01-01

    Evaluation of the phytochemistry, total phenolic content and antioxidant activity of the endemic plant of northern Balochistan Xylanthemum Macropodum of the Asteraceae family, is reported for the first time in this document. Chemical composition of Xylanthemum Macropodum was determined using well-established chemical tests and modern spectroscopic techniques. Extracts were taken from the whole plant using methanol and the extracts were tested for phytochemicals (secondary metabolites), total phenolic content (TPC) and antioxidant activity. The phytochemical (biochemical) examination of Xylanthemum Macropodum exposed the presence of alkaloids, phenols, steroids, flavonoids, tannins, terpenoids, saponins, coumarins, carbohydrates, cardiac glycosides, reducing sugars, and quinines. TPC of crude methanolic extract (CME) of plant was determined using Folin-Ciocalteu's reagent. The TPC determined was 256mg of tannic acid Eq/g of extract. Antioxidant activities were determined spectrophotometrically using the DPPH assay and Ferric ion (Fe/sup +3/) reducing antioxidant power assay. The potency of the DPPH assay of Xylanthemum Macropodum extract was 68% for the 0.10 mg/ml concentration and the FRAP value of the extract was 3.368 mmol Fe/sup +2//g of extract. Xylanthemum Macropodum has proved to be very rich in secondary metabolites, natural phenolics and has a very potent antioxidant activity. (author)

  7. Improvements in knee biomechanics during walking are associated with increased physical activity after total knee arthroplasty.

    Science.gov (United States)

    Arnold, John B; Mackintosh, Shylie; Olds, Timothy S; Jones, Sara; Thewlis, Dominic

    2015-12-01

    Total knee arthroplasty (TKA) in people with knee osteoarthritis increases knee-specific and general physical function, but it has not been established if there is a relationship between changes in these elements of functional ability. This study investigated changes and relationships between knee biomechanics during walking, physical activity, and use of time after TKA. Fifteen people awaiting TKA underwent 3D gait analysis before and six months after surgery. Physical activity and use of time were determined in free-living conditions from a high resolution 24-h activity recall. After surgery, participants displayed significant improvements in sagittal plane knee biomechanics and improved their physical activity profiles, standing for 105 more minutes (p=0.001) and performing 64 min more inside chores on average per day (p=0.008). Changes in sagittal plane knee range of motion (ROM) and peak knee flexion positively correlated with changes in total daily energy expenditure, time spent undertaking moderate to vigorous physical activity, inside chores and passive transport (r=0.52-0.66, p=0.005-0.047). Restoration of knee function occurs in parallel and is associated with improvements in physical activity and use of time after TKA. Increased functional knee ROM is required to support improvements in total and context specific physical activity. © 2015 Orthopaedic Research Society. Published by Wiley Periodicals, Inc.

  8. Total's LNG activities from Algeria to Yemen

    International Nuclear Information System (INIS)

    Vedrenne, J.P.

    1997-01-01

    In March 1995, further to an international tender, Total was awarded the leadership of the first LNG project in Yemen. On January 1997 Total announced the extension of the share-holding of the Yemen LNG Co. to include the companies with interests in the Marib area (Hunt-Exxon-Yukong). The Marib area will supply the gas to the future liquefaction plant. The ratification of these agreements confirms the role of Total as lead shareholder with 36% in the share-holding structure and guarantees gas supply from the Marib licence, operated by Hunt-Exxon. (author)

  9. Effects of xenobiotic compounds on the cell activities of Euplotes crassus, a single-cell eukaryotic test organism for the study of the pollution of marine sediments

    International Nuclear Information System (INIS)

    Trielli, Francesca; Amaroli, Andrea; Sifredi, Francesca; Marchi, Barbara; Falugi, Carla; Corrado, Maria Umberta Delmonte

    2007-01-01

    It is now widely accepted that assays with protists are relevant to be exploited for the study of environmental modifications due to the presence of xenobiotic compounds. In this work, the possibility of utilizing Euplotes crassus, an interstitial marine ciliate, for the pre-chemical screening of estuarine and coastal sediments was evaluated. For this purpose, the effects of exposure to pollutants were tested on the cell viability, fission rate and lysosomal membrane stability of E. crassus. The following toxicants were used: an organophosphate (OP) pesticide, basudin, an organochlorine hydrocarbon, AFD25, both employed especially for pest control in agricultural sites, a toxic heavy metal, mercury (HgCl 2 ) and different mixtures of the above-mentioned compounds, as they might occur in polluted sites. Exposure to these toxicants affected cell viability at concentrations ranging from 96.6 to 966 x 10 3 mg/l for basudin, from 3.3 to 33 x 10 3 mg/l for AFD25 and from 0.1 to 1 mg/l for HgCl 2 . A significant decrease in the mean fission rate (P -2 mg/l HgCl 2 . Furthermore, the Neutral Red Retention Assay showed a significant decrease in lysosomal membrane stability after 60- and 120-min exposures to AFD25 (33 mg/l) and HgCl 2 (0.33 mg/l). In addition, as it is well-known that the inhibition of acetylcholinesterase activity represents a specific biomarker of exposure to OP and carbamate pesticides in higher organisms, initially the presence of cholinesterase (ChE) activity was detected in E. crassus, using cytochemical, spectrophotometric and electrophoretic methods. Afterwards, this enzyme activity was characterized spectrophotometrically by its sensitivity to specific ChE inhibitors and to variations in pH and temperature. The ChE activity was inhibited significantly by basudin- (9.66 and 96.6 mg/l) or AFD25-exposure (3.3 mg/l). Conversely, exposure to AFD25 (33 mg/l) or HgCl 2 (0.1 and 0.3 mg/l) caused a significant increase in this enzyme activity. Moreover

  10. Effect of chitosan and alginate based coatings enriched with pomegranate peel extract to extend the postharvest quality of guava (Psidium guajava L.).

    Science.gov (United States)

    Nair, M Sneha; Saxena, Alok; Kaur, Charanjit

    2018-02-01

    The influence of chitosan (1% w/v) and alginate (2% w/v) coatings in combination with pomegranate peel extract (PPE; 1% w/v) on quality of guavas (cv Allahabad safeda) were studied. Restricted changes were recorded in respiration rate, ripening index, and instrumental colour values in case of the coated samples as compared to the control for 20days at 10°C. Samples coated with chitosan enriched with PPE (CHE) proved to be the most effective treatment in maintaining the overall fruit quality. Ascorbic acid, total phenolics, total flavonoids contents and antioxidant activity were recorded with restricted losses of 29%, 8%, 12%, 12% (DPPH) and 9% (FRAP), respectively for CHE samples at the end of storage. A higher degree of correlation (r>0.918) was established between various phytochemicals and AOA. PPE enriched coatings was proved efficient in maintaining the quality of guavas during 20days of low temperature storage. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Catastrophic Health Expenditure After the Implementation of Health Sector Evolution Plan: A Case Study in the West of Iran

    Directory of Open Access Journals (Sweden)

    Bakhtiar Piroozi

    2016-07-01

    Full Text Available Background: One of the main objectives of health systems is the financial protection against out-of-pocket (OOP health expenditures. OOP health expenditures can lead to catastrophic payments, impoverishment or poverty among households. In Iran, health sector evolution plan (HSEP has been implemented since 2014 in order to achieve universal health coverage and reduce the OOP health expenditures as a percentage of total health expenditures. This study aimed to explore the percentage of households facing catastrophic health expenditures (CHE after the implementation of HSEP and the factors that determine CHE. Methods: A total of 663 households were selected through a cluster sampling based on the census framework of Sanandaj Health Center in July 2015. Data were gathered using face-to-face interviews based on the household section of the World Health Survey questionnaire. In this study, according to the World Health Organization (WHO definition, if household health expenditures were equal to or more than 40% of the household capacity to pay, household was considered to be facing CHE. The determinants of CHE were analyzed using logistic regression model. Results: The rates of households facing CHE were 4.8%. The key determinants of CHE were household economic status, presence of elderly or disabled members in the household and utilization of inpatient or rehabilitation services. Conclusion: The comparison of our findings and those of other studies carried out using a methodology comparable with ours in different parts of Iran before the implementation of HSEP suggests that the implementation of recent reforms has reduced CHE at the household level. Utilization of inpatient and rehabilitation services, the presence of elderly or disabled members in the household and the low economic status of the household would increase the likelihood of facing CHE. These variables should be considered by health policy-makers in order to review and revise content of

  12. Assessment of uranium exposure from total activity and 234U:238U activity ratios in urine

    International Nuclear Information System (INIS)

    Nicholas, T.; Bingham, D.

    2011-01-01

    Radiation workers at Atomic Weapons Establishment (AWE) are monitored for uranium exposure by routine bioassay sampling (primarily urine sampling). However, the interpretation of uranium in urine and faecal results in terms of occupational intakes is difficult because of the presence of uranium due to intakes from environmental (dietary) sources. For uranium in urine data obtained using current analytical techniques at AWE, the mean, median and standard deviation of excreted uranium concentrations were 0.006, 0.002 and 0.012 μg per g creatinine, respectively. These values are consistent with what might be expected from local dietary intakes and the knowledge that occupational exposures at AWE are likely to be very low. However, some samples do exceed derived investigation levels (DILs), which have been set up taking account of the likely contribution from environmental sources. We investigate how the activity and isotopic composition of uranium in the diet affects the sensitivity of uranium in urine monitoring for occupational exposures. We conclude that DILs based on both total uranium in urine activity and also 234 U: 238 U ratios are useful given the likely variation in dietary contribution for AWE workers. Assuming a background excretion rate and that the enrichment of the likely exposure is known, it is possible to assess exposures using 234 U: 238 U ratios and/or total uranium activity. The health implications of internalised uranium, enriched to 235 U, centre on its nephrotoxicity; the DILs for bioassay samples at AWE are an order of magnitude below the conservative recommendations made by the literature. (authors)

  13. Measurement of total-body oxygen, nitrogen, and carbon in vivo by photon activation analysis

    International Nuclear Information System (INIS)

    Ulin, K.

    1984-01-01

    With the aim of assessing nutritional status, the feasibility of measuring the total body quantities of the major body elements, i.e. oxygen, nitrogen, and carbon, using the photon beam of a 45 MV betatron and a whole-body counter, has been evaluated in detail. Following photon activation a single energy γ-radiation (.511 MeV) is observed from all three elements to be measured. The half-lives of 15 O, 13 N, and 11 C, however, are sufficiently different (20.5 min, 10.0 min, and 20.4 min. respectively) to permit their measurement from an analysis of the measured decay curve. Following corrections for interfering reactions, a computer curve-fitting algorithm is used to resolve the data into 15 O, 13 N, and 11 C components. Measurements of O, N, and C have been made both in phantoms and in live and dead rats. A comparison of the body composition results from this technique with results from chemical analysis indicates that measured carbon can quite accurately predict total body fat. The comparison of the total body nitrogen measurement by photon activation with total body protein by chemical analysis was inconclusive and suggests that further work be done to verify the estimated accuracy of the nitrogen measurement

  14. Determination of phytochemicals, antioxidant activity and total phenolic content in Andrographis paniculata using chromatographic methods.

    Science.gov (United States)

    Kurzawa, Marzanna; Filipiak-Szok, Anna; Kłodzińska, Ewa; Szłyk, Edward

    2015-07-15

    Antioxidant activity, total phenolics content and selected phytochemicals (alkaloids and andrographolides) were determined in Andrographis paniculata and in dietary supplements containing this plant. Antioxidant activity was measured by FRAP, CUPRAC and DPPH procedures and ranged from 503.36 to 6164.09μmol TE/100g d.m. depending on methods, part of plant and kind of dietary supplement. The total phenolics (175.13-1723.79mg GAE/100g) and andrographolides content (19.44-85.13mg/g) in the studied samples were correlated with antioxidant activities determined by CUPRAC, FRAP and DPPH (r>0.95, ppaniculata leaves, whereas the lowest in dietary supplement Pn. Moreover principal component analysis, cluster analysis and one-way ANOVA follow by Duncan's tests were also performed. Copyright © 2015. Published by Elsevier B.V.

  15. In vivo and in vitro changes in neurochemical parameters related to mercury concentrations from specific brain regions of polar bears (Ursus maritimus).

    Science.gov (United States)

    Krey, Anke; Kwan, Michael; Chan, Hing Man

    2014-11-01

    Mercury (Hg) has been detected in polar bear brain tissue, but its biological effects are not well known. Relationships between Hg concentrations and neurochemical enzyme activities and receptor binding were assessed in the cerebellum, frontal lobes, and occipital lobes of 24 polar bears collected from Nunavik (Northern Quebec), Canada. The concentration-response relationship was further studied with in vitro experiments using pooled brain homogenate of 12 randomly chosen bears. In environmentally exposed brain samples, there was no correlative relationship between Hg concentration and cholinesterase (ChE) activity or muscarinic acetylcholine receptor (mAChR) binding in any of the 3 brain regions. Monoamine oxidase (MAO) activity in the occipital lobe showed a negative correlative relationship with total Hg concentration. In vitro experiments, however, demonstrated that Hg (mercuric chloride and methylmercury chloride) can inhibit ChE and MAO activities and muscarinic mAChR binding. These results show that Hg can alter neurobiochemical parameters but the current environmental Hg exposure level does have an effect on the neurochemistry of polar bears from northern Canada. © 2014 SETAC.

  16. Total joint replacement: A multiple risk factor analysis of physical activity level 1-2 years postoperatively.

    Science.gov (United States)

    Paxton, Elizabeth W; Torres, Andy; Love, Rebecca M; Barber, Thomas C; Sheth, Dhiren S; Inacio, Maria C S

    2016-07-01

    Background and purpose - The effect of total joint arthroplasty (TJA) on physical activity is not fully understood. We investigated the change in physical activity after TJA and patient factors associated with change. Patients and methods - Using a total joint replacement registry, primary total hip arthroplasty (THA) patients (n = 5,678) and knee arthroplasty (TKA) patients (n = 11,084) between January 1, 2010 and December 31, 2012 were identified. Median age at THA was 68 and median age at TKA was 67. Change in self-reported physical activity (minutes per week) from before TJA (within 1 year of surgery) to after TJA (1-2 years) was the outcome of interest. Patient demographics and comorbidities were evaluated as risk factors. Multiple linear regression was used. Results - Median physical activity before surgery was 50 min/week (IQR: 0-140) for THA patients and 58 (IQR: 3-143) for TKA patients. Median physical activity after surgery was 150 min/week (IQR: 60-280) for both THA patients and TKA patients. Following TJA, 50% of patients met CDC/WHO physical activity guideline criteria. Higher body mass index was associated with lower change in physical activity (THA: -7.1 min/week; TKA: -5.9 min/week). Females had lower change than males (THA: -11 min/week; TKA: -9.1 min/week). In TKA patients, renal failure was associated with lower change (-17 min/week), as were neurological disorders (-30 min/week). Interpretation - Self-reported minutes of physical activity increased from before to after TJA, but 50% of TJA patients did not meet recommended physical activity guideline criteria. Higher body mass index, female sex, and specific comorbidities were found to be associated with low change in physical activity. Patient education on the benefits of physical activity should concentrate on these subgroups of patients.

  17. Total body neutron activation analysis of calcium: calibration and normalisation

    Energy Technology Data Exchange (ETDEWEB)

    Kennedy, N S.J.; Eastell, R; Ferrington, C M; Simpson, J D; Strong, J A [Western General Hospital, Edinburgh (UK); Smith, M A; Tothill, P [Royal Infirmary, Edinburgh (UK)

    1982-05-01

    An irradiation system has been designed, using a neutron beam from a cyclotron, which optimises the uniformity of activation of calcium. Induced activity is measured in a scanning, shadow-shield whole-body counter. Calibration has been effected and reproducibility assessed with three different types of phantom. Corrections were derived for variations in body height, depth and fat thickness. The coefficient of variation for repeated measurements of an anthropomorphic phantom was 1.8% for an absorbed dose equivalent of 13 mSv (1.3 rem). Measurements of total body calcium in 40 normal adults were used to derive normalisation factors which predict the normal calcium in a subject of given size and age. The coefficient of variation of normalised calcium was 6.2% in men and 6.6% in women, with the demonstration of an annual loss of 1.5% after the menopause. The narrow range should make single measurements useful for diagnostic purposes.

  18. RELÉ ELECTRÓNICO PARA LA DETECCIÓN DEL MOVIMIENTO EN LOS TANQUES DE SEDIMENTACIÓN DE LA EMPRESA COMANDANTE ¨ERNESTO CHE GUEVARA¨

    Directory of Open Access Journals (Sweden)

    Orlys Ernesto Torres Breffe

    2011-02-01

    Full Text Available En este trabajo se muestran los resultados del diseño de un dispositivo electrónico para detectar el movimiento del tanquede sedimentación de la planta de lixiviación de la Empresa Ernesto Che Guevara.Estos tanque actualmente se encuentran sin esta protección y su parada por avería solo es detectada de forma visual por eloperario o cuando la densidad de la pulpa aumente a valores tan altos que sea reflejado en el sistema de monitoreo instalado(EROS. La parada inadvertida de estos tanque casi siempre sucede por razones fácilmente corregibles, pero si no se detectaa tiempo la sedimentación del minerales es casi inevitable y las pérdidas de recursos y materiales son cuantiosas.La propuesta electrónica en sustitución a las desechas electromagnéticas, es muy barata y su reproducción es fácilmenterealizable en la propia empresa, dado que los elementos que se utiliza son clásicos, sin exigencias de fabricación, tolerancias,etc.  The main goal of this research paper is to show the electronic device design results while dealing with the location of thesedimentation tank on the leaching plant located on Ernesto Che Guevara factory.Nowadays there is no protection for this tank, thus, if it stops working it can only be noticed by the engine sunner on avisual way or when the extremely high figures of the pulp density are reflected on the available monitor system (EROS.The unnoticed misfunctioning of this device is caused mainly to easily solved reasons. Nevertheless, when not detected ontime, the mineral sedimentation is almost unavoidable which results on the losses of resources.The electronic proposal to substitute the electromagnetic scraps is very cheap and easily to reproduce on the factory itself forthe needed elements are classic with no resistance and manufacture demands.

  19. Evita Perón y el Che Guevara: De la historia a la construcción literaria del mito biográfico

    Directory of Open Access Journals (Sweden)

    Cecilia López Badano

    2014-06-01

    Full Text Available Eva Perón y el Che Guevara son dos de las figuras paradigmáticas argentinas, conocidas internacionalmente a través no sólo de sus vidas, que pueden reconstruirse a partir de documentos históricos, sino por el mito nacional - e internacional - que la muerte temprana ha configurado con ambos mediante la ayuda de la literatura y el cine, expandiendo ficcionalmente el matiz revolucionario de su accionar. El presente texto se propone, en consecuencia, dar cuenta de esas "capas" ficcionales que conforman la construcción estética de los dos mitos biográficos e inciden en la evaluación de sus protagonistas reales, modelando la percepción de ambos, particularmente, la considerada por el gran público más que por los especialistas.

  20. Screening of immunomodulatory activity of total and protein extracts of some Moroccan medicinal plants.

    Science.gov (United States)

    Daoudi, Abdeljlil; Aarab, Lotfi; Abdel-Sattar, Essam

    2013-04-01

    Herbal and traditional medicines are being widely used in practice in many countries for their benefits of treating different ailments. A large number of plants in Morocco were used in folk medicine to treat immune-related disorders. The objective of this study is to evaluate the immunomodulatory activity of protein extracts (PEs) of 14 Moroccan medicinal plants. This activity was tested on the proliferation of immune cells. The prepared total and PEs of the plant samples were tested using MTT (3-(4,5-dimethylthiazol-2yl)-2,5-diphenyltetrazolium bromide) assay on the splenocytes with or without stimulation by concanavalin-A (Con-A), a mitogenic agent used as positive control. The results of this study indicated different activity spectra. Three groups of activities were observed. The first group represented by Citrullus colocynthis, Urtica dioica, Elettaria cardamomum, Capparis spinosa and Piper cubeba showed a significant immunosuppressive activity. The second group that showed a significant immunostimulatory activity was represented by Aristolochia longa, Datura stramonium, Marrubium vulgare, Sinapis nigra, Delphynium staphysagria, Lepidium sativum, Ammi visnaga and Tetraclinis articulata. The rest of the plant extracts did not alter the proliferation induced by Con-A. This result was more important for the PE than for the total extract. In conclusion, this study revealed an interesting immunomodulating action of certain PEs, which could explain their traditional use. The results of this study may also have implications in therapeutic treatment of infections, such as prophylactic and adjuvant with cancer chemotherapy.

  1. Evaluation and comparison of the content of total polyphenols and antioxidant activity of selected species of the genus Allium

    Directory of Open Access Journals (Sweden)

    Marianna LENKOVÁ

    2016-12-01

    Full Text Available The species of the genus Allium are very important crops for human health. They contain many health beneficial substances, such as polyphenols (especially flavonoids, sulphur compounds, vitamins, mineral substances and substances with antioxidant activity. This work has focused on the comparison of total phenolic content and antioxidant activity of selected species of the genus Allium – garlic (Allium sativum L., chives (Allium schoenoprasum L., ramson (Allium ursinum L. and red, yellow and white onion (Allium cepa L.. Samples of plant material were collected at the stage of full maturity in the area of Nitra. Total polyphenols content was determined using the spectrophotometric method of Folin-Ciocalteu agents. Determined the content of total polyphenols were in the range 444.3 - 1591 mg*kg-1. Total polyphenols content in the observed crops declined in the following order: chives > red onion > garlic > yellow onion > ramson > white onion. Antioxidant activity was measured by the spectrophotometric method using a compound DPPH (2.2-diphenyl-1-picryhydrazyl. Determined the value of antioxidant activity ranged 12.29 – 76.57%. Antioxidant activity observed in crops declined in the following order: chives > ramson > red onion > yellow onion > garlic > white onion. In all the analysed crop plants was confirmed by the strong dependence of the antioxidant activity and the total content of polyphenolic substances.

  2. Physical Activity Behavior of Patients 1 Year After Primary Total Hip Arthroplasty : A Prospective Multicenter Cohort Study

    NARCIS (Netherlands)

    Wagenmakers, Robert; Stevens, Martin; Groothoff, Johan W.; Zijlstra, Wiebren; Bulstra, Sjoerd K.; van Beveren, Jan; van Raaij, Jos J. A. M.; van den Akker-Scheek, Inge

    Background. Besides the important beneficial effects of regular physical activity on general health, some of the musculoskeletal effects of physical activity are of particular interest for older adults after total hip arthroplasty (THA). However, research on physical activity behavior of patients

  3. Population dynamics of active and total ciliate populations in arable soil amended with wheat

    DEFF Research Database (Denmark)

    Ekelund, F.; Frederiksen, Helle B.; Ronn, R.

    2002-01-01

    of the population may be encysted. The factors governing the dynamics of active and encysted cells in the soil are not well understood. Our objective was to determine the dynamics of active and encysted populations of ciliates during the decomposition of freshly added organic material. We monitored, in soil...... microcosms, the active and total populations of ciliates, their potential prey (bacteria and small protozoa), their potential competitors (amoebae, flagellates, and nematodes), and their potential predators (nematodes). We sampled with short time intervals (2 to 6 days) and generated a data set, suitable...

  4. Atomistic structural ensemble refinement reveals non-native structure stabilizes a sub-millisecond folding intermediate of CheY

    International Nuclear Information System (INIS)

    Shi, Jade; Schwantes, Christian; Bilsel, Osman

    2017-01-01

    The dynamics of globular proteins can be described in terms of transitions between a folded native state and less-populated intermediates, or excited states, which can play critical roles in both protein folding and function. Excited states are by definition transient species, and therefore are difficult to characterize using current experimental techniques. We report an atomistic model of the excited state ensemble of a stabilized mutant of an extensively studied flavodoxin fold protein CheY. We employed a hybrid simulation and experimental approach in which an aggregate 42 milliseconds of all-atom molecular dynamics were used as an informative prior for the structure of the excited state ensemble. The resulting prior was then refined against small-angle X-ray scattering (SAXS) data employing an established method (EROS). The most striking feature of the resulting excited state ensemble was an unstructured N-terminus stabilized by non-native contacts in a conformation that is topologically simpler than the native state. We then predict incisive single molecule FRET experiments, using these results, as a means of model validation. Our study demonstrates the paradigm of uniting simulation and experiment in a statistical model to study the structure of protein excited states and rationally design validating experiments.

  5. RAPID KNEE-EXTENSIONS TO INCREASE QUADRICEPS MUSCLE ACTIVITY IN PATIENTS WITH TOTAL KNEE ARTHROPLASTY

    DEFF Research Database (Denmark)

    Husted, Rasmus Skov; Wilquin, Lousia; Jakobsen, Thomas Linding

    2017-01-01

    rapid knee-extensions were associated with greater voluntary quadriceps muscle activity during an experimental strength training session, compared to that elicited using slow knee-extensions. STUDY DESIGN: A randomized cross-over study. METHODS: Twenty-four patients (age 66.5) 4-8 weeks post total knee...... agonist muscle activity, especially if the exercise is conducted using rapid muscle contractions. PURPOSE: The purpose of this study was to examine if patients with total knee arthroplasty could perform rapid knee-extensions using a 10 RM load four to eight weeks after surgery, and the degree to which...... arthroplasty randomly performed one set of five rapid, and one set of five slow knee-extensions with the operated leg, using a load of their 10 repetition maximum, while surface electromyography recordings were obtained from the vastus medialis and lateralis of the quadriceps muscle. RESULTS: Data from 23...

  6. Rapid knee-extensions to increase quadriceps muscle activity in patients with total knee arthroplasty

    DEFF Research Database (Denmark)

    Husted, Rasmus Skov; Wilquin, Lousia; Jakobsen, Thomas Linding

    2017-01-01

    rapid knee-extensions were associated with greater voluntary quadriceps muscle activity during an experimental strength training session, compared to that elicited using slow knee-extensions. STUDY DESIGN: A randomized cross-over study. METHODS: Twenty-four patients (age 66.5) 4-8 weeks post total knee...... agonist muscle activity, especially if the exercise is conducted using rapid muscle contractions. PURPOSE: The purpose of this study was to examine if patients with total knee arthroplasty could perform rapid knee-extensions using a 10 RM load four to eight weeks after surgery, and the degree to which...... arthroplasty randomly performed one set of five rapid, and one set of five slow knee-extensions with the operated leg, using a load of their 10 repetition maximum, while surface electromyography recordings were obtained from the vastus medialis and lateralis of the quadriceps muscle. RESULTS: Data from 23...

  7. Evaluation the protective effect of diphenhydramine against acute toxicity induced by levamisole in male mice

    Directory of Open Access Journals (Sweden)

    M.Y. Matti

    2015-06-01

    Full Text Available The aim of this study was to evaluate the protective effect of different doses of diphenhydramine against acute toxicosis with Levamisole. The Mechanism of levamisole induced acute toxicity and that of protective effect of diphenhydramine against Levamisole toxicosis also examined on the level of cholinesterase (ChE activity. Subcutanous injection of 100mg/kg levamisole in male mice with induced cholinergic over stimulation and death in 100% of animals. The Toxicosis was not related to the significantly decreased in plasma, red blood cells and brain ChE activity. Injection low dose of diphenhydramin 2.5mg/kg S.C. 15 min before levamisole produced protective effect against acute toxicity with levamisole. Significantly decreased the severity of toxicosis and increased survival rates to 100%. Diphenhydramine at low dose alone or with acute dose of levamisole did not Produced Significantly inhibition in ChE activity.The data suggested that the toxic effect of Levamisole was not related to inhibition of ChE. The low dose of diphenhydramine protected mice from Levamisole toxicity. The antidoatal effect of diphenhydramine not at the level of protection from ChE inhibition. There was no adverse interaction between two drugs.

  8. Antioxidant Activities of Total Phenols of Prunella vulgaris L. in Vitro and in Tumor-bearing Mice

    Directory of Open Access Journals (Sweden)

    Feng Shi

    2010-12-01

    Full Text Available Prunella vulgaris L. (PV, Labiatae is known as a self-heal herb. The different extracts of dried spikes were studied for the best antioxidant active compounds. The 60% ethanol extract (P-60 showed strong antioxidant activity based on the results of 2,2’-azino-di(3-ethylbenzthiazoline-6-sulfonic acid (ABTS˙+, 2,2-diphenyl-1-picrylhydrazyl (DPPH and ferric reducing antioxidant power (FRAP assay methods. High performance liquid chromatography (HPLC and LC/MS analysis showed that the main active compounds in P-60 were phenols, such as caffeic acid, rosmarinic acid, rutin and quercetin. Total phenols were highly correlated with the antioxidant activity (R2 = 0.9988 in ABTS˙+; 0.6284 in DPPH and 0.9673 FRAP tests. P-60 could inhibit significantly the tumor growth in C57BL/6 mice. It can also been showed that increased superoxide dismutase (SOD activity and decreased malondialdehyde (MDA content in serum of tumor-bearing mice. These results suggested that P-60 extract had high antioxidant activity in vitro and in vivo and total phenols played an important role in antioxidant activity for inhibition of tumor growth.

  9. Joint association of physical activity in leisure and total sitting time with metabolic syndrome amongst 15,235 Danish adults

    DEFF Research Database (Denmark)

    Petersen, Christina Bjørk; Nielsen, Asser Jon; Bauman, Adrian

    2014-01-01

    and total daily sitting time were assessed by self-report in 15,235 men and women in the Danish Health Examination Survey 2007-2008. Associations between leisure time physical activity, total sitting time and metabolic syndrome were investigated in logistic regression analysis. RESULTS: Adjusted odds ratios......BACKGROUND: Recent studies suggest that physical inactivity as well as sitting time are associated with metabolic syndrome. Our aim was to examine joint associations of leisure time physical activity and total daily sitting time with metabolic syndrome. METHODS: Leisure time physical activity...... (OR) for metabolic syndrome were 2.14 (95% CI: 1.88-2.43) amongst participants who were inactive in leisure time compared to the most active, and 1.42 (95% CI: 1.26-1.61) amongst those who sat for ≥10h/day compared to physical activity, sitting time...

  10. Remediation of total petroleum hydrocarbons using combined in-vessel composting ‎and oxidation by activated persulfate

    Directory of Open Access Journals (Sweden)

    A.R. Asgari

    2017-12-01

    Full Text Available This study was investigated the efficiency of activated persulfate and ‎in-vessel composting for removal of total petroleum hydrocarbons. ‎Remediation by activated persulfate with ferrous sulfate as pre-treatment was done at batch system. In the chemical oxidation, various variables including persulfate concentrations (10-3000 mg/g as waste, pH (3-7, ferrous sulfate (0.5-4 mg/g as wasteand temperature (20-60°C were studied. In the biological system, premature compost was added as an amendment. The filter cake to compost ratio were 1:0 (as control and 1:5 to 15 (as dry basis. C: N: P ratio and moisture content were 100:5:1 and 45-60%, respectively. The results showed that acidic pH (pH=3 had high efficiency for the removal of total petroleum hydrocarbons by activated persulfate. Temperature had the significant effect during the persulfate oxidation. When ferrous sulfate was used as an activator for degradation at acidic condition and 60°C, removal efficiency increased to 47.32%. The results of biological process showed that the minimum total petroleum hydrocarbons removal in all reactors was 62 percent. The maximum and minimum removal efficiency was obtained at 1:5 (69.46% and 1:10 (62.42% mixing ratios, respectively. Kinetic study showed that second order kinetic model (R2>0.81 shows the best agreement with the experimental data and the rate of TPH degradation at low mixing ratio (1:3 was faster than high mixing ratio (1:15. Therefore, according to the results, in-vessel composting after pre-treatment by activated persulfate is suggested as an efficient process for degradation of total petroleum hydrocarbons.

  11. Che fatica far festa all’Odin Teatret!

    DEFF Research Database (Denmark)

    Chemi, Tatiana

    2004-01-01

    A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark.......A report of the many activities, planned to celebrate a unique birthday: the one of a theatre group existing for 40 years. A piece of history of contemporary theatre is going to show its past, its present and its future. With a synoptic table for the activities in Denmark....

  12. Physical Activity Attenuates Total and Cardiovascular Mortality Associated With Physical Disability: A National Cohort of Older Adults.

    Science.gov (United States)

    Martinez-Gomez, David; Guallar-Castillon, Pilar; Higueras-Fresnillo, Sara; Garcia-Esquinas, Esther; Lopez-Garcia, Esther; Bandinelli, Stefania; Rodríguez-Artalejo, Fernando

    2018-01-16

    Regular physical activity (PA) has been shown to protect against disability onset but, once the disability is present, it is unclear if PA might attenuate its harmful health consequences. Thus, we examined if mortality risk associated with physical disability can be offset by PA among older adults. We used data from a cohort of 3,752 individuals representative of the noninstitutionalized population aged 60 years and older in Spain. In 2000-2001, participants self-reported both PA levels (inactive, occasionally, monthly, weekly) and five physical disabilities (agility, mobility, global daily activities, instrumental activities of daily living, and self-care). Individuals were prospectively followed through 2014 to assess incident deaths. The mean follow-up was 10.8 years, with a total of 1,727 deaths, 638 of them due to cardiovascular disease (CVD). All disability types were associated with higher total and CVD mortality. Being physically active (ie, doing any PA) was associated with a statistically significant 26%-37% and 35%-50% lower risk of total and CVD death, respectively, across types of disability. As compared with those being physically active and without disability, those who were inactive and had a disability showed the highest mortality risk from total (hazard ratios from 1.52 to 1.90 across disabilities, all p disability. In older adults, PA could attenuate the increased risk of mortality associated with physical disability. © The Author 2017. Published by Oxford University Press on behalf of The Gerontological Society of America. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  13. Tendenza al minor sforzo dell'espressione nelle lingue romanze

    Directory of Open Access Journals (Sweden)

    Mitja Skubic

    2013-12-01

    Full Text Available Lʼidea dello sforzo minore - in linea generale valida e rispettata - è senzʼaltro giusta. Havers (1931 a pienamente ragione. Dobbiamo però considerare che lʼesprimersi troppo succintamente non è sempre il più facile, anche se per il locutore più sbrigativo, e - se non cʼè dubbio che esprimersi ampiamente, con più elementi linguistici, sia desiderabile e auspicabile da parte dellʼinterlocutore - non è sempre facile nemmeno per il locutore, "più facile" nel senso di trovare subito il termine adeguato, forse più espressivo che convenga allʼinterlocutore. Il locutore è certo il nucleo della comunicazione, vuol dire, può creare espressioni nuove, il che è nella lingua un procedimento costante, oppure scegliere tra le possibilità che gli si offrono, persino violando il sistema morfosintattico valido il che può portare addirittura allʼannientamento del sistema in vigore e la sua sostituzione con un altro. Il che si verificò, nel mondo linguistico romanzo, appunto con il declino totale dellʼesistenza del sistema della flessione del sostantivo, e parzialmente nel sistema del verbo, in misura minore in quello del pronome. Analizzando tali cambiamenti constatiamo che il principio della legge del minor sforzo, formulato da Havers (1931, è senzʼaltro valido, cerchiamo tuttavia di trovare le ragioni le quali, talvolta, spingono il locutore a violare il sistema in vigore. Crediamo che anche in tale scelta abbia un peso importante una espressione o una struttura spontanea, perciò più naturale e con questo più facile.

  14. Characterization of cholinesterases in plasma of three Portuguese native bird species: application to biomonitoring.

    Directory of Open Access Journals (Sweden)

    Cátia S A Santos

    Full Text Available Over the last decades the inhibition of plasma cholinesterase (ChE activity has been widely used as a biomarker to diagnose organophosphate and carbamate exposure. Plasma ChE activity is a useful and non-invasive method to monitor bird exposure to anticholinesterase compounds; nonetheless several studies had shown that the ChE form(s present in avian plasma may vary greatly among species. In order to support further biomonitoring studies and provide reference data for wildlife risk-assessment, plasma cholinesterase of the northern gannet (Morus bassanus, the white stork (Ciconia ciconia and the grey heron (Ardea cinerea were characterized using three substrates (acetylthiocholine iodide, propionylthiocholine iodide, and S-butyrylthiocholine iodide and three ChE inhibitors (eserine sulphate, BW284C51, and iso-OMPA. Additionally, the range of ChE activity that may be considered as basal levels for non-exposed individuals was determined. The results suggest that in the plasma of the three species studied the main cholinesterase form present is butyrylcholinesterase (BChE. Plasma BChE activity in non-exposed individuals was 0.48±0.11 SD U/ml, 0.39±0.12 SD U/ml, 0.15±0.04 SD U/ml in the northern gannet, white stork and grey heron, respectively. These results are crucial for the further use of plasma BChE activity in these bird species as a contamination bioindicator of anti-cholinesterase agents in both wetland and marine environments. Our findings also underscore the importance of plasma ChE characterization before its use as a biomarker in biomonitoring studies with birds.

  15. Nascita e destino della soggettività. Dai ruoli professionali ai processi di cura, attraverso una lettura di "Quel che resta del giorno" di Kazuo Ishiguro

    Directory of Open Access Journals (Sweden)

    Gabriele Profita

    2017-07-01

    Full Text Available Questa riflessione affronta un tema assai rilevante per le professioni di cura, con uno sguardo particolare alla psicoterapia. Per chiarire il ruolo della soggettività e della nascita e maturazione di un ruolo professionale riporterò un’analisi di un testo letterario attraverso il quale sarà più agevole scoprire come si forma l’identità di un ruolo professionale e come si avvia alla sua maturazione e alla sua codificazione. In particolare quali sono i rischi legati ad una sua rigida codificazione rivolta alla sua normatività tecnica? Mi propongo di tracciare un confronto con alcune forme di costruzione della soggettività che nel corso dei secoli hanno fondato il modello dell’uomo occidentale nelle sue articolazioni professionali.

  16. In vivo Prompt Gamma Neutron Activation Analysis Facility for Total Body Nitrogen and Cd

    International Nuclear Information System (INIS)

    Munive, Marco; Revilla, Angel; Solis, Jose L.

    2007-01-01

    A Prompt Gamma Neutron Activation Analysis (PGNAA) system has been designed and constructed to measure the total body nitrogen and Cd for in vivo studies. An aqueous solution of KNO 3 was used as phantom for system calibration. The facility has been used to monitor total body nitrogen (TBN) of mice and found that is related to their diet. Some mice swallowed diluted water with Cl 2 Cd, and the presence of Cd was detected in the animals. The minimum Cd concentration that the system can detect was 20 ppm

  17. Development of square wave voltammetry method for the assessment of organophosphorus compound impact on the cholinesterase of Pheretima with 2,6-dichloroindophenol as a redox indicator.

    Science.gov (United States)

    Qiu, Jingxia; Chen, Jin; Ma, Qianqian; Miao, Yuqing

    2009-09-01

    A square wave voltammetry method was developed for the assessment of organophosphorus (OPs) compound impact on the cholinesterase of Pheretima with 2,6-dichloroindophenol (2,6-DCIP) as a redox indicator. The substrate of acetylthiocholine is hydrolysed by the cholinesterase (ChE) from soil animal pheretima, and the produced thiocholine reacts with the 2,6-DCIP to give obvious shift of electrochemical signal. The inhibition of ChE was assessed by measuring the enzyme activity before and after incubating with parathion-methyl. The reduction peak current of 2,6-DCIP decreases with the time of enzymatical reaction. The ChE loses almost 32.74% activity after 10 min incubation with 1ng mL(-1) paraoxon and 54.62% with 10 microg mL(-1) paraoxon, while the activity that corresponds to 100 microg mL(-1) paraoxon was nearly completely inhibited. This method can be employed to assess the inhibition of ChE and investigate OPs impact on environmental animals.

  18. Effect of cold storage on total phenolics content, antioxidant activity and vitamin C level of selected potato clones.

    Science.gov (United States)

    Külen, Oktay; Stushnoff, Cecil; Holm, David G

    2013-08-15

    Twelve Colorado-grown specialty potato clones were evaluated for total phenolic content, antioxidant activity and ascorbic acid content at harvest and after 2, 4, 6 and 7 months cold storage at 4 °C. Potato clones were categorized as pigmented ('CO97226-2R/R', 'CO99364-3R/R', 'CO97215-2P/P', 'CO97216-3P/P', 'CO97227-2P/P', 'CO97222-1R/R', 'Purple Majesty', 'Mountain Rose' and 'All Blue'), yellow ('Yukon Gold') and white fleshed ('Russet Nugget', 'Russet Burbank'). Folin-Ciocalteu reagent was used to estimate total phenolic content, and 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt (ABTS(•+) ) and 2,2-diphenyl-1-picrylhydrazyl (DPPH(•) ) radical scavenging assays were used to estimate antioxidant capacity. Pigmented potato genotypes had significantly higher total phenolic content and antioxidant activity at all data points than yellow- and white-fleshed cultivars. Vitamin C content was higher in 'Yukon Gold' than in the other clones. The highest level of vitamin C in all clones was at harvest and after 2 months in cold storage. Vitamin C content in all potato clones dropped rapidly with longer intervals of cold storage. Although total phenolic content and antioxidant activity fluctuated during cold storage, after 7 months of cold storage their levels were slightly higher than at harvest. Total phenolic content was better correlated with Trolox equivalent antioxidant capacity (TEAC)/ABTS(•+) than the TEAC/DPPH(•) radical scavenging assay. Pigmented potato clones had significantly higher total phenolic content and antioxidant activity, while the yellow-fleshed potato cultivar 'Yukon Gold' had significantly higher vitamin C content. Vitamin C content decreased in all potato clones during cold storage, while total phenolics increased in pigmented clones. © 2013 Society of Chemical Industry.

  19. Effects of xenobiotic compounds on the cell activities of Euplotes crassus, a single-cell eukaryotic test organism for the study of the pollution of marine sediments

    Energy Technology Data Exchange (ETDEWEB)

    Trielli, Francesca [Dipartimento per lo Studio del Territorio e delle sue Risorse, University of Genoa Corso Europa, 26, I-16132 Genova (Italy); Amaroli, Andrea [Dipartimento per lo Studio del Territorio e delle sue Risorse, University of Genoa Corso Europa, 26, I-16132 Genova (Italy); Sifredi, Francesca [Dipartimento per lo Studio del Territorio e delle sue Risorse, University of Genoa Corso Europa, 26, I-16132 Genova (Italy); Marchi, Barbara [Dipartimento di Biologia, University of Genoa, Viale Benedetto XV, 5, I-16132 Genova (Italy); Falugi, Carla [Dipartimento di Biologia, University of Genoa, Viale Benedetto XV, 5, I-16132 Genova (Italy); Corrado, Maria Umberta Delmonte [Dipartimento per lo Studio del Territorio e delle sue Risorse, University of Genoa Corso Europa, 26, I-16132 Genova (Italy)]. E-mail: corrado@dipteris.unige.it

    2007-08-01

    It is now widely accepted that assays with protists are relevant to be exploited for the study of environmental modifications due to the presence of xenobiotic compounds. In this work, the possibility of utilizing Euplotes crassus, an interstitial marine ciliate, for the pre-chemical screening of estuarine and coastal sediments was evaluated. For this purpose, the effects of exposure to pollutants were tested on the cell viability, fission rate and lysosomal membrane stability of E. crassus. The following toxicants were used: an organophosphate (OP) pesticide, basudin, an organochlorine hydrocarbon, AFD25, both employed especially for pest control in agricultural sites, a toxic heavy metal, mercury (HgCl{sub 2}) and different mixtures of the above-mentioned compounds, as they might occur in polluted sites. Exposure to these toxicants affected cell viability at concentrations ranging from 96.6 to 966 x 10{sup 3} mg/l for basudin, from 3.3 to 33 x 10{sup 3} mg/l for AFD25 and from 0.1 to 1 mg/l for HgCl{sub 2}. A significant decrease in the mean fission rate (P < 0.001) was found after 24- or 48-h exposures to 9.66 mg/l basudin, 3.3 mg/l AFD25 and 7 x 10{sup -2} mg/l HgCl{sub 2}. Furthermore, the Neutral Red Retention Assay showed a significant decrease in lysosomal membrane stability after 60- and 120-min exposures to AFD25 (33 mg/l) and HgCl{sub 2} (0.33 mg/l). In addition, as it is well-known that the inhibition of acetylcholinesterase activity represents a specific biomarker of exposure to OP and carbamate pesticides in higher organisms, initially the presence of cholinesterase (ChE) activity was detected in E. crassus, using cytochemical, spectrophotometric and electrophoretic methods. Afterwards, this enzyme activity was characterized spectrophotometrically by its sensitivity to specific ChE inhibitors and to variations in pH and temperature. The ChE activity was inhibited significantly by basudin- (9.66 and 96.6 mg/l) or AFD25-exposure (3.3 mg/l). Conversely

  20. Total phenolics, flavonoids, tannins and antioxidant activity of lima beans conserved in a Brazilian Genebank

    Directory of Open Access Journals (Sweden)

    Tânia da Silveira Agostini-Costa

    2015-02-01

    Full Text Available The objective of this study was to characterize for the first time polyphenols and DPPH (2-diphenyl-1-picryhydrazyl radical antioxidant activity in commonly cultivated accessions of Phaseolus lunatus from an ex situ germplasm collection maintained by Embrapa, in Brazil. Furthermore, the study aimed to detect changes in total polyphenols, total flavonoids and condensed tannin for the same accessions after regeneration in a greenhouse. The results showed the diversity of the lima bean collection for phenolic compounds, which were strongly correlated with antioxidant activity. Lima beans accessions with the highest polyphenols and antioxidant activity were those with colored seeds. Conservation through cold storage of P. lunatus seeds in a cold chamber in the germplasm collection did not necessarily affect phenolic compounds. Variations observed in values after regeneration seeds may be mainly results of biotic and abiotic factors, including not only cultivar, but also environmental conditions. This study suggests that polyphenols in the lima beans present antioxidant activity, with possible beneficial effects for human health. It was expected that the potential of this tasty legume can be also used as a functional food crop and/or as a new ingredient in gastronomy.

  1. Measurement of fluorine total concentration in dental enamel using fast neutron activation

    International Nuclear Information System (INIS)

    Mouadili, A.; Vernais, J.; Isabelle, D.B.

    1988-01-01

    Fluorine which is present in dental enamel, at the level of a few tens to a few hundred ppm, plays an important role in the behaviour of this tissue. Therefore quantitative determination is of interest for particular studies of the dental system. We present a nuclear nondestructive method to determine the total fluorine content in dental enamel by cyclotron-produced fast-neutron activation. The 19 F(n,2n) reaction leads to 18 F which is a β + emitter with a 109.8 min half-life. The irradiated sample activity is measured by detecting in coincidence the annihilation photons. A fluorine standard is used for calibration. The detection limit is of the order of 1 ppm, while the reproducibility is better than 95% [pt

  2. Total pepsin activity and gastrin in sera as markers of eradication of Helicobacter pylori

    NARCIS (Netherlands)

    Khoshkholgh, M.; Saberi-Firoozi, M.; Fattahi, M.; Siavoshi, F.; Khatibian, M.; Vahedi, H.; Mikaeli, J.; Ansari, R.; Alizadeh, B.; Malekzadeh, R.; Massarrat, S.

    1994-01-01

    The measurement of total pepsin activity by colorimetry, and gastrin by radioimmunoassay method was performed on the sera of 100 patients (80 with duodenal ulcer and 20 with non-ulcer dyspepsia) before and 4 weeks after the end of antibacterial treatment for eradication of Helicobacter pylori. While

  3. Effect of gibberellic acid on total antioxidant activity during Chenopodium rubrum L. ontogenesis invitro

    Directory of Open Access Journals (Sweden)

    Mitrović Aleksandra

    2009-01-01

    Full Text Available Total antioxidant activity (TAA represents the combined ability of diverse antioxidants present in a sample of plant material to scavenge free radicals. Chenopodium rubrum L. sel. 184 is a qualitatively short-day plant; as an early-flowering species, it is a suitable object for studying ontogenesis in vitro. We investigated the effect of GA3 (5 mg/l on TAA during C. rubrum ontogenesis under two different inductive photoperiodic regimes in vitro. Total antioxidant activ­ity does not change in different phases of C. rubrum ontogenesis under the same photoperiodic treatment. Exposure to continuous irradiation caused an increase of TAA in both C. rubrum plants and collected matured seeds. Gibberellic acid stimulated stem elongation, but did not affect leaf development or the number of matured seeds per plant, regardless of photoperiodic treatment; it induced a decrease of TAA in C. rubrum plants regardless of photoperiodic treatment or the phase of development, while it had no effect on TAA of matured seeds.

  4. Modeling boron separation from water by activated carbon, impregnated and unimpregnated

    Energy Technology Data Exchange (ETDEWEB)

    Ristic, M.; Grbavcic, Z. [Belgrade Univ., Belgrade (BA). Faculty of Technology and Metallurgy; Marinovic, V. [Belgrade Univ., Belgrade (BA). Ist. of Technical Science of the Serbian Academy of Science and Arts

    2000-10-01

    The sorption of boron from boric acid water solution by impregnated activated carbon has been studied. Barium, calcium, mannitol, tartaric acid and citric acid were used as chemical active materials. All processes were performed in a chromatographic continuous system at 22{sup 0} C. Experimental results show that activated carbon impregnated with mannitol is effective in removing boron from water. The separation of boron from the wastewater from a factory for producing enameled dishes by activated carbon impregnated with mannitol was also performed. Two models have been applied to describe published and new data on boron sorption by impregnated activated carbon. Both of them are based on the analysis of boron concentration response to the step input function. This led to a mathematical model that quite successfully described impregnation effects on adsorption capacities. [Italian] E' stato studiato l'assorbimento del boro, mediante carbone attivo impregnato, da soluzioni acquose di acido borico. Quali materiali chimici attivi sono stati utilizzati: bario, calcio, mannitolo, acido tartarico ed acido citrico. Tutti i processi sono stati condotti in un sistema cromatografico continuo a 22{sup 0}C. I risultati sperimentali mostrano che il carbone attivo impregnato con mannitolo e' efficace nella rimozione del boro dall'acqua. E' anche stata effettuata la separazione del boro da acque di scarico di un'industria per la produzione di piatti smaltati mediante carbone attivo impregnato con mannitolo. Sono stati applicati due modelli per descrivere i risultati, pubblicati e nuovi, dell'assorbimento del boro mediante carbone attivo impregnato. Entrambi sono basati sull'analisi della risposta alla concentrazione di boro successivamente incrementata a stadi. Cio' porta ad un modello matematico che descrive abbastanza soddisfacentemente gli effetti dell'impregnazione sulla capacita' di assorbimento.

  5. The effect of intesification factors to total antioxidant activity of highbush blueberry (Vaccinium corymbosum L. and lingonberry (Vaccinium vitis-idaea L.

    Directory of Open Access Journals (Sweden)

    Michal Medvecký

    2015-12-01

    Full Text Available Public attention is increasingly drawn to the protective effects of natural antioxidants against civilization diseases. An important source of antioxidants are berries, which until recently has received little attention, but the latest research towards the right to it. The phenolic profile and quantitative composition of blueberries as well as the corresponding antioxidant activity of blueberries is well documented. The aim of this paper was the determination of the relationship between different methods of fertilization and total antioxidant activity of six selected varieties of blueberries and five varieties of lingonberries. Each sample of blueberry varieties (Bluejay, Nelson, Bluecrop, Patriot, Berkeley and Brigitta and lingonberry varieties (Koralle, Ida, Sanna, Linnea and Sussi were collected from the research station Krivá in Orava. The values of total antioxidant activity of the extracts of studied varieties of blueberry after organic fertilization ranged from 27.15 to 52.25 μg.mg-1 eq. Trolox. After mineral fertilization, the values of total antioxidant activity of the extracts of studied varieties of blueberry ranged from 21.27 to 51.00 μg.mg-1 eq. Trolox. In the control treatment, the values of total antioxidant activity of the extracts of studied varieties of blueberry ranged from 26.99 to 54.15 μg.mg-1 eq. Trolox. The values of values ​​of total antioxidant activity of the extracts of studied varieties of lingonberry after organic fertilization ranged from 42.49 to 60.27 μg.mg-1 eq. Trolox. After mineral fertilization, the values of total antioxidant activity of the extracts of studied varieties of lingonberry were in the interval from 38.85 to 55.15 μg.mg-1 eq. Trolox. In the variant without fertilization, the values of total antioxidant activity of the extracts of studied varieties of lingonberry ranged from 37.16 to 65.11 μg.mg-1 eq. Trolox. The application of organic fertilizer has a positive effect to increasing

  6. Evaluation and comparison of the content of total polyphenols and antioxidant activity in garlic (Allium sativum L.

    Directory of Open Access Journals (Sweden)

    Marianna Lenková

    2017-01-01

    Full Text Available Garlic (Allium sativum L. is one of the oldest cultivated plants in the world and highly valued throughout the ages as a culinary spice. It is a hardy perennial belonging to the Alliaceae family. The garlic bulb is the most commonly used portion of the plant, composed of 5 - 20 individual. It is a very good source of manganese, selenium, vitamin C and vitamin B6 (pyridoxine. In addition, garlic is a good source of other minerals, including phosphorous, calcium, potassium, iron and copper. Many of the perceived therapeutic effects of garlic are thought to be due to its active ingredient allicin. This sulphur-containing compound gives garlic its distinctive pungent smell and taste. Garlic possesses antiviral, antibacterial, anti-fungal properties allowing it to stand against all infections. This work has focused on the evaluation and comparison of total content of polyphenols and antioxidant activity in five varieties of garlic - Mojmír, Záhorský, Lukan, Havran and Makoi. Samples of plant material were collected at the stage of full maturity in the area of Nitra. The total content of polyphenols was determined using the spectrophotometric method of Folin-Ciocalteu agents. Determined the content of total polyphenols in garlic were in the range 621.13 mg.kg-1 (Záhorský to 763.28 mg.kg-1 (Havran. Total polyphenols content in garlic declined in the following order: Havran >Mojmír >Makoi >Lukan >Záhorský. Antioxidant activity was measured by the spectrophotometric method using a compound DPPH (2.2-diphenyl-1-picryhydrazyl. Statistically significant highest value of antioxidant was recorded in 20.22% (Mojmír and the lowest value was in 13.61% (Záhorský. The values of antioxidant activity observed in the varieties of garlic may be arranged as follows: Mojmír >Havran >Lukan >Makoi >Záhorský. In all the analysed varieties of garlic was confirmed by the strong dependence of the antioxidant activity and the total content of polyphenols.

  7. Total body calcium by neutron activation analysis. Reference data for children

    International Nuclear Information System (INIS)

    Ellis, K.J.; Shypailo, R.J.

    2001-01-01

    There is a paucity of data on the chemical composition of the human body during growth. Total body calcium (TBCa) has been reported for only one male child, aged 41/2 yr. TBCa values for 25 children and 27 young women using in vivo neutron activation analysis have been obtained. TBCa results were lower than those reported for the one male cadaver, as well as the estimates derived for the 'Reference Man' model. It was concluded that the reference values for TBCa may need to be adjusted to appropriately describe skeletal mineralization of contemporary children. (author)

  8. Total Lactic Acid Bacteria (LAB), Antioxidant Activity, and Acceptance of Synbiotic Yoghurt with Binahong Leaf Extract (Anredera cordifolia (Ten.) Steenis)

    Science.gov (United States)

    Lestari, R. P.; Nissa, C.; Afifah, D. N.; Anjani, G.; Rustanti, N.

    2018-02-01

    Alternative treatment for metabolic syndrome can be done by providing a diet consist of functional foods or beverages. Synbiotic yoghurt containing binahong leaf extract which high in antioxidant, total LAB and fiber can be selected to reduce the risk of metabolic syndrome. The effect of binahong leaf extract in synbiotic yoghurt against total LAB, antioxidant activity, and acceptance were analyzed. The experiment was done with complete randomized design with addition of binahong leaf extract 0% (control); 0.12%; 0.25%; 0.5% in synbiotic yoghurt. Analysis of total LAB using Total Plate Count test, antioxidant activity using DPPH, and acceptance were analyzed by hedonic test. The addition of binahong leaf extract in various doses in synbiotic yoghurt decreased total LAB without significant effect (p=0,145). There was no effect of addition binahong leaf extract on antioxidant activity (p=0,297). The addition of binahong leaf extract had an effect on color, but not on aroma, texture and taste. The best result was yoghurt synbiotic with addition of 0,12% binahong leaf extract. Conclusion of the research was the addition of binahong leaf extract to synbiotic yogurt did not significantly affect total LAB, antioxidant activity, aroma, texture and taste; but had a significant effect on color.

  9. Effects of total solar eclipse on the behavioural and metabolic activities of tropical intertidal animals

    Digital Repository Service at National Institute of Oceanography (India)

    Parulekar, A.H.; Ansari, Z.A.; Verlecar, X.N.; Harkantra, S.N.

    To study the effects of total solar eclipse of 16th Feb. 1980, on the behaviour and metabolic activities of intertidal invertebrates - nematodes, gastropods and bivalves - having different habitat preference a set of relevant observations, covering...

  10. Measurement of total phenolic content and antioxidant activity of aerial parts of medicinal plant Coronopus didymus.

    Science.gov (United States)

    Noreen, Hafiza; Semmar, Nabil; Farman, Muhammad; McCullagh, James S O

    2017-08-01

    To evaluate the total phenolic content and compare the antioxidant activity of various solvent extracts and fractions from the aerial parts of Coronopus didymus through various assays. Total phenolic content was determined using the Folin-Ciocalteu assay and the in vitro antioxidant activity of a number of different extracts was investigated in a dose-dependent manner with three different methods: the 2,2-diphenyl-1-picrylhydrazyl (DPPH), 2,2'-azino-bis(3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt (ABTS) and ferric reducing antioxidant power (FRAP) assays. A flavone was isolated from the most active ethanolic extract with high antioxidant activity using size exclusion chromatography. IC 50 values were calculated for the DPPH and ABTS methods. The FRAP activity was assessed in terms of μM Fe (II) equivalent. The phenolic content was found to be highest in the ethanol extract (CDA Et; 47.8 mM GAE) and the lowest in the dichloromethane extract (CDA DCM; 3.13 mM GAE). The ethanol extract showed high radical scavenging activity towards DPPH and ABTS radicals with IC 50 values of (7.80 × 10 2 ) and (4.32 × 10 2 ) μg/mL, respectively. The most active ethanol extract had a FRAP value of 1921.7 μM Fe (II) equivalent. The isolated flavone F10C (5,7,4'-trihydroxy-3'-methoxy flavone) was far more effective for scavenging free radicals in the DPPH and ABTS assays with IC 50 of 43.8 and 0.08 μg/mL, than the standard trolox, with IC 50 values of 97.5 and 21.1 μg/mL, respectively. In addition, the flavone F10C and the standard ascorbic acid had FRAP values of 1621.7 and 16 038.0 μM Fe (II) equivalents, respectively. The total phenolic content of extracts in decreasing order is ethanol extract (CDA Et) > acetone extract (CDA ACE) > phenolic extract (CDA MW) > n-hexane extract (CDA nHX)> chloroform extract (CDA CHL) > dichloromethane extract (CDA DCM). The ordering of extracts in terms of antioxidant activity from highest to lowest is CDA Et

  11. Total phenolics and antioxidant activity of five medicinal plant; Fenois totais e atividade antioxidante de cinco plantas medicinais

    Energy Technology Data Exchange (ETDEWEB)

    Sousa, Cleyton Marcos de M.; Silva, Hilris Rocha e; Vieira-Junior, Gerardo Magela; Ayres, Mariane Cruz C.; Costa, Charllyton Luis S. da; Araajo, Delton Servulo; Cavalcante, Luis Carlos D.; Barros, Elcio Daniel S.; Araujo, Paulo Breitner de M.; Brandao, Marcela S.; Chaves, Mariana H. [Universidade Federal do Piaui, Teresina, PI (Brazil). Dept. de Quimica]. E-mail: mariana@ufpi.br

    2007-03-15

    This paper describes total phenolics content and antioxidant activity in the ethanolic extract of leaves, bark and roots of five medicinal plants: Terminalia brasiliensis Camb., Terminalia fagifolia Mart. and Zucc., Copernicia cerifera (Miller) H.E. Moore, Cenostigma macrophyllum Tul. var. acuminata Teles Freire and Qualea grandiflora Mart. The total phenolics content of the plant extracts, determined by the Folin-Ciocalteu method, varied from 250.0 {+-}8,2 to 763,63 {+-}13.03 mg of gallic acid equivalent/g dry EtOH extract. The antioxidant activity of extracts was evaluated using the 2,2-diphenyl-1-picrylhydrazyl (DPPH) assay system. Extract of bark from T. brasiliensis, the most active, with an EC{sub 50} value of 27.59 {+-} 0.82 {mu}g/mL, was comparable to rutin (EC{sub 50} = 27.80 {+-} 1.38) and gallic acid (EC{sub 50} = 24.27 {+-} 0.31), used as positive controls. The relationship between total phenolic content and antioxidant activity was positive and significant for T. brasiliensis, C. macrophyllum and C. cerifera. (author)

  12. Total phenolic and flavonoid contents and biological activities of Cachrys cristata DC. extracts

    Directory of Open Access Journals (Sweden)

    Matejić Jelena S.

    2014-01-01

    Full Text Available The total phenolic/flavonoid contents and antioxidant potential of the methanol, ethyl-acetate, acetone and water extracts obtained from the aerial parts and fruits of Cachrys cristata DC.(Apiaceae were compared. The total phenolic contents of the tested extracts were determined using Folin-Ciocalteu’s reagent. The amounts per g of dry plant extract of gallic acid (GA and quercetin (Qu ranged between 22.60-166.97 mg, and 8.91-46.02 mg, respectively. The antioxidant activity, expressed as IC50, ranged from 1.784-17.621 mg/mL and from 1.01-3.42 mg L(+-ascorbic acid (Vitamin C/g when tested with 2,2-diphenyl-1-picrylhydrazyl (DPPH and ABTS, respectively. The antimicrobial activity of the extracts was investigated by the microwell dilution assay, for the most common human gastrointestinal pathogenic bacterial strains: Escherichia coli ATCC 25922, Pseudomonas aeruginosa ATCC 9027, Salmonella enteritidis ATCC 13076, Bacillus cereus ATCC 10876, Listeria monocytogenes ATCC15313, Staphylococcus aureus ATCC 25923 and yeast Candida albicans ATCC 10231. The results indicate that C. cristata can be regarded as a potential source of antioxidant and antimicrobial agents. [Projekat Ministarstva nauke Republike Srbije, br. 173029

  13. Zur chemie der marsoberfläche

    Science.gov (United States)

    Keil, Klaus; Clark, Benton C.; Baird, A.K.; Toulmin, Priestley; Rose, Harry J.

    1978-01-01

    Analyses of 13 samples of Martian surface materials with the Viking X-ray fluorescence spectrometers show SiO2 similar to that of terrestrial mafic rocks, whereas Fe2O3, Cl, and S are higher and Al2O3, K2O, Rb, Sr, Y, and Zr are lower. Low totals suggest presence of CO2, H2O, and Na2O. Duricrust fragments are higher in S than fines, but samples from both landing sites are surprisingly similar. We suggest that Martian surface materials are aeolian deposits of complex mixtures of weathering products of maficultramafic rocks, possibly consisting of iron-rich clays, sulfates, iron oxides, carbonates, and chlorides.

  14. ANTIOXIDANT ACTIVITY AND TOTAL PHENOLIC CONTENT OF GRAPE SEEDS AND PEELS FROM ROMANIAN VARIETIES

    Directory of Open Access Journals (Sweden)

    Mădălina IUGA

    2017-12-01

    Full Text Available Grape seeds and peels are valuable by-products from wine production industry that can be valorized in food production. Both grape seeds and peels have a great amount of antioxidants and polyphenolic compounds. The aim of this study was to investigate the total phenolic content of red and white grape seeds and peels and to establish the optimal solvent concentration for highest extraction yield. For this purpose, Folin Ciocâlteu method was used to achieve the phenols content and the antioxidant activity was estimated using 2,2 – diphenyl-1-1picrylhydrazyl (DPPH reagent. The total phenolic content ranged from 81.13 mg GAE/g for red peels, 93.47 mg GAE/g for white peels, to 128.47 mg GAE/g for red seeds and 164.70 mg GAE/g for white seeds. The One-Way ANOVA method was used to see if there are differences between the antioxidant activities depending on the solvent concentration. The results showed that the methanol concentration significantly (p < 0.05 influences the antioxidants extraction. The inhibition percent IC50 ranged from 0,24 to 4,37 μg/mL for white peels, from 3,12 to 6,29 μg/mL for red peels, from 5,53 to 5,90 μg/mL for white seeds and from 4,59 to 6,14 μg/mL for red seeds. This study highlighted the possibility to use grape seeds and peels as food ingredients or natural antioxidant to extend the shelf life of food, especial of lipids and lipid-containing foods because of their high antioxidant activity and total phenolic content.

  15. Soybean and tempeh total isoflvones improved antioxidant activities in normal and scopolamine-induced rat brain

    Directory of Open Access Journals (Sweden)

    Aliya Ahmad

    2015-11-01

    Full Text Available Objective: To highlight the comparative studies between total isoflavone extracts from soybean and tempeh on the neuronal oxidative stress and antioxidant activities. Methods: The total isoflavones were administered orally for 15 days with 3 selected doses (10, 20 and 40 mg/kg. Piracetam (400 mg/kg, p.o. was used as a standard drug while scopolamine (1 mg/kg, i.p. was used as a drug that promoted amnesia in selected groups. The oxidative markers (thiobarbituric acid reactive substances and nitric oxide were measured in brain homogenate. The antioxidant activities evaluated were catalase, superoxide dismutase, glutathione reductase and glutathione. Results: Our results showed that soybean and tempeh isoflavones significantly improved the levels of catalase, superoxide dismutase, glutathione reductase and glutathione while decreased levels of thiobarbituric acid reactive substances and nitric oxide in both the brain of normal as well as scopolamine-induced animals. Conclusions: Our findings suggested that soybean and tempeh isoflavones could be useful in the management and prevention of age-related neurodegenerative changes including Alzheimer’s disease through its antioxidant activities.

  16. Total phenols and antioxidant activities of leaf and stem extracts from coriander, mint and parsley grown in Saudi Arabia

    International Nuclear Information System (INIS)

    Al-Juhaimi, F.; Ghafoorr, K.

    2011-01-01

    Leaves and stems of three different herbs from two different families were used to extract phenolic compounds and the bioactivity of the extracts was evaluated by using 1, 1-diphenyl-2-picrylhydrazyl or DPPH scavenging ability or their antioxidant activities. Extract from leaves of mint, which belongs to Lamiaceae family contained 1.24 mgGAE/100 mL of total phenolic compounds and 34.21% antioxidant activity which were significantly higher than those in extracts from coriander and parsley, both of which belong to Apiaceae family. Extracts of leaves from these herbs showed more quantity of total phenols and higher antioxidant activities than extracts from stem parts, however both leaves and stems of these three herbs grown in Saudi Arabia contained good quantities of total phenols (>1.02 mgGAE/100 mL) and showed more than 18.3% free radical scavenging activity. (author)

  17. Hydroalcoholic extract of Carum carvi L. in oral mucositis: a clinical trial in male golden hamsters.

    Science.gov (United States)

    Mardani, M; Afra, S M; Tanideh, N; Tadbir, A Andisheh; Modarresi, F; Koohi-Hosseinabadi, O; Iraji, A; Sepehrimanesh, M

    2016-01-01

    Several studies have attempted to prevent or improve oral mucositis (OM) but have not produced a qualified treatment yet. This study evaluates the effects of Carum carvi L. (caraway) hydroalcoholic extract (CHE) as one of the traditional medicinal plants in 5-fluorouracil (5-FU)-induced OM in golden hamsters. OM was induced in 54 male golden hamsters by 5-FU and cheek pouch scratching. Starting from day 12, 500 and 1000 mg kg(-1) per day topical CHE were administered. Pouch histopathology score, malondialdehyde and reduced glutathione contents, and activity of myeloperoxidase plus microbial cultures of cheek pouch, antimicrobial properties of CHE, and essential oil constituents were evaluated. Lower histopathology score (0, 1, and 2) and malondialdehyde level, higher reduced glutathione level and activities of myeloperoxidase were detected in 1000 and 500 mg kg(-1) per day topical CHE and control groups, respectively (P epidermidis and Streptococcus intermedius. γ-Terpinene (37.2%) was identified as the main constituent of essential oil. The use of CHE in topical form may be associated with reduced intensity of OM. This may be due to appropriate antibacterial activity and terpinene contents. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  18. Fruit quality, anthocyanin and total phenolic contents, and antioxidant activities of 45 blueberry cultivars grown in Suwon, Korea

    OpenAIRE

    Kim, Jin Gook; Kim, Hong Lim; Kim, Su Jin; Park, Kyo-Sun

    2013-01-01

    Blueberry fruits from 45 commercial cultivars (39 northern highbush and 6 half highbush blueberry) grown in Suwon, Korea were analyzed for fruit size, soluble solids content, titratable acidity, total anthocyanin content, total phenolic content, and antioxidant activity. Fruit characteristics varied widely among the 45 blueberry cultivars. Fruit weight ranged from 0.9 to 3.6 g, soluble solids content from 8.3 to 14.3 °Brix, and titratable acidity from 0.8% to 3.6%. Antioxidant activity ranged...

  19. Overview of total beta activity index and beta rest in surface waters of the Spanish rivers

    International Nuclear Information System (INIS)

    Pujol, L.; Payeras, J.; Pablo, M. A. de

    2013-01-01

    This work aims to give an overview of the index of total beta activity and the activity index beta rest in surface waters of the main Spanish rivers. These indices are a parameter over water quality that CEDEX comes determined by order of the Ministry of Agriculture, Food and Environment, in water policy. (Author)

  20. Mineral Composition, Total Phenol Content and Antioxidant Activity of a Macrolichen Everniastrum cirrhatum (Fr. Hale (Parmeliaceae

    Directory of Open Access Journals (Sweden)

    T. R. Prashith Kekuda

    2011-01-01

    Full Text Available In the present study, we investigated for the first time mineral composition, total phenol content and antioxidant activity of a foliose macrolichen Everniastrum cirrhatum (Fr. Hale (Parmeliaceae from Bhadra wildlife sanctuary, Karnataka, India. Mineral content of the lichen was estimated by Atomic absorption spectrophotometer after acid digestion. The secondary metabolites were detected by thin layer chromatography (TLC and phytochemical assays. The lichen material was extracted with methanol in soxhlet apparatus. Total phenol content was estimated by folin ciocalteu method. Antioxidant activity was determined by DPPH, Ferric reducing and metal chelating assays. Among the principal elements, calcium was found in high concentration followed by magnesium, potassium and phosphorus. Among trace elements, iron was detected in high amount followed by zinc, manganese and copper. The DPPH radical scavenging activity was found to be dose dependent with an IC50 of 6.73 μg/mL. In ferric reducing assay, the absorbance increased with the concentration of extract suggesting reducing power. The extract exhibited good metal chelating activity with an IC50 value of 29.28 μg/mL. Total phenol content was 101.2 mg tannic acid equivalents per gram of extract. Phytochemical analysis revealed the presence of alkaloids, saponins, tannins and terpenoids. TLC revealed atranorin, salazinic acid and protolichesterinic acid. The lichen can be consumed as a source of minerals required for the body as appreciable amount of minerals has been detected. The marked antioxidant activity may be attributed to the presence of phenol content in the extract. Further studies on isolation of metabolites and their bioactivities are under investigation.

  1. Impact of Osteoarthritis on Household Catastrophic Health Expenditures in Korea.

    Science.gov (United States)

    Kim, Hyoungyoung; Cho, Soo-Kyung; Kim, Daehyun; Kim, Dalho; Jung, Sun-Young; Jang, Eun Jin; Sung, Yoon-Kyoung

    2018-05-21

    Osteoarthritis (OA) is a disease of old age whose prevalence is increasing. This study explored the impact of OA on household catastrophic health expenditure (CHE) in Korea. We used data on 5,200 households from the Korea Health Panel Survey in 2013 and estimated annual living expenses and out-of-pocket (OOP) payments. Household CHE was defined when a household's total OOP health payments exceeded 10%, 20%, 30%, or 40% of the household's capacity to pay. To compare the OOP payments of households with OA individuals and those without OA, OA households were matched 1:1 with households containing a member with other chronic disease such as neoplasm, hypertension, heart disease, cerebrovascular disease, diabetes, or osteoporosis. The impact of OA on CHE was determined by multivariable logistic analysis. A total of 1,289 households were included, and households with and without OA patients paid mean annual OOP payments of $2,789 and $2,607, respectively. The prevalence of household CHE at thresholds of 10%, 20%, 30%, and 40% were higher in households with OA patients than in those without OA patients ( P < 0.001). The presence of OA patients in each household contributed significantly to CHE at thresholds of 10% (odds ratio [OR], 1.48; 95% confidence interval [CI], 1.16-1.87), 20% (OR, 1.29; 95% CI, 1.01-1.66), and 30% (OR, 1.37; 95% CI, 1.05-1.78), but not of 40% (OR, 1.17; 95% CI, 0.87-1.57). The presence of OA patients in Korean households is significantly related to CHE. Policy makers should try to reduce OOP payments in households with OA patients.

  2. Changes in body chemical composition with age measured by total-body neutron activation

    International Nuclear Information System (INIS)

    Cohn, S.H.; Vaswani, A.; Zanzi, I.; Aloia, J.F.; Roginsky, M.S.; Ellis, K.J.

    1976-01-01

    Total-body levels of calcium and phosphorus (reflecting skeletal mass) and total-body levels of potassium (reflecting muscle mass) were measured by neutron activation analysis in 39 men and 40 women ages 30 to 90 yr. In order to intercompare the total body calcium (TBCa) values in a heterogeneous population, such as this, it was necessary to normalize the data for skeletal size. The normalization consisted of dividing the absolute calcium level by the predicted calcium level for each individual matched to a set of critical parameters. The parameter used in the computation of normal values were age, sex, muscle mass, i.e., total body potassium (TBK) and height. For the calcium data of the women, it was necessary to add an age correction factor after the age of 55 yr. The calcium ratio (mean ratio of the predicted to measured TBCa) in men was 1.000 +- 7.8 percent and in women 0.996 +- 7.1 percent. The TBCa of normal males and females can thus be predicted to +-13 percent (at the 90 percent confidence level). An exception to this was found in males (70 to 90 yr) who exhibited a mean calcium ratio greater than 1.13

  3. Fluctuations in phenolic content, ascorbic acid and total carotenoids and antioxidant activity of fruit beverages during storage

    Directory of Open Access Journals (Sweden)

    C. Castro-López

    2016-09-01

    Full Text Available Stability of the total phenolic content, ascorbic acid, total carotenoids and antioxidant activity in eight fruit beverages was analyzed. The influence of storage temperature (4, 8 and 11 °C during the product shelf-life (20 days was evaluated. Pomegranate Juice presented the highest values for antioxidant activity by DPPH·− assay (552.93 ± 6.00 GAE μg mL−1, total carotenoids (3.18 ± 0.11 βCE μg mL−1, and total phenolic content (3967.07 ± 2.47 GAE μg mL−1; while Splash Blend recorded the highest levels of ascorbic acid (607.39 ± 2.13 AAE μg mL−1. The antioxidant capacity was stable at 4 and 8 °C for the first 8 days of storage; while carotenoids and ascorbic acid were slightly degraded through the storage time, possibly due to oxidation and/or reactions with other compounds. The results suggest that the observed variation during testing could be related to storage conditions of the final product.

  4. Duration and frequency of every day activities in total hip patients.

    Science.gov (United States)

    Morlock, M; Schneider, E; Bluhm, A; Vollmer, M; Bergmann, G; Müller, V; Honl, M

    2001-07-01

    Little knowledge about frequency and duration of daily activities in patients after total hip arthroplasty is available. Such information is required for the definition of realistic load collectives for pre-clinical testing of prostheses. It could also be helpful for the quantitative evaluation of surgery outcome with different prosthesis types. The purpose of this study was to develop and apply a system for the determination of frequency and duration of patient activities in their habitual environment and to compare the results to a clinical outcome score (Harris hip score).A portable activity monitoring system (weight 1.6 kg including batteries) was designed using a Palm top computer, 2 inclination sensors for the thigh and calf and one goniometer positioned at the knee joint. An algorithm was developed to identify frequency and duration of the activities lying, sitting, standing, walking and stair climbing from the signals of the 3 sensors. 42 patients participated in the study and were equipped with the system in the morning at their home. Datasets of 31 patients (age 62.5+/-11.5 y) covered more than 6h (9.8 +/- 1.6 h) and were included in the analysis. Prosthesis specific data as well as the Harris hip score were collected. The most frequent patient activity was sitting (44.3% of the time), followed by standing (24.5%), walking (10.2%), lying (5.8%) and stair climbing (0.4%). The median number of steps/stairs was 6048/164. The number of step cycles representing one year in vivo use should, consequently, be increased to 1.1 million. The Harris hip score (91.4 +/- 9.8) correlated significantly with the number of stairs (r(2) = 0.26, p = 0.003) and showed a positive tendency with the number of steps per day. No differences in activity levels between prosthesis specific factors were found.

  5. The relationship between total cholinesterase activity and mortality in four butterfly species

    Science.gov (United States)

    Bargar, Timothy A.

    2012-01-01

    The relationship between total cholinesterase activity (TChE) and mortality in four butterfly species (great southern white [Ascia monuste], common buckeye [Junonia coenia], painted lady [Vanessa cardui], and julia butterflies [Dryas julia]) was investigated. Acute contact toxicity studies were conducted to evaluate the response (median lethal dose [LD50] and TChE) of the four species following exposure to the organophosphate insecticide naled. The LD50 for these butterflies ranged from 2.3 to 7.6 μg/g. The average level of TChE inhibition associated with significant mortality ranged from 26 to 67%, depending on the species. The lower bounds of normal TChE activity (2 standard deviations less than the average TChE for reference butterflies) ranged from 8.4 to 12.3 μM/min/g. As a percentage of the average reference TChE activity for the respective species, the lower bounds were similar to the inhibition levels associated with significant mortality, indicating there was little difference between the dose resulting in significant TChE inhibition and that resulting in mortality.

  6. Bat species richness and activity over an elevation gradient in mediterranean shrublands of Crete

    Directory of Open Access Journals (Sweden)

    Panagiotis Georgiakakis

    2010-08-01

    Full Text Available Abstract
    The effect of elevation on bat species richness and activity was investigated in shrublands of central Crete (Greece using broad-band acoustic surveys. Recordings of echolocation calls were made in 15 transects equally distributed in three distinct elevation zones (500, 1000 and 1500 m a.s.l. during spring and autumn 2007-2008. Time-expanded calls were subsequently identified with the use of quadratic discriminant functions.
    Out of 13 species recorded, Hypsugo savii, Pipistrellus kuhlii and Tadarida teniotis were the most common and abundant. Many Rhinolophus hipposideros were also recorded in all elevation zones. Thirteen species were recorded in the lower elevation zone, 7 species in the mid one and 8 species in the 1500 m a.s.l. sites. Species richness, the number of bat passes of the most abundant species, as well as the total number of bat passes were not significantly affected by elevation. In spring both species richness and bat activity were higher than in autumn, although the corresponding difference in temperature was not significant.
    The high variability in both bat activity and the number of species found per transect in each elevation zone probably depended on the presence of other habitat types in the close vicinity, while roost availability and location might also have played an important role.
    We suggest that the ability of bats to perform regular movements along the elevational gradient has to be taken in account when assessing elevational patterns in bat diversity and activity. The geology of the study area is also of considerable importance through its effect on foraging and roosting opportunities for bats.

    Riassunto
    Ricchezza specifica e attività dei chirotteri lungo un gradiente altitudinale nella macchia mediterranea di Creta
    L’effetto della quota su ricchezza in specie e

  7. Warming and organic matter sources impact the proportion of dissolved to total activities in marine extracellular enzymatic rates

    KAUST Repository

    Baltar, Federico

    2017-04-19

    Extracellular enzymatic activities (EEAs) are the rate-limiting step in the degradation of organic matter. Extracellular enzymes can be found associated to cells or dissolved in the surrounding water. The proportion of cell-free EEA constitutes in many marine environments more than half of the total activity. This high proportion causes an uncoupling between hydrolysis rates and the actual bacterial activity. However, we do not know what factors control the proportion of dissolved relative to total EEA, nor how this may change in the future ocean. To resolve this, we performed laboratory experiments with water from the Great Barrier Reef (Australia) to study the effects of temperature and dissolved organic matter sources on EEA and the proportion of dissolved EEA. We found that warming increases the rates of organic matter hydrolysis and reduces the proportion of dissolved relative to total EEA. This suggests a potential increase of the coupling between organic matter hydrolysis and heterotrophic activities with increasing ocean temperatures, although strongly dependent on the organic matter substrates available. Our study suggests that local differences in the organic matter composition in tropical coastal ecosystems will strongly affect the proportion of dissolved EEA in response to ocean warming.

  8. Squilibri finanziari, cambio del dollaro e politica monetaria internazionale. (Financial imbalances, the dollar exchange rate and international monetary policy.

    Directory of Open Access Journals (Sweden)

    R. TRIFFIN

    2013-12-01

    Full Text Available L'aumento continuo e spettacolare del dollaro sul mercato globale dei cambi, nonostante l'altrettanto spettacolare disavanzo delle partite correnti della bilancia dei pagamenti, è una cosa che nessun economista avrebbe sognato . Tutti saranno d'accordo che la risposta al puzzle sta nel fatto che le operazioni in conto corrente costituiscono ormai solo una piccola parte dei movimenti valutari lordi,  dominata di fattop da movimenti di capitali. Ciò che deve essere spiegato  allora è l'enorme volume di capitale netto totale che finanzia il deficit. Il presente lavoro considera questo paradosso, il ruolo del dollaro nel sistema monetario mondiale e le prospettive a medio e lungo termine per il sistema finanziario mondiale.The continuous and spectacular rise of the dollar on the global foreign exchange market, despite the equally spectacular current account deficit of the U.S. balance of payments, is something that no economist would have dreamed to be possible. Everyone will agree that the answer to the puzzle lies in the fact that the transactions in the current account now constitute only a small part of the gross currency movements, in fact dominated by capital movements. What needs to be explained then is the sheer volume of the total net capital that finances the deficit. The present work considers this paradox, the dollar’s role in the world monetary system and medium and long-term perspectives for the world financial system.JEL: E52, F31, E42,

  9. Measurement of activated rCBF by the 133Xe inhalation technique: a comparison of total versus partial curve analysis

    International Nuclear Information System (INIS)

    Leli, D.A.; Katholi, C.R.; Hazelrig, J.B.; Falgout, J.C.; Hannay, H.J.; Wilson, E.M.; Wills, E.L.; Halsey, J.H. Jr.

    1985-01-01

    An initial assessment of the differential sensitivity of total versus partial curve analysis in estimating task related focal changes in cortical blood flow measured by the 133 Xe inhalation technique was accomplished by comparing the patterns during the performance of two sensorimotor tasks by normal subjects. The validity of these patterns was evaluated by comparing them to the activation patterns expected from activation studies with the intra-arterial technique and the patterns expected from neuropsychological research literature. Subjects were 10 young adult nonsmoking healthy male volunteers. They were administered two tasks having identical sensory and cognitive components but different response requirements (oral versus manual). The regional activation patterns produced by the tasks varied with the method of curve analysis. The activation produced by the two tasks was very similar to that predicted from the research literature only for total curve analysis. To the extent that the predictions are correct, these data suggest that the 133 Xe inhalation technique is more sensitive to regional flow changes when flow parameters are estimated from the total head curve. The utility of the total head curve analysis will be strengthened if similar sensitivity is demonstrated in future studies assessing normal subjects and patients with neurological and psychiatric disorders

  10. Antiproliferative activity in tumor cell lines, antioxidant capacity and total phenolic, flavonoid and tannin contents of Myrciaria floribunda

    Directory of Open Access Journals (Sweden)

    LUIS A.C. TIETBOHL

    Full Text Available ABSTRACT Myrciaria floribunda (H. West ex Willd. O. Berg, Myrtaceae, is a native plant species of the Atlantic Rain Forest, from north to south of Brazil. The lyophilized ethyl acetate extract from the leaves of M. floribunda was investigated for its antiproliferative activity in tumor cell lines, antioxidant capacity and its total phenolic, flavonoid and tannin contents. Antiproliferative activity was tested in vitro against seven human cancer cells and against immortalized human skin keratinocytes line (HaCat, no cancer cell. Antioxidant activity was determined using 1-diphenyl-2-picrylhydrazyl (DPPH radical scavenging and oxygen radical absorbing capacity (ORAC assays and total phenolic, flavonoid and tannin contents were determined by spectrophotometric techniques. Ethyl acetate extract of M. floribunda exhibited antiproliferative activity against cancer cell lines with total growth inhibition (TGI between 69.70 and 172.10 µg/mL. For HaCat cell, TGI value was 213.60 µg/mL. M. floribunda showed a strong antioxidant potential: EC50 of 45.89±0.42 µg/mL and 0.55±0.05 mmol TE/g for DPPH and ORAC, respectively. Total phenolic content was 0.23±0.013g gallic acid equivalents (GAE/g extract and exhibited 13.10±1.60% of tannins content. The content of flavonoid was 24.08±0.44% expressed as rutin equivalents. These results provide a direction for further researches about the antitumoral potential of M. floribunda.

  11. Possible mechanisms for sensitivity to organophosphorus and carbamate insecticides in eastern screech-owls and American kestrels

    Science.gov (United States)

    Vyas, N.B.; Thiele, L.A.; Garland, S.C.

    1998-01-01

    Effects of a single dietary exposure to fenthion and carbofuran on the survival, feeding behavior and brain ChE activity of eastern screech-owls, Otus asio and American kestrels, Falco sparverius, were evaluated. Birds were exposed to fenthion (23.6–189.0 ppm) or carbofuran (31.7–253.6 ppm) via meatballs. Carbofuran-exposed owls ate either ≤10% or ≥80% of the meatball whereas all kestrels ate ≤10% of the meatball before exhibiting acute signs of toxicity. Fenthion-exposed owls and kestrels displayed a wide spectrum of meatball consumption (<10–100%). Significant brain ChE inhibition was observed in dead and surviving kestrels exposed to fenthion and carbofuran and dead owls exposed to fenthion (P<0.0001). Brain ChE activity of owls exposed to carbofuran that survived was not different from that of controls (P=0.25). Data suggest: (1) slow feeding on a carbamate-contaminated item may provide limited protection from the toxicity of the chemical at certain rates of exposure; (2) the degree of ChE inhibition at neuromuscular junctions may be critical in determining the sensitivity of a species to a carbamate insecticide; (3) sensitivity may be a function of the ChE affinity for the carbamate inhibitor; and (4) the importance of neuromuscular junction ChE depression in determining the sensitivity of an animal may be species-specific.

  12. Possible mechanisms for sensitivity to organophosphorus and carbamate insecticides in eastern screech-owls and American kestrels.

    Science.gov (United States)

    Vyas, N B; Thiele, L A; Garland, S C

    1998-07-01

    Effects of a single dietary exposure to fenthion and carbofuran on the survival, feeding behavior and brain ChE activity of eastern screech-owls, Otus asio and American kestrels, Falco sparverius, were evaluated. Birds were exposed to fenthion (23.6-189.0 ppm) or carbofuran (31.7-253.6 ppm) via meatballs. Carbofuran-exposed owls ate either or = 80% of the meatball whereas all kestrels ate meatball before exhibiting acute signs of toxicity. Fenthion-exposed owls and kestrels displayed a wide spectrum of meatball consumption (< 10-100%). Significant brain ChE inhibition was observed in dead and surviving kestrels exposed to fenthion and carbofuran and dead owls exposed to fenthion (P < 0.0001). Brain ChE activity of owls exposed to carbofuran that survived was not different from that of controls (P = 0.25). Data suggest: (1) slow feeding on a carbamate-contaminated item may provide limited protection from the toxicity of the chemical at certain rates of exposure; (2) the degree of ChE inhibition at neuromuscular junctions may be critical in determining the sensitivity of a species to a carbamate insecticide; (3) sensitivity may be a function of the ChE affinity for the carbamate inhibitor; and (4) the importance of neuromuscular junction ChE depression in determining the sensitivity of an animal may be species-specific.

  13. Comparative study of the total phenol content and antioxidant activity of some medicinal herbal extracts

    Directory of Open Access Journals (Sweden)

    H. Hajimehdipoor

    2014-08-01

    Full Text Available Herbal medicines can be used as the potential sources of anti-oxidative compounds to help the treatment of diseases associated to oxidative stress. In this paper, the Ferric Reducing Antioxidant Power (FRAP activity of four Lamiaceae herbal extracts, which traditionally applied in oxidative stress related diseases, has been evaluated and total phenolics contents of these extracts determined by using Folin-Ciocalteu reagent. The aqueous methanol extracts were prepared by percolation method and investigated for antioxidant properties and total phenolics content evaluation. All the extracts showed antioxidant effect from 123.6±4.6 mmol of FeSO4.7H2Oequivalent/100 g dried extract in Scutellaria tornefortii to 551.5±16.0 mmol of FeSO4.7H2Oequivalent/100 g dried extract in Satureja sahendica. Interestingly, although Satureja sahendica exhibited the most antioxidant activity, the highest content of polyphenolics belonged to Stachys byzantina. Taking together, antioxidant activity of the mentioned medicinal plants is not necessarily associated with polyphenolic compounds and might be partially due to the presence of other polar constituents like terpenoid-glycosides in aqueous extracts that traditionally used as decoction.

  14. Black-bellied whistling duck (Dendrocygna autumnalis) brain cholinesterase characterization and diagnosis of anticholinesterase pesticide exposure in wild populations from Mexico.

    Science.gov (United States)

    Osten, Jaime Rendón-von; Soares, Amadeu M V M; Guilhermino, Lucia

    2005-02-01

    Rice is the main crop in the subbasin of the fluvial lagoon system of Palizada River (FLSPR) in the state of Campeche, Mexico. The pesticides used to control pests of this crop mainly are carbofuran, chlorpyrifos, and glyphosate. Black-bellied whistling duck (Dendrocygna autumnalis) is an ecologically and economically important species in the area. This duck is consumed by local inhabitants throughout the year, despite its potential exposure to pesticides. Due to its feeding habits, abundance, and nutritional value, D. autumnalis is a good indicator of environmental contamination and a potential route of human exposure to organophosphate and carbamate pesticides. In this study, the brain cholinesterase (ChE) in the frontal cerebral cortex of autochthonous ducks was characterized. In addition, the potential of the three locally used pesticides and mixtures to inhibit ChE activity was investigated and the exposure of the wild duck population during intensive pesticide applications in rice fields was evaluated. We found that acetylcholinesterase (AChE) seems to be the predominant ChE form in the biological fraction analyzed. Carbofuran was the most potent ChE inhibitor of D. autumnalis brain ChE activity from the three pesticides analyzed. Cholinesterase inhibition after exposure to pesticide mixtures predominantly was due to carbofuran. A decrease (p 30%) was apparent in wild ducks compared to reference ducks, with recovery of ChE inhibition in wild ducks occurring months later when no pesticides were applied in the field. Dendrocygna autumnalis brain ChE is a suitable parameter for inclusion in biomonitoring programs for both environmental protection and human safety.

  15. Effectiveness of Three Different Walking Prescription Durations on Total Physical Activity in Normal- and Overweight Women

    Directory of Open Access Journals (Sweden)

    Yves Schutz

    2014-08-01

    Full Text Available Objective: While there is a dose-response relationship between physical activity (PA and health benefit, little is known about the effectiveness of different PA prescriptions on total daily PA. Aim: To test, under real-life conditions and using an objective, non-invasive measurement technique (accelerometry, the effect of prescribing additional physical activity (walking only of different durations (30, 60 and 90 min/day on compliance (to the activity prescribed and compensation (to total daily PA. Participants in each group were prescribed 5 sessions of walking per week over 4 weeks. Methods: 55 normal-weight and overweight women (mean BMI 25 ± 5 kg/m2, height 165 ± 1 cm, weight 68 ± 2 kg and mean age 27 ± 1 years were randomly assigned to 3 prescription groups: 30, 60 or 90 min/day PA. Results: Walking duration resulted in an almost linear increase in the number of steps per day during the prescription period from an average of about 10,000 steps per day for the 30-min prescription to about 14,000 for the 90-min prescription. Compliance was excellent for the 30-min prescription but decreased significantly with 60-min and 90-min prescriptions. In parallel, degree of compensation subsequent to exercise increased progressively as length of prescription increased. Conclusion: A 30-min prescription of extra walking 5 times per week was well tolerated. However, in order to increase total PA further, much more than 60 min of walking may need to be prescribed in the majority of individuals. While total exercise ‘volume' increased with prescriptions longer than 30 min, compliance to the prescription decreased and greater compensation was evident.

  16. Catastrophic healthcare expenditure and poverty related to out-of-pocket payments for healthcare in Bangladesh-an estimation of financial risk protection of universal health coverage.

    Science.gov (United States)

    Khan, Jahangir A M; Ahmed, Sayem; Evans, Timothy G

    2017-10-01

    The Sustainable Development Goals target to achieve Universal Health Coverage (UHC), including financial risk protection (FRP) among other dimensions. There are four indicators of FRP, namely incidence of catastrophic health expenditure (CHE), mean positive catastrophic overshoot, incidence of impoverishment and increase in the depth of poverty occur for high out-of-pocket (OOP) healthcare spending. OOP spending is the major payment strategy for healthcare in most low-and-middle-income countries, such as Bangladesh. Large and unpredictable health payments can expose households to substantial financial risk and, at their most extreme, can result in poverty. The aim of this study was to estimate the impact of OOP spending on CHE and poverty, i.e. status of FRP for UHC in Bangladesh. A nationally representative Household Income and Expenditure Survey 2010 was used to determine household consumption expenditure and health-related spending in the last 30 days. Mean CHE headcount and its concentration indices (CI) were calculated. The propensity of facing CHE for households was predicted by demographic and socioeconomic characteristics. The poverty headcount was estimated using 'total household consumption expenditure' and such expenditure without OOP payments for health in comparison with the poverty-line measured by cost of basic need. In absolute values, a pro-rich distribution of OOP payment for healthcare was found in urban and rural Bangladesh. At the 10%-threshold level, in total 14.2% of households faced CHE with 1.9% overshoot. 16.5% of the poorest and 9.2% of the richest households faced CHE. An overall pro-poor distribution was found for CHE (CI = -0.064) in both urban and rural households, while the former had higher CHE incidences. The poverty headcount increased by 3.5% (5.1 million individuals) due to OOP payments. Reliance on OOP payments for healthcare in Bangladesh should be reduced for poverty alleviation in urban and rural Bangladesh in order to

  17. Fruit quality, anthocyanin and total phenolic contents, and antioxidant activities of 45 blueberry cultivars grown in Suwon, Korea.

    Science.gov (United States)

    Kim, Jin Gook; Kim, Hong Lim; Kim, Su Jin; Park, Kyo-Sun

    2013-09-01

    Blueberry fruits from 45 commercial cultivars (39 northern highbush and 6 half highbush blueberry) grown in Suwon, Korea were analyzed for fruit size, soluble solids content, titratable acidity, total anthocyanin content, total phenolic content, and antioxidant activity. Fruit characteristics varied widely among the 45 blueberry cultivars. Fruit weight ranged from 0.9 to 3.6 g, soluble solids content from 8.3 to 14.3 °Brix, and titratable acidity from 0.8% to 3.6%. Antioxidant activity ranged from 0.7 to 2.1 mg of quercetin equivalents per gram of fresh berries in different blueberry cultivars. Among the 45 blueberry cultivars, high amounts of anthocyanins and polyphenols, and high antioxidant activity were observed in 'Elliott', 'Rubel', 'Rancocas', and 'Friendship'.

  18. Early decrease in total hemolytic complement activity (CH100) after fasting or intestinal bypass in the rat.

    Science.gov (United States)

    Montanari, M; Violi, V; Muri, M; Roncoroni, L; Mora, G; Ronzoni, M

    1986-01-01

    An evaluation of total hemolytic complement activity (CH100) after fasting or intestinal bypass was performed in rats. The experiment lasted 6 days. Three groups, of 5 animals each, were studied. On the 1st day, basal values of total complement (TC), albumin and body weight were determined. Group A received normal, ad libitum feeding, group B started on a 'water only' diet, group C underwent intestinal bypass. On the 4th and 6th day the parameters were assessed. TC mean values were significantly lower in groups B and C, as compared to group A, on the 4th as well as on the 6th day (p less than 0.01 by Mann-Whitney's U test). Body weight showed a similar trend. Differences in albumin were never statistically significant. Limitations of the analytical method are discussed. The data show that fasting or bypass-induced malabsorption may determine an early decrease in total hemolytic complement activity, though a development of an immune deficiency is not proved.

  19. Effect of Cistanches Herba Aqueous Extract on Bone Loss in Ovariectomized Rat

    Directory of Open Access Journals (Sweden)

    Zaiguo Huang

    2011-08-01

    Full Text Available To assess the ability of traditional Chinese medicine Cistanches Herba extract (CHE to prevent bone loss in the ovariectomized (OVX rat, Cistanches Herba extract (CHE was administered intragastrically to the rats. Female rats were anesthetized with pentobarbital sodium (40 mg kg−1, i.p., and their ovaries were removed bilaterally. The rats in the sham-operated group were anesthetized, laparotomized, and sutured without removing their ovaries. After 1 week of recovery from surgery, the OVX rats were randomly divided into three groups and orally treated with H2O (OVX group or CHE (100 or 200 mg kg−1 daily for 3 months. The sham-operated group (n = 8 was orally treated with H2O. After 3 months, the total body bone mineral density (BMD, bone mineral content (BMC, Bone biomechanical index, blood mineral levels and blood antioxidant enzymes activities were examined in sham-operated, ovariectomized and Cistanches Herba extract treated rats. Results showed that Cistanches Herba extract treatment significantly dose-dependently enhanced bone mineral density (BMD, bone mineral content (BMC, maximum load, displacement at maximum load, stress at maximum load, load at auto break, displacement at auto break, and stress at auto break, and blood antioxidant enzymes activities, decreased blood Ca, Zn and Cu levels compared to the OVX group. This experiment demonstrates that the administration of Cistanches Herba extract to ovariectomized rats reverses bone loss and prevents osteoporosis.

  20. Effects of temperature and fertilization on total vs. active bacterial communities exposed to crude and diesel oil pollution in NW Mediterranean Sea

    Energy Technology Data Exchange (ETDEWEB)

    Rodriguez-Blanco, Arturo; Antoine, Virginie [UPMC Univ Paris 06, UMR 7621, Laboratoire ARAGO, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France); CNRS, UMR 7621, Laboratoire d' Oceanographie Biologique de Banyuls, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France); Pelletier, Emilien [Institut des Sciences de la Mer de Rimouski (ISMER), Universite du Quebec a Rimouski, 310 allee des Ursulines, Rimouski, Canada G5L 3A1 (Canada); Delille, Daniel [UPMC Univ Paris 06, UMR 7621, Laboratoire ARAGO, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France); CNRS, UMR 7621, Laboratoire d' Oceanographie Biologique de Banyuls, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France); Ghiglione, Jean-Francois, E-mail: ghiglione@obs-banyuls.f [UPMC Univ Paris 06, UMR 7621, Laboratoire ARAGO, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France); CNRS, UMR 7621, Laboratoire d' Oceanographie Biologique de Banyuls, Avenue Fontaule, BP44, F-66650 Banyuls-sur-Mer (France)

    2010-03-15

    The dynamics of total and active microbial communities were studied in seawater microcosms amended with crude or diesel oil at different temperatures (25, 10 and 4 deg. C) in the presence/absence of organic fertilization (Inipol EAP 22). Total and hydrocarbon-degrading microbes were enumerated by fluorescence microscopy and Most Probable Number (MPN) method, respectively. Total (16S rDNA-based) vs. active (16S rRNA) bacterial community structure was monitored by Capillary-Electrophoresis Single Strand Conformation Polymorphism (CE-SSCP) fingerprinting. Hydrocarbons were analyzed after 12 weeks of incubation by gas chromatography-mass spectrometry. Total and hydrocarbon-degrading microbial counts were highly influenced by fertilization while no important differences were observed between temperatures. Higher biodegradation levels were observed in fertilized microcosms. Temperature and fertilization induced changes in structure of total bacterial communities. However, fertilization showed a more important effect on active bacterial structure. The calculation of Simpson's diversity index showed similar trends among temperatures whereas fertilization reduced diversity index of both total and active bacterial communities. - Nutrient availability was the most important factor influencing microbial oil biodegradation in coastal waters of the North-western Mediterranean Sea.

  1. In vitro callus culture of Heliotropium indicum Linn. for assessment of total phenolic and flavonoid content and antioxidant activity.

    Science.gov (United States)

    Kumar, Muthusamy Senthil; Chaudhury, Shibani; Balachandran, Srinivasan

    2014-12-01

    The total phenolic and flavonoid content and percentage of 2,2-diphenyl-1-picrylhydrazyl (DPPH) radical scavenging activity of callus and in vivo plant parts of Heliotropium indicum Linn. were estimated. Murashige and Skoog (MS) basal medium supplemented with α-naphthaleneacetic acid (NAA) 2.0 mg/l with benzyladenine (BA) 0.5 mg/l showed the highest amount of callus biomass (1.87 g/tube). The morphology of callus was significantly different according to the plant growth regulators and their concentrations used in the medium. The highest amount of total phenolic (21.70 mg gallic acid equivalent per gram (GAE/g)) and flavonoid (4.90 mg quercetin equivalent per gram (QE/g)) content and the maximum percentage (77.78 %) of radical scavenging activity were estimated in the extract of inflorescence. The synergistic effect of NAA (2.0 mg/l) and BA (0.5 mg/l) enhances the synthesis of total phenolic (9.20 mg GAE/g) and flavonoid (1.25 mg QE/g) content in the callus tissue. The callus produced by the same concentration shows 45.24 % of free radical scavenging activity. While comparing the various concentrations of NAA with 2,4-dichlorophenoxyacetic acid (2,4-D) for the production of callus biomass, total phenolic and flavonoid content and free radical scavenging activity, all the concentrations of NAA were found to be superior than those of 2,4-D.

  2. The Effect of Tallow As Lipase Inducer on Total of Aspergillus Niger, Lipolitic Activity and Lipase Yield

    Directory of Open Access Journals (Sweden)

    Manik Eirry Sawitri

    2012-02-01

    Full Text Available The objectives of this research was to determined of tallow addition with different concentration as lipase Aspergillus niger inducer to total of A. niger, lipolitic activity and lipase yield. The result showed that tallow addition as inducer in the lipase A. niger production gave no significant effect on total of A. niger (5.3 x 107 – 1.7 x 108 cfu/gram in the medium. Tallow addition gave a highly significant effect on lipolytic activity and yield of lipase A. niger. Lipolytic activity ranged between 32.0354 – 53.1197 U/mg protein, while the yield of lipase was 6.6418–7.8941 µg/ml. The conclusion of this research was the addition of tallow for 8% as the lipase inducer of A. niger on lipase production was  more effective to obtain the optimal result. Keywords : Tallow, lipase, inducer, Aspergillus niger

  3. Evaluation of Postprandial Total Antioxidant Activity in Normal and Overweight Individuals

    Directory of Open Access Journals (Sweden)

    Fatma Arslan

    2016-09-01

    Full Text Available Aim: Postprandial changes acutely alter some mechanisms in body. There are many studies showing blood oxidative status changes after food intake, and supplementation. The aim of the present study was to evaluate the effects of a standardized meal on serum total antioxidant activity (TAA in normal weight and overweight individuals. Material and Method: Fourteen normal weight and twelve overweight individuals were given a standardized meal in the morning after an overnight fast. Serum TAA, glucose, total cholesterol, HDL cholesterol, LDL cholesterol, and triglyceride concentrations were measured at baseline, 3rd hour, and 6th hour after the meal in both groups.Results: In both normal and overweight groups, the difference between baseline and 3rd hour was significant for TAA. The TAA of the overweight group was also significantly lower than the TAA of the normal weight group at 3rd hour. However, there was no significant correlation between lipid parameters and TAA levels. Discussion: The present study shows that postprandial oxidative damage occurs more prominently in overweight individuals than in normal weight individuals. Postprandial changes acutely induce oxidative stress and impair the natural antioxidant defense mechanism. It should be noted that consuming foods with antioxidants in order to avoid various diseases and complications is useful, particularly in obese subjects.

  4. Biochemical and locomotor responses of Carcinus maenas exposed to the serotonin reuptake inhibitor fluoxetine.

    Science.gov (United States)

    Mesquita, Sofia Raquel; Guilhermino, Lúcia; Guimarães, Laura

    2011-10-01

    The aim of this study was to assess the effects of the widely used anti-depressant fluoxetine on behaviour (locomotion), moulting, neuromuscular transmission, energy production and anti-oxidant defences' efficiency of the epibenthic crab Carcinus maenas. Crabs were individually exposed to fluoxetine concentrations for 7d. Effects on locomotion were assessed at the end of the exposure using an open field test adapted to C. maenas in the present study. Tissue samples were later collected to evaluate fluoxetine effects on physiological functions using the activity of key enzymes and other parameters as biomarkers, namely: N-acetyl-β-glucosaminidase (NAGase) in the epidermis (moulting) and the hepatopancreas; cholinesterases (ChE) in muscle (neuromuscular cholinergic transmission); NADP(+)-dependent isocitrate dehydrogenase (IDH) and lactate dehydrogenease (LDH) in muscle (energy production); glutathione S-transferases (GST) in hepatopancreas (biotransformation and oxidative stress system); glutathione reductase (GR), and glutathione peroxidade (GPx), total glutathione levels (TG) and lipid peroxidation levels in the hepatopancreas (anti-oxidant defences and oxidative damage). Because no information on C. maenas NAGase activity was previously available, its variation during the moult cycle was also investigated. The results showed that locomotion was significantly increased at fluoxetine concentrations equal or above 120 μg L⁻¹, with animals spending more time moving, walking longer distances than controls. Levels of NAGase activity were found to vary in relation to C. maenas moult cycle, but no alterations were observed after exposure to fluoxetine. Significant increases in the activity of ChE, GST and GR enzymes, and the levels of TG were found, with a lowest observed effect concentration (LOEC) of 120 μg L⁻¹. Effects on locomotion were significantly and positively correlated to those induced on ChE activity. The results raise concern when hypothesising

  5. Total phenolic contents and free-radical scavenging activities of grape (Vitis vinifera L.) and grape products.

    Science.gov (United States)

    Keser, Serhat; Celik, Sait; Turkoglu, Semra

    2013-03-01

    Grape is one of the world's largest fruit crops, with an approximate annual production of 58 million metric tons, and it is well known that the grape skins, seeds and stems, waste products generated during wine and grape juice processing, are rich sources of polyphenols. It contains flavonoids, phenolic acids and stilbenes. In this study, we tried to determine antioxidant properties and phenolic contents of grape and grape products (fresh fruit, seed, dried fruit, molasses, pestil, vinegar) of ethanol and water extracts. Antioxidant properties of extracts were investigated by DPPH(√), ABTS(√+), superoxide, H(2)O(2) scavenging, reducing power, metal chelating activity and determination of total phenolic contents. The seed extracts revealed highest ABTS(√+), DPPH(√), H(2)O(2) scavenging and reducing power activities. Furthermore, these extracts showed higher total phenolic contents than other grape product extracts.

  6. Acute Exercise Increases Plasma Total Antioxidant Status and Antioxidant Enzyme Activities in Untrained Men

    Directory of Open Access Journals (Sweden)

    C. Berzosa

    2011-01-01

    Full Text Available Antioxidant defences are essential for cellular redox regulation. Since free-radical production may be enhanced by physical activity, herein, we evaluated the effect of acute exercise on total antioxidant status (TAS and the plasma activities of catalase, glutathione reductase, glutathione peroxidase, and superoxide dismutase and its possible relation to oxidative stress resulting from exercise. Healthy untrained male subjects (=34 performed three cycloergometric tests, including maximal and submaximal episodes. Venous blood samples were collected before and immediately after each different exercise. TAS and enzyme activities were assessed by spectrophotometry. An increase of the antioxidant enzyme activities in plasma was detected after both maximal and submaximal exercise periods. Moreover, under our experimental conditions, exercise also led to an augmentation of TAS levels. These findings are consistent with the idea that acute exercise may play a beneficial role because of its ability to increase antioxidant defense mechanisms through a redox sensitive pathway.

  7. A study on the total phenols content and antioxidant activity of essential oil and different solvent extracts of endemic plant Merremia borneensis

    Directory of Open Access Journals (Sweden)

    M. Amzad Hossain

    2015-01-01

    Full Text Available This study is planned to determine the antioxidant activity and total phenols content of the essential oil and different solvent extracts of the endemic plant Merremia borneensis. The antioxidant activities of the extracts were examined by three different methods, DPPH, β-carotene and reducing power assays. In all methods, aqueous ethanol extract exhibited a higher activity potential than that of other extracts (hexane, chloroform, ethyl acetate and butanol and the essential oil. As assumed, the amount of total phenolics was very high in this extract. Chloroform extract has been found to be rich in flavonoids. A positive result was observed between the antioxidant activity potential and total flavonoid levels of the extracts.

  8. Antioxidant activity and total phenolic content in Red Ginger (Zingiber officinale) based drinks

    Science.gov (United States)

    Widayat; Cahyono, B.; Satriadi, H.; Munfarida, S.

    2018-01-01

    Indonesia is a rich spices country, both as a cooking spice and medicine. One of the most abundant commodities is red ginger, where it still less in application. On the other hand, the level of pollution is higher, so antioxidants are needed to protect the body cells from the bad effects of free radicals. The body can not naturally produce antioxidants as needed, so we need to consume foods with high antioxidant content. The purpose of this study is to know the antioxidant activity and total phenolic content in red ginger (Zingiber officinale) based drinks. Research design with complete randomized design (RAL) with factorial pattern 3 x 3, as the first factor is red ginger extract and water ratio (1: 1, 1: 2 and 1: 3) and second factor is the type of sugar used (cane sugar, palm sugar and mixed sugar). The results of this study indicate that red ginger extract and water ratio of 1: 3 give higher antioxidant. The highest antioxidant obtained in red ginger extract and water ratio of 1: 3 and using mixed sugar. That antioxidants value is 88.56%, it is not significant decreased compared to the antioxidant of pure ginger extract that is 91.46%. For higher phenol total content obtained on syrup that uses palm sugar. The highest phenol total content obtained in red ginger extract and water ratio of 1: 1 and using palm sugar. That total phenol content value is 6299 ppm.

  9. Evaluation of total phenols, total flavonoids and antioxidant activity of the leaves crude extracts of locally grown pigeon pea traditionally used in Sultanate of Oman for the treatment of jaundice and diabetes

    Directory of Open Access Journals (Sweden)

    Asma Hamood Al-Saeedi

    2015-04-01

    Full Text Available Objective: To determine the total phenols, total flavonoids and evaluate the antioxidant activity of crude extracts from the leaves of pigeon pea native to Sultanate of Oman by a popular method. Methods: The powdered leaves samples from pigeon pea were used for extraction by maceration method with methanol solvent. The methanol free crude extract by maceration method was suspended in water and successively extracted with different polarities of solvents. The obtained crude extracts with different polarities were used for the determination of total phenols and flavonoids contents by using Folin-Ciocalteu reagent and aluminum chloride methods. The antioxidant activity of six crude extracts from pigeon pea was determined by α, α-diphenyl-β-picrylhydrazyl method. Results: The different polarities leaves crude extracts showed a significant amount of total phenols content ranging from 97.80 to 256.00 mg of GAE/g of crude extract. The same leaves crude extracts also showed good amount of total flavonoids content ranging from 1.38 to 8.51 mg QE/g plant material. The six crude extracts from the leaves displayed significant α, α- diphenyl-β-picrylhydrazyl free radical scavenging activity with highest value in chloroform extract followed by methanol, butanol, ethyl acetate, hexane and water crude extracts (98.13%, 89.26%, 88.82%, 86.41%, 79.95% and 69.44%, respectively. Conclusions: Leaves crude extracts from pigeon pea have high contents of total phenols and flavonoids. In this regards, it could be used as a medicine for the treatment of different diseases.

  10. Autonomous and professional maintenance in metallurgical enterprise as activities within total productive maintenance

    Directory of Open Access Journals (Sweden)

    B. Gajdzik

    2014-04-01

    Full Text Available The content of this publication consists of notions connected with Total Productive Maintenance (TPM in metallurgical enterprise. The basic areas of devices condition management through Autonomous and Professional Maintenance are described here. Mentioned areas of activities are performed in metallurgical enterprise ArcelorMittal Poland within pillars of World Class Manufacturing (WCM. The aims of UR programs are to maintain the basic functionality of the devices and decrease the number of failures in order to reach improvement of production efficiency.

  11. Antitumor Activity of Total Flavonoids from Daphne genkwa in Colorectal Cancer.

    Science.gov (United States)

    Du, Wen-Juan; Yang, Xiao-Lin; Song, Zi-Jing; Wang, Jiao-Ying; Zhang, Wen-Jun; He, Xin; Zhang, Run-Qi; Zhang, Chun-Feng; Li, Fei; Yu, Chun-Hao; Wang, Chong-Zhi; Yuan, Chun-Su

    2016-02-01

    Daphne genkwa Sieb.et Zucc. is a well-known medicinal plant. This study was designed to investigate the anticancer effects of total flavonoids in D. genkwa (TFDG) in vitro and in vivo. HT-29 and SW-480 human colorectal cancer cells were cultured to investigate the anticancer activity of TFDG. In addition, the Apc(Min/+) mouse model was applied in the in vivo experiment. Results of the cell experiment revealed that TFDG possessed significant inhibitory effects on HT-29 and SW-480 human colorectal cancer cells (both p colon (both p cancer therapeutics, and TFDG's action is likely linked to its ability to regulate immune function and inhibit the production of inflammatory cytokines. Copyright © 2015 John Wiley & Sons, Ltd.

  12. PET quantification with a histogram derived total activity metric: Superior quantitative consistency compared to total lesion glycolysis with absolute or relative SUV thresholds in phantoms and lung cancer patients

    International Nuclear Information System (INIS)

    Burger, Irene A.; Vargas, Hebert Alberto; Apte, Aditya; Beattie, Bradley J.; Humm, John L.; Gonen, Mithat; Larson, Steven M.; Ross Schmidtlein, C.

    2014-01-01

    Introduction: The increasing use of molecular imaging probes as biomarkers in oncology emphasizes the need for robust and stable methods for quantifying tracer uptake in PET imaging. The primary motivation for this research was to find an accurate method to quantify the total tumor uptake. Therefore we developed a histogram-based method to calculate the background subtracted lesion (BSL) activity and validated BSL by comparing the quantitative consistency with the total lesion glycolysis (TLG) in phantom and patient studies. Methods: A thorax phantom and a PET-ACR quality assurance phantom were scanned with increasing FDG concentrations. Volumes of interest (VOIs) were placed over each chamber. TLG was calculated with a fixed threshold at SUV 2.5 (TLG 2.5 ) and a relative threshold at 42% of SUV max (TLG 42% ). The histogram for each VOI was built and BSL was calculated. Comparison with the total injected FDG activity (TIA) was performed using concordance correlation coefficients (CCC) and the slope (a). Fifty consecutive patients with FDG-avid lung tumors were selected under an IRB waiver. TLG 42% , TLG 2.5 and BSL were compared to the reference standard calculating CCC and the slope. Results: In both phantoms, the CCC for lesions with a TIA ≤ 50 ml*SUV between TIA and BSL was higher and the slope closer to 1 (CCC = 0.933, a = 1.189), than for TLG 42% (CCC = 0.350, a = 0.731) or TLG 2.5 (CCC = 0.761, a = 0.727). In 50 lung lesions BSL had a slope closer to 1 compared to the reference activity than TLG 42% (a = 1.084 vs 0.618 – for high activity lesions) and also closer to 1 than TLG 2.5 (a = 1.117 vs 0.548 – for low activity lesions). Conclusion: The histogram based BSL correlated better with TIA in both phantom studies than TLG 2.5 or TLG 42% . Also in lung tumors, the BSL activity is overall more accurate in quantifying the lesion activity compared to the two most commonly applied TLG quantification methods

  13. THE DYNAMICS OF TOTAL AMYLASE\\'S ACTIVITY IN PANICUM MILIACEUM AND SETARIA GLAUCA DURING THE GERMINATION PERIOD

    Directory of Open Access Journals (Sweden)

    Elena Ciornea

    2006-08-01

    Full Text Available : It was studied the dynamics of total amylase\\'s activity in millet (Panicum miliaceum and bristle grass (Setaria glauca during the germination period. The enzymatic activity was determined by the Noelting - Brenfeld method, the results obtained being expressed in M maltose / g. In both millet and bristle grass, it was evidenced that both parameters taken into study (the species and the germination time do influence the enzymatic activity, although to a different extent.

  14. Statistical mixture design selective extraction of compounds with antioxidant activity and total polyphenol content from Trichilia catigua.

    Science.gov (United States)

    Lonni, Audrey Alesandra Stinghen Garcia; Longhini, Renata; Lopes, Gisely Cristiny; de Mello, João Carlos Palazzo; Scarminio, Ieda Spacino

    2012-03-16

    Statistical design mixtures of water, methanol, acetone and ethanol were used to extract material from Trichilia catigua (Meliaceae) barks to study the effects of different solvents and their mixtures on its yield, total polyphenol content and antioxidant activity. The experimental results and their response surface models showed that quaternary mixtures with approximately equal proportions of all four solvents provided the highest yields, total polyphenol contents and antioxidant activities of the crude extracts followed by ternary design mixtures. Principal component and hierarchical clustering analysis of the HPLC-DAD spectra of the chromatographic peaks of 1:1:1:1 water-methanol-acetone-ethanol mixture extracts indicate the presence of cinchonains, gallic acid derivatives, natural polyphenols, flavanoids, catechins, and epicatechins. Copyright © 2011 Elsevier B.V. All rights reserved.

  15. Cadmium-induced changes in pigments, total phenolics, and phenylalanine ammonia-lyase activity in fronds of Azolla imbricata.

    Science.gov (United States)

    Dai, Ling-Peng; Xiong, Zhi-Ting; Huang, Yu; Li, Min-Jing

    2006-10-01

    This study was designed to examine the effects of cadmium on several color-related parameters (including chlorophyll, carotenoid, and anthocyanin), total phenolics, and phenylalanine ammonia-lyase (PAL) activity in an aquatic fern species Azolla imbricate (A. imbricata). Cd accumulation and effects in the fronds were closely related with Cd concentration in the growth medium. The fronds under 0.5 mg/L Cd treatment turned red on the 3rd day, and this color change also appeared under 0.05 and 0.1 mg/L Cd treatment on the 5th day. Correlated with the color change, the contents of chlorophyll and carotenoid in the fronds significantly decreased in the presence of high Cd concentrations, while the anthocyanin content increased during the experiment. Significant increase in total phenolics content and PAL activity were also detected during Cd treatment. The results suggested that the Cd-induced change in color of fronds might be due to the decrease in chlorophyll and carotenoid and the increase in anthocyanin. Anthocyanin, total phenolics and their biosynthesis-related PAL might play a role in detoxification of Cd in A. imbricata.

  16. Catastrophic health expenditure and its determinants in Kenya slum communities.

    Science.gov (United States)

    Buigut, Steven; Ettarh, Remare; Amendah, Djesika D

    2015-05-14

    In Kenya, where 60 to 80% of the urban residents live in informal settlements (frequently referred to as slums), out-of-pocket (OOP) payments account for more than a third of national health expenditures. However, little is known on the extent to which these OOP payments are associated with personal or household financial catastrophe in the slums. This paper seeks to examine the incidence and determinants of catastrophic health expenditure among urban slum communities in Kenya. We use a unique dataset on informal settlement residents in Kenya and various approaches that relate households OOP payments for healthcare to total expenditures adjusted for subsistence, or income. We classified households whose OOP was in excess of a predefined threshold as facing catastrophic health expenditures (CHE), and identified the determinants of CHE using multivariate logistic regression analysis. The results indicate that the proportion of households facing CHE varies widely between 1.52% and 28.38% depending on the method and the threshold used. A core set of variables were found to be key determinants of CHE. The number of working adults in a household and membership in a social safety net appear to reduce the risk of catastrophic expenditure. Conversely, seeking care in a public or private hospital increases the risk of CHE. This study suggests that a substantial proportion of residents of informal settlements in Kenya face CHE and would likely forgo health care they need but cannot afford. Mechanisms that pool risk and cost (insurance) are needed to protect slum residents from CHE and improve equity in health care access and payment.

  17. Effect of growth stages on total phenolics content and antioxidant activity of Fumaria vaillantii L.

    Directory of Open Access Journals (Sweden)

    L. Mehdizadeh*

    2017-11-01

    Full Text Available Background and objectives: Plant extracts and their constituents are known to exert biological effects, especially antioxidant activity. Fumaria vaillantii (Fumariaceae has several therapeutic effects in traditional medicine. Antioxidants are able to protect the human body from oxidative damage connected to the reaction of free radicals. Synthetic antioxidants have toxic and carcinogenic effects on human health; therefore, their application has been limited. Thus, there has been an increasing interest in the natural antioxidant compounds to prevent the foods from deterioration. In this study, the antioxidant activity of F. vaillantii extracts at three stages of growth has been evaluated. Methods: The ethanol extracts from the aerial parts of the plants at different phenological stages were prepared and the total phenolics content was determined by Folin-Ciocalteu reagent. Also, the antioxidant activity were determined by three methods as 2,2-diphenyl-1-picrylhydrazyl (DPPH, ferric-ion reducing antioxidant power (FRAP and phosphomolybdenum complex tests. All experiments were carried out in triplicate, and data were subjected to ANOVA according to the SAS software. Results: Total phenolics content of vegetative, budding and flowering stages were 68.38, 71.11 and 56.42 mg GAE/g extract, respectively. Although flowering stage showed the highest antioxidant activity in phosphomolybdenum complex, in DPPH and FRAP methods, it decreased from vegetative to flowering stages. Conclusion: According to the results, the Iranian F. vaillantii extract from vegetative stage was a potential source of natural antioxidants for food and pharmaceutical industries that can be used in different industries.

  18. Anti-pseudomonas activity of essential oil, total extract, and proanthocyanidins of Pinus eldarica Medw. bark.

    Science.gov (United States)

    Sadeghi, Masoud; Zolfaghari, Behzad; Jahanian-Najafabadi, Ali; Abtahi, Seyed Reza

    2016-01-01

    Pinus eldarica Medw. (Iranian pine) is native to Transcaucasian region and has been vastly planted in Iran, Afghanistan, and Pakistan. Various parts of this plant have been widely used in traditional medicine for the treatment of various diseases including infectious conditions (e.g. infectious wounds). In this study we aimed to investigate the antibacterial activity of P. eldarica bark extract, essential oil and proanthocyanidins on three important bacteria, Staphylococcus aureus, Escherichia coli and Pseudomonas aeruginosa. Antibacterial analysis was performed using standard disk diffusion method with different concentrations of essential oil, bark total hydroalcoholic extract, and bark proanthocyanidins (0.5, 1, 2 and 3 mg/ml). After incubation at 37°C for 24 h, the antibacterial activity was assessed by measuring the zone of growth inhibition surrounding the disks. The results indicated that the essential oil, total hydroalcoholic extract, and proanthocyanidins of the bark of the P. eldarica were effective against the gram negative bacteria, P. aeruginosa, and significantly inhibited its growth in disk diffusion method (Pessential oil had the most potent inhibitory effect. However, none of the bark preparations could significantly inhibit the growth of S. aureus or E. coli. Our findings showed that P. eldarica bark components have significant anti-pseudomonas activity having potentials for new sources of antibacterial agents or antibacterial herbal preparations.

  19. Total 2004 annual report; TOTAL 2004 rapport annuel

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2004-07-01

    This annual report of the Group Total brings information and economic data on the following topics, for the year 2004: the corporate governance, the corporate social responsibility, the shareholder notebook, the management report, the activities, the upstream (exploration and production) and downstream (refining and marketing) operating, chemicals and other matters. (A.L.B.)

  20. Validity and reproducibility of the Physical Activity Scale for the Elderly (PASE) questionnaire for the measurement of the physical activity level in patients after total knee arthroplasty.

    Science.gov (United States)

    Bolszak, Sylvain; Casartelli, Nicola C; Impellizzeri, Franco M; Maffiuletti, Nicola A

    2014-02-20

    The need for valid and reproducible questionnaires to routinely assess the physical activity level of patients after total knee arthroplasty (TKA) is of particular concern in clinical settings. Aims of this study were to evaluate the validity and reproducibility of the physical activity scale for the elderly (PASE) questionnaire in TKA patients, with a particular view on gender differences. A total of 50 elderly patients (25 women and 25 men aged 70 ± 6 years) following primary unilateral TKA were recruited. The reproducibility was evaluated by administering the PASE questionnaire during two occasions separated by 7 days. The construct (criterion) validity was investigated by comparing the physical activity level reported by patients in the PASE questionnaire to that measured by accelerometry. Reproducibility was evaluated using intraclass correlation coefficients (ICC3,1) for reliability and standard error of measurement (SEM) and smallest detectable change (SDC) for agreement, while validity was investigated with Pearson correlation coefficients. Reliability of the PASE total score was acceptable for men (ICC = 0.77) but not for women (ICC = 0.58). Its agreement was low for both men and women, as witnessed by high SEM (32% and 35%, respectively) and SDC (89% and 97%, respectively). Construct validity of the PASE total score was low in both men (r = 0.45) and women (r = 0.06). The PASE questionnaire has several validity and reproducibility shortcomings, therefore its use is not recommended for the assessment of physical activity level in patients after TKA, particularly in women.

  1. Antioxidant, Cytotoxic Activities and Total Phenolic Content of Four Indonesian Medicinal Plants

    Directory of Open Access Journals (Sweden)

    Waras Nurcholis

    2017-03-01

    Full Text Available The crude ethanol extracts of four Indonesian medicinal plants namely Curcuma xanthorrhiza Roxb.,Phyllanthus niruri Linn., Andrographis paniculata Ness., and Curcuma aeruginosa Roxb. wereexamined for their antioxidant (radical scavenging activity using 2, 2-diphenyl-2-picrylhydrazyl(DPPH free radical and cytotoxicity using brine shrimp lethality test (BSLT. The total phenoliccontent was used the Folin-Ciocalteu method. IC50 values for DPPH radical scavenging activityranged from 14.5 to 178.5 μg/ml, with P. niruri having the lowest value and therefore the mostpotent, and C. aeruginosa having the highest value. LC50 values for BSLT ranged from 210.3 to593.2 μg/ml, with C. xanthorrhiza and A. paniculata having the lowest and highest values,respectively. The total phenolic content of the Indonesian plants ranged from 133.0 ±3.7 to863.3±54.7 mg tannic acid equivalent per 1 g extract, with C. aeruginosa and P. niruri having thelowest and highest values, respectively. A positive correlation between free radical scavengingactivity and the content of phenolic compounds was found in the four of Indonesian medicinal plants.

  2. [Insect cholinesterases and irreversible inhibitors. Statistical treatment of the data].

    Science.gov (United States)

    Moralev, S N

    2010-01-01

    The data on sensitivity of cholinesterases (ChE) of different insects to reversible inhibitors, as well as the data on physico-chemical parameters of amino acids constituting their active centers, were treated by factor analysis and juxtaposed. It is shown that both these characteristics are related to taxonomical belonging of insects. It is revealed the "material substrate" of the factors determining inhibitor action specificity, which are specific sites in ChE active center.

  3. The Attributable Proportion of Specific Leisure-Time Physical Activities to Total Leisure Activity Volume Among US Adults, National Health and Nutrition Examination Survey 1999-2006.

    Science.gov (United States)

    Watson, Kathleen Bachtel; Dai, Shifan; Paul, Prabasaj; Carlson, Susan A; Carroll, Dianna D; Fulton, Janet

    2016-11-01

    Previous studies have examined participation in specific leisure-time physical activities (PA) among US adults. The purpose of this study was to identify specific activities that contribute substantially to total volume of leisure-time PA in US adults. Proportion of total volume of leisure-time PA moderate-equivalent minutes attributable to 9 specific types of activities was estimated using self-reported data from 21,685 adult participants (≥ 18 years) in the National Health and Nutrition Examination Survey 1999-2006. Overall, walking (28%), sports (22%), and dancing (9%) contributed most to PA volume. Attributable proportion was higher among men than women for sports (30% vs. 11%) and higher among women than men for walking (36% vs. 23%), dancing (16% vs. 4%), and conditioning exercises (10% vs. 5%). The proportion was lower for walking, but higher for sports, among active adults than those insufficiently active and increased with age for walking. Compared with other racial/ethnic groups, the proportion was lower for sports among non-Hispanic white men and for dancing among non-Hispanic white women. Walking, sports, and dance account for the most activity time among US adults overall, yet some demographic variations exist. Strategies for PA promotion should be tailored to differences across population subgroups.

  4. Physical activity level, leisure activities and related quality of life 1 year after lumbar decompression or total hip arthroplasty.

    Science.gov (United States)

    Rolving, Nanna; Obling, Kirstine H; Christensen, Finn B; Fonager, Kirsten

    2013-04-01

    Lumbar decompression surgery (LDS) and total hip arthroplasty (THA) are frequently performed in the elderly population, but very little is known about their subsequent physical capacity and participation in leisure activities. Despite similar demographics and comorbidities, it is questionable whether LDS patients achieve equally high levels of physical capacity and quality of life postoperatively as do THA patients. The aim was to compare the physical activity level, participation in leisure activities and related quality of life 1 year after an LDS and THA procedure. Data from 95 THA patients and 83 LDS patients were gathered from questionnaires on self-reported physical activity level, leisure activities and quality of life. LDS and THA patients reported equally moderate levels of physical activity. The median score was 42.3 METs/day (IQR 37.9; 47.7) for the LDS group and 41.0 METs/day (IQR 38.5; 48.5) for the THA group (p = 0.79). Weekly time consumption for leisure activities in the LDS group was a median of 420 min/week (IQR 210; 660) compared to a median of 480 min/week (IQR 240; 870) in the THA group (p = 0.16). Regarding quality of life, LDS patients reported significantly worse Euroqol Five Dimensions scores with a median value of 0.740 (IQR 0.68; 0.82) compared to THA patients' median of 0.824 (IQR 0.72; 1.0), p leisure activities, LDS patients did not achieve a quality of life comparable to that of THA patients 1 year postoperatively.

  5. Diabetes that impacts on routine activities predicts slower recovery after total knee arthroplasty: an observational study

    Directory of Open Access Journals (Sweden)

    Nurudeen Amusat

    2014-12-01

    Full Text Available Question: In the 6 months after total knee arthroplasty (TKA, what is the pattern of pain resolution and functional recovery in people without diabetes, with diabetes that does not impact on routine activities, and with diabetes that does impact on routine activities? Is diabetes that impacts on routine activities an independent predictor of slower resolution of pain and functional recovery after TKA? Design: Community-based prospective observational study. Participants: A consecutive cohort of 405 people undergoing primary TKA, of whom 60 (15% had diabetes. Participants with diabetes were also asked preoperatively whether diabetes impacted on their routine activities. Participants were categorised into three groups: no diabetes (n = 345, diabetes with no impact on activities (n = 41, and diabetes that impacted activities (n = 19. Outcome measures: Pain and function were measured using the Western Ontario and McMaster Universities (WOMAC Osteoarthritis Index within the month before surgery and 1, 3 and 6 months after surgery. Demographic, medical and surgical factors were also measured, along with depression, social support and health-related quality of life. Results: No baseline differences in pain and function were seen among the three groups (p > 0.05. Adjusting for age, gender and contralateral joint involvement across the 6 postoperative months, participants with diabetes that impacted on routine activities had pain scores that were 8.3 points higher (indicating greater pain and function scores that were 5.4 points higher (indicating lower function than participants without diabetes. Participants with diabetes that doesn’t impact on routine activities had similar recovery to those without diabetes. Conclusion: People undergoing TKA who report preoperatively that diabetes impacts on their routine activities have less recovery over 6 months than those without diabetes or those with diabetes that does not impact on routine activities

  6. Il piu grande centro europeo di ricerca oggi festeggia l'anniversario del Nobel di Rubbia e Van der Meer. Cern, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia

    CERN Multimedia

    Durante, E

    2003-01-01

    "CERN, vent'anni guardando al futuro Ora la sfida si gioca sull'acceleratore di particelle pronto per il 2007, che provera a svelare i segreti della materia" [CERN, twenty years of looking towards the future. The present challenge is the particle accelerator that will be ready in 2007, which will try to reveal the secrets of matter] (2 pages)

  7. Cholinesterases and neurotoxicity as highly sensitive biomarkers for an organophosphate insecticide in a freshwater gastropod (Chilina gibbosa) with low sensitivity carboxylesterases.

    Science.gov (United States)

    Bianco, Karina; Yusseppone, María Soledad; Otero, Sofía; Luquet, Carlos; Ríos de Molina, María Del Carmen; Kristoff, Gisela

    2013-11-15

    In the Upper Valley of Río Negro and Río Neuquén in Argentina, agriculture represents the second most important economic activity. Azinphos-methyl has been found in water from this region throughout the year at a maximum concentration of 22.48 μg L(-1) during the application period. Toxicological studies on local non-target species have been performed mostly on vertebrates, while mollusks, which could be more sensitive, have not been studied so far. This work aims to characterize cholinesterase (ChE) and carboxilesterase (CE) activities of Chilina gibbosa, a freshwater gastropod native to southern Argentina and Chile. These enzymes, together with neurotoxicity signals, are evaluated herein after as sensitive biomarkers of exposure to azinphos-methyl at environmentally relevant concentrations. Effects of azinphos-methyl on antioxidant defenses: glutathione (GSH), catalase (CAT), superoxide dismutase (SOD) and glutathione S-transferase (GST) are also studied in order to complete a set of biomarkers with different sensitivity and specificity, to propose C. gibbosa as a sentinel species. The highest specific activity was obtained with acetylthiocholine as substrate, followed by propionylthiocholine (83% in comparison to acetylthiocholine) and butyrylthiocholine (19%).The lowest Km and the highest efficiency for ChE were obtained with acetylthiocholine. Regarding CEs activities, a higher efficiency was obtained with p-nitrophenyl butyrate than with p-nitrophenyl acetate. Eserine produced significant inhibition of ChE activity (81% with 0.001 mM and 98% with 1mM) while iso-OMPA did not produce any significant effect on ChE. Our results show that C. gibbosa ChE is very sensitive to azinphos-methyl (CI50 0.02 μg L(-1)) while CEs are inhibited at higher concentrations (CI50 1,000 μg L(-1)). CEs have been reported to be more sensitive to OPs than ChEs in most of the aquatic invertebrates protecting the organisms from neurotoxic effects. In contrast, C. gibbosa, has ChE

  8. Role of SSNTD technique in three-step method for total assay of alpha activity in air effluents

    International Nuclear Information System (INIS)

    Kolekar, R.V.; Joshi, V.B.; Bhanti, D.P.; Bhagwat, A.M.

    2000-01-01

    In the present work, low levels of alpha activity in air effluents were estimated. Currently this essay involves collection of effluent samples and assaying them for the release using ZnS(Ag) based scintillation counter (background=1 cpm). Any activity below 1 cpm (net) therefore goes unreported. Air samples showing activity -6 Bq/m 3 (3.73x10 -17 Ci/m 3 ) to 36.41x10 -6 Bq/m 3 (9.84x10 -16 Ci/m 3 ) for samples studied over twelve months period. The three step procedure helps to measure total activity without significant burden on SSNTD technique thereby improving the acceptability of the methodology. (author)

  9. Cholinesterase activities in the scallop Pecten jacobaeus: Characterization and effects of exposure to aquatic contaminants

    International Nuclear Information System (INIS)

    Stefano, Bonacci; Ilaria, Corsi; Silvano, Focardi

    2008-01-01

    Nearshore marine environments of industrialized countries are increasingly threatened by anthropogenic pollution. It is therefore a priority task to investigate the sensitivity of new ecotoxicological warning signals of the occurrence and effects of aquatic pollutants. The main aims of the present study were: 1) to characterize the biochemical properties of ChEs in tissues of the bivalve Pecten jacobaeus, using different specific substrates and selective inhibitors; 2) to measure sensitivity of ChE activities to in vitro exposure to the OPs azamethiphos and DFP and to the heavy metals cadmium and zinc. Our final aim was to carry out a preliminary evaluation of the suitability of ChEs measurement in tissues of the scallop for monitoring marine environmental quality and neurotoxic compounds contamination in the Mediterranean Sea. Responses to specific inhibitors have suggested that ChEs in adductor muscle share many characteristics with vertebrate acetylcholinesterase. Dose-dependent inhibition of ChE was observed in response to in vitro exposure to environmental contaminants such as cadmium and azamethiphos. Sensitivity to zinc and DFP was lower. ChEs in P. jacobaeus might therefore have potential as a sensitive biomarker for monitoring marine pollution. Results of the present study will be useful to focus further experiment of exposure to pollutants under in vivo conditions. Capsule: Cholinesterase activities in scallop Pecten jacobaeus were observed to be sensitive to contaminants in vitro and may therefore have potential as biomarkers for monitoring water pollution

  10. Cholinesterase activities in the scallop Pecten jacobaeus: Characterization and effects of exposure to aquatic contaminants

    Energy Technology Data Exchange (ETDEWEB)

    Stefano, Bonacci [Department of Environmental Sciences ' G. Sarfatti' , University of Siena, Via P.A. Mattioli 4, I-53100 Siena (Italy)], E-mail: bonacci@unisi.it; Ilaria, Corsi [Department of Environmental Sciences ' G. Sarfatti' , University of Siena, Via P.A. Mattioli 4, I-53100 Siena (Italy)], E-mail: corsii@unisi.it; Silvano, Focardi [Department of Environmental Sciences ' G. Sarfatti' , University of Siena, Via P.A. Mattioli 4, I-53100 Siena (Italy)], E-mail: focardi@unisi.it

    2008-03-15

    Nearshore marine environments of industrialized countries are increasingly threatened by anthropogenic pollution. It is therefore a priority task to investigate the sensitivity of new ecotoxicological warning signals of the occurrence and effects of aquatic pollutants. The main aims of the present study were: 1) to characterize the biochemical properties of ChEs in tissues of the bivalve Pecten jacobaeus, using different specific substrates and selective inhibitors; 2) to measure sensitivity of ChE activities to in vitro exposure to the OPs azamethiphos and DFP and to the heavy metals cadmium and zinc. Our final aim was to carry out a preliminary evaluation of the suitability of ChEs measurement in tissues of the scallop for monitoring marine environmental quality and neurotoxic compounds contamination in the Mediterranean Sea. Responses to specific inhibitors have suggested that ChEs in adductor muscle share many characteristics with vertebrate acetylcholinesterase. Dose-dependent inhibition of ChE was observed in response to in vitro exposure to environmental contaminants such as cadmium and azamethiphos. Sensitivity to zinc and DFP was lower. ChEs in P. jacobaeus might therefore have potential as a sensitive biomarker for monitoring marine pollution. Results of the present study will be useful to focus further experiment of exposure to pollutants under in vivo conditions. Capsule: Cholinesterase activities in scallop Pecten jacobaeus were observed to be sensitive to contaminants in vitro and may therefore have potential as biomarkers for monitoring water pollution.

  11. Illustrations to “Gespräche in dem Reiche derer Todten zwischen dem vortreflichen Moscowitischen Czaar Petro Magno und dem grossen Tyrannen Ivan Basilowiz II” (Peter the Great and Ivan the Terrible) by David Fassmann (1725)

    OpenAIRE

    Ekaterina A. Skvortcova

    2017-01-01

    The journal created by David Fassmann (1683–1744), Gespräche in dem Reiche derer Todten, edited in Leipzig, was a huge success. Each of the 240 issues presents a dialogue between two historical figures from the afterworld. In the 83rd–86th Entrevuë, the interlocutors are Peter the Great and Ivan the Terrible. The texts of the four conversations were thoroughly examined by Eckhard Matthes (1987). The present paper explores how the illustrations to the 83rd–86th Entrevuë visualize the texts, w...

  12. Male aging symptoms: the positive influence of moderate and total physical activity

    Directory of Open Access Journals (Sweden)

    Melissa de Carvalho Souza Vieira

    2016-09-01

    Full Text Available DOI: http://dx.doi.org/10.5007/1980-0037.2016v18n4p460   The aim of the research was to analyze the association of physical activity (PA intensity and duration with male aging symptoms. This is a cross-sectional study of probabilistic sample involving 416 men from two cities in southern Brazil. Data collection used a questionnaire divided into six parts: sample characteristics; anthropometric measurements; economic level by the Brazilian Institute of Geography and Statistics (IBGE; International Physical Activity Questionnaire (IPAQ short-version; Behavioral Risk Factors Surveillance System Questionnaire (BRFSS and Male Aging Symptoms Scale (AMS. The sample was divided into two groups: with and without male aging symptoms, making use of descriptive and inferential statistics. The presence of male aging symptoms was identified in 61.6% of men, especially somatic and psychological symptoms. Most were considered sufficiently active (60.1%, highlighting men without male aging symptoms (p = 0.026, with a possible effect of moderate and total PA on low-intensity symptoms (p = 0.027; p = 0.015. This study identified relationships between PA duration and intensity and intensity of male aging symptoms. PA practice with specific intensity and duration is suggested in order to obtain health benefits related to male aging symptoms.

  13. Performance on a Clinical Quadriceps Activation Battery Is Related to a Laboratory Measure of Activation and Recovery After Total Knee Arthroplasty.

    Science.gov (United States)

    Bade, Michael; Struessel, Tamara; Paxton, Roger; Winters, Joshua; Baym, Carol; Stevens-Lapsley, Jennifer

    2018-01-01

    To determine the relation between performance on a clinical quadriceps activation battery with (1) activation measured by doublet interpolation and (2) recovery of quadriceps strength and functional performance after total knee arthroplasty (TKA). Planned secondary analysis of a randomized controlled trial. University research laboratory. Patients (N=162; mean age, 63±7y; 89 women) undergoing TKA. Patients were classified as high (quadriceps activation battery ≥4/6) or low (quadriceps activation battery ≤3/6) based on performance on the quadriceps activation battery measured 4 days after TKA. Differences between groups in activation and recovery at 1, 2, 3, 6, and 12 months after TKA were compared using a repeated-measures maximum likelihood model. The low quadriceps activation battery group demonstrated poorer quadriceps activation via doublet interpolation (P=.01), greater quadriceps strength loss (P=.01), and greater functional performance decline (all Pbattery group. Differences between low and high quadriceps activation battery groups on all measures did not persist at 3 and 12 months (all P>.05). Poor performance on the quadriceps activation battery early after TKA is related to poor quadriceps activation and poor recovery in the early postoperative period. Patients in the low quadriceps activation battery group took 3 months to recover to the same level as the high quadriceps activation battery group. The quadriceps activation battery may be useful in identifying individuals who need specific interventions to target activation deficits or different care pathways in the early postoperative period to speed recovery after TKA. Copyright © 2017 American Congress of Rehabilitation Medicine. Published by Elsevier Inc. All rights reserved.

  14. Return to work and workplace activity limitations following total hip or knee replacement.

    Science.gov (United States)

    Sankar, A; Davis, A M; Palaganas, M P; Beaton, D E; Badley, E M; Gignac, M A

    2013-10-01

    Total hip (THR) and knee (TKR) replacements increasingly are performed on younger people making return to work a salient outcome. This research evaluates characteristics of individuals with early and later return to work following THR and TKR. Additionally, at work limitations pre-surgery and upon returning to work, and factors associated with work limitations were evaluated. 190 THR and 170 TKR of a total 931 cohort participants were eligible (i.e., working or on short-term disability pre-surgery). They completed questionnaires pre-surgery and 1, 3, 6 and 12 months post-surgery that included demographics, type of occupation, and the Workplace Activity Limitations Scale (WALS). 166 (87%) and 144 (85%) returned to work by 12 months following THR and TKR, respectively. Early (1 month) return to work was associated with, male gender, university education, working in business, finance or administration, and low physical demand work. People with THR returned to work earlier than those with TKR. For both groups, less pain and every day functional limitations were associated with less workplace activity limitations at the time return to work. The majority of individuals working prior to surgery return to work following hip or knee replacement for osteoarthritis (OA) and experience fewer limitations at work than pre-surgery. The changing workforce dynamics and trends toward surgery at younger ages mean that these are important outcomes for clinicians to assess. Additionally, this is important information for employers in understanding continued participation in employment for people with OA. Copyright © 2013 Osteoarthritis Research Society International. Published by Elsevier Ltd. All rights reserved.

  15. Il Salento che abbiamo attraversato: Rina Durante e Bruno Brancher, il racconto di due vite diverse sulle strade di terra d'Otranto

    Directory of Open Access Journals (Sweden)

    Massimo Melillo

    2015-07-01

    Full Text Available Rina Durante ha rappresentato il meglio della cultura meridionale, ne ha raccolto l’eredità e ne è stata tra le interpreti più acute. Abbiamo avuto l’onore della sua amicizia fraterna e solidale, conosciuto l’azzardo e la radicalità delle sue scelte di vita, la sua dolce timidezza e l’ardita padronanza e consapevolezza del suo ruolo: anni di discussioni, di confronto, di legame cementato da infuocati innamoramenti intellettuali per uno scrittore, un poeta, un regista, di accese ironie sui nostri caratteri, di scontri politici e furibondi litigi finiti in un abbraccio. Anche per Bruno Brancher, milanese di tutti e di nessuno, il ricordo si fa memoria per le sue mille improvvise e imprevedibili incursioni in terra salentina. Non era un uomo facile, anche se aveva dalla sua parte il puntiglio dell’innocenza tipica del ladro gentiluomo. Portava leggero il fardello di due vite in una: la prima segnata da una marginalità, fattasi a volte precariamente lussuosa con i proventi di furti e disarmanti rapine; l’altra con la faccia del redento, che con la scoperta della scrittura diventa cosciente di sé.

  16. Synthesis, biological evaluation, QSAR study and molecular docking of novel N-(4-amino carbonylpiperazinyl) (thio)phosphoramide derivatives as cholinesterase inhibitors.

    Science.gov (United States)

    Gholivand, Khodayar; Ebrahimi Valmoozi, Ali Asghar; Bonsaii, Mahyar

    2014-06-01

    Novel (thio)phosphoramidate derivatives based on piperidincarboxamide with the general formula of (NH2-C(O)-C5H9N)-P(X=O,S)R1R2 (1-5) and (NH2-C(O)-C5H9N)2-P(O)R (6-9) were synthesized and characterized by (31)P, (13)C, (1)H NMR, IR spectroscopy. Furthermore, the crystal structure of compound (NH2-C(O)-C5H9N)2-P(O)(OC6H5) (6) was investigated. The activities of derivatives on cholinesterases (ChE) were determined using a modified Ellman's method. Also the mixed-type mechanisms of these compounds were evaluated by Lineweaver-Burk plots. Molecular docking and quantitative structure-activity relationship (QSAR) were used to understand the relationship between molecular structural features and anti-ChE activity, and to predict the binding affinity of phosphoramido-piperidinecarboxamides (PAPCAs) to ChE receptors. From molecular docking analysis, noncovalent interactions especially hydrogen bonding as well as hydrophobic was found between PAPCAs and ChE. Based on the docking results, appropriate molecular structural parameters were adopted to develop a QSAR model. DFT-QSAR models for ChE enzymes demonstrated the importance of electrophilicity parameter in describing the anti-AChE and anti-BChE activities of the synthesized compounds. The correlation matrix of QSAR models and docking analysis confirmed that electrophilicity descriptor can control the influence of the hydrophobic properties of P=(O, S) and CO functional groups of PAPCA derivatives in the inhibition of human ChE enzymes. Copyright © 2014 Elsevier Inc. All rights reserved.

  17. Effects of gamma irradiation on chickpea seeds vis-a-vis total seed storage proteins, antioxidant activity and protein profiling.

    Science.gov (United States)

    Bhagyawant, S S; Gupta, N; Shrivastava, N

    2015-10-23

    The present work describes radiation—induced effects on seed composition vis—à—vis total seed proteins, antioxidant levels and protein profiling employing two dimensional gel electrophoresis (2D—GE) in kabuli and desi chickpea varities. Seeds were exposed to the radiation doses of 1,2,3,4 and 5 kGy. The total protein concentrations decreased and antioxidant levels were increased with increasing dose compared to control seed samples. Radiation induced effects were dose dependent to these seed parameters while it showed tolerance to 1 kGy dose. Increase in the dose was complimented with increase in antioxidant levels, like 5 kGy enhanced % scavenging activities in all the seed extracts. Precisely, the investigations reflected that the dose range from 2 to 5 kGy was effective for total seed storage proteins, as depicted quantitatively and qualitative 2D—GE means enhance antioxidant activities in vitro.

  18. Patient Activity Levels After Reverse Total Shoulder Arthroplasty: What Are Patients Doing?

    Science.gov (United States)

    Garcia, Grant H; Taylor, Samuel A; DePalma, Brian J; Mahony, Gregory T; Grawe, Brian M; Nguyen, Joseph; Dines, Joshua S; Dines, David M; Warren, Russell F; Craig, Edward V; Gulotta, Lawrence V

    2015-11-01

    The indications for reverse total shoulder arthroplasty (RTSA) continue to expand, which has resulted in younger patients who want to remain active after RTSA. Little information is available to manage expectations of both physicians and patients for return to sporting activities. To determine the rate of return to sporting activities and assess average time to return to sports after RTSA. Case series; Level of evidence, 4. This was a retrospective review of consecutive RTSA patients collected from our institution's shoulder arthroplasty registry. All patients who played sports preoperatively and had a minimum of 1-year follow-up were included. Final follow-up consisted of an additional patient-reported questionnaire with questions regarding physical fitness and sporting activities. Each patient also completed an assessment with the American Shoulder and Elbow Society (ASES) Shoulder Score and a visual analog scale (VAS) for pain. Seventy-six patients played a sport preoperatively and met inclusion and exclusion criteria. The average follow-up was 31.6 months (range, 12-65 months), and average age was 74.8 years (range, 49.9-92.6 years). Average VAS pain scores improved from 6.57 to 0.63 (P sport. Average time to return to full sports was 5.3 months. Fitness sports had the highest direct rate of return (81.5%), followed by swimming (66.7%), running (57.1%), cycling (50.0%), and golf (50%). Postoperatively, 41.1% of patients reported improved physical fitness; 88.2% felt that their sports outcome was good to excellent, and 93.4% felt that their surgical outcome was good to excellent. Patients undergoing RTSA had an 85% rate of return to 1 or more sporting activities at an average of 5.3 months after surgery. Age greater than 70 years was a significant predictor of decreased return to activities. The present study offers valuable information to help manage patient and surgeon expectations. © 2015 The Author(s).

  19. Dose evaluation for workers employed in an industry involving enamel paints containing zirconium silicate; Valutazione di dose per i lavoratori occupati in una industria che utilizza vernici a smalto contenenti silicato di zirconio

    Energy Technology Data Exchange (ETDEWEB)

    Castellani, C.M.; Berico, M.; De Zaiacomo, T.; Formignani, M.; Ianni, A.; Nobili, C.; Sandri, S.; Vasselli, R. [ENEA, Centro Ricerche Ezio Clementel, Bologna (Italy). Dipt. Ambiente

    1999-07-01

    In the frame of the European Recommendations for radiological protection, an evaluation of the annual dose has been made for workers employed in an industry for the production of sanitary equipment involving the use of enamel paints containing zirconium silicate. [Italian] Nella prospettiva dell'applicazione della direttiva europea relativa alla protezione radiologica dei lavoratori, vengono presentati i risultati relativi alla valutazione di dose annuale complessiva per i lavoratori occupati in una industria per la produzione di articoli igienico-sanitari che utilizza vernici a smalto contenenti silicato di zirconio. Il fine e' la valutazione del problema radioprotezionistico per gli addetti a causa delle impurezza radioattive presenti nei materiali utlizzati.

  20. Effect of Different Solvents on Total Phenolic Contents and Antioxidant Activity of Zizyphus jujube Miller Fruits

    Directory of Open Access Journals (Sweden)

    Gholamhossein Davarynejad

    2017-10-01

    Full Text Available Introduction: Phenolic compounds have an ability to scavenge free radicals and cause the balance of reactive oxygen species (ROS in our body. This balance prevents atherosclerosis, coronary heart and cancer diseases. Butylated hydroxyl toluene (BHT is a well-known synthetic antioxidant, which is restricted to be used due to its probable toxic effects. Therefore, replacement of synthetic antioxidants with plant materials with high amounts of antioxidant activity, which protect the body from free radicals and many diseases caused by lipid peroxidation, is an appropriate option. ZiziphusjujubaMiller is one of the forty species belonging to Rhamnaceae family, which produces a great deal of industrial raw materials for horticultural, ornamental, food, and pharmaceutical industries. Antioxidants can be extracted by various solvents and extraction methods. Solvent extraction is the most common method used for separating natural antioxidants. Solvent properties undoubtedly play a key role in the extraction of antioxidative compounds. The type and yield of antioxidant extracted have been found to vary as affected by the solvent properties such as polarity, viscosity and vapor pressure. Therefore, it is difficult to develop a unified standard method for the extraction of antioxidants from all plant materials. Materials and Methods: Plant materials Fresh fruits were collected from Birjand, Iran, in late summer 2014. The samples were air dried under the shade at room temperature. Dried fruits were ground by using a mortar and pestle and were separately extracted by distilled water and organic solvents such as methanol, ethanol and acetone (50%, 90% and100% (v/v. After filtering through the Whatman paper #3 and removing the solvents (using a rotary evaporator (BUCHI V-850 and water (using a freeze dryer, (OPERON, FDB-5503, Korea, the dried extracts were stored in refrigerator for further analysis. Determination of Total Phenolic Content (TPC Samples were

  1. Antioxidant activity, phenolic and flavonoids total of ethanolic extract of Ipomoea batata L. leaves (white, yellow, orange, and purple)

    Science.gov (United States)

    Dewijanti, Indah Dwiatmi; Banjarnahor, Sofna D.; Triyuliani, Maryani, Faiza; Meilawati, Lia

    2017-11-01

    Antioxidant activity, phenolic and total flavonoids from sweet potato ethanol extract (Ipomea batatas L.) of different varieties (white, yellow, orange and purple) were studied. Sweet potatoes were collected from Research Centre for Chemistry. Sweet potato leaves have been used for numerous oxidative-associated diseases such as cancer, allergy, aging, HIV and cardiovascular. 1,1-diphenyl-2-picryl hydrazyl (DPPH) method was used to investigate antioxidant activity in leaves, in which the yellow and purple varieties showed the highest and the lowest scavenging activities of 47.65 µg/ ml (IC50) and 87.402 µg/ ml (IC50), respectively. In this study, the yellow leaves showed the highest concentrations of total phenolic and flavonoids contents at 11.293 µg/g and 44.963 µg/g, respectively. Therefore, sweet potato leaves can be used as a prospective natural antioxidant.

  2. Effects on wildlife of ethyl and methyl parathion applied to California rice fields

    Science.gov (United States)

    Custer, T.W.; Hill, E.F.; Ohlendorf, H.M.

    1985-01-01

    Selected rice fields on the Sacramento National Wildlife Refuge Complex were aerially sprayed one time during May or June 1982 with either ethyl (0.11 kg Al/ha) or methyl (0.84 kg AI/ha) parathion for control of tadpole shrimp, Triops longicaudatus. No sick or dead vertebrate wildlife were found or adjacent to the treated rice fields after spraying. Specimens of the following birds and mammals were assayed for brain cholinesterase (ChE) activity to determine exposure to either form of parathion; house mouse, Mus musculus; black-tailed jackrabbit, Lepus californicus; mallard, Anas platyrhynchos; ring-necked pheasant, Phasianus colchicus; American coot, Fulica americana; and red-winged blackbird, Agelaius phoeniceus. Both mice and pheasants from methyl parathion-treated fields had overall mean ChE activities that were significantly (P < 0.05) inhibited compared with controls, and 7, 40, 54 and 57% of individual blackbirds, pheasant, mice, and coots, respectively, had inhibited brain ChE activities (i.e., less than -2 SD of control mean). Although no overall species effect was detected for ethyl parathoid treatment, pheasants (43%), coots (33%), and mice (37%) had significantly inhibited brain ChE activities. Neither of the parathion treatment appeared acutely hazardous to wildlife in or adjacent to rice fields, but sufficient information on potential hazards was obtained to warrant caution in use of these chemicals, especially methyl parathion, in rice fields.

  3. Effects of wildlife of ethyl and methyl parathion applied to California USA rice fields

    Science.gov (United States)

    Custer, T.W.; Hill, E.F.; Ohlendorf, H.M.

    1985-01-01

    Selected rice fields on the Sacramento National Wildlife Refuge Complex were aerially sprayed one time during May or June 1982 with either ethyl (0.11 kg Al/ha) or methyl (0.84 kg AI/ha) parathion for control of tadpole shrimp, Triops longicaudatus. No sick or dead vertebrate wildlife were found or adjacent to the treated rice fields after spraying. Specimens of the following birds and mammals were assayed for brain cholinesterase (ChE) activity to determine exposure to either form of parathion; house mouse, Mus musculus; black-tailed jackrabbit, Lepus californicus; mallard, Anas platyrhynchos; ring-necked pheasant, Phasianus colchicus; American coot, Fulica americana; and red-winged blackbird, Agelaius phoeniceus. Both mice and pheasants from methyl parathion-treated fields had overall mean ChE activities that were significantly (P < 0.05) inhibited compared with controls, and 7, 40, 54 and 57% of individual blackbirds, pheasant, mice, and coots, respectively, had inhibited brain ChE activities (i.e., less than -2 SD of control mean). Although no overall species effect was detected for ethyl parathoid treatment, pheasants (43%), coots (33%), and mice (37%) had significantly inhibited brain ChE activities. Neither of the parathion treatment appeared acutely hazardous to wildlife in or adjacent to rice fields, but sufficient information on potential hazards was obtained to warrant caution in use of these chemicals, especially methyl parathion, in rice fields.

  4. Total Factbook 2003

    International Nuclear Information System (INIS)

    2003-01-01

    This report presents the activities and results of the Group Total-Fina-Elf for the year 2003. It brings information and economic data on the following topics: the corporate and business; the upstream activities with the reserves, the costs, standardized measure and changes of discounted future net cash flow,oil and gas acreage, drilling, liquefied natural gas, pipelines; downstream activities with refining and marketing maps, refinery, petroleum products, sales, retail gasoline outlets; chemicals with sales and operating income by sector, major applications, base chemicals and polymers, intermediates and performance polymers. (A.L.B.)

  5. Joint reconstruction of dynamic PET activity and kinetic parametric images using total variation constrained dictionary sparse coding

    Science.gov (United States)

    Yu, Haiqing; Chen, Shuhang; Chen, Yunmei; Liu, Huafeng

    2017-05-01

    Dynamic positron emission tomography (PET) is capable of providing both spatial and temporal information of radio tracers in vivo. In this paper, we present a novel joint estimation framework to reconstruct temporal sequences of dynamic PET images and the coefficients characterizing the system impulse response function, from which the associated parametric images of the system macro parameters for tracer kinetics can be estimated. The proposed algorithm, which combines statistical data measurement and tracer kinetic models, integrates a dictionary sparse coding (DSC) into a total variational minimization based algorithm for simultaneous reconstruction of the activity distribution and parametric map from measured emission sinograms. DSC, based on the compartmental theory, provides biologically meaningful regularization, and total variation regularization is incorporated to provide edge-preserving guidance. We rely on techniques from minimization algorithms (the alternating direction method of multipliers) to first generate the estimated activity distributions with sub-optimal kinetic parameter estimates, and then recover the parametric maps given these activity estimates. These coupled iterative steps are repeated as necessary until convergence. Experiments with synthetic, Monte Carlo generated data, and real patient data have been conducted, and the results are very promising.

  6. Hydrogen Exchange Differences between Chemoreceptor Signaling Complexes Localize to Functionally Important Subdomains

    Science.gov (United States)

    2015-01-01

    The goal of understanding mechanisms of transmembrane signaling, one of many key life processes mediated by membrane proteins, has motivated numerous studies of bacterial chemotaxis receptors. Ligand binding to the receptor causes a piston motion of an α helix in the periplasmic and transmembrane domains, but it is unclear how the signal is then propagated through the cytoplasmic domain to control the activity of the associated kinase CheA. Recent proposals suggest that signaling in the cytoplasmic domain involves opposing changes in dynamics in different subdomains. However, it has been difficult to measure dynamics within the functional system, consisting of extended arrays of receptor complexes with two other proteins, CheA and CheW. We have combined hydrogen exchange mass spectrometry with vesicle template assembly of functional complexes of the receptor cytoplasmic domain to reveal that there are significant signaling-associated changes in exchange, and these changes localize to key regions of the receptor involved in the excitation and adaptation responses. The methylation subdomain exhibits complex changes that include slower hydrogen exchange in complexes in a kinase-activating state, which may be partially consistent with proposals that this subdomain is stabilized in this state. The signaling subdomain exhibits significant protection from hydrogen exchange in complexes in a kinase-activating state, suggesting a tighter and/or larger interaction interface with CheA and CheW in this state. These first measurements of the stability of protein subdomains within functional signaling complexes demonstrate the promise of this approach for measuring functionally important protein dynamics within the various physiologically relevant states of multiprotein complexes. PMID:25420045

  7. Total sitting time, leisure time physical activity and risk of hospitalization due to low back pain: The Danish Health Examination Survey cohort 2007-2008.

    Science.gov (United States)

    Balling, Mie; Holmberg, Teresa; Petersen, Christina B; Aadahl, Mette; Meyrowitsch, Dan W; Tolstrup, Janne S

    2018-02-01

    This study aimed to test the hypotheses that a high total sitting time and vigorous physical activity in leisure time increase the risk of low back pain and herniated lumbar disc disease. A total of 76,438 adults answered questions regarding their total sitting time and physical activity during leisure time in the Danish Health Examination Survey 2007-2008. Information on low back pain diagnoses up to 10 September 2015 was obtained from The National Patient Register. The mean follow-up time was 7.4 years. Data were analysed using Cox regression analysis with adjustment for potential confounders. Multiple imputations were performed for missing values. During the follow-up period, 1796 individuals were diagnosed with low back pain, of whom 479 were diagnosed with herniated lumbar disc disease. Total sitting time was not associated with low back pain or herniated lumbar disc disease. However, moderate or vigorous physical activity, as compared to light physical activity, was associated with increased risk of low back pain (HR = 1.16, 95% CI: 1.03-1.30 and HR = 1.45, 95% CI: 1.15-1.83). Moderate, but not vigorous physical activity was associated with increased risk of herniated lumbar disc disease. The results suggest that total sitting time is not associated with low back pain, but moderate and vigorous physical activity is associated with increased risk of low back pain compared with light physical activity.

  8. Solvent Effect on Antioxidant Activity and Total Phenolic Content of Betula alba and Convolvulus arvensi

    OpenAIRE

    Mohd Azman A. Nurul; Husni Shafik; Almajano P. Maria; Gallego G. Maria

    2013-01-01

    The potential of using herbal Betula alba (BA) and Convolvulus arvensis (CA) as a natural antioxidant for food applications were investigated. Each plant extract was prepared by using pure ethanol, different concentration of ethanol aqueous solutions, including 50% and 75%, 50% methanol aqueous and water. Total phenolic content (TPC) was determined using Folin–Ciocalteau method and antioxidant activity were analyzed by 2,2-diphenyl-1-picrylhydrazyl (DPPH) radicals, trolox equivalent antioxida...

  9. Effects of different components of Mao Dongqing's total flavonoids and total saponins on transient ischemic attack (TIA) model of rats.

    Science.gov (United States)

    Miao, Ming-San; Peng, Meng-Fan; Ma, Rui-Juan; Bai, Ming; Liu, Bao-Song

    2018-03-01

    Objective: To study the effects of the different components of the total flavonoids and total saponins from Mao Dongqing's active site on the rats of TIA model, determine the optimal reactive components ratio of Mao Dongqing on the rats of TIA. Methods: TIA rat model was induced by tail vein injection of tert butyl alcohol, the blank group was injected with the same amount of physiological saline, then behavioral score wasevaluated. Determination the level of glutamic acid in serum, the activity of Na+-K+-ATP enzyme, CA ++ -ATP enzyme and Mg ++ -ATP enzyme in Brain tissue, observe the changes of hippocampus in brain tissue, the comprehensive weight method was used to evaluate the efficacy of each component finally. Results: The contents of total flavonoids and total saponins in the active part of Mao Dongqing can significantly improve the pathological changes of brain tissue in rats, improve the activity of Na + -K + -ATP enzyme, Ca ++ -ATP enzyme and Mg ++ -ATP enzyme in the brain of rats, and reduce the level of glutamic acid in serum. The most significant of the contents was the ratio of 10:6. The different proportions of total flavonoids and total saponins in the active part of Mao Dongqing all has a better effect on the rats with TIA, and the ratio of 10:6 is the best active component for preventing and controlling TIA.

  10. Total synthesis of leopolic acid A, a natural 2,3-pyrrolidinedione with antimicrobial activity

    Directory of Open Access Journals (Sweden)

    Atul A. Dhavan

    2016-07-01

    Full Text Available The first total synthesis of leopolic acid A, a fungal metabolite with a rare 2,3-pyrrolidinedione nucleus linked to an ureido dipeptide, was designed and carried out. Crucial steps for the strategy include a Dieckmann cyclization to obtain the 2,3-pyrrolidinedione ring and a Wittig olefination to install the polymethylene chain. An oxazolidinone-containing leopolic acid A analogue was also synthesized. The antibacterial activity showed by both compounds suggests that they could be considered as promising candidates for future developments.

  11. Il fascino oscuro dell’inflazione alla scoperta della storia dell’universo

    CERN Document Server

    Fré, Pietro

    2009-01-01

    È dalla più remota antichità che l’uomo si interroga sulla struttura dell’Universo e sulle leggi che lo governano. Ma il progresso compiuto all’inizio del XX secolo non ha paragoni rispetto a quello di tutti i secoli precedenti: nel 1915 fu formulata la relatività generale, indispensabile per inquadrare tutti i fenomeni cosmici e astrofisici; tra il 1920 e il 1930 furono determinate le reali dimensioni dell’Universo visibile e fu scoperta la sua costante espansione. La cosmologia ha poi fatto un grande salto di qualità a cavallo tra la fine del XX secolo e l’inizio del XXI, quando una serie di osservazioni ha confermato che: L’Universo è spazialmente "piatto", in seguito all’inflazione cosmica che, una frazione di secondo dopo il Big Bang, ne ha gonfiato le dimensioni di decine o centinaia di miliardi di volte. L’Universo è costituito al 70% da energia oscura e al 24% da materia oscura: la materia visibile, cioè stelle e galassie, rappresenta solo il 6% del totale. Attualmente l’espa...

  12. Optimization of Conditions for Extraction of Polyphenols and the Determination of the Impact of Cooking on Total Polyphenolic, Antioxidant, and Anticholinesterase Activities of Potato

    Science.gov (United States)

    Laib, Imen; Barkat, Malika

    2018-01-01

    In this work we optimized the cooking and extraction conditions for obtaining high yields of total polyphenols from potato and studied the effect of three domestic methods of cooking on total phenols, antioxidant activity, and anticholinesterase activities. The optimization of the experiment was carried out by the experimental designs. The extraction of the polyphenols was carried out by maceration and ultrasonication. Determination of the polyphenols was performed by using the Folin-Ciocalteau reagent method. The antioxidant activity was evaluated by three methods: 1,1-diphenyl-2-picryl-hydrazyl (DPPH), 2,2′-azino-bis(3-ethylbenzothiazoline-6-sulphonic acid) (ABTS), and CUPRAC(Cupric reducing antioxidant capacity), the anticholinesterase activity was evaluated by the method of Elmann. The optimum of total phenolic obtained was: 4.668 × 104, 1.406 × 104, 3357.009, 16,208.99 µg Gallic Acid Equivalent (GAE)/g of dry extract for crude potato, steamed potatoes, in boiling water, and by microwave, respectively. The three modes of cooking cause a decrease in the total polyphenol contents, antioxidant and anticholinesterase activities. PMID:29522482

  13. Evaluation of Antioxidant Activity, Total Flavonoids, Tannins and Phenolic Compounds in Psychotria Leaf Extracts

    Directory of Open Access Journals (Sweden)

    Anelise Samara Nazari Formagio

    2014-11-01

    Full Text Available The antioxidant activity of Psychotria carthagenensis, P. leiocarpa, P. capillacea and P. deflexa (Rubiaceae extracts were investigated, and the concentrations of total phenolics, flavonoids, condensed tannins and flavonols were determined. The chemical compositions of the extracts were investigated using the high performance liquid chromatography (HPLC/PAD method. We used 1,1-diphenyl-1-picrylhydrazyl free radical (DPPH, β-Carotene bleaching and 2,2-azinobis (3-ethylbenzothiazoline-6-sulfonic acid (ABTS radical cations to determine antioxidant activity. The ability to scavenge radical was measured in these experiments by the discoloration of the solution. Concentrations of constituents were measured spectrophotometrically. P. carthagenensis and P. capillacea exhibited the highest antioxidant activity, in the DPPH test, β-carotene bleaching and ABTS system. The highest phenolic, flavonoid, condensed tannin and flavonol concentration was found in P. carthagenensis and P. capillacea extracts. HPLC-PDA analysis of P. carthagenensis and P. capillacea revealed hydroxycinnamic acid (p-coumaric acid. This is the first report on the antioxidant properties and constituent analysis of these Psychotria extracts.

  14. Evaluation of Antibacterial Activity and Total Phenol Compounds of Punica granatum Hydro-Alcoholic Extract

    Directory of Open Access Journals (Sweden)

    Elahe Ahmadi

    2016-12-01

    Full Text Available Background & Objectives: Punica granatum is a non-productive form of a plant and is used for the treatment of diseases in traditional medicine. In this study, we evaluate the antibacterial activity and the total phenol compounds of Punica granatum. Materials & Methods: Disk and well diffusion methods and MIC were used to evaluate the antibacterial activity of hydro-alcoholic extract on S. aureus and E. coli compared to standard commercial antibiotic disks. Measurement of phenol compounds were performed by Seevers and Daly colorimetric methods (Folin-ciocalteu indicator. Results: 35 and 29 mm inhibition zones in S. aureus and 22 and 17 mm inhibition zones in E. coli were shown by disk and well diffusion method, respectively. Also, 7.8 mg/ml concentration of extract showed the MIC points for two bacteria. Phenol compound of extract was 233.15±5.1 mg/g of extraction. Conclusion: Antibacterial effect of Punica granatum compared to antibiotics indicates the strong activity against examined bacteria. Extensive antibacterial study of Punica granatum is suggested.

  15. Cholinesterase inhibition and acetylcholine accumulation following intracerebral administration of paraoxon in rats

    International Nuclear Information System (INIS)

    Ray, A.; Liu, J.; Karanth, S.; Gao, Y.; Brimijoin, S.; Pope, C.

    2009-01-01

    We evaluated the inhibition of striatal cholinesterase activity following intracerebral administration of paraoxon assaying activity either in tissue homogenates ex vivo or by substrate hydrolysis in situ. Artificial cerebrospinal fluid (aCSF) or paraoxon in aCSF was infused unilaterally (0.5 μl/min for 2 h) and ipsilateral and contralateral striata were harvested for ChE assay ex vivo. High paraoxon concentrations were needed to inhibit ipsilateral striatal cholinesterase activity (no inhibition at < 0.1 mM; 27% at 0.1 mM; 79% at 1 mM paraoxon). With 3 mM paraoxon infusion, substantial ChE inhibition was also noted in contralateral striatum. ChE histochemistry generally confirmed these concentration- and side-dependent effects. Microdialysates collected for up to 4 h after paraoxon infusion inhibited ChE activity when added to striatal homogenate, suggesting prolonged efflux of paraoxon. Since paraoxon efflux could complicate acetylcholine analysis, we evaluated the effects of paraoxon (0, 0.03, 0.1, 1, 10 or 100 μM, 1.5 μl/min for 45 min) administered by reverse dialysis through a microdialysis probe. ChE activity was then monitored in situ by perfusing the colorimetric substrate acetylthiocholine through the same probe and measuring product (thiocholine) in dialysates. Concentration-dependent inhibition was noted but reached a plateau of about 70% at 1 μM and higher concentrations. Striatal acetylcholine was below the detection limit at all times with 0.1 μM paraoxon but was transiently elevated (0.5-1.5 h) with 10 μM paraoxon. In vivo paraoxon (0.4 mg/kg, sc) in adult rats elicited about 90% striatal ChE inhibition measured ex vivo, but only about 10% inhibition measured in situ. Histochemical analyses revealed intense AChE and glial fibrillary acidic protein staining near the cannula track, suggesting proliferation of inflammatory cells/glia. The findings suggest that ex vivo and in situ cholinesterase assays can provide very different views into enzyme

  16. Determination of Total Arsenic in Seaweed Products by Neutron Activation Analysis

    International Nuclear Information System (INIS)

    Salim, N.; Santoso, M.; Yanuar, A.; Damayanti; Kartawinata, T.G.

    2013-01-01

    Seaweed products are widely consumed as food nowadays. Seaweeds are known to contain arsenic due to their capability to accumulate arsenic from the environment. Arsenic is a known toxic element which naturally occurs in the environment. Ingestion of high levels of arsenic will cause several adverse health effects. Arsenic in food occurs at trace concentrations which require sensitive and selective analysis methods to perform elemental analysis on. Validated neutron activation analysis was used to determine the arsenic contents in seaweed products namely catoni from domestic product and nori from foreign products. The total arsenic concentration in the samples analyzed ranges from 0.79 mg/kg to 30.14 mg/kg with mean concentration 14.39 mg/kg. The estimated exposure to arsenic contributed by the analyzed products is from 0.07% up to 8.54% of the established provisional tolerable daily intake (PTDI) which is still far below the maximum tolerable level. (author)

  17. Determination of Total Arsenic in Seaweed Products by Neutron Activation Analysis

    Directory of Open Access Journals (Sweden)

    N. Salim

    2013-04-01

    Full Text Available Seaweed products are widely consumed as food nowadays. Seaweeds are known to contain arsenic due to their capability to accumulate arsenic from the environment. Arsenic is a known toxic element which naturally occurs in the environment. Ingestion of high levels of arsenic will cause several adverse health effects. Arsenic in food occurs at trace concentrations which require sensitive and selective analysis methods to perform elemental analysis on. Validated neutron activation analysis was used to determine the arsenic contents in seaweed products namely catoni from domestic product and nori from foreign products. The total arsenic concentration in the samples analyzed ranges from 0.79 mg/kg to 30.14 mg/kg with mean concentration 14.39 mg/kg. The estimated exposure to arsenic contributed by the analyzed products is from 0.07% up to 8.54% of the established provisional tolerable daily intake (PTDI which is still far below the maximum tolerable level

  18. Il rilievo del ponte normanno di Serravalle

    Directory of Open Access Journals (Sweden)

    Fulvio Bernardini

    2015-02-01

    Full Text Available Un ponte normanno che versa in stato di totale abbando no nel contesto unico delle forre laviche ai piedi dell’Etna. Un topog rafo che, nonostante alcune difficoltà logistiche ne effettua il rilievo.An ancient norman bridge in disrepair at the foot of Etna, in Sicily. The project to restore the bridge needed a detailed scale model of the bridge and the surrounding area. The survey proved to be demanding due to the difficult conditions of the area: dense vegetation and steep terrain.

  19. Antioxidant, Phytotoxic and Antiurease Activities, and Total Phenolic ...

    African Journals Online (AJOL)

    Purpose: To evaluate the antioxidant, phytotoxic and anti-urease properties of dichloromethane and methanol extracts of Conocarpus lancifolius in correlation with total phenolic and flavonoid contents. Methods: The whole plant (dried aerial parts and root) of Conocarpus lancifolius was extracted successively with ...

  20. In vivo prompt gamma activation analysis facility for total body nitrogen and cadmium

    International Nuclear Information System (INIS)

    Munive, Marco; Solis, Jose; Revilla, Angel

    2008-01-01

    Full text: Prompt Neutron Activation Analysis (PGNAA) is a technique that could have medical applications, like determination of body's contents of protein and heavy metals in vivo. The in vivo PGNAA facility, contains a neutron source (Cf-252) with safety device, a compartment for animal irradiation, and a gamma rays detecting system based on the NaI(Tl) detector with an analytical software. The prompt gamma rays were emitted after 10 -15 s of the interaction, so they don't produce radioactive waste, and have a characteristics energy for each element, i.e. a strong peak at 2.24 MeV is observed for H. The facility has been used with laboratory mice. Water-filled phantom placed in the neutron beam was used to system calibration. Three study groups of 5 mice each one were selected and were feed with a different diet and the total body nitrogen (TBN) of the mice was monitored with the facility. The diet produced a different TBN for each group. Some mice drunk diluted water with Cl 2 Cd, so the presence of Cd was detected in the mouse. The minimum Cd concentration that the system can detect was 20 ppm. The total dose (neutron and gamma dose was measured from TLDs and simulated by MNCP-4B in the sample compartment during the irradiation time (5 minutes) is less than 2.5 mSv. This total dose is low than the dose from other analytical radiological techniques (25 a 50 mSv). (author)

  1. Total flavonoid content and antioxidant activity in leaves and stems extract of cultivated and wild tabat barito (Ficus deltoidea Jack)

    Science.gov (United States)

    Manurung, Hetty; Kustiawan, Wawan; Kusuma, Irawan W.; Marjenah

    2017-02-01

    Tabat barito (Ficus deltoidea Jack) is a name given by Dayak Tribe who lived in Borneo-Kalimantan and it is belongs to the moraceae. Almost all of the parts of F. deltoidea plant is widely used as a medicinal property. The total flavonoid content (TFC) and antioxidant activity from cultivated and wild F. deltoidea leaves and stems extract were assessed. Total flavonoid content was estimated by using Aluminium chloride colorimetric method and expressed as catechin equivalents (mg CE g-1 extract) and the antioxidant activity by the DPPH (2,2-diphenyl-1-picryl hydrazyl) method. The content of total flavonoid of leaves and stems (430.77 and 371.80 µg CE mg-1 extract) of cultivated F. deltoidea were higher than in the wild leaves and stems (114.82 and 66.67 µg CE mg-1 extract). The IC50 of leaves extract of cultivated and wild F. deltoidea, based on the DPPH assay, has a strong antioxidant activity (34.19 and 39.31 µg mL-1 extract) as compared to stems extract. These results showed that the cultivated F. deltoidea are suitable source for medicinal properties and the leaves could be exploited as source of natural antioxidants.

  2. Total Content of Phenolics and Antioxidant Activity in Crispbreads with Plant By-product addition

    Directory of Open Access Journals (Sweden)

    Konrade Daiga

    2017-11-01

    Full Text Available Vegetable processing in food industry results in significant amount of by-products – peel, mark, bark, seeds still rich in bioactive compounds. Apple, carrot and pumpkin peel and mark may be used for production of crispbreads as functional ingredients. The objective of this study is to investigate the stability of total phenolic content (TPC and antioxidant activity after high temperature and short time (HTST extrusion cooking of a wheat and rice-based crispbreads with addition of apple, carrot and pumpkin by-products obtained after juice extraxtion and dried. Raw materials for crispbread production were wheat flour, rice flour, wheat bran (72%, 24% and 4% respectively with addition of microwave–vacuum dried by-product powder in different amount (5%, 10%, 15%, 20%. Extrusion process was performed by using a laboratory singlescrew extruder GÖTTFERT 1 screw Extrusiometer L series (Germany. Total phenolic content (TPC was determined using the Folin Ciocalteu method. Antioxidant activity was evaluated by free radical 2, 2-diphenyl-1-picrylhydrazyl (DPPH antioxidant scavenging activity using a modified colorimetric method. Comparing different raw formulations, it was observed that the TPC of the apple by-product flour was significantly higher (p < 0.05 than in carrot and pumpkin flour. TPC in cereal-based crispbread was 36.06±1.15 before extrusion and 13.90±1.01 mg GAEg-1 DW (milligram Gallic acid equivalent per 100 g of dry weight (mg GAE 100 g−1 DW after extrusion. Addition of apple BPF increased TPC in crispbreads to 106.25±2.08, carrot BPF 84.73±3.45 and pumpkin BPF to 108.82±1.04 mg GAEg−1 DW. Antioxidant activity of control sample was 1.07±0.01mg TE (Trolox equivalents g−1 DW but in samples with addition of 20% apple by-products, it reached 3.77±0.02 TE g−1 DW for samples wih 20% carrot by-products reached 2.52±0.03TE g−1 DW and for samples wih 20% pumpkin by-products reached 3.77±0.02 TE g−1 DW.

  3. Prothrombin fragment 1+2 in urine as an indicator of sustained coagulation activation after total hip arthroplasty

    DEFF Research Database (Denmark)

    Borris, L.C.; Breindahl, M.; Ryge, C.

    2007-01-01

    Purpose: Prothrombin fragment 1 + 2 measured in spot urine (uF1 + 2) is an indicator of thrombin generation. We examined whether measured levels of uF1 + 2 can be used to differentiate between patients who do and do not acquire sustained coagulation activation after total hip arthroplasty (THA...

  4. Enhancing anaerobic digestion of waste activated sludge by pretreatment: effect of volatile to total solids.

    Science.gov (United States)

    Wang, Xiao; Duan, Xu; Chen, Jianguang; Fang, Kuo; Feng, Leiyu; Yan, Yuanyuan; Zhou, Qi

    2016-01-01

    In this study the effect of volatile to total solids (VS/TS) on anaerobic digestion of waste activated sludge (WAS) pretreated by alkaline, thermal and thermal-alkaline strategies was studied. Experimental results showed that the production of methane from sludge was increased with VS/TS. When anaerobic digesters were fed with sludge pretreated by the thermal-alkaline method, the average methane yield was improved from 2.8 L/d at VS/TS 0.35 to 4.7 L/d at VS/TS 0.56. Also, the efficiency of VS reduction during sludge anaerobic digestion varied between 18.9% and 45.6%, and increased gradually with VS/TS. Mechanism investigation of VS/TS on WAS anaerobic digestion suggested that the general activities of anaerobic microorganisms, activities of key enzymes related to sludge hydrolysis, acidification and methanogenesis, and the ratio of Archaea to Bacteria were all increased with VS/TS, showing good agreement with methane production.

  5. Trasformazione urbana verso la mobilità dolce: il caso di Istanbul

    Directory of Open Access Journals (Sweden)

    Emilia Giovanna Trifiletti

    2008-12-01

    Full Text Available Nell’articolo si descrivono le recenti trasformazioni urbane della città di Istanbul in Turchia in relazione all’implementazione di aree pedonali e all’utilizzo di mobilità dolce. Il sistema trasportistico è stato ampliato ed integrato di recente ed in tempi molto brevi: nei soli ultimi due anni è stata potenziata la linea tranviaria, sono state inaugurate una funicolare ed una teleferica ed è stata realizzata una stazione di interscambio gomma-ferro, ponendo grande attenzione all’integrazione del trasporto su ferro e/o gomma con la mobilità pedonale. Allo stesso modo sono state implementate le linee marittime che collegano le diverse sponde della città ed integrate alle linee su ferro e su gomma. Lo sviluppo e la riqualificazione della città sono dunque stati guidati dalla trasformazione del sistema trasportistico che ha rappresentato il vero motore della riqualificazione urbana. L’antico quartiere di Sultanahmet è stato interamente riqualificato e collegato, attraverso la linea tranviaria veloce che lo attraversa interamente, al resto della città fino ai quartieri più periferici. Allo stesso modo nel quartiere di Beyoglu che, dopo l’indipendenza era caduto in totale rovina, ha riacquistato l’antica eleganza che lo connotava. Il viale dell’Indipendenza (antica Rue De Pera che attraversa tutto il quartiere è stato reso pedonale e con un tram vintage che percorre tutto il viale sono stati collegati il nodo di interscambio Taksim, dotato di metropolitana e funicolare, con il nodo di interscambio Tünel, dotato di tram veloce e trasporto su gomma. Nell’articolo si è inteso evidenziare come la riqualificazione urbana della città sia stata guidata da interventi integrati trasporto/territorio e come i risultati ottenuti, nel caso-studio, siano stati anche il frutto di politiche attente alla sicurezza sociale.

  6. Optimization of extraction conditions of total phenolics, antioxidant activities, and anthocyanin of oregano, thyme, terebinth, and pomegranate.

    Science.gov (United States)

    Rababah, Taha M; Banat, Fawzi; Rababah, Anfal; Ereifej, Khalil; Yang, Wade

    2010-09-01

    The purpose of this study was to evaluate the total phenolic extracts and antioxidant activity and anthocyanins of varieties of the investigated plants. These plants include oregano, thyme, terebinth, and pomegranate. The optimum extraction conditions including temperature and solvent of the extraction process itself were investigated. Total phenolic and anthocyanin extracts were examined according to Folin-Ciocalteu assay and Rabino and Mancinelli method, respectively. The effect of different extracting solvents and temperatures on extracts of phenolic compounds and anthocyanins were studied. Plant samples were evaluated for their antioxidant chemical activity by 2, 2-diphenyl-1-picrylhydrazl assay, to determine their potential as a source of natural antioxidant. Results showed that all tested plants exhibited appreciable amounts of phenolic compounds. The methanolic extract (60 °C) of sour pomegranate peel contained the highest phenolic extract (4952.4 mg/100 g of dry weight). Terebinth green seed had the lowest phenolic extract (599.4 mg/100 g of dry weight). Anthocyanins ranged between 3.5 (terebinth red seed) and 0.2 mg/100 g of dry material (thyme). Significant effect of different extracting solvents and temperatures on total phenolics and anthocyanin extracts were found. The methanol and 60 °C of extraction conditions found to be the best for extracting phenolic compounds. The distilled water and 60 °C extraction conditions found to be the best for extracting anthocyanin.

  7. La fuga dell’‘Io’ narrativo nel romanzo del dopoguerra spagnolo

    Directory of Open Access Journals (Sweden)

    Rosa Pignataro

    2014-10-01

    Full Text Available Il contributo consiste in una proposta di analisi di alcuni dei romanzi più significativi del dopoguerra spagnolo a partire dagli anni ’40 fino agli anni ’60-’70. Mi soffermo ad analizzare la ‘fuga’ dell’‘Io’ dalla narrazione in La familia de Pascual Duarte e La colmena, di Camilo José Cela, El camino di Miguel Delibes e Volverás a Región di Juan Benet. Il primo dei romanzi in esame è marcato dalla presenza forte ed imperante del yo narrativo di Pascual che rappresenta appieno la rotondità dell’autobiografia. La ‘fuga’, l’allontanamento, la disgregazione fino alla totale rottura del patto narrativo tra autore e lettore comincia a concretizzarsi con un romanzo della decade successiva, El camino, in cui un narratore onnisciente filtra l’esperienza autobiografica attraverso gli occhi dei bambini. Il passo successivo è la moltiplicazione infinita della rappresentazione del sé in un mosaico di voci e personaggi narranti ne La colmena. La fuga dell’‘Io’, poi, trova la piena realizzazione nell’opera benetiana Volverás a Región che stigmatizza il totale anonimato narrativo dato da un narratore onnisciente ma che, infrangendo le regole ‘tradizionali’ della narrazione, introduce il lettore in uno spazio dai contorni indefiniti, labili, opachi dove l’‘Io’ fluttua, rivela ciò che i personaggi dicono e sentono ma, confondendone nomi e vicende, testimonia la condizione di rovina dell’esistenza umana.

  8. Lifestyle predictors of oxidant and antioxidant enzyme activities and total antioxidant capacity in healthy women: a cross-sectional study.

    Science.gov (United States)

    Mahasneh, Amjad A; Zhang, Yali; Zhao, Hua; Ambrosone, Christine B; Hong, Chi-Chen

    2016-12-01

    The aim of this study was to identify demographic and modifiable lifestyle factors that may be related to endogenous oxidant and antioxidant activity measured in blood specimens from putatively healthy women recruited at the Roswell Park Cancer Institute (Buffalo, NY, USA). Total glutathione (TGSH), catalase (CAT), CuZn-superoxide dismutase (CuZn-SOD), glutathione peroxidase (GPx), glutathione reductase (GR), and myeloperoxidase (MPO) activity, and total antioxidant capacity (TAC) were measured in 124 healthy women, and associations with epidemiological factors were tested using general linear models. There were significant differences in oxidant and antioxidant enzyme activities according to lifestyle factors, after adjusting for duration of blood storage and season of blood draw. Compared to women who consumed ≤2.8 servings of fruits and vegetables daily, those consuming >5.3 servings had on average 31 % lower MPO activity (p-trend = 0.02), as a marker of oxidative stress, 16 % higher antioxidant GPx activity (p-trend = 0.08), and 9 % higher TAC (p-trend = 0.05). Obese women (body mass index, BMI ≥ 30) in contrast showed 17 % lower antioxidant GPx activity, 44 % higher MPO activity (p-trend = 0.03), and 10 % higher TAC (p-trend = 0.03) compared to women with normal BMI lifestyle factors and, therefore, may be potentially modifiable, with implications for risk reduction of chronic conditions related to oxidative stress.

  9. Quantification of the levels of tannins and total phenols and evaluation of the antioxidant activity of fruits of pepper tree

    Directory of Open Access Journals (Sweden)

    Natália Ribeiro Bernardes

    2011-12-01

    Full Text Available The fruits of pepper tree (Schinus terebinthifolius Raddi are widely used in the world cooking and its consumption has been encouraged since the late 80’s due to the presence of phenolic substances. Therefore, this study quantified the levels of tannins and total phenols in the fruits of pepper tree, aiming at establishing a possible correlation between these substances and their antioxidant activity. Phenolic compounds were extracted with acetone: water (7:3, and quantified by spectrophotometry. The antioxidant activity was measured by DPPH method. The results showed low levels of condensed tannins and total phenols in the peel of the fruit, not being detected hydrolysable tannins in them. Nevertheless, the methanolic extract showed high antioxidant potential, which indicates the absence of a correlation between antioxidant activity and the levels of phenolic compounds in these fruits.

  10. In vitro antimicrobial activity of total extracts of the leaves of Petiveria alliacea L. (Anamu

    Directory of Open Access Journals (Sweden)

    Ania Ochoa Pacheco

    2013-06-01

    Full Text Available The antimicrobial activity of 13 total extracts was evaluated, 10 soft extracts (B and 3 blended extracts (E prepared from dry and fresh leaves of Petiveria alliacea L. Various solvents were used for their preparation: hydroalcoholic solution at 30%, 80% and isopropyl alcohol. The antimicrobial effect of the extracts was tested by means of the method of Kirby-Bauer, using four bacterial strains from the ATCC collection (Escherichia coli, Staphylococcus aureus, Enterococcus faecalis and Pseudomonas aeruginosa and a leveduriform fungus (Candida albicans. The following quality control parameters were determined for most active extracts: physical, physical-chemical and chemical parameters. The results were: nine extracts showed antibacterial activity, being the most concentrated (B8 and E3, the ones with the highest activity in the presence of the bacteria tested; the effect of blended extracts (E1, E2 and E3 was greater in the presence of P. aeruginosa. Blended extracts are considered more potent and active than soft extracts. No antifungal activity was obtained for both types of extracts. The Minimum Inhibitory Concentration (MIC and Minimum Bactericidal Concentration (MBC were determined for both extracts, with the following results: MIC-soft extracts (>100 mg/mL, blended extracts (>50 mg/mL; MBC-soft extracts (≥400 mg/mL, blended extracts (≥200 mg/mL based on fresh leaves.

  11. Louis Blajan, Dottore in Medicina Veterinaria: Il dinamico veterinario che seppe traghettare l’Organizzazione Mondiale per la Sanità Animale (Office International des Épizooties: OIE nel mondo moderno

    Directory of Open Access Journals (Sweden)

    Anon.

    2010-03-01

    Full Text Available Nato il 10 aprile 1924 a Lahage (nell’Alta Garonna, in Francia, Louis Blajan si è spento lo scorso 10 febbraio 2010 a Mont-de-Marsan.Dopo aver frequentato il Lycée Pierre de Fermat di Tolosa, nel 1948 Louis completa gli studi presso la Scuola di Veterinaria di Tolosa. Nel 1949, si diploma all’Institut d’élevage et de médecine vétérinaire des pays tropicaux (IEMVT e dal 1949 al 1952 è nel territorio d’oltremare francese del Mali. Tornato in Francia, dal 1953 al 1968 Louis esercita come veterinario di Stato presso il Ministero dell’Agricoltura, responsabile per l’afta epizootica, la peste suina e la malattia di Newcastle, nonché come Presidente del Comitato consultivo per le malattie infettive. In seguito, viene nominato Ispettore capo veterinario e Responsabile per la politica di controllo delle frontiere.Nel 1952, Louis sposa Janine, moglie affezionata che lo appoggia con ardore in ogni fase della sua carriera e perde la vita in un incidente un mese prima che il marito vada in pensione nel 1990.Dal 1968 al 1977, Louis è Direttore tecnico di Cofranimex (Compagnie Française pour l’importation et l’exportation des animaux reproducteurs et leur semence e dal 1977 al 1978 riveste il ruolo di Direttore dell’Association pour le développement des techniques de l’élevage français (ADETEF.Louis entra a lavorare nell’Office International des Épizooties (oggi noto come Organizzazione Mondiale per la Sanità Animale o ‘OIE’ dove, dal 1978 al 1980, occupa la posizione di Direttore del Dipartimento tecnico. Due anni più tardi, nel 1980, viene eletto Direttore Generale, coronando il sogno di ogni professionista della medicina veterinaria e raggiungendo l’apice della propria carriera. Rieletto nel 1985, si ritira dalla vita lavorativa nel 1990.Durante gli anni in cui fu a capo dell’OIE, Louis seppe trasformare quella che all’epoca era una struttura antiquata in un’organizzazione internazionale moderna ed

  12. Total physical activity volume, physical activity intensity, and metabolic syndrome: 1999-2004 National Health and Nutrition Examination Survey.

    Science.gov (United States)

    Churilla, James R; Fitzhugh, Eugene C

    2012-02-01

    This study examined the association of total physical activity volume (TPAV) and physical activity (PA) from three domains [leisure-time physical activity (LTPA), domestic, transportation] with metabolic syndrome. We also investigated the relationship between LTPA intensity and metabolic syndrome risk. Sample included adults who participated in the 1999-2004 National Health and Nutrition Examination Survey. Physical activity measures were created for TPAV, LTPA, domestic PA, and transportational PA. For each, a six-level measure based upon no PA (level 1) and quintiles (levels 2-6) of metabolic equivalents (MET)·min·wk(-1) was created. A three-level variable associated with the current Department of Health and Human Services (DHHS) PA recommendation was also created. SAS and SUDAAN were used for the statistical analysis. Adults reporting the greatest volume of TPAV and LTPA were found to be 36% [odds ratio (OR) 0.64; 95% confidence interval (CI) 0.49-0.83] and 42% (OR 0.58; 95% CI 0.43-0.77), respectively, less likely to have metabolic syndrome. Domestic and transportational PA provided no specific level of protection from metabolic syndrome. Those reporting a TPAV that met the DHHS PA recommendation were found to be 33% (OR 0.67; 95%; CI 0.55-0.83) less likely to have metabolic syndrome compared to their sedentary counterparts. Adults reporting engaging in only vigorous-intensity LTPA were found to be 37% (OR 0.63; 95 CI 0.42-0.96) to 56% (OR 0.44; 95% CI 0.29-0.67) less likely to have metabolic syndrome. Volume, intensity, and domain of PA may all play important roles in reducing the prevalence and risk of metabolic syndrome.

  13. Comparative Analysis of ?-Oryzanol, ?-Glucan, Total Phenolic Content and Antioxidant Activity in Fermented Rice Bran of Different Varieties

    OpenAIRE

    Jung, Tae-Dong; Shin, Gi-Hae; Kim, Jae-Min; Choi, Sun-Il; Lee, Jin-Ha; Lee, Sang Jong; Park, Seon Ju; Woo, Koan Sik; Oh, Sea Kwan; Lee, Ok-Hawn

    2017-01-01

    Rice bran, a by-product derived from processing rice, is a rich source of bioactive compounds. Recent studies have suggested that the fermentation can improve their biological activities. This study aimed to determined the level of γ-oryzanol, β-glucan and total phenol contents of fermented rice bran from 21 Korean varieties, as well as to evaluate their antioxidant activities. We also assessed the validation of the analytical method for determining γ-oryzanol content in fermented rice brans....

  14. Volatile flavor compounds, total polyphenolic contents and antioxidant activities of a China gingko wine.

    Science.gov (United States)

    Wang, Xu; Xie, Kelin; Zhuang, Haining; Ye, Ran; Fang, Zhongxiang; Feng, Tao

    2015-09-01

    The volatile compounds in gingko wine, a novel functional wine, were extracted by head-space solid phase micro-extraction (SPME) and analyzed by gas chromatography-mass spectrometry (GC-MS) coupled with odor activity value (OAV) and relative odor contribution (ROC) analyses. In addition, the total polyphenolic content of gingko wine was determined using the Folin-Ciocalteu reagent, and its antioxidant capacity was evaluated by 1,1-diphenyl-2-picrylhydrazyl (DPPH) and 2,2'-azinobis(3-ethylbenzothiazoline-6-sulfonic acid) (ABTS) assays. Fifty-eight compounds were tentatively identified, including 13 esters, 10 alcohols, 11 acids, 12 carbonyl compounds, 2 lactones, 2 phenols, and 8 hydrocarbons. Ethyl hexanoate, ethyl pentanoate, nonanal, ethyl butyrate and ethyl heptanoate were the major contributors to the gingko wine aroma based on the results of OAV and ROC. The total phenols content of the gingko wine was 456 mg/L gallic acid equivalents, and its antioxidant capacity was higher than those of typical Chinese liquors analyzed in this paper. Copyright © 2015 Elsevier Ltd. All rights reserved.

  15. Deciphering chemotaxis pathways using cross species comparisons

    Directory of Open Access Journals (Sweden)

    Armitage Judith P

    2010-01-01

    Full Text Available Abstract Background Chemotaxis is the process by which motile bacteria sense their chemical environment and move towards more favourable conditions. Escherichia coli utilises a single sensory pathway, but little is known about signalling pathways in species with more complex systems. Results To investigate whether chemotaxis pathways in other bacteria follow the E. coli paradigm, we analysed 206 species encoding at least 1 homologue of each of the 5 core chemotaxis proteins (CheA, CheB, CheR, CheW and CheY. 61 species encode more than one of all of these 5 proteins, suggesting they have multiple chemotaxis pathways. Operon information is not available for most bacteria, so we developed a novel statistical approach to cluster che genes into putative operons. Using operon-based models, we reconstructed putative chemotaxis pathways for all 206 species. We show that cheA-cheW and cheR-cheB have strong preferences to occur in the same operon as two-gene blocks, which may reflect a functional requirement for co-transcription. However, other che genes, most notably cheY, are more dispersed on the genome. Comparison of our operons with shuffled equivalents demonstrates that specific patterns of genomic location may be a determining factor for the observed in vivo chemotaxis pathways. We then examined the chemotaxis pathways of Rhodobacter sphaeroides. Here, the PpfA protein is known to be critical for correct partitioning of proteins in the cytoplasmically-localised pathway. We found ppfA in che operons of many species, suggesting that partitioning of cytoplasmic Che protein clusters is common. We also examined the apparently non-typical chemotaxis components, CheA3, CheA4 and CheY6. We found that though variants of CheA proteins are rare, the CheY6 variant may be a common type of CheY, with a significantly disordered C-terminal region which may be functionally significant. Conclusions We find that many bacterial species potentially have multiple

  16. Comparative Analysis of γ-Oryzanol, β-Glucan, Total Phenolic Content and Antioxidant Activity in Fermented Rice Bran of Different Varieties.

    Science.gov (United States)

    Jung, Tae-Dong; Shin, Gi-Hae; Kim, Jae-Min; Choi, Sun-Il; Lee, Jin-Ha; Lee, Sang Jong; Park, Seon Ju; Woo, Koan Sik; Oh, Sea Kwan; Lee, Ok-Hawn

    2017-06-03

    Rice bran, a by-product derived from processing rice, is a rich source of bioactive compounds. Recent studies have suggested that the fermentation can improve their biological activities. This study aimed to determined the level of γ-oryzanol, β-glucan and total phenol contents of fermented rice bran from 21 Korean varieties, as well as to evaluate their antioxidant activities. We also assessed the validation of the analytical method for determining γ-oryzanol content in fermented rice brans. Among the fermented rice brans, the Haedam rice bran contained the highest level of total phenol content (156.08 mg gallic acid equivalents/g), DPPH (2,2-diphenyl-1-picrylhydrazyl) radical scavenging activity (71.30%) and ORAC (Oxygen radical absorbance capacity) value (1101.31 μM trolox equivalents/g). Furthermore, the fermented Migwang rice bran showed the highest level of γ-oryzanol content (294.77 ± 6.74 mg/100 g).

  17. Quality control on the accuracy of the total Beta activity index in different sample matrices water

    International Nuclear Information System (INIS)

    Pujol, L.; Pablo, M. A. de; Payeras, J.

    2013-01-01

    The standard ISO/IEC 17025:2005 of general requirements for the technical competence of testing and calibration laboratories, provides that a laboratory shall have quality control procedures for monitoring the validity of tests and calibrations ago. In this paper, the experience of Isotopic Applications Laboratory (CEDEX) in controlling the accuracy rate of total beta activity in samples of drinking water, inland waters and marine waters is presented. (Author)

  18. The influence of ripening stage and cultivation system on the total antioxidant activity and total phenolic compounds of yellow passion fruit pulp.

    Science.gov (United States)

    Macoris, Mariana S; De Marchi, Renata; Janzantti, Natália S; Monteiro, Magali

    2012-07-01

    This work aimed to investigate the influence of both ripening stage and cultivation system on the total phenolic compounds (TPC) and total antioxidant activity (TAA) of passion fruit pulp. TPC extraction was optimized using a 2³ central composed design. The variables were fruit pulp volume, methanol volume and extraction solution volume. TPC was determined using the Folin-Ciocalteu reaction, and TAA using the ABTS radical reaction. The conditions to extract TPC were 2 mL passion fruit pulp and 9 mL extraction solution containing 40% methanol:water (v/v). TPC values increased in the passion fruit pulp during ripening for both cultivation systems, ranging from 281.8 to 361.9 mg gallic acid L⁻¹ (P ≤ 0.05) for the organic pulp and from 291.0 to 338.6 mg gallic acid L⁻¹ (P ≤ 0.05) for the conventional pulp. TPC values increased during ripening for both organic and conventional passion fruit. The same was true for TAA values for conventional passion fruit. For organic passion fruit, however, TAA values were highest at the initial ripening stages. These results suggest that antioxidant compounds exert strong influence on the initial ripening stages for organic passion fruit, when TPC still did not reach its maximum level. Copyright © 2012 Society of Chemical Industry.

  19. Hydrogen Exchange Mass Spectrometry of Functional Membrane-bound Chemotaxis Receptor Complexes

    Science.gov (United States)

    Koshy, Seena S.; Eyles, Stephen J.; Weis, Robert M.; Thompson, Lynmarie K.

    2014-01-01

    The transmembrane signaling mechanism of bacterial chemotaxis receptors is thought to involve changes in receptor conformation and dynamics. The receptors function in ternary complexes with two other proteins, CheA and CheW, that form extended membrane-bound arrays. Previous studies have shown that attractant binding induces a small (~2 Å) piston displacement of one helix of the periplasmic and transmembrane domains towards the cytoplasm, but it is not clear how this signal propagates through the cytoplasmic domain to control the kinase activity of the CheA bound at the membrane-distal tip, nearly 200 Å away. The cytoplasmic domain has been shown to be highly dynamic, which raises the question of how a small piston motion could propagate through a dynamic domain to control CheA kinase activity. To address this, we have developed a method for measuring dynamics of the receptor cytoplasmic fragment (CF) in functional complexes with CheA and CheW. Hydrogen exchange mass spectrometry (HDX-MS) measurements of global exchange of CF demonstrate that CF exhibits significantly slower exchange in functional complexes than in solution. Since the exchange rates in functional complexes are comparable to that of other proteins of similar structure, the CF appears to be a well-structured protein within these complexes, which is compatible with its role in propagating a signal that appears to be a tiny conformational change in the periplasmic and transmembrane domains of the receptor. We also demonstrate the feasibility of this protocol for local exchange measurements, by incorporating a pepsin digest step to produce peptides with 87% sequence coverage and only 20% back exchange. This method extends HDX-MS to membrane-bound functional complexes without detergents that may perturb the stability or structure of the system. PMID:24274333

  20. Evaluation of extracts and essential oil from Callistemon viminalis leaves: antibacterial and antioxidant activities, total phenolic and flavonoid contents.

    Science.gov (United States)

    Salem, Mohamed Z M; Ali, Hayssam M; El-Shanhorey, Nader A; Abdel-Megeed, Ahmed

    2013-10-01

    To investigate antioxidant and antibacterial activities of Callistemon viminalis (C. viminalis) leaves. The essential oil of C. viminalis leaves obtained by hydro-distillation was analyzed by GC/MS. Different extracts were tested for total phenolic and flavonoid contents and in vitro antioxidant (DPPH assay) and antibacterial (agar disc diffusion and 96-well micro-plates methods) actives. Fourteen components were identified in the essential oil, representing 98.94% of the total oil. The major components were 1,8-cineole (64.53%) and α-pinene (9.69%). Leaf essential oil exhibited the highest antioxidant activity of (88.60±1.51)% comparable to gallic acid, a standard compound [(80.00±2.12)%]. Additionally, the biggest zone of inhibitions against the studied bacterial strains was observed by the essential oil when compared to the standard antibiotic (tetracycline). The crude methanol extract and ethyl acetate fraction had a significant antibacterial activity against the tested bacterial strains. It can be suggested that C. viminalis is a great potential source of antibacterial and antioxidant compounds useful for new antimicrobial drugs from the natural basis. The present study revealed that the essential oil as well as the methanol extracts and ethyl acetate fraction of C. viminalis leaves exhibited highly significant antibacterial activity against the tested bacterial strains. Copyright © 2013 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  1. A Longitudinal Study of Predictors of Sexual Dysfunction in Men on Active Surveillance for Prostate Cancer

    Directory of Open Access Journals (Sweden)

    Shane M. Pearce, MD

    2015-09-01

    Conclusions: Men on AS experienced a gradual decline in sexual function during the first 24 months of enrollment. Older age, PSA × time, and diabetes were all independent predictors of diminished sexual function over time. Anxiety, AUA‐SI, the number of cores and the number of biopsies were not predictors of reduced sexual function in men in AS. Pearce SM, Wang CHE, Victorson DE, Helfand BT, Novakovic KR, Brendler CB, and Albaugh JA. A longitudinal study of predictors of sexual dysfunction in men on active surveillance for prostate cancer. Sex Med 2015;3:156–164.

  2. Total volume versus bouts

    DEFF Research Database (Denmark)

    Chinapaw, Mai; Klakk, Heidi; Møller, Niels Christian

    2018-01-01

    BACKGROUND/OBJECTIVES: Examine the prospective relationship of total volume versus bouts of sedentary behaviour (SB) and moderate-to-vigorous physical activity (MVPA) with cardiometabolic risk in children. In addition, the moderating effects of weight status and MVPA were explored. SUBJECTS....../METHODS: Longitudinal study including 454 primary school children (mean age 10.3 years). Total volume and bouts (i.e. ≥10 min consecutive minutes) of MVPA and SB were assessed by accelerometry in Nov 2009/Jan 2010 (T1) and Aug/Oct 2010 (T2). Triglycerides, total cholesterol/HDL cholesterol ratio (TC:HDLC ratio......, with or without mutual adjustments between MVPA and SB. The moderating effects of weight status and MVPA (for SB only) were examined by adding interaction terms. RESULTS: Children engaged daily in about 60 min of total MVPA and 0-15 min/week in MVPA bouts. Mean total sedentary time was around 7 h/day with over 3...

  3. Curing Ingredients, Characteristics, Total Phenolic, and Antioxidant Activity of Commercial Indonesian Dried Meat Product (Dendeng

    Directory of Open Access Journals (Sweden)

    T. Suryati

    2012-08-01

    Full Text Available Dendeng is Indonesian dried meat product that used spices rich in antioxidant component as ingredient. In addition, commercial dendeng usually use saltpeter (nitrate/nitrite salt as curing ingredient to inhibit rancidity and to produce stable red color. The aims of this study were to investigate composition of spices and saltpeter added, characteristic, total phenolic, and antioxidant activity of commercial dendeng. This research was conducted through interview with some dendeng producers to get information about saltpeter adding and spices composition used in their products. Then the interview results were verified by laboratory analysis. The results showed that spices and saltpeter adding from some producers varied. The saltpeter added in curing process produced inconsistent red color on commercial dendeng in this investigation. Total phenolic of dendeng from producers ranged from 42.47 to 102.0 mg GAE/100 g DM for raw dendeng, and 36.51 to 95.49 mg GAE/100 g DM for fried dendeng. Antioxidant capacity against DPPH ranged from 79.35 to 379.40 mg VCE/100 g DM for raw dendeng, and 94.30 to 559.40 mg VCE/100 g DM for fried dendeng. Antioxidant capacity of raw dendeng was influenced by phenolic content about 87.2%, but in fried dendeng was only 59.0%. In conclusion, dendeng has a significant antioxidant activity, even after frying, and saltpeter addition was not effective to maintain stable red color in dendeng products.

  4. Effect of climate change on phytochemical diversity, total phenolic content and in vitro antioxidant activity of Aloe vera (L.) Burm.f.

    Science.gov (United States)

    Kumar, Sandeep; Yadav, Amita; Yadav, Manila; Yadav, Jaya Parkash

    2017-01-25

    The aim of the present study was to analyse the effect of climate change on phytochemicals, total phenolic content (TPC) and antioxidant potential of methanolic extracts of Aloe vera collected from different climatic zones of the India. Crude methanolic extracts of A. vera from the different states of India were screened for presence of various phytochemicals, total phenolic content and in vitro antioxidant activity. Total phenolic content was tested by Folin-Ciocalteau reagent based assay whilst DPPH free radical scavenging assay, metal chelating assay, hydrogen peroxide scavenging assay, reducing power assay and β carotene-linoleic assay were used to assess the antioxidant potential of A. vera methanolic leaf extracts. Alkaloids, phenols, flavonoids, saponins, and terpenes were the main phytochemicals presents in all accessions. A significant positive correlation was found between TPC and antioxidant activity of different accessions. Extracts of highland and semi-arid zones possessed maximum antioxidant potential. Accessions from tropical zones showed the least antioxidant activity in all assays. It could be concluded that different agro-climatic conditions have effects on the phytochemicals, total phenolic content (TPC) and antioxidant potential of the A. vera plant. The results reveal that A. vera can be a potential source of novel natural antioxidant compounds.

  5. Comparative Analysis of γ-Oryzanol, β-Glucan, Total Phenolic Content and Antioxidant Activity in Fermented Rice Bran of Different Varieties

    Directory of Open Access Journals (Sweden)

    Tae-Dong Jung

    2017-06-01

    Full Text Available Rice bran, a by-product derived from processing rice, is a rich source of bioactive compounds. Recent studies have suggested that the fermentation can improve their biological activities. This study aimed to determined the level of γ-oryzanol, β-glucan and total phenol contents of fermented rice bran from 21 Korean varieties, as well as to evaluate their antioxidant activities. We also assessed the validation of the analytical method for determining γ-oryzanol content in fermented rice brans. Among the fermented rice brans, the Haedam rice bran contained the highest level of total phenol content (156.08 mg gallic acid equivalents/g, DPPH (2,2-diphenyl-1-picrylhydrazyl radical scavenging activity (71.30% and ORAC (Oxygen radical absorbance capacity value (1101.31 μM trolox equivalents/g. Furthermore, the fermented Migwang rice bran showed the highest level of γ-oryzanol content (294.77 ± 6.74 mg/100 g.

  6. ISCO'S LONG-TERM IMPACT ON AQUIFER CONDITIONS AND MICROBIAL ACTIVITY

    Science.gov (United States)

    Permanganate has been successfully used in in-situ chemical oxidation (ISCO) to transform a wide range of organic contaminants under diverse geologic and geochemical conditions. Here, a critical analysis is presented of several technical issues commonly raised during in-situ che...

  7. Total 2004 fact book

    International Nuclear Information System (INIS)

    2004-01-01

    This report presents the activities and results of the Group Total-Fina-Elf for the year 2004. It brings information and economic data on the following topics: the corporate and business; the upstream activities with the reserves, the costs, standardized measure and changes of discounted future net cash flow,oil and gas acreage, drilling, liquefied natural gas, pipelines; downstream activities with refining and marketing maps, refinery, petroleum products, sales, retail gasoline outlets; chemicals with sales and operating income by sector, major applications, base chemicals and polymers, intermediates and performance polymers. (A.L.B.)

  8. Sports Activity after Low-contact-stress Total Knee Arthroplasty - A long term follow-up study.

    Science.gov (United States)

    Vielgut, Ines; Leitner, Lukas; Kastner, Norbert; Radl, Roman; Leithner, Andreas; Sadoghi, Patrick

    2016-04-19

    The purpose of this study was to provide comprehensive long-term data about sports activity levels in patients following total knee arthroplasty (TKA) and to determine the impact of pre-operative function, pain and specific performed sports on the results. 236 patients who have undergone TKA for severe osteoarthritis of the knee were asked to provide specific information regarding exercised types of sports before surgery and after at least 10 years following TKA. Pre- and postoperative function and pain were evaluated by the use of Tegner-, WOMAC- and VAS Score. After a mean of 14.9 years, a significant improvement regarding pain and function was observed. Pre-operative Tegner- and WOMAC scores revealed significant positive correlations with the post-operative Tegner-Score. Accordingly, a high percentage of patients (70.9%) stayed actively involved in sports. Nevertheless, the number of performing patients has decreased according to the sports impact. 71.3% continued practising low-impact-, 43.7% intermediate-impact sports whereas only 16.4% kept performing high impact sports. We conclude that TKA is highly effective in long-time pain reduction as well as improvement of function. Additionally, we found considerable sports activities preserved in the investigated series. However, sports activities in particular, seem to decrease according to the impact of sports.

  9. Changes of serum pancreatic stone protein and cholinesterase contents in children with sepsis and their correlation with systemic inflammatory response and target organ damage

    Directory of Open Access Journals (Sweden)

    Zhi-Hong Ren

    2017-10-01

    Full Text Available Objective: To study the changes of serum pancreatic stone protein (PSP and cholinesterase (ChE contents in children with sepsis and their correlation with systemic inflammatory response and target organ damage. Methods: A total of 64 children with sepsis who were treated in the hospital between January 2015 and January 2017 were selected as observation group, and 50 healthy children who received vaccination in the hospital during the same period were selected as normal control group. The contents of PSP, ChE, inflammatory factors as well as liver and kidney function indexes in the two groups were detected. Pearson test was used to assess the correlation of serum PSP and ChE contents with systemic inflammatory response and target organ damage in children with sepsis. Results: Serum PSP content of observation group was higher than that of control group while ChE content was lower than that of control group; serum inflammatory factors PCT, CRP, IL-1, IL-6 and IL-10 contents of observation group were higher than those of normal control group; liver function indexes TBIL, ALT and AST contents were higher than those of normal control group; kidney function indexes Scr and BUN contents were higher than those of normal control group. Pearson test showed that the serum PSP and ChE contents in children with sepsis were directly correlated with the systemic inflammatory response as well as liver and renal function injury. Conclusion: Serum PSP content significantly increases while ChE content significantly decreases in children with sepsis and the specific change is directly correlated with the overall disease severity.

  10. Agronomic performance of new open pollinated experimental lines of broccoli (Brassica oleracea L. var. italica) evaluated under organic farming.

    Science.gov (United States)

    Sahamishirazi, Samira; Moehring, Jens; Zikeli, Sabine; Fleck, Michael; Claupein, Wilhelm; Graeff-Hoenninger, Simone

    2018-01-01

    In order to develop new open pollinating cultivars of broccoli for organic farming, two experiments were conducted during fall 2015 and spring 2016. This study was aimed at comparing the agronomic performance of eleven new open pollinating breeding lines of broccoli to introduce new lines and to test their seasonal suitability for organic farming. Field experiments were carried out at the organic research station Kleinhohenheim of the University of Hohenheim (Stuttgart-Germany). Different agronomic traits total biomass fresh weight, head fresh weight, head diameter, hollow-stem, fresh weight harvest index and marketable yield were assessed together with commercial control cultivars. The data from both experiments were analyzed using a two-stage mixed model approach. In our study, genotype, growing season and their interaction had significant effects on most traits. Plants belonging to the fall growing season had bigger sizes in comparison to spring with significantly (pbroccoli heads. The low average minimum temperatures during the spring growing season lead to low biomass fresh weight but high fresh weight harvest index. Testing the seasonal suitability of all open pollinating lines showed that the considered fall season was better for broccoli production. However, the change in yield between the fall and the spring growing season was not significant for "Line 701" and "CHE-MIC". Considering the expression of different agronomic traits, "CHE-GRE-G", "Calinaro" and "CAN-SPB" performed the best in the fall growing season, and "CHE-GRE-G", "CHE-GRE-A", "CHE-BAL-A" and "CHE-MIC" and "Line 701" were best in the spring growing season, specifically due to the highest marketable yield and proportion of marketable heads.

  11. Investigation of the effect of support thermal treatment on gold-based catalysts' activity towards propene total oxidation

    International Nuclear Information System (INIS)

    Lamallem, M.; Cousin, R.; Thomas, R.; Siffert, St.; Aissi, F.; Aboukais, A.

    2009-01-01

    This paper reports a study on the effect of support thermal treatment on the activity of gold-based catalysts for the total oxidation of propene. Ce 0.3 Ti 0.7 O 2 supports were prepared using sol-gel method. These compounds are calcined at 400, 500 and 600 C. Physico-chemical properties of synthesized materials were characterized by means of XRD, DR/UV-vis and H 2 -TPR. Then gold was deposited on these supports by the deposition precipitation method. Thus the catalytic activity of these solids in the propene oxidation was evaluated. On the basis of the catalytic results, a better activity is obtained when gold is deposited on Ce 0.3 Ti 0.7 O 2 support previously calcined at 400 C under air. (authors)

  12. Doutorado sanduíche: considerações para uma experiência de sucesso no exterior Doctorado sándwich: consideraciones para una experiencia exitosa en el extranjero 'Sandwich PhD': considerations for a successful experience abroad

    Directory of Open Access Journals (Sweden)

    Marina de Goes Salvetti

    2013-03-01

    Full Text Available O estágio de doutorado no exterior, conhecido, no Brasil, como "Doutorado Sanduíche", é uma oportunidade de aprimorar as habilidades em pesquisa, destacar-se no meio acadêmico e estabelecer e/ou ampliar oportunidades de trabalho em contexto internacional. Neste artigo, descrevemos elementos-chave do processo de planejamento e desenvolvimento do Doutorado Sanduíche aprendidos por professores e alunos envolvidos na colaboração entre a Escola de Enfermagem da Universidade de São Paulo e a Lawrence S. Bloomberg Faculty of Nursing, Universidade de Toronto, Canadá, e apresentamos a participação em uma rede de doutorados, como alternativa ao Doutorado Sanduíche. A experiência internacional, quando bem planejada e desenvolvida, promove o desenvolvimento pessoal e profissional do aluno, favorece a internacionalização dos programas de pós-graduação e dos grupos de pesquisa brasileiros.Una estancia de doctorado internacional, "Doctorado Sándwich" como es conocido en Brasil, es una oportunidad de mejorar las habilidades de investigación, hacerse conocido académicamente y establecer y/o agrandar las oportunidades de trabajo en el contexto internacional. En este artículo, nosotros describimos factores importantes del proceso de la planificación y desarrollo del "Doctorado Sándwich" aprendidos por estudiantes y profesores involucrados en la colaboración entre la Escuela de Enfermería de la Universidad de São Paulo y la Facultad de Enfermería Lawrence S. Bloomberg, Universidad de Toronto, Canadá y presentamos la participación en una red de doctorados como una alternativa a la estancia doctoral internacional. La experiencia internacional, cuando bien planeada y desarrollada, promueve el desarrollo personal y profesional del estudiante y favorece la internacionalización de los programas de postgrado y de los grupos de investigación brasileños.International PhD internship, named "Sandwich PhD'" in Brazil, is an opportunity to

  13. Effect of Sulfites on Antioxidant Activity, Total Polyphenols, and Flavonoid Measurements in White Wine.

    Science.gov (United States)

    Nardini, Mirella; Garaguso, Ivana

    2018-03-09

    Polyphenols content and antioxidant activity are directly related to the quality of wine. Wine also contains sulfites, which are added during the winemaking process. The present study aimed to evaluate the effects of sulfites on the assays commonly used to measure the antioxidant activity and polyphenols and flavonoids content of white wines. The effects of sulfites were explored both in the standard assays and in white wine. The addition of sulfites (at 1-10 μg) in the standard assays resulted in a significant, positive interference in the Folin-Ciocalteu's assay used for polyphenols measurements and in both the Ferric Reducing Antioxidant Power and 2,2'-azino-bis (3-ethylbenzothiazoline-6-sulfonic acid) diammonium salt radical cation decolorization assays, which were used for antioxidant activity evaluation. A negative interference of sulfites (at 1-20 μg) was observed for the colorimetric aluminium-chloride flavonoids assay. The addition of sulfites to organic white wines (at 25-200 mg/L wine) clearly resulted in a significant overestimation of antioxidant activity and polyphenols content, and in an underestimation of flavonoids concentration. To overcome sulfite interferences, white wines were treated with cross-linked polyvinylpyrrolidone. The total polyphenols content and antioxidant activity measurements obtained after polyvinylpyrrolidone treatment were significantly lower than those obtained in the untreated wines. Flavonoids were expected to be higher after polyvinylpyrrolidone treatment, but were instead found to be lower than for untreated wines, suggesting that in addition to sulfites, other non-phenolic reducing compounds were present in white wine and interfered with the flavonoid assay. In view of our results, we advise that a purification procedure should be applied in order to evaluate the quality of white wine.

  14. Impact of Altitudes and Habitats on Valerenic Acid, Total Phenolics, Flavonoids, Tannins, and Antioxidant Activity of Valeriana jatamansi.

    Science.gov (United States)

    Jugran, Arun K; Bahukhandi, Amit; Dhyani, Praveen; Bhatt, Indra D; Rawal, Ranbeer S; Nandi, Shyamal K

    2016-07-01

    The changes in total phenolics, flavonoids, tannins, valerenic acid, and antioxidant activity were assessed in 25 populations of Valeriana jatamansi sampled from 1200 to 2775 m asl and four habitat types of Uttarakhand, West Himalaya. Significant (p analysis, and principal component analysis (PCA) identified Talwari, Jaberkhet, Manjkhali, and Khirshu populations as promising sources with higher phytochemicals and antioxidant activity. The results recommended that the identified populations with higher value of phytochemicals and antioxidants can be utilized for mass multiplication and breeding program to meet the domestic as well as commercial demand.

  15. Mechanism of soman-induced contractions in canine tracheal smooth muscle. (Reannouncement with new availability information)

    Energy Technology Data Exchange (ETDEWEB)

    Adler, M.; Moore, D.H.; Filbert, M.G.

    1992-12-31

    The actions of the irreversible organophosphorus cholinesterase (ChE) inhibitor soman were investigated on canine trachea smooth muscle in vitro. Concentrations of soman > or - 1 nM increased the amplitude and decay of contractions elicited by electric field stimulation. The effect on decay showed a marked dependence on stimulation frequency, undergoing a 2.4-fold increase between 3 and 60 Hz. Soman also potentiated tensions due to bath applied acetylcholine (ACh). Little or no potentiation was observed for contractions elicited by carbamylcholine, an agonist that is not hydrolyzed by ChE. Concentration of soman > or - 3 nM led to the appearance of sustained contractures. These contractures developed with a delayed onset and were well correlated with ChE activity. Alkylation of muscarinic receptors by propylbenzilylcholine mustard antagonized the actions of soman on both spontaneous and electrically-evoked muscle contractions. The results are consistent with a mechanism in which the toxic actions of soman are mediated by accumulation of neurally-released ACh secondary to inhibition of ChE activity. An important factor in this accumulation is suggested to be the buffering effect of the muscarinic receptors on the efflux of ACh from the neuroeffector junction. Tracheal smooth muscle, Cholinesterase inhibitors, Muscarinic receptor, Soman, Organophosphate.

  16. Carqueja (Baccharis trimera Protects against Oxidative Stress and β-Amyloid-Induced Toxicity in Caenorhabditis elegans

    Directory of Open Access Journals (Sweden)

    Franciny Aparecida Paiva

    2015-01-01

    Full Text Available Carqueja (Baccharis trimera is a native plant found throughout South America. Several studies have shown that Carqueja has antioxidant activity in vitro, as well as anti-inflammatory, antidiabetic, analgesic, antihepatotoxic, and antimutagenic properties. However, studies regarding its antioxidant potential in vivo are limited. In this study, we used Caenorhabditis elegans as a model to examine the antioxidant effects of a Carqueja hydroalcoholic extract (CHE on stress resistance and lifespan and to investigate whether CHE has a protective effect in a C. elegans model for Alzheimer's disease. Here, we show for the first time, using in vivo assays, that CHE treatment improved oxidative stress resistance by increasing survival rate and by reducing ROS levels under oxidative stress conditions independently of the stress-related signaling pathways (p38, JNK, and ERK and transcription factors (SKN-1/Nrf and DAF-16/Foxo tested here. CHE treatment also increased the defenses against β-amyloid toxicity in C. elegans, in part by increasing proteasome activity and the expression of two heat shock protein genes. Our findings suggest a potential neuroprotective use for Carqueja, supporting the idea that dietary antioxidants are a promising approach to boost the defensive systems against stress and neurodegeneration.

  17. Partial protection from organophosphate-induced cholinesterase inhibition by metyrapone treatment

    Directory of Open Access Journals (Sweden)

    Radosław Świercz

    2013-08-01

    Full Text Available Background: Organophosphates are cholinesterase (ChE inhibitors with worldwide use as insecticides. Stress response, evidenced by a dramatic and relatively long-lasting (several hours rise in the plasma glucocorticoid concentration is an integral element of the organophosphate (OP poisoning symptomatology. In rodents, corticosterone (CORT is the main glucocorticoid. There are several reports suggesting a relationship between the stressor-induced rise in CORT concentraion (the CORT response and the activity of the cerebral and peripheral ChE. Thus, it seems reasonable to presume that, in OP intoxication, the rise in plasma CORT concentration may somehow affect the magnitude of the OP-induced ChE inhibition. Metyrapone (MET [2-methyl-1,2-di(pyridin-3-ylpropan-1-one] blocks CORT synthesis by inhibiting steoid 11β-hydroxylase, thereby preventing the CORT response. Chlorfenvinphos (CVP [2-chloro-1-(2,4-dichlorophenyl ethenyl diethyl phosphate] is an organophosphate insecticide still in use in some countries. Material and Methods: The purose of the present work was to compare the CVP-induced effects - the rise of the plasma CORT concentration and the reduction in ChE activity - in MET-treated and MET-untreated rats. Chlorfenvinphos was administered once at 0.0, 0.5, 1.0 and 3.0 mg/kg i.p. Metyrapone, at 100 mg/kg i.p., was administered five times, at 24-h intervals. The first MET dose was given two hours before CVP. Conclusion: The following was observed in the MET-treated rats: i no rise in plasma CORT concentration after the CVP administration, ii a reduced inhibition and a faster restitution of blood and brain ChE activities. The results suggest that MET treatment may confer significant protection against at least some effects of OP poisoning. The likely mechanism of the protective MET action has been discussed.

  18. [Hygienic evaluation of the total mutagenic activity of snow samples from Magnitogorsk].

    Science.gov (United States)

    Legostaeva, T B; Ingel', F I; Antipanova, N A; Iurchenko, V V; Iuretseva, N A; Kotliar, N N

    2010-01-01

    The paper gives the results of 4-year monitoring of the total mutagenic activity of snow samples from different Magnitogork areas in a test for induction of dominant lethal mutations (DLM) in the gametes of Drosophila melanogaster. An association was first found between the rate of DLM and the content of some chemical compounds in the ambient air and snow samples; moreover all the substances present in the samples, which had found genotoxic effects, showed a positive correlation with the rate of DLM. Furthermore, direct correlations were first established between the rate of DLM and the air pollution index and morbidity rates in 5-7-year-old children residing in the areas under study. The findings allow the test for induction of dominant lethal mutations (DLM) in the gametes of Drosophila melanogaster to be recommended due to its unique informative and prognostic value for monitoring ambient air pollution and for extensive use in the risk assessment system.

  19. Determination of biological activities and total phenolic contents of flowers of jasminum humile and roots of dorema aucheri

    International Nuclear Information System (INIS)

    Khan, A.; Farooq, U.; Ullah, F.; Iqbal, J.

    2014-01-01

    The present study was designed to investigate in vitro antioxidant, NO scavenging, and antibacterial activities as well as total phenolic contents of different extracts of flowers of Jasminum humile and roots of Dorema aucheri. The plant extracts showed significant antioxidant activity, having IC50 values comparable to those of references used in each assay and also inhibited accumulation of nitrite in vitro. The plant extracts yielded phenolic contents and showed significant antibacterial activity. The observed antioxidant potential and phenolic contents of the extracts showed that flowers of J. humile and roots of D. aucheri are potential source of natural antioxidants that may help to retard oxidative degradation and microbial growth in food industry. (author)

  20. Impact Of Total Quality Management (TQM), Activity Based Costing ...

    African Journals Online (AJOL)

    Time (JIT), and Total Quality Management (TQM) as strategic initiatives lead to improved financial performance in the Turkish textile industry. Strong evidence emerged that there is a strong positive association between using ABC, JIT or TQM ...

  1. Daily total physical activity level and premature death in men and women: results from a large-scale population-based cohort study in Japan (JPHC study).

    Science.gov (United States)

    Inoue, Manami; Iso, Hiroyasu; Yamamoto, Seiichiro; Kurahashi, Norie; Iwasaki, Motoki; Sasazuki, Shizuka; Tsugane, Shoichiro

    2008-07-01

    The impact of daily total physical activity level on premature deaths has not been fully clarified in non-Western, relatively lean populations. We prospectively examined the association between daily total physical activity level (METs/day) and subsequent risk of all-cause mortality and mortalities from cancer, heart disease, and cerebrovascular disease. A total of 83,034 general Japanese citizens ages 45-74 years who responded to the questionnaire in 1995-1999 were followed for any cause of death through December 2005. Mutlivariate-adjusted hazard ratios were calculated with a Cox proportional hazards model controlling for potential confounding factors. During follow-up, a total of 4564 deaths were recorded. Compared with subjects in the lowest quartile, increased daily total physical activity was associated with a significantly decreased risk of all-cause mortality in both sexes (hazard ratios for the second, third, and highest quartiles were: men, 0.79, 0.82, 0.73 and women, 0.75, 0.64, 0.61, respectively). The decreased risk was observed regardless of age, frequency of leisure-time sports or physical exercise, or obesity status, albeit with a degree of risk attenuation among those with a high body mass index. A significantly decreased risk was similarly observed for death from cancer and heart disease in both sexes, and from cerebrovascular disease in women. Greater daily total physical activity level, either from occupation, daily life, or leisure time, may be of benefit in preventing premature death.

  2. Overview of total beta activity index and beta rest in surface waters of the Spanish rivers; Vision general del indice de actividad beta total y beta resto en las aguas superficiales de los rios espanoles

    Energy Technology Data Exchange (ETDEWEB)

    Pujol, L.; Payeras, J.; Pablo, M. A. de

    2013-07-01

    This work aims to give an overview of the index of total beta activity and the activity index beta rest in surface waters of the main Spanish rivers. These indices are a parameter over water quality that CEDEX comes determined by order of the Ministry of Agriculture, Food and Environment, in water policy. (Author)

  3. Total phenolics and total flavonoids in selected Indian medicinal plants.

    Science.gov (United States)

    Sulaiman, C T; Balachandran, Indira

    2012-05-01

    Plant phenolics and flavonoids have a powerful biological activity, which outlines the necessity of their determination. The phenolics and flavonoids content of 20 medicinal plants were determined in the present investigation. The phenolic content was determined by using Folin-Ciocalteu assay. The total flavonoids were measured spectrophotometrically by using the aluminium chloride colorimetric assay. The results showed that the family Mimosaceae is the richest source of phenolics, (Acacia nilotica: 80.63 mg gallic acid equivalents, Acacia catechu 78.12 mg gallic acid equivalents, Albizia lebbeck 66.23 mg gallic acid equivalents). The highest total flavonoid content was revealed in Senna tora which belongs to the family Caesalpiniaceae. The present study also shows the ratio of flavonoids to the phenolics in each sample for their specificity.

  4. Determination of human and Sprague-Dawley rat trimethylseleonium ion and total selenium urine concentrations from endogenous body selenium pool by neutron activation analysis

    International Nuclear Information System (INIS)

    Blotcky, A.J.; Claassen, J.P.; Rack, E.P.

    1992-01-01

    This study determined trimethylselenonium ion [TMSe,(CH 3 ) 3 Se + ] and total organic selenium cationic species urinary excretion values for healthy human subjects and Sprague-Dawley rats fed regular diets. The only source of TMSe was from the endogenous selenium body pool. Total selenium concentration in urine was determined by instrumental neutron activation analysis. TMSe and total selenium cationic species concentrations and percent of total selenium urine excretion were determined by chemical neutron activation analysis and coupled anion-cation exchange chromatography and anion-exchange chromatography, respectively. Within experimental error, mean values for TMSe and cationic species as percent selenium were comparable for both human subjects and Sprague-Dawley rats. This study suggested that TMSe excreated in urine by healthy human subjects and Sprague-Dawley rats fed a normal diet is not a minor but a general metabolite of selenium ingested in a normal diet. (author) 27 refs.; 1 fig.; 2 tabs

  5. Methods and results of reconstruction of 131I concentration in milk from total beta-activity measurements in Belarus after Chernobyl

    International Nuclear Information System (INIS)

    Savkin, Mikhail; Shinkarev, Sergey; Titov, Alexey

    2008-01-01

    Full text: During the first few weeks following the Chernobyl accident a large scale monitoring of radioactive contamination of foodstuffs locally produced was carried out in the most contaminated areas of Belarus. Due to a lack of spectrometric instruments, radiometric devices (DP-100) were used for beta activity measurements mostly of milk and milk products. Because the intake of 131 I with milk was the main contributor of the thyroid dose for the Belarus population, it is very important to reconstruct levels of 131 I in milk for Belarus settlements. The purpose of the paper is to present the methods and results of assessing the 13I concentration in milk based on historical records of total-beta activity measurements carried out in April-June 1986 in Belarus. The results of reconstruction of the 131 I concentration in milk will be used in on-going epidemiologic studies of a cohort of Belarus children. About 20,000 total-beta activity measurements were used in the analysis; for about 50% of those, the measurement result exceeded the minimum detectable activity. Estimates of 131 I concentration in milk at the date of sampling and of time-integrated milk concentrations were reconstructed for 482 settlements in Gomel Oblast and for 100 settlements in Mogilev Oblast, the most contaminated areas in Belarus, where at least one milk measurement was available. The assessment of the 131 I concentrations in milk involved: 1) An analysis of the calibration coefficients of the detectors for radionuclides available in milk (the main radionuclides were 131 I, 132 4Cs, 137 Cs, 89 Sr, 90 Sr); and 2) An assessment of the relative activity distribution of those radionuclides in milk. Only measurements made before 21 May 1986 were considered to be reliable, as the measurements conducted late May and in June were found to be unreliable because of the decrease in 131 I concentrations and the growing influence of other radionuclides with longer half-lives. Analysis of multiple

  6. Phytochemistry, antioxidant capacity, total phenolic content and anti-inflammatory activity of Hibiscus sabdariffa leaves.

    Science.gov (United States)

    Zhen, Jing; Villani, Thomas S; Guo, Yue; Qi, Yadong; Chin, Kit; Pan, Min-Hsiung; Ho, Chi-Tang; Simon, James E; Wu, Qingli

    2016-01-01

    A liquid chromatography-mass spectrometry method was developed for the simultaneous separation, and determination of natural compounds including phenolic acids and flavonoids in the leaves of Hibiscus sabdariffa. By analyzing the UV and MS data, and comparison with authenticated standards, 10 polyphenols including neochlorogenic acid, chlorogenic acid, cryptochlorogenic acid, quercetin, kaempferol and their glycosides were identified together with 5-(hydroxymethyl)furfural. Major constituents in the leaves of 25 different populations from worldwide accessions were quantified and compared with each other. The total phenolic content of each accession was determined using Folin-Ciocalteu assay, ranging from 18.98 ± 2.7 to 29.9 ± 0.5 mg GAE/g. Their in vitro antioxidant activities were measured by ABTS radical cation decolorization assay, varying from 17.5 to 152.5 ± 18.8 μmol Trolox/g. After the treatment of H. sabdariffa leaf extract, the reduction of LPS-induced NO production dose-dependently in RAW 264.7 cell indicates the extract's potential anti-inflammatory activity. Copyright © 2015 Elsevier Ltd. All rights reserved.

  7. Polysaccharides, total flavonoids content and antioxidant activities in different parts of Silybum marianum L. plants

    Science.gov (United States)

    Sun, Jing; Li, Xinhua; Yu, Xiaolei

    2017-01-01

    Silybum marianum L. is used for the production of silymarin, a flavonoid utilized for regenerating damaged hepatic tissues. Herein, the total flavonoid content (TFC) and polysaccharides content (PC) in the roots, main stems, leaves, fruit receptacles, and pappi of Silybum marianum were determined. The antioxidant activities of plant ethanol extracts were assessed to validate the medicinal potential of the various plant parts. The pappi exhibited the highest TFC (17.10 mg rutin/g of dry plant material), followed by the fruit receptacles (15.34 mg/g). The PC varied from 3.57±0.23 to 11.02±0.35 mg glucose /g dry plant material; the highest PC was obtained from the roots. At 50 ug/mL, the pappi ethanol extract showed the highest 1, 1-Diphenyl-2-picryl-hydrazyl (DPPH) radical scavenging activity (69.68%), followed by the roots (66.02%).

  8. Seasonal variations of total 234Th and dissolved 238U concentration activities in surface water of Bransfield Strait, Antarctica, from March to October 2011

    International Nuclear Information System (INIS)

    Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R.; Braga, Elisabete S.

    2013-01-01

    In this study the naturally occurring radionuclides 234 Th and 238 U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO 2 via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total 234 Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L -1 (station EB 011) during March/11 campaign, while in October/11 total 234 Th activity concentrations varied from 1.4 to 2.9 dpm L -1 . Highest total 234 Th activities were found late in the austral summer season. Activity concentrations of dissolved 238 U in surface seawater varied from 2.1 to 2.4 dpm L -1 . Taking into account all sampling stations established in March and October/11 the relative variability of total 234 Th distribution was 22%. (author)

  9. NIF total neutron yield diagnostic

    International Nuclear Information System (INIS)

    Cooper, Gary W.; Ruiz, Carlos L.

    2001-01-01

    We have designed a total neutron yield diagnostic for the National Ignition Facility (NIF) which is based on the activation of In and Cu samples. The particular approach that we have chosen is one in which we calibrate the entire counting system and which we call the ''F factor'' method. In this method, In and/or Cu samples are exposed to known sources of DD and DT neutrons. The activated samples are then counted with an appropriate system: a high purity Ge detector for In and a NaI coincidence system for Cu. We can then calculate a calibration factor, which relates measured activity to total neutron yield. The advantage of this approach is that specific knowledge of such quantities as cross sections and detector efficiencies is not needed. Unless the actual scattering environment of the NIF can be mocked up in the calibration experiment, the F factor will have to be modified using the results of a numerical simulation of the NIF scattering environment. In this article, the calibration factor methodology will be discussed and experimental results for the calibration factors will be presented. Total NIF neutron yields of 10 9 --10 19 can be measured with this method assuming a 50 cm stand-off distance can be employed for the lower yields

  10. Tree age, fruit size and storage conditions affect levels of ascorbic acid, total phenolic concentrations and total antioxidant activity of 'Kinnow' mandarin juice.

    Science.gov (United States)

    Khalid, Samina; Malik, Aman U; Khan, Ahmad S; Shahid, Muhammad; Shafique, Muhammad

    2016-03-15

    Bioactive compounds (ascorbic acid, total phenolics and total antioxidants) are important constituents of citrus fruit juice; however, information with regard to their concentrations and changes in relation to tree age and storage conditions is limited. 'Kinnow' (Citrus nobilis Lour × Citrus deliciosa Tenora) mandarin juice from fruit of three tree ages (6, 18 and 35 years old) and fruit sizes (large, medium and small) were examined for their bioactive compounds during 7 days under ambient storage conditions (20 ± 2 °C and 60-65% relative humidity (RH)) and during 60 days under cold storage (4 ± 1 °C and 75-80% RH) conditions. Under ambient conditions, a reduction in total phenolic concentrations (TPC) and in total antioxidant activity (TAA) was found for the juice from all tree ages and fruit sizes. Overall, fruit from 18-year-old trees had higher mean TPC (95.86 µg mL(-1) ) and TAA (93.68 mg L(-1) ), as compared to 6 and 35-year-old trees. Likewise, in cold storage, TAA decreased in all fruit size groups from 18 and 35-year-old trees. In all tree age and fruit size groups, TPC decreased initially during 15 days of cold storage and then increased gradually with increase in storage duration. Ascorbic acid concentrations showed an increasing trend in all fruit size groups from 35-year-old trees. Overall, during cold storage, fruit from 18-year-old trees maintained higher mean ascorbic acid (33.05 mg 100 mL(-1) ) concentrations, whereas fruit from 6-year-old trees had higher TAA (153.1 mg L(-1) ) and TPC (115.1 µg mL(-1) ). Large-sized fruit had higher ascorbic acid (32.08 mg 100 mL(-1) ) concentrations and TAA (157.5 mg L(-1) ). Fruit from 18-year-old trees maintained higher TPC and TAA under ambient storage conditions, whereas fruit from 6-year-old trees maintained higher TPC and TAA during cold storage. Small-sized fruit had higher TPC after ambient temperature storage, whereas large fruit size showed higher ascorbic acid concentrations and TAA after cold

  11. Knee Flexion and Daily Activities in Patients following Total Knee Replacement: A Comparison with ISO Standard 14243

    Directory of Open Access Journals (Sweden)

    Markus A. Wimmer

    2015-01-01

    Full Text Available Walking is only one of many daily activities performed by patients following total knee replacement (TKR. The purpose of this study was to examine the hypotheses (a that subject activity characteristics are correlated with knee flexion range of motion (ROM and (b that there is a significant difference between the subject’s flexion/extension excursion throughout the day and the ISO specified input for knee wear testing. In order to characterize activity, the number of walking and stair stepping cycles, the time spent with dynamic and stationary activities, the number of activity sequences, and the knee flexion/extension excursion of 32 TKR subjects were collected during daily activity. Flexion/extension profiles were compared with the ISO 14243 simulator input profile using a level crossing classification algorithm. Subjects took an average of 3102 (range: 343–5857 walking cycles including 65 (range: 0–319 stair stepping cycles. Active and passive ROMs were positively correlated with stair walking time, stair step counts, and stair walking sequences. Simulated knee motion according to ISO showed significantly fewer level crossings at the flexion angles 20–40° and beyond 50° than those measured with the monitor. This suggests that implant wear testing protocols should contain more cycles and a variety of activities requiring higher knee flexion angles with incorporated resting/transition periods to account for the many activity sequences.

  12. Dissidenze statali contemporanee. Guerra, internazionalizzazione e sviluppo informale nel Somaliland

    Directory of Open Access Journals (Sweden)

    Luca Ciabarri

    2015-03-01

    Full Text Available Il termine somalizzazione sembra in questo inizio secolo aver completamente sostituito l’espressione balcanizzazione, suo omologo perfetto per i secoli XIX e XX, per alludere ad un rischio a cui molte crisi internazionali (Siria, Libia, Mali, Afghanistan… vi è in effetti un lungo elenco potrebbero tendere: il rischio cioè del precipitare nell’anarchia e nel disordine totale, nella lotta settaria, così rappresentata, senza logica e senza sbocco. L’articolo intende analizzare da un punto di vista etnografico uno specifico paesaggio sociale all’interno di queste aree di crisi, in particolare all’interno dell’area somala, per mettere in luce, piuttosto che la disconnessione e l’eccezionalità di queste zone, le forme della loro connessione con il mondo degli Stati più ampio. Il commercio informale transfrontaliero, e la sovrapposizione tra movimenti di beni, di persone e di denaro, è preso ad esempio in questo studio di caso per mostrare le profonde ambiguità e contraddizioni di queste forme di relazione. Dinamiche regionali che intrecciano percorsi di persone e merci, che alimentano confini reali e ideologici, che avvicinano o allontanano gli attori in campo in forme inattese e che sono irriducibili rispetto a macro discorsi fondati sul pericolo di radicalizzazioni islamiche o violenze settarie sono qui proposte come determinanti decisive per poter comprendere i percorsi verso il conflitto e verso la pace nelle aree contemporanee di dissidenza e vuoto statale.

  13. Predictive value of the Western Ontario and McMaster Universities Osteoarthritis Index for the amount of physical activity after total hip arthroplasty

    NARCIS (Netherlands)

    Wagenmakers, Robert; Stevens, Martin; van den Akker-Scheek, Inge; Zijlstra, Wiebren; Groothoff, Johan W.

    Background and Purpose Despite the recognized health benefits of physical activity, little is known about the amount of physical activity that patients perform after total hip arthroplasty (THA). To this end, the ability of the Western Ontario and McMaster Universities Osteoarthritis Index (WOMAC)

  14. Relationship between circulating serum osteoprotegerin and total receptor activator of nuclear κ-B ligand levels, triglycerides, and coronary calcification in postmenopausal women.

    Science.gov (United States)

    Poornima, Indu G; Mackey, Rachel H; Buhari, Alhaji M; Cauley, Jane A; Matthews, Karen A; Kuller, Lewis H

    2014-07-01

    This study evaluates the relationship of blood osteoprotegerin (OPG) and receptor activator of nuclear κ-B ligand (RANKL) levels with coronary artery calcium (CAC) and cardiovascular risk factors in two studies of postmenopausal women. OPG, a marker of bone turnover, and its ligand, RANKL, may contribute to cardiovascular disease risk. We tested the hypothesis that serum OPG and RANKL levels were associated with CAC and cardiovascular disease risk factors among postmenopausal women in the Women On the Move through Activity and Nutrition Study (WOMAN Study; n = 86; mean [SD], age 58 [2.9] y) and replicated our findings in the Healthy Women Study (HWS; n = 205; mean [SD] age, 61 [2.3] y). Serum OPG, total RANKL, and CAC were measured at baseline and 48 months in the WOMAN Study and on the eighth postmenopausal visit in the HWS. In the WOMAN Study, higher OPG was associated with higher CAC, and higher total RANKL was associated with lower CAC and triglycerides. In the HWS, higher total RANKL was also associated with lower CAC and triglycerides. In logistic regression models adjusted for body mass index and triglycerides, the odds ratios (95% CIs) for CAC per unit increase in OPG were 1.78 (1.17-2.73) for the WOMAN Study and 1.02 (0.84-1.24) for the HWS, and the odds ratios (95% CIs) for CAC per unit increase in log total RANKL were 0.86 (0.64-1.17) for the WOMAN Study and 0.83 (0.72-0.96) for the HWS. The inverse association of total RANKL with CAC and triglycerides is a new finding and may have important implications given the increasing use of drugs that modify total RANKL and its receptor, receptor activator of nuclear κ-B.

  15. Mapping of critical loads of acidity for the Italian terrestrial ecosystems; Mappa dei carichi critici di acidita' totale riferita al territorio italiano

    Energy Technology Data Exchange (ETDEWEB)

    Bonanni, P.; Brini, S.; Delmonaco, G.; Liburdi, C.; Trocciola, A.; Vetrella, G. [ENEA, Centro Ricerche Casaccia, Rome (Italy). Dipt. Ambiente

    1999-07-01

    In this report the mapping of critical loads of acidity for the Italian terrestrial ecosystems is presented. The level 0 method (Stockholm Environment Institute) has been used to determine sensitivity to acid deposition; this semi-quantitative method has been modified to address some Italian characteristics. The sensitivity of the Italian soils to acidification is not particularly elevated: there are really only few small areas with poor tolerance to acid depositions in the north-east Italy, Alpine and Prealpine region. [Italian] Nel presente relazione vengono riportati i risultati della mappatura riferita ad ecosistemi terrestri del territorio italiano, dei carichi critici per l'acidita' totale. Il calcolo dei carichi e' stato eseguito sulla base della metodologia messa a punto dallo Stockholm Environment Institute con alcune modifiche per adattarlo meglio alle caratteristiche del territorio italiano. Si dimostra che la sensibilita' dei suoli italiani all'acidificazione non sia particolarmente elevata: sono state riscontrate infatti solo alcune aree, peraltro con superficie limitata, con una scarsa tolleranza alle deposizioni acide nelle zone del Nord Est, in zona alpina e prealpina.

  16. Influence of physical activity on the metabolism and the total body content of sodium and potassium in the rat

    International Nuclear Information System (INIS)

    Yeh, J.K.; Yasumura, A.; Aloia, J.F.

    1986-01-01

    The purpose of this study was to investigate the effect of exercise (EX) and immobilization (IMB) on the absorption, excretion and total body content of sodium (TBNa) and potassium (TBK). Female Sprague Dawley rats 5 weeks old were divided into four groups: EX; Control (CON); EX with pair feeding to the level equal to the CON (EX-P); IMB by sciatica denervation. The nutritional balance study data was taken 5 weeks into the experimental period and the animals were sacrificed after 5 additional weeks of experimentation. The carcasses were kept frozen and used for total body composition by neutron activation. The results of the total body composition show that EX resulted in an increase, IMB resulted in a decrease, of the TBNa and TBK. There was no significant difference in TBNa of TBK, between the EX and the EX-P groups even though, the food intake was higher in the EX group. The results of the nutritional balance study confirmed the results of the total body composition

  17. ISCO'S LONG-TERM IMPACT ON AQUIFER CONDITIONS AND MICROBIAL ACTIVITY (ABSTRACT)

    Science.gov (United States)

    Permanganate has been successfully used in in-situ chemical oxidation (ISCO) to transform a wide range of organic contaminants under diverse geologic and geochemical conditions. Here, a critical analysis is presented of several technical issues commonly raised during in-situ che...

  18. Time-driven Activity-based Cost of Fast-Track Total Hip and Knee Arthroplasty

    DEFF Research Database (Denmark)

    Andreasen, Signe E; Holm, Henriette B; Jørgensen, Mira

    2017-01-01

    this between 2 departments with different logistical set-ups. METHODS: Prospective data collection was analyzed using the time-driven activity-based costing method (TDABC) on time consumed by different staff members involved in patient treatment in the perioperative period of fast-track THA and TKA in 2 Danish...... orthopedic departments with standardized fast-track settings, but different logistical set-ups. RESULTS: Length of stay was median 2 days in both departments. TDABC revealed minor differences in the perioperative settings between departments, but the total cost excluding the prosthesis was similar at USD......-track methodology, the result could be a more cost-effective pathway altogether. As THA and TKA are potentially costly procedures and the numbers are increasing in an economical limited environment, the aim of this study is to present baseline detailed economical calculations of fast-track THA and TKA and compare...

  19. rich extract on total polyphenols and antioxidant activity obtained

    African Journals Online (AJOL)

    Z. Ghouila

    USTHB, Organic Functional Analysis Laboratory, 16111 Bab Ezzouar, Algiers, ... Keywords: Ahmeur Bouamer, extraction, grape seeds, total polyphenols, ... These compounds are known as good natural antioxidant agents arising from natural ... surface between solid and liquid phases; this is mainly due to the dispersion of ...

  20. LWD–TCP complex activates the morning gene CCA1 in Arabidopsis

    Science.gov (United States)

    Wu, Jing-Fen; Tsai, Huang-Lung; Joanito, Ignasius; Wu, Yi-Chen; Chang, Chin-Wen; Li, Yi-Hang; Wang, Ying; Hong, Jong Chan; Chu, Jhih-Wei; Hsu, Chao-Ping; Wu, Shu-Hsing

    2016-01-01

    A double-negative feedback loop formed by the morning genes CIRCADIAN CLOCK ASSOCIATED1 (CCA1)/LATE ELONGATED HYPOCOTYL (LHY) and the evening gene TIMING OF CAB EXPRESSION1 (TOC1) contributes to regulation of the circadian clock in Arabidopsis. A 24-h circadian cycle starts with the peak expression of CCA1 at dawn. Although CCA1 is targeted by multiple transcriptional repressors, including PSEUDO-RESPONSE REGULATOR9 (PRR9), PRR7, PRR5 and CCA1 HIKING EXPEDITION (CHE), activators of CCA1 remain elusive. Here we use mathematical modelling to infer a co-activator role for LIGHT-REGULATED WD1 (LWD1) in CCA1 expression. We show that the TEOSINTE BRANCHED 1-CYCLOIDEA-PCF20 (TCP20) and TCP22 proteins act as LWD-interacting transcriptional activators. The concomitant binding of LWD1 and TCP20/TCP22 to the TCP-binding site in the CCA1 promoter activates CCA1. Our study reveals activators of the morning gene CCA1 and provides an action mechanism that ensures elevated expression of CCA1 at dawn to sustain a robust clock. PMID:27734958

  1. LWD-TCP complex activates the morning gene CCA1 in Arabidopsis.

    Science.gov (United States)

    Wu, Jing-Fen; Tsai, Huang-Lung; Joanito, Ignasius; Wu, Yi-Chen; Chang, Chin-Wen; Li, Yi-Hang; Wang, Ying; Hong, Jong Chan; Chu, Jhih-Wei; Hsu, Chao-Ping; Wu, Shu-Hsing

    2016-10-13

    A double-negative feedback loop formed by the morning genes CIRCADIAN CLOCK ASSOCIATED1 (CCA1)/LATE ELONGATED HYPOCOTYL (LHY) and the evening gene TIMING OF CAB EXPRESSION1 (TOC1) contributes to regulation of the circadian clock in Arabidopsis. A 24-h circadian cycle starts with the peak expression of CCA1 at dawn. Although CCA1 is targeted by multiple transcriptional repressors, including PSEUDO-RESPONSE REGULATOR9 (PRR9), PRR7, PRR5 and CCA1 HIKING EXPEDITION (CHE), activators of CCA1 remain elusive. Here we use mathematical modelling to infer a co-activator role for LIGHT-REGULATED WD1 (LWD1) in CCA1 expression. We show that the TEOSINTE BRANCHED 1-CYCLOIDEA-PCF20 (TCP20) and TCP22 proteins act as LWD-interacting transcriptional activators. The concomitant binding of LWD1 and TCP20/TCP22 to the TCP-binding site in the CCA1 promoter activates CCA1. Our study reveals activators of the morning gene CCA1 and provides an action mechanism that ensures elevated expression of CCA1 at dawn to sustain a robust clock.

  2. Estimation of total phenolic content, cytotoxicity and in-vitro antioxidant activity of stem bark of Moringa oleifera

    Directory of Open Access Journals (Sweden)

    Kumbhare MR

    2012-04-01

    Full Text Available Objective: To assess the phytochemical constituents, total phenolic content, cytotoxicity and invitro antioxidant activity of stem bark extracts of Moringa oleifera (M. oleifera (Moringaceae. Methods: Brine shrimp lethality (BSL bioassay was used to investigate the cytotoxic effects. DPPH and nitric oxide radical scavenging activity was used to demonstrate antioxidant activity. Results: Phytochemical analysis revealed the presence of tannins, flavonoids, steroids and alkaloids. The LC 50 values were obtained for extracts as 850 毺 g/mL for petroleum ether extract, 800 毺 g/mL for chloroform extract and 900 毺 g/mL for methanol extract. The total phenolic content of the methanolic extract was 50.72% w/w, equivalent to gallic acid. Petroleum ether, chloroform and methanolic extracts of M. oleifera and standard ascorbic acid were found to be scavenger of DPPH radical with an IC 50 of 124.75, 112.08, 54.34 and 13.86 毺 g/mL, respectively. Methanolic extract was found to be good scavenger of DPPH radical. Petroleum ether, chloroform, ethyl acetate soluble fraction of methanolic extracts of M. oleifera and ascorbic acid were found to be scavenger of nitric oxide radical with an IC 50 of 93.32, 65.12, 54.83 and 12.59 毺 g/mL, respectively. Ethyl acetate soluble fraction was found to be good scavenger of nitric oxide radical. Conclusions: It can be concluded that the crude extracts of M. oleifera is a potential source of natural antioxidants, and this justifies its uses in folkloric medicines.

  3. Changes in antioxidant activity, total phenolic and abscisic acid constituents in the aquatic plants Myriophyllum spicatum L. and Myriophyllum triphyllum Orchard exposed to cadmium.

    Science.gov (United States)

    Sivaci, Aysel; Sivaci, E Ridvan; Sökmen, Münevver

    2007-07-01

    Changes in antioxidant activity, total phenolic and abscisic acid (ABA) constituents of Myriophyllum spicatum L. and Myriophyllum triphyllum Orchard, cadmium (Cd) aqueous macrophytes, were investigated exposed to 0, 2, 4, 6, 8, 16 mg l(-1) Cd concentrations. M. triphyllum exhibited strong antioxidant activity but not M. spicatum before and after exposure. Free radical scavenging activity of M. triphyllum was significantly affected from the Cd concentrations and a significant increase was observed at 6 mgl(-1) Cd concentration. Total phenolic constituent and ABA concentration of M. triphyllum is higher than that of M. spicatum with or without heavy metal exposure (P macrophytes that grown in polluted aqueous ecosystem.

  4. The Addition of White Turmeric (Curcuma zedoaria Concentrated Base on Quality Antioxidant Activity, Total Phenol, Protein Content and Salt Content of Salted Egg

    Directory of Open Access Journals (Sweden)

    Mu’addimah Mu’addimah

    2017-03-01

    Full Text Available The purposes of this research was to determine the effect of Curcuma zedoaria concentrated addition on quality antioxidant activity, total phenols, protein content and salt content of salted egg. The materials were duck’s egg, water, salt, and essence of white turmeric. The method was experiment using Complete Randomized Design (CRD with five treatments and three for replications. The Curcuma zedoaria juice research were divided into P0 (0%, P1 (10%, P2 (20%, P3 (30% and P4 (40%. Data was analyzed using Analysis of Variance (ANOVA and then continued by Duncan’s Multiple Range Test (DMRT, if it was found significant effect among treatmeants. The result showed that the addition of Curcuma zedoaria juice indicated highly significant different effect (P<0.01 on antioxidant activity, protein content and salt content, but significantly effect (P<0.05 on total phenol. The best treatment was the addition of Curcuma zedoaria juice 40% were indicated of antioxidant activity, total phenol, protein content and the salt content was 99.80 mg/g, 0.16%, 9.96%, 2.43% respectively.

  5. Evoluzione dell' abitudine al fumo nei locali dellíAzienda Ospedaliera Universitaria Senese dal 1998 al 2003

    Directory of Open Access Journals (Sweden)

    B. Bianconi

    2003-05-01

    Full Text Available

    Obiettivi: l’ospedale dovrebbe rappresentare un modello per la promozione della salute, tuttavia, nonostante i divieti di legge, l’abitudine di fumare in ospedale è ancora diffusa. Obiettivo dello studio è rilevare l’abitudine al fumo di personale sanitario, pazienti e visitatori, nei locali dell’AOUS.

    Metodi: alcuni studenti universitari, durante le loro attività curricolari, hanno percorso i locali del policlinico in orari diversi, contando il numero di persone incontrate, operatori sanitari e pazienti/visitatori, e indicando il numero di coloro che stavano fumando, in entrambe le categorie. Questo studio è stato ripetuto negli anni 1998, 1999 e 2003.

    Risultati: la prevalenza di persone che stavano fumando è risultata del 6,4% nel 1998, del 3,8% nel 1999 e dell’1,1% nel 2003. La prevalenza di operatori sanitari che fumavano rispetto al totale dei fumatori è risultata rispettivamente del 25%, del 26% e del 23,8%. Nei due anni passati, nell’atrio, nel bar e nelle zone antistanti i reparti c’era una maggiore presenza di persone che fumavano; mentre nell’ultima indagine sono stati riscontrati più fumatori, oltre che nell’atrio, nei corridoi del piano didattico, zona non indagata in precedenza. Nell’ultima rilevazione, non sono stati individuati fumatori nei due bar del policlinico; mentre sono sempre stati rilevati, in numero esiguo, operatori sanitari che fumano all’interno delle corsie di degenza.

    Conclusioni: la diminuzione costante del numero di fumatori in ospedale, mostra come ci sia stato negli ultimi anni un rispetto sempre maggiore del divieto di fumo nei luoghi di cura. Il coinvolgimento di futuri medici permette di promuovere il problema fumo in ospedale.

  6. Total phenolic and phytosterol compounds and the radical scavenging activity of germinated Australian sweet lupin flour.

    Science.gov (United States)

    Rumiyati; Jayasena, Vijay; James, Anthony P

    2013-12-01

    In addition to their favourable nutritional profile, legumes also contain a range of bioactive compounds such as phenolic compounds and phytosterols which may protect against chronic diseases including cancer and cardiovascular disease. Germination of some legume seeds has been previously reported to increase the concentration of the bioactive compounds. In this study, the effect of germination of Australian Sweet Lupin (ASL) seeds for 9 days on the concentration of some bioactive compounds and the radical scavenging activity in the resulting flour was determined. The concentration of total phenolic compounds in methanolic extracts of germinated ASL flour was determined using Folin Ciocalteu reagent and phytosterols in oil extracts were analyzed by gas-liquid chromatography. The methanolic and oil extracts were also used to determine radical scavenging activity toward 2,2-diphenyl-1-picrylhydrazyl. In the methanolic extracts of germinated ASL flour, phenolic contents and the antioxidant activity were significantly increased following germination (700 and 1400 %, respectively). Analysis of the oil extracts of germinated ASL flour revealed that the concentration of phytosterols and the antioxidant activity were also increased significantly compared to ungerminated ASL flour (300 and 800 %, respectively). The relative proportion of phytosterols in germinated ASL flour was: β-sitosterol (60 %), stigmasterol (30 %) and campesterol (10 %). Germination increases the concentration of bioactive compounds and the radical scavenging activity in the germinated ASL flour.

  7. Il mondo dentro il mondo

    CERN Document Server

    Barrow, John D

    1991-01-01

    Davvero esistono “lì fuori” leggi di natura, che stanno in attesa di essere scoperte, indipendenti dal nostro modo di pensare, o esse rappresentano soltanto la descrizione più conveniente di ciò che abbiamo visto? Come è nata l’idea stessa di “leggi di natura”? Queste costituiscono la realtà profonda o sono soltanto pezzi di un regolamento che ci siamo dati per organizzare meglio la nostra conoscenza del mondo? o semplici paletti che piantiamo e ci lasciamo alle spalle come segnali via via che procediamo nella giungla dell’esperienza? È possibile che non esistano affatto leggi di natura? Forse esse, e anche l’universo che da esse sembra regolato, sono del tutto creazioni della nostra mente: un’illusione che scompare appena cessiamo di pensarvi. Ma allora, che cosa accadrebbe, se non ci fossero osservatori dell’universo?». Interrogativi di questo genere, che incontriamo sulla soglia del Mondo dentro il mondo, sarebbero suonati eccentrici fino a qualche anno fa. Oggi, al contrario, circ...

  8. Flavonoid, hesperidine, total phenolic contents and antioxidant ...

    African Journals Online (AJOL)

    Additionally, the antioxidant activities were also determined by ferric reducing antioxidant power (FRAP) and 1,1-diphenyl-2-picryl hydrazyl (DPPH) radical scavenging activity. C. hystrix had the highest flavonoid and total phenolic contents while C. aurantifolia had the highest hesperidine content. The antioxidant activity of ...

  9. DPPH RADICAL SCAVENGING ACTIVITY, TOTAL PHENOLICS AND FLAVONOIDS OF WATER SOLUBLE EXTRACTS DERIVED FROM LEAVES AND FRUIT OF Ficus carica L. AND Ficus parietalis Bl.

    Directory of Open Access Journals (Sweden)

    Oktavia Tri Wahyuni

    2016-08-01

    Full Text Available Ficus carica L and Ficus parietalis Bl. (Moraceae are closely related plants which also known in Indonesia as Figs L. Considering the wide therapeutic value of Figs, this research was aimed to evaluate the DPPH-radical scavenging activity of both plants as well as their total phenolic and flavonoids. Extracts were produced by using boiled water and diluted to gain the desired concentration. Analyses were performed by using UV-vis spectrophotometer. Radical scavenging activity testing was done by using radical of DPPH (2,2-diphenyl-1-pycrylhydrazyl to determine the IC50s. The determination of total phenolic was conducted by using Folin-Ciocalteau method and calculated as Gallic Acid Equivalence (GAE. The total flavonoid was measured by using AlCl3-reagents, and calculated as Rutin Equivalence (RE. Afterwards, the radical scavenging activity was correlated to the total phenolic and flavonoids contents. The results showed that the water soluble extract of F. carica fruit had the best IC50 value of 33.38 mg/mL, followed successively by the F. parietalis fruit (35.69 mg/mL, F. parietalis leaves (44.01 mg/mL and the F. carica leaves (76.38 mg/mL. The highest content of total phenolic was shown by the leaves of F. parietalis (1.46% w/w GAE and the lowest was in the fruit or F. carica (0.36% w/w GAE. The highest flavonoid content was detected in the leaves of F. carica (1.42% w/w RE and the lowest was in the F. parietalis fruit (0.20% w/w RE. Correlation analyses of the IC50 values vs. the total phenolic and the flavonoids contents resulted in a positive slope having R2 values as 0.5362 and 0.9895, respectively. As a conclusion, the total flavonoid content influenced the DPPH radical scavenging activity by 98.95%, while the total phenolic content influence was only 53.62%.

  10. Opera aperta: Wikipedia e l’oralità secondaria

    Directory of Open Access Journals (Sweden)

    Tommaso Venturini

    2006-03-01

    Full Text Available In questo articolo si discuterà di Wikipedia, la prima e più importante enciclopedia compilata collaborativamente su Internet. Se ne analizzerà il modello comunicativo e si mostrerà come esso getti nuova luce sulla distinzione oralità/scrittura. Il lettore, tuttavia, dovrà armarsi di pazienza, poiché non prenderemo la via breve. Prima di arrivare a Wikipedia, esamineremo la relazione segno-referente e quella mezzo-messaggio. Contesteremo la semplificazione che riduce la comunicazione a mera trasmissione di messaggi e quella che riduce l’evoluzione sociale allo sviluppo delle tecnologie mediatiche. Criticheremo la nozione di villaggio globale, di oralità secondaria e la loro applicazione al mondo della Rete. Dimostreremo, in particolare, che la comunicazione telematica non conduce a una nuova forma di oralità. Solo a questo punto, al riparo dagli equivoci del determinismo sociale e tecnologico, potremo infine affrontare l’innovazione mediale introdotta dall’invenzione dei wiki. Riflettendo sui processi e sui prodotti della mediazione comunicativa, illustreremo quindi come Wikipedia abbia dato vita a una forma di comunicazione davvero nuova. Un modello comunicativo caratterizzato da un’apertura radicale e totale che non può essere assimilata né all’oralità, né alla scrittura.

  11. The use of Total Body In Vivo Neutron Activation Analysis (TBIVNAA) in balance studies in rodents

    International Nuclear Information System (INIS)

    Smith, D.A.; Lindsay, R.L.; Anderson, J.

    1976-01-01

    In the investigation of animals subject to alteration in diet or other metabolic experiments, the measurements of change in body calcium, phosphorus, sodium and nitrogen are of considerable interest. However, conventional balance studies are tedious and subject to both random and cumulative error, necessitating as they do accurate estimates of dietary intake and faecal and urinary output. The object of the present study was to determine the usefulness of total body in vivo neutron activation analysis, used at the beginning and end of the experimental period, as an alternative to conventional balance techniques. (orig.) [de

  12. THE ANALYSIS OF TOTAL EXPENSES AT 1000 LEI TOTAL REVENUES AND OF THE RESULT OF THE GROWTH OF THEIR EFFICIENCY

    Directory of Open Access Journals (Sweden)

    LĂPĂDUŞI MIHAELA LOREDANA

    2013-12-01

    Full Text Available act The analysis of the company’s expenses is mainly important in the management and control activity, because it highlights the way in which are used the resources (material, human, financial and the impact of their allocation on the company’s performances. The optimization of the level of costs or the their reduction, where it is possible, without affecting the quality of the products and working conditions of the activity, represent the primary objectives of the management of companies.[9] Expenses have been and will remain one of the key indicators of a company requiring continuous application of a control and monitoring mechanism because when it comes to expenses we never speak of their growth, but their reduction. This reduction is the main objective of any economic agent that will result in increasing the efficiency of the entire activity. The costs of a company reflect in cash the total consumption of material, human and financial resources used in manufacturing and selling of the products. The level, dynamics and structure of these expenses reflect synthetically the activity of industrial enterprises when using effectively the available resources. The purpose of this article is to analyze synthetically a company's expenses efficiency based on the efficiency ratio of total expenses at 1000 lei total revenues and the purpose of the article results in a set of conclusions that will highlight a number of important issues concerning the role and the importance of the efficiency of total expenses related to total revenue, as well as the result of the growth of the efficiency of total expenses.

  13. Total gamma activity measurements for determining the radioactivity of residual materials from nuclear power stations

    International Nuclear Information System (INIS)

    Auler, I.; Meyer, M.; Stickelmann, J.

    1995-01-01

    Large amounts of residual materials from retrofitting measures and from decommissioning of nuclear power stations shows such a weak level of radioactivity that they could be released after decision measurements. Expenses incurred with complex geometry cannot be taken with common methods. NIS developed a Release Measurement Facility (RMF) based on total gamma activity measurements especially for these kind of residual materials. The RMF has been applied for decision measurements in different nuclear power plants. Altogether about 2,000 Mg of various types of materials have been measured up to now. More than 90 % of these materials could be released 0 without any restriction after decision measurements

  14. Sports Activity after Low-contact-stress Total Knee Arthroplasty – A long term follow-up study

    Science.gov (United States)

    Vielgut, Ines; Leitner, Lukas; Kastner, Norbert; Radl, Roman; Leithner, Andreas; Sadoghi, Patrick

    2016-01-01

    The purpose of this study was to provide comprehensive long-term data about sports activity levels in patients following total knee arthroplasty (TKA) and to determine the impact of pre-operative function, pain and specific performed sports on the results. 236 patients who have undergone TKA for severe osteoarthritis of the knee were asked to provide specific information regarding exercised types of sports before surgery and after at least 10 years following TKA. Pre- and postoperative function and pain were evaluated by the use of Tegner-, WOMAC- and VAS Score. After a mean of 14.9 years, a significant improvement regarding pain and function was observed. Pre-operative Tegner- and WOMAC scores revealed significant positive correlations with the post-operative Tegner-Score. Accordingly, a high percentage of patients (70.9%) stayed actively involved in sports. Nevertheless, the number of performing patients has decreased according to the sports impact. 71.3% continued practising low-impact-, 43.7% intermediate-impact sports whereas only 16.4% kept performing high impact sports. We conclude that TKA is highly effective in long-time pain reduction as well as improvement of function. Additionally, we found considerable sports activities preserved in the investigated series. However, sports activities in particular, seem to decrease according to the impact of sports. PMID:27090945

  15. EFFECTS OF SEED IRRADIATION ON 14C FIXATION AND ANTIOXIDANT ACTIVITY OF VITAMIN C AND TOTAL PHENOLS OF CANOLA LEAVES

    International Nuclear Information System (INIS)

    KAMEL, H.A.

    2008-01-01

    Seeds of canola were gamma irradiated with doses of 10, 25, 50, 100 and 200 Gy then cultivated in 30 cm plastic pots containing 7 kg clay soil. After 45 days of cultivation, plants were used to measure 14 C fixation capacity, vitamin C, total phenol, free proline and peroxidase activity in addition to the antioxidant activity. The results showed decrease in the chlorophyll content and 14 C fixation at all gamma doses. Irradiation of canola seeds caused significant reduction in vitamin C and phenol content, while significant increase was occurred in free proline and peroxidase activity. Antioxidant activity of vitamin C was higher than that of phenols at all doses used

  16. Total glucosides of paeony can reduce the hepatotoxicity caused by Methotrexate and Leflunomide combination treatment of active rheumatoid arthritis.

    Science.gov (United States)

    Xiang, Nan; Li, Xiao-Mei; Zhang, Miao-Jia; Zhao, Dong-Bao; Zhu, Ping; Zuo, Xiao-Xia; Yang, Min; Su, Yin; Li, Zhan-Guo; Chen, Zhu; Li, Xiang-Pei

    2015-09-01

    Total glucosides of paeony (TGP) have been confirmed to exert anti-inflammatory and hepatoprotective effects. Methotrexate (MTX) and Leflunomide (LEF) combination has a better efficacy in the treatment of active rheumatoid arthritis (RA), but hepatotoxicity was observed. In this study, we investigated the effect of TGP on hepatic dysfunction caused by MTX and LEF in patients with active RA. A total of 268 patients with active RA (disease activity score in 28 joints, DAS28>3.2) were enrolled in this study. All patients were randomly assigned to two groups, the therapeutic group in which patients were treated with TGP (1.8 g/day) combined with MTX and LEF (MTX 10mg/week plus LEF 20mg/day) while in the control group, patients were treated without TGP up to 12 weeks. The efficacy and liver abnormalities were observed. The incidence of abnormal liver function within 12 weeks in TGP group was significantly lower than that in control group (11.38% vs 23.26%, P=0.013). The proportion of patients with ALT/AST >3 times ULN (upper limits of normal) was significantly lower in TGP group than control group (1.63% vs 7.75%, P=0.022). More patients achieved remission, good and moderate response in TGP group than control group at 4, 8 and 12 weeks, but the difference was not significant (P>0.05). The proportions of all adverse events were comparable in the two groups except for diarrhea. Our study demonstrates that TGP can significantly reduce the incidence and severity of liver damage caused by MTX+LEF in the treatment of active RA patients. Copyright © 2015 Elsevier B.V. All rights reserved.

  17. Influence of different extracts addition on total phenols, anthocyanin content and antioxidant activity of blackberry juice during storage

    Directory of Open Access Journals (Sweden)

    Blanka Bilić

    2011-01-01

    Full Text Available The aim of this study was investigation of influence of different extracts addition on total phenols, anthocyanin content, antioxidant activity and percent of polymeric colour of blackberry juice during storage of 52 days at 4 °C. Anthocyanin content of control sample (blackberry juice without extracts addition was 149.91 mg/L. Samples with addition of extracts (olive leaf, pine bark PE 5:1, pine bark PE 95 %, green tea, red wine PE 30 %, red wine PE 4:1 and bioflavonoids had higher anthocyanin content (from 152.42 to 161.19 mg/L in comparison to control sample. Sample with addition of bioflavonoids had the highest anthocyanin content. Samples with addition of extracts had much higher total phenol content and antioxidant activity than control sample, what was expected since extracts are rich in phenols. During storage decrease of phenols, anthocyanins and antioxidant activity occurred in higher or lesser extent, depending on extract type addition. Anthocyanin content in control sample was 119.85 mg/L. Samples with addition of bioflavonoids, olive leaf, pine bark PE 5:1 and red wine PE 4:1 had lower (from 103.44 to 118.84 mg/L, while other samples had higher (from 131.99 to 135.57 mg/L anthocyanin content than control sample. After storage, decrease of anthocyanins was followed with increase of percent of polymeric colour, with exception of samples with addition of green tea.

  18. Can total knee arthroplasty (TKA) achieve its goal in knee flexion floor activity of Thai Buddhist monks?

    Science.gov (United States)

    Sresuriyasawad, Viriya

    2012-10-01

    To study knee's angulation required for Thai Buddhist monks whose activity based on floor sitting basis. And to identify an inter-observer reliability of knee flexion measurement based on radiologic reading. Descriptive analysis study comprised of measuring bilateral knee flexing angulation in 4 postures of floor activities; kneeling, monk's position in both right and left manner and sit cross-legged position, in 35 Thai Buddhist monks at Priest Hospital using plain radiograph image. The radiograph imaging for each patient was performed by one radiologist and two orthopedics. The measurement result was also analyzed for inter-observer reliability. Mean knee flexion angle in kneel, left monk's position, right monk's position and sit cross-legged postures were 163.21, 146.49, 148.89 and 138.38 degree, respectively. No statistical difference between knee flexion measurements among 3 investigators. Daily floor activity of Thai Buddhist monks need more flexion capacity than that can achieve by total knee arthroplasty instrument using nowadays.

  19. The effect of ultraviolet treatment on enzymatic activity and total phenolic content of minimally processed potato slices.

    Science.gov (United States)

    Teoh, Li Shing; Lasekan, Ola; Adzahan, Noranizan Mohd; Hashim, Norhashila

    2016-07-01

    In this work, potato slices were exposed to different doses of UV-C irradiation (i.e. 2.28, 6.84, 11.41, and 13.68 kJ m -2 ) with or without pretreatment [i.e. ascorbic acid and calcium chloride (AACCl) dip] and stored at 4 ± 1 °C. Changes in enzymatic activities of polyphenol oxidase (PPO), peroxidase (POD) and phenylalanine ammonia lyase (PAL), as well as total phenolic content (TPC) were investigated after 0, 3, 7 and 10 days of storage. Results showed that untreated and UV-C treated potato slices at 13.68 kJ m -2 dosage level showed significantly higher PPO, POD and PAL activities. Conversely, untreated potato slices showed the lowest TPC during storage period. Potato slices subjected to AACCl dip plus UV-C at 6.84 kJ m -2 produced lower PPO, POD and PAL activities, as well as maintained a high TPC during storage.

  20. A strategic zone for Total's future

    International Nuclear Information System (INIS)

    Legros, E.J.

    1997-01-01

    In 1997, the Total company investments in the Middle East reached 1.2 billions of French Francs. This region is considered as a major growth zone by the French group. This paper summarizes the Total's participations in oil and gas activities and partnerships of Middle East countries (Abu Dhabi, Dubai, Oman, Qatar, Yemen): exploration, production, development, contracts, permits, technical assistance etc.. (J.S.)

  1. Investigation of Total Phenolic and Flavonoid Contents, and Evaluation of Antimicrobial and Antioxidant Activities from Baeckea frutescens Extracts

    Science.gov (United States)

    Nisa, K.; Nurhayati, S.; Apriyana, W.; Indrianingsih, A. W.

    2017-12-01

    Baeckea frutescens L. is a medicinal plant endemic to the tropical area and it has been used by locals for topical and oral ailments. This study investigated total phenolic and flavonoid contents and also evaluated in vitro antimicrobial and antioxidant activities of of Baeckea frutescens crude extracts. These extracts were assessed for their antibacterial activities against strains of Escherichia coli, Staphylococcus aureus, Salmonella thypii, and Pseudomonas aureginosa by the broth micro-dilution methods using a modified tetrazolium-based colorimetric assay (3-(4, 5-dimethylthiazol)-2, 5-diphenyl tetrazolium bromide (MTT) assay). Baeckea frutescens crude extracts were also tested against the stable DPPH (2,2-diphenyl-1-picryl-hydrazyl-hydrate) free-radical. The results indicated that Baeckea frutescens water and ethanol extracts possesed remarkable antibacterial activity with the minimum inhibitory concentration less than 100 μg/ml against Escherichia coli and Salmonella thypi. On the evaluation of the antioxidant activity via DPPH assay, Baeckea frutescens ethanol extracts exhibited a good antioxidant activity with IC50 less than 50 μg/ml and Baeckea frutescens water extracts showed a moderate antioxidant activity with IC50 less than 100 μg/ml.

  2. TotalFinaElf Factbook 2002

    International Nuclear Information System (INIS)

    2002-01-01

    This report presents the activities and results of the Group Total-Fina-Elf for the year 2002. It brings information and economic data on the following topics: the corporate and business; the upstream activities with the reserves, the costs, standardized measure and changes of discounted future net cash flow,oil and gas acreage, drilling, liquefied natural gas, pipelines; downstream activities with refining and marketing maps, refinery, petroleum products, sales, retail gasoline outlets; chemicals with sales and operating income by sector, major applications, base chemicals and polymers, intermediates and performance polymers. (A.L.B.)

  3. Total 2004 annual report

    International Nuclear Information System (INIS)

    2004-01-01

    This annual report of the Group Total brings information and economic data on the following topics, for the year 2004: the corporate governance, the corporate social responsibility, the shareholder notebook, the management report, the activities, the upstream (exploration and production) and downstream (refining and marketing) operating, chemicals and other matters. (A.L.B.)

  4. Determination of the Proportion of Total Soil Extracellular Acid Phosphomonoesterase (E.C. 3.1.3.2 Activity Represented by Roots in the Soil of Different Forest Ecosystems

    Directory of Open Access Journals (Sweden)

    Klement Rejsek

    2012-01-01

    Full Text Available The aim of this study is to present a new method for determining the root-derived extracellular acid phosphomonoesterase (EAPM activity fraction within the total EAPM activity of soil. EAPM activity was determined for roots, organic and mineral soil. Samples were collected using paired PVC cylinders, inserted to a depth of 15 cm, within seven selected forest stands. Root-derived EAPM formed between 4 and18% of the total EAPM activity of soil from forests of differing maturity. A new approach, presented in this work, enables separation of root-derived EAPM activity from total soil EAPM. Separation of root-derived EAPM from soil provides a better understanding of its role in P-cycling in terrestrial ecosystems. The method presented in this work is a first step towards the separation of root- and microbe-derived EAPM in soils, which are thought to possess different kinetic properties and different sensitivity to environmental change.

  5. In Teufels Küche – Bohrungen ins Innere von Vulkanen

    OpenAIRE

    T. Wiersberg; Samuel Niedermann; Martin Zimmer

    2014-01-01

    Volcanoes fascinate both scientists and the general public alike. Their hazard risk, their capability to provide unique samples from depth, and their geothermal potential renders them important targets for scientific drilling. To date, a total of seven ICDP volcano drilling projects have been in operation or completed, while several others are in planning. Here we report on the Hawaii Scientific Drilling Project HSDP (USA), the Unzen Scientific Drilling Project USDP (Japan) and the C...

  6. Disturbi dello spettro autistico tra filosofia della medicina e delle neuroscienze

    Directory of Open Access Journals (Sweden)

    Carlo Maria Cirino

    2012-05-01

    Full Text Available L’autismo è un disturbo pervasivo dello sviluppo neuropsicologico che interessa all’incirca un bambino su mille. Purtroppo, si tratta di un dato destinato ad aumentare, anche per via dell’interesse mediatico e scientifico che questa patologia è stata capace di richiamare intorno a sé. Da un lato, infatti, sono aumentate le richieste di screening presso i numerosi centri che monitorano questa complessa patologia neurologica e dall’altro sono migliorate le tecniche di diagnosi che sempre più spesso si avvalgono di esami genetici all’avanguardia in aggiunta alle ormai classiche interviste psicologiche. L’autismo pone, dunque, serie questioni all’attenzione della ricerca scientifica sia nel vasto campo delle neuroscienze che in quello della neuropsichiatria e della psicologia clinica. Ebbene: quel settore della filosofia che guarda alla scienza con interesse particolare, non può che seguire con partecipazione i progressi nella spiegazione di questa misteriosa patologia che, attualmente, resta un vero e proprio rompicapo per tutti coloro che hanno a che fare con la complessità dell’organizzazione cerebrale dell’essere umano.

  7. Misura della sezione d'urto totale e Dello scattering elastico all'energia Nel centro di massa di $\\sqrt{s}=1.8$ TeV

    Energy Technology Data Exchange (ETDEWEB)

    Paoletti, Riccardo [Univ. of Pisa (Italy)

    1991-01-01

    La produzione di eventi elastici è stata misurata al Collider Tevatron del Fermi National Accelerator Laboratory (Batavia. 11.~ U .S.A.) alla energia nel centro di massa. di √s = 1800 GeV, nell'intervallo 0.06 < I t I< 0.24. Sono forniti dettagli sull'esperimento CDF che ha compiuto la misura e sui criteri di selezione degli eventi.

  8. Biological variation and reference intervals for circulating osteopontin, osteoprotegerin, total soluble receptor activator of nuclear factor kappa B ligand and high-sensitivity C-reactive protein

    DEFF Research Database (Denmark)

    Sennels, H P; Jacobsen, Søren; Jensen, T

    2007-01-01

    Objective. Monitoring inflammatory diseases and osteoclastogenesis with osteopontin (OPN), osteoprotegerin (OPG), total soluble receptor activator of nuclear factor kappa B ligand (total sRANKL) and high-sensitivity C-reactive protein (hsCRP) has recently attracted increased interest. The purpose...

  9. Concerns of patients actively contemplating total knee replacement: differences by race and gender.

    Science.gov (United States)

    Chang, Huan J; Mehta, Priya S; Rosenberg, Aaron; Scrimshaw, Susan C

    2004-02-15

    To examine differences by race/ethnicity and gender in patients' concerns regarding total knee replacement (TKR). Focus groups of patients actively considering TKR were conducted. Discussion included patients' questions and concerns regarding TKR. The software ATLAS.ti was used to tabulate themes by race/ethnicity and gender. Concerns raised by focus group participants were compared with thematic content from patient joint replacement information materials. This comparison used patient literature from 3 high-volume academic TKR centers, the Arthritis Foundation, and the American Academy of Orthopedic Surgeons. All groups shared similar concerns. However, some issues were more prevalent among certain gender and racial groups. For instance, concerns regarding anesthesia were more important to white Americans and concerns regarding recovery were more important to women. Some of these concerns were not addressed in the available patient literature. Different gender and racial subgroups focus on different concerns when considering TKR. These differences may contribute to gender and race/ethnicity disparity seen in TKR use.

  10. Determination of total alpha activity index in samples of radioactive wastes

    International Nuclear Information System (INIS)

    Galicia C, F. J.

    2015-01-01

    This study aimed to develop a methodology of preparation and quantification of samples containing radionuclides beta and/or alpha emitters, to determine the rates of alpha and beta total activity of radioactive waste samples. For this, a device of planchettes preparer was designed, to assist the planchettes preparation in a controlled environment and free of corrosive vapors. Planchettes were prepared in three means: nitrate, carbonate and sulfate, to different mass thickness, natural uranium (alpha and beta emitter) and in case of Sr-90 (beta emitter pure) only in half nitrate; and these planchettes were quantified in an alpha/beta counter, in order to construct the self-absorption curves for alpha and beta particles. These curves are necessary to determine the rate of alpha-beta activity of any sample because they provide the self-absorption correction factor to be applied in calculating the index. Samples with U were prepared with the help of the device of planchettes preparer and subsequently were analyzed in the proportional counter Mpc-100 Pic brand. Samples with Sr-90 were prepared without the device to see if there was a different behavior with respect to obtaining mass thickness. Similarly they were calcined and carried out count in the Mpc-100. To perform the count, first the parameters of counter operating were determined: operating voltages for alpha and beta particles 630 and 1500 V respectively, a count routine was generated where the time and count type were adjusted, and counting efficiencies for alpha and beta particles, with the aid of calibration sources of 210 Po for alphas and 90 Sr for betas. According to the results, the counts per minute will decrease as increasing the mass thickness of the sample (self-absorption curve), adjusting this behavior to an exponential function in all cases studied. The minor self-absorption of alpha and beta particles in the case of U was obtained in sulfate medium. The self-absorption curves of Sr-90 follow the

  11. Department of Che

    African Journals Online (AJOL)

    USER

    2015-03-26

    Mar 26, 2015 ... watering, fish culturing and nursery of seedlings. Air is also very ... synthesized organic and inorganic fertilizers are made, synthesized pesticides and herbicides for ..... production and nutritional quality of grains. (Graham and ...

  12. Are total, intensity- and domain-specific physical activity levels associated with life satisfaction among university students?

    Science.gov (United States)

    Pedišić, Željko; Greblo, Zrinka; Phongsavan, Philayrath; Milton, Karen; Bauman, Adrian E

    2015-01-01

    Thorough information about the relationship between physical activity (PA) and life satisfaction is still lacking. Therefore, this study examined the cross-sectional relationships between life satisfaction and meeting the World Health Organization (WHO) moderate to vigorous-intensity PA recommendations, total volume and duration of PA, intensity-specific PA (walking, moderate- and vigorous-intensity), domain-specific PA (work, transport-related, domestic, and leisure-time), and 11 domain and intensity-specific PA types among university students. Additionally, we examined the associations between life satisfaction and gender, age, disposable income, community size, smoking, alcohol intake, body mass index (BMI), and self-rated health. The study included a random sample of 1750 university students in Zagreb, Croatia (response rate = 71.7%; 62.4% females; mean age 21.5 ± 1.8 years), using the International Physical Activity Questionnaire-long form and the Satisfaction with Life Scale. Higher life satisfaction was associated with female gender (β = 0.13; p = leisure-time vigorous-intensity PA was significantly associated with life satisfaction after adjustments for socio-demographic characteristics, lifestyle and self-rated general health (β = 0.06; p = 0.045). This study indicated a weak positive relationship between leisure-time vigorous-intensity PA and life satisfaction, whilst no such association was found for other PA variables. These findings underscore the importance of analyzing domain and intensity-specific PA levels in future studies among university students, as drawing conclusions about the relationship between PA and life satisfaction based on total PA levels only may be misleading.

  13. Correlation Between Total Flavonoid Contents and Macrophage Phagocytosis Activity of Fractions From Faloak (Sterculia quadrifida R.Br. Barks Ethanolic Extract In Vitro

    Directory of Open Access Journals (Sweden)

    Rima Munawaroh

    2018-04-01

    Full Text Available On Timor island, Nusa Tenggara Timur, faloak barks (Sterculia quadrifida R.Br. has been used empirically to restore stamina. Faloak bark ethanolic extract proved to have immunomodulatory activity in vitro, which can increase macrophage phagocytosis activity. This research aimed: (i to determine the immunomodulatory active fraction of faloak bark ethanolic extract, (ii to determine the total flavonoid contents of faloak extract and fractions, and (iii to evaluate the correlation of the total flavonoid contents of those extract and fractions with their macrophage phagocytosis activity. The simplisia powder is macerated with 96% ethanol. The extract was dissolved in methanol:water (9:1v/v was then subsequently partitioned with n-hexane, ethyl acetate, and water to obtain n-hexane fraction, ethyl acetate fraction, water fraction, and insoluble fraction. Faloak extract and fractions at concentration 62,5; 125; 250; 500μg/mL were tested for their effect on the peritoneal macrophage phagocytosis of Balb/c mice in vitro by the latex beads method. Phagocytosis capacity and phagocytosis index were analyzed using one-way anova and post hoc Tukey HSD test with 95% confidence level. The results showed that ethyl acetate fraction had the highest macrophage phagocytosis capacity and the highest total flavonoid content compared to other fractions. The highest macrophage phagocytosis capacity of ethyl acetate fraction at concentration of 250 μg/mL was 51,94±4,67%, this value was significantly different from cell control (7,50±1,29%, negative controls of 0,0625% dimethylsulphoxide (6,25±0,36%, as well as positive control of 200 μg/mL echinaceae extract syrup® (9,97±0,33%. The total flavonoid content of ethyl acetate fraction determined by aluminum chloride method was 4,290±0.029 mg of quercetin equivalent/g fraction. There was a positive and strong correlation between the total flavonoid content of these extract and fractions with their macrophage

  14. Relationship between total and segmental bone mineral density and different domains of physical activity among children and adolescents: cross-sectional study.

    Science.gov (United States)

    Diniz, Tiego Aparecido; Agostinete, Ricardo Ribeiro; Costa, Paulo; Saraiva, Bruna Thamyres Ciccotti; Sonvenso, Diego Kanashiro; Freitas, Ismael Forte; Fernandes, Rômulo Araujo; Christofaro, Diego Giulliano Destro

    2017-01-01

    This study aimed to investigate the relationship between total and segmental bone mineral density (BDM) and physical activity (PA) in different domains (school, leisure and sports) among adolescents and children. Cross-sectional study in the Universidade Estadual Paulista Júlio de Mesquita Filho (UNESP). The study sample consisted of 173 children and adolescents (10.31 ± 1.87 years). The BMDs for the whole body (WB) and the regions of the trunk and legs were measured using dual energy X-ray absorptiometry (DXA). PA was measured using the Baecke questionnaire. A regression model was used to analyze the relationship between all the BMDs and the different domains of PA. 41.5% of the adolescents had high percentages of body fat. Regarding the comparison between physically active and insufficiently active adolescents, there were no statistically significant differences in any BMD variables (P > 0.05). The BMD of the legs showed positive relationships with the total PA (β = 0.009; P = 0.013) and sports PA (β = 0.010; P = 0.049) after insertion of the confounders. Similarly, the WB BMD showed the same relationships (total PA: β = 0.005; P = 0.045; and sports PA: β = 0.008; P = 0.049). No relationship was found between leisure and school PA and any of the BMDs (P > 0.05). The results indicated that practice of sport was related to higher BMD values, independent of sex, age and body fatness.

  15. Soil pH, total phosphorus, climate and distance are the major factors influencing microbial activity at a regional spatial scale

    DEFF Research Database (Denmark)

    Cao, Haichuan; Chen, Ruirui; Wang, Libing

    2016-01-01

    Considering the extensive functional redundancy in microbial communities and great difficulty in elucidating it based on taxonomic structure, studies on the biogeography of soil microbial activity at large spatial scale are as important as microbial community structure. Eighty-four soil samples...... scaling clearly revealed that soil microbial activities showed distinct differentiation at different sites over a regional spatial scale, which were strongly affected by soil pH, total P, rainfall, temperature, soil type and location. In addition, microbial community structure was greatly influenced...... scales. There are common (distance, climate, pH and soil type) but differentiated aspects (TP, SOC and N) in the biogeography of soil microbial community structure and activity....

  16. Total Phenolics and Total Flavonoids Contents and Hypnotic Effect in Mice of Ziziphus mauritiana Lam. Seed Extract

    Directory of Open Access Journals (Sweden)

    Aye Moh Moh San

    2013-01-01

    Full Text Available The seeds of Ziziphus mauritiana Lam. have been traditionally used for treatment of various complications including insomnia and anxiety. They are popularly used as sedative and hypnotic drugs in China, Korea, Myanmar, Vietnam, and other Asian countries. However, no scientific proof on hypnotic activity of Z. mauritiana seeds (ZMS was reported. In this study, the hypnotic activity of 50% ethanolic extract from ZMS was observed on the loss of righting reflex in mice using pentobarbital-induced sleep mice method. The contents of total phenolics and total flavonoids in the extract were also determined. The results showed that the 50% ethanolic extract from ZMS contained total phenolics  mg gallic acid equivalent (GAE/g extract and total flavonoids  mg quercetin equivalent (QE/g extract. Oral administration of the extract at the dose of 200 mg/kg significantly increased the sleeping time in mice intraperitoneally administered with sodium pentobarbital (50 mg/kg body weight. These results supported the traditional use of ZMS for the treatment of insomnia. The seeds of Z. mauritiana should be further developed as an alternative sedative and/or hypnotic product.

  17. La fisica del Novecento per un bilancio critico

    CERN Document Server

    Selleri, Franco

    1999-01-01

    Ma chi ha detto che la fine della fisica è vicina? Che tutto quello che c'era da scoprire è già stato scoperto? E che le generazioni future potranno solo precisare e raffinare, e mai negare o arricchire le attuali teorie? Questo libro si contrappone a pensatori come Heisenberg, Feyman e Hawking che hanno predetto la morte della fisica. L'autore sostiene che grandi progressi sono possibili, ma che il prezzo da pagare per realizzarli è una modifica radicale delle basi della fisica moderna, in particolare abbandonando l'indeterminismo, la non località (paradosso di Einstein, Podolsky e Rosen) e lo stesso principio di relatività.

  18. In vitro total phenolics, flavonoids contents and antioxidant activity of essential oil, various organic extracts from the leaves of tropical medicinal plant Tetrastigma from Sabah.

    Science.gov (United States)

    Hossain, M Amzad; Shah, Muhammad Dawood; Gnanaraj, Charles; Iqbal, Muhammad

    2011-09-01

    To detect the in vitro total phenolics, flavonoids contents and antioxidant activity of essential oil, various organic extracts from the leaves of tropical medicinal plant Tetrastigma from Sabah. The dry powder leaves of Tetrastigma were extracted with different organic solvent such as hexane, ethyl acetate, chloroform, butanol and aqueous methanol. The total phenolic and total flavonoids contents of the essential oil and various organic extracts such as hexane, ethyl acetate, chloroform, butanol and aqueous ethanol were determined by Folin - Ciocalteu method and the assayed antioxidant activity was determined in vitro models such as antioxidant capacity by radical scavenging activity using α, α-diphenyl- β-picrylhydrazyl (DPPH) method. The total phenolic contents of the essential oil and different extracts as gallic acid equivalents were found to be highest in methanol extract (386.22 mg/g) followed by ethyl acetate (190.89 mg/g), chloroform (175.89 mg/g), hexane (173.44 mg/g), and butanol extract (131.72 mg/g) and the phenolic contents not detected in essential oil. The antioxidant capacity of the essential oil and different extracts as ascorbic acid standard was in the order of methanol extract > ethyl acetate extract >chloroform> butanol > hexane extract also the antioxidant activity was not detected in essential oil. The findings show that the extent of antioxidant activity of the essential oil and all extracts are in accordance with the amount of phenolics present in that extract. Leaves of Tetrastigma being rich in phenolics may provide a good source of antioxidant. Copyright © 2011 Hainan Medical College. Published by Elsevier B.V. All rights reserved.

  19. La mente incarnata e le prospettive morali della Fenomenologia della Percezione

    Directory of Open Access Journals (Sweden)

    Francesco Consiglio

    2015-03-01

    Full Text Available In contrasto con quella che era stata la tradizione dell’empirismo classico di matrice hobbesiana e lockiana da un lato, e la tradizione razionalista a erente al nucleo loso co cartesiano, Merleau-Ponty elabora una “terza via” che si propone di riportare la conoscenza nell’ambito dello stretto rapporto tra il corpo e i fenomeni che esso esperisce in quanto corpo vivente e non mero oggetto tra gli oggetti. Il mio corpo non è, come credeva convintamente Cartesio, mera res extensa, separata dalla mia più pura e vera essenza di res cogitans; anzi è proprio col mio essere corpo vivente che conosco pienamente il mondo. Noi non costruiamo il mondo naturale, ma lo viviamo. È in esso che avviene l’incontro con l’Altro, l’incontro di prospettive che ci mette alla prova nell’agire morale; è in questo incontro che nasce il senso che esso assume per noi. È in questo rapporto d’intersoggettività che si genera il nodo di signi cati che costituisce il mondo culturale e più ancora quello morale. In questo contesto l’ottica del corpo vissuto costituisce un presupposto radicale che modi ca n dal principio il rapporto tra soggetto e mondo, tra soggetto singolo e altri individui.

  20. Seasonal variations of total {sup 234}Th and dissolved {sup 238}U concentration activities in surface water of Bransfield Strait, Antarctica, from March to October 2011

    Energy Technology Data Exchange (ETDEWEB)

    Lapa, Flavia V.; Oliveira, Joselene de; Costa, Alice M.R., E-mail: fvlapa@ipen.br, E-mail: jolivei@ipen.br, E-mail: lice_mrc@hotmail.com [Instituto de Pesquisas Energeticas e Nucleares (IPEN-CNEN/SP), Sao Paulo, SP (Brazil). Laboratorio de Radiometria Ambiental; Braga, Elisabete S., E-mail: edsbraga@usp.br [Universidade de Sao Paulo (USP), Sao Paulo, SP (Brazil). Inst. Oceanografico. Lab. de Nutrientes, Micronutrientes e Tracos nos Oceanos

    2013-07-01

    In this study the naturally occurring radionuclides {sup 234}Th and {sup 238}U were used to investigate the magnitude of upper ocean particulate organic carbon export in Bransfield Strait, Southern Ocean. This region is the largest oceanic high-nitrate low-chlorophyll (HNLC) area in the world and is known to contribute to regulate of the atmospheric CO{sub 2} via the biological pump. Due to its different geochemical behavior in seawater, the resulting U/Th disequilibria can be easily used to constrain the transport rates of particles and reaction processes between solution and particulate phases. Sampling occurred during the summer (March and November) 2011. Total {sup 234}Th activities in surface seawater samples ranged from 1.3 to 3.7 dpm L{sup -1} (station EB 011) during March/11 campaign, while in October/11 total {sup 234}Th activity concentrations varied from 1.4 to 2.9 dpm L{sup -1}. Highest total {sup 234}Th activities were found late in the austral summer season. Activity concentrations of dissolved {sup 238}U in surface seawater varied from 2.1 to 2.4 dpm L{sup -1}. Taking into account all sampling stations established in March and October/11 the relative variability of total {sup 234}Th distribution was 22%. (author)

  1. Total design of participation

    DEFF Research Database (Denmark)

    Munch, Anders V.

    2016-01-01

    The idea of design as an art made not only for the people, but also by the people is an old dream going back at least to William Morris. It is, however, reappearing vigoriously in many kinds of design activism and grows out of the visions of a Total Design of society. The ideas of participation b...

  2. Acute toxicity and cholinesterase inhibition of the nematicide ethoprophos in larvae of gar Atractosteus tropicus (Semionotiformes: Lepisosteidae

    Directory of Open Access Journals (Sweden)

    Freylan Mena Torres

    2012-03-01

    Full Text Available Biomarkers are a widely applied approach in environmental studies. Analyses of cholinesterase (ChE, glutathione S-transferase (GST and lipid peroxidation (LPO are biomarkers that can provide information regarding early effects of pollutants at different biochemical levels on an organism. The aim of this study was to evaluate the biomarker approach on a Costa Rican native and relevant species. For this, larvae of gar (Atractosteus tropicus were exposed to the organophosphorus nematicide, ethoprophos. Acute (96hr exposure was conducted with pesticide concentrations ranging from 0.1μg/L to 1 500μg/L. The 96hr LC50 calculated was 859.7μg/L. After exposure, three biomarkers (ChE, GST and LPO were analyzed in fish that survived the acute test. The lowest observed effect concentration (LOEC regarding ChE activity inhibition was 50μg/L. This concentration produced a significant inhibition (p0.05 in GST activity and LPO were observed in A. tropicus larvae after exposure to ethoprophos.

  3. ARTICLES / SAGGI

    African Journals Online (AJOL)

    User

    che intellettuali o analfabeti, fortunati o disgraziati, poveri o ricchi, alla fine il bilancio è sempre lo stesso. [...] È la vita, e basta, e se riesco a dirla in modo che altri la riconosca in fraternità leggendomi, questo è il solo dovere che conti, la sola estetica che sia anche un'etica. Che sollievo! Infine l'ho detto, e in prima persona”.

  4. Fermentation and complex enzyme hydrolysis for improving the total soluble phenolic contents, flavonoid aglycones contents and bio-activities of guava leaves tea.

    Science.gov (United States)

    Wang, Lu; Luo, You; Wu, Yanan; Liu, Yan; Wu, Zhenqiang

    2018-10-30

    There are both soluble and insoluble-bound forms of phenolics in tea-leaf products. In order to increase total soluble phenolics contents, guava leaves tea (GLT) was first fermented with Monascus anka and Saccharomyces cerevisiae, and then hydrolyzed with complex enzymes. The changes in phenolics profiles, antioxidant activities and inhibitory effect on α-glucosidase in processed GLT were investigated. Compared with the un-fermented GLT, fermentation and complex enzymatic processing (FE) significantly increased the total phenolics, total flavonoids, quercetin and kaempferol contents by 2.1, 2.0, 13.0 and 6.8 times, respectively. After the FE, a major proportion of phenolics existed in the soluble form. Quercetin was released in the highest amount among different phenolics. In addition, soluble phenolic extracts from GLT following FE exhibited a highest antioxidant activity and inhibitory effect on α-glucosidase. The paper suggested an improved method for processing GLT into high-value products rich in phenolics and flavonoids aglycones with enhanced health benefits. Copyright © 2018 Elsevier Ltd. All rights reserved.

  5. Case study on total electron content enhancements at low latitudes during low geomagnetic activities before the storms

    Directory of Open Access Journals (Sweden)

    Libo Liu

    2008-05-01

    Full Text Available Sometimes the ionospheric total electron content (TEC is significantly enhanced during low geomagnetic activities before storms. In this article, we investigate the characteristics of those interesting TEC enhancements using regional and global TEC data. We analyzed the low-latitude TEC enhancement events that occurred around longitude 120° E on 10 February 2004, 21 January 2004, and 4 March 2001, respectively. The TEC data are derived from regional Global Positioning System (GPS observations in the Asia/Australia sector as well as global ionospheric maps (GIMs produced by Jet Propulsion Laboratory (JPL. Strong enhancements under low geomagnetic activity before the storms are simultaneously presented at low latitudes in the Asia/Australia sector in regional TEC and JPL GIMs. These TEC enhancements are shown to be regional events with longitudinal and latitudinal extent. The regions of TEC enhancements during these events are confined at narrow longitude ranges around longitude 120° E. The latitudinal belts of maxima of enhancements locate around the northern and southern equatorial ionization anomaly (EIA crests, which are consistent with those low-latitude events presented by Liu et al. (2008. During the 4 March 2001 event, the total plasma density Ni observed by the Defense Meteorological Satellite Program (DMSP spacecraft F13 at 840 km altitude are of considerably higher values on 4 March than on the previous day in the TEC enhanced regions. Some TEC enhancement events are possibly due to contributions from auroral/magnetospheric origins; while there are also quasi-periodic enhancement events not related to geomagnetic activity and associated probably with planetary wave type oscillations (e.g. the 6 January 1998 event. Further investigation is warrented to identify/separate contributions from possible sources.

  6. Antioxidant activity and total phenolic and flavonoid content of ...

    African Journals Online (AJOL)

    ajl yemi

    2011-12-19

    Dec 19, 2011 ... Figure 3. Antioxidant activity of A. squarrosus extract by FTC method. A low absorbance value represents a high level of antioxidant activity. lipid peroxides. The Fe3+-thiocyanate complex produces a deep red color, which is detectable at 500 nm. The advantage of using ammonium thiocyanate over other.

  7. Time-driven activity based costing of total knee replacement surgery at a London teaching hospital.

    Science.gov (United States)

    Chen, Alvin; Sabharwal, Sanjeeve; Akhtar, Kashif; Makaram, Navnit; Gupte, Chinmay M

    2015-12-01

    The aim of this study was to conduct a time-driven activity based costing (TDABC) analysis of the clinical pathway for total knee replacement (TKR) and to determine where the major cost drivers lay. The in-patient pathway was prospectively mapped utilising a TDABC model, following 20 TKRs. The mean age for these patients was 73.4 years. All patients were ASA grade I or II and their mean BMI was 30.4. The 14 varus knees had a mean deformity of 5.32° and the six valgus knee had a mean deformity of 10.83°. Timings were prospectively collected as each patient was followed through the TKR pathway. Pre-operative costs including pre-assessment and joint school were £ 163. Total staff costs for admission and the operating theatre were £ 658. Consumables cost for the operating theatre were £ 1862. The average length of stay was 5.25 days at a total cost of £ 910. Trust overheads contributed £ 1651. The overall institutional cost of a 'noncomplex' TKR in patients without substantial medical co-morbidities was estimated to be £ 5422, representing a profit of £ 1065 based on a best practice tariff of £ 6487. The major cost drivers in the TKR pathway were determined to be theatre consumables, corporate overheads, overall ward cost and operating theatre staffing costs. Appropriate discounting of implant costs, reduction in length of stay by adopting an enhanced recovery programme and control of corporate overheads through the use of elective orthopaedic treatment centres are proposed approaches for reducing the overall cost of treatment. Copyright © 2015 Elsevier B.V. All rights reserved.

  8. Total phenolic content and antioxidant activities of pomegranate juice and whey based novel beverage fermented by kefir grains.

    Science.gov (United States)

    Sabokbar, Nayereh; Khodaiyan, Faramarz

    2016-01-01

    Mixture of pomegranate juice and whey was evaluated as a potential substrate for production of a novel beverage by kefir grains. The effects of two different variables, fermentation, temperature (19 and 25 °C) and kefir grain amount (5 %w/v and 8 %w/v), on total phenolic content (TPC) and antioxidant activities of beverage were examined during a fermentation time of 32 h. TPC and antioxidant activities including 1,1-diphenyl-2-picrylhydrazyl (DPPH) radical scavenging, reducing power, inhibition effect upon linoleic acid autoxidation and inhibition effect upon ascorbate autoxidation increased significantly (p < 0.05) during fermentation, but metal chelating effect showed no significant difference. The highest increases were observed when the temperature of 25 °C and kefir grain amount of 8 %w/v were applied. Results proved antioxidant activities of beverages were desirable and fermentation by kefir grains has the ability to enhance these antioxidant activities, as compared with unfermented beverage. Also pomegranate juice and whey were suitable media for producing a novel dairy-juice beverage.

  9. The Evaluation of Protein C Activity and Some Inflammatory Markers in Synovia of Patients Undergoing Total Knee Arthroplasty

    Directory of Open Access Journals (Sweden)

    Ahmet Ata Alturfan

    2011-06-01

    Full Text Available Objective: Total knee arthroplasty (TKA is a major risk factor for thrombosis in patients over 40 years of age and this risk persists for several weeks after the surgery. Since inflammatory mechanisms affect coagulation and the natural anticoagulant system, we aimed to investigate protein C activities and inflammatory markers in patients undergoing TKA surgery.Material and Methods: We included 20 osteoarthritis patients and 20 healthy controls. Protein C activity and tumor necrosis factor-α (TNF-α levels in plasma and synovia were evaluated by ELISA technique. Results: In the patient group, protein C activities decreased and TNF-α levels increased significantly both in synovia and plasma when compared with the controls. Erythrocyte sedimentation rate of the patient group was found to be significantly elevated in comparison to the controls. On the other hand, serum C reactive protein values increased insignificantly when compared to controls.Conclusion: The decreased activity of protein C and increased levels of inflammatory markers in preoperative plasma and synovia of the patient group may enhance the risk for developing thrombosis.

  10. Total Phenolic, Flavonoid, Tomatine, and Tomatidine Contents and Antioxidant and Antimicrobial Activities of Extracts of Tomato Plant

    Science.gov (United States)

    Silva-Beltrán, Norma Patricia; Ruiz-Cruz, Saul; Cira-Chávez, Luis Alberto; Estrada-Alvarado, María Isabel; Ornelas-Paz, José de Jesús; López-Mata, Marco Antonio; Del-Toro-Sánchez, Carmen Lizette; Ayala-Zavala, J. Fernando; Márquez-Ríos, Enrique

    2015-01-01

    The purpose of this study was to evaluate the antioxidant and antimicrobial properties of extracts of different fractions of two tomato plant cultivars. The stems, roots, leaves, and whole-plant fractions were evaluated. Tomatine and tomatidine were identified by HPLC-DAD. The leaf extracts from the two varieties showed the highest flavonoids, chlorophyll, carotenoids, and total phenolics contents and the highest antioxidant activity determined by DPPH, ABTS, and ORAC. A positive correlation was observed between the antioxidant capacities of the extracts and the total phenolic, flavonoid, and chlorophyll contents. The Pitenza variety extracts inhibited the growth of pathogens such as E. coli O157:H7, Salmonella Typhimurium, Staphylococcus aureus, and Listeria ivanovii, yielding inhibition halos of 8.0 to 12.9 mm in diameter and MIC values of 12.5 to 3.125 mg/mL. These results suggest that tomato plant shows well potential as sources of various bioactive compounds, antioxidants, and antimicrobials. PMID:26609308

  11. Reduced hepatotoxicity by total glucosides of paeony in combination treatment with leflunomide and methotrexate for patients with active rheumatoid arthritis.

    Science.gov (United States)

    Chen, Zhu; Li, Xiang-Pei; Li, Zhi-Jun; Xu, Liang; Li, Xiao-Mei

    2013-03-01

    Combination use of methotrexate (MTX) and leflunomide (LEF) has been proved effective in the treatment of active rheumatoid arthritis (RA). However, previous trials have documented that both are associated with increased incidence of liver toxicity. As active compounds extracted from the roots of the traditional Chinese herb Paeonia lactiflora Pall, total glucosides of paeony (TGP) have been shown to have anti-inflammatory, hepatoprotective and immuno-regulatory activities, without evident toxicity or side effects. In this 24-week, open label, randomized multicenter clinical trial, we investigated the efficacy of TGP and the protective effect on hepatotoxicity in the combination treatment with LEF and MTX for patients with active RA. A total of 204 patients with active RA (DAS28>3.2) recruited from 3 regional referral centers were enrolled and received MTX and LEF combination therapy (MTX 10 mg/week plus LEF 20 mg/day) with or without TGP for up to 24 weeks by randomization. Hepatotoxicity was defined as an increase of at least 1.5-fold the upper limits of normal (ULN) of alanine aminotransferase (ALT) or aspartate aminotransferase (AST). Significantly less frequent hepatotoxicity was observed in patients with TGP than those without (9.5% vs 34.8%, p 1.5 to ≤2 times and >2 to ≤3 times the ULN were lower in TGP group than the control (1.9% vs 10.1%, 2.9% vs 12.4%, p TGP group achieved a European League Against Rheumatism (EULAR) good response or moderate response at 12 weeks, although there is no statistical significance. Similar results were observed at 24 weeks. Our preliminary study demonstrates the hepatoprotective and additive role of TGP in combination with MTX and LEF in the treatment of active RA. Copyright © 2013 Elsevier B.V. All rights reserved.

  12. Estimation of salivary flow rate, pH, buffer capacity, calcium, total protein content and total antioxidant capacity in relation to dental caries severity, age and gender.

    Science.gov (United States)

    Pandey, Pallavi; Reddy, N Venugopal; Rao, V Arun Prasad; Saxena, Aditya; Chaudhary, C P

    2015-03-01

    The aim of the study was to evaluate salivary flow rate, pH, buffering capacity, calcium, total protein content and total antioxidant capacity in relation to dental caries, age and gender. The study population consisted of 120 healthy children aged 7-15 years that was further divided into two groups: 7-10 years and 11-15 years. In this 60 children with DMFS/dfs = 0 and 60 children with DMFS/dfs ≥5 were included. The subjects were divided into two groups; Group A: Children with DMFS/dfs = 0 (caries-free) Group B: Children with DMFS/dfs ≥5 (caries active). Unstimulated saliva samples were collected from all groups. Flow rates were determined, and samples analyzed for pH, buffer capacity, calcium, total protein and total antioxidant status. Salivary antioxidant activity is measured with spectrophotometer by an adaptation of 2,2'-azino-di-(3-ethylbenzthiazoline-6-sulphonate) assays. The mean difference of the two groups; caries-free and caries active were proved to be statistically significant (P salivary calcium, total protein and total antioxidant level for both the sexes in the age group 7-10 years and for the age 11-15 years the mean difference of the two groups were proved to be statistically significant (P salivary calcium level for both the sexes. Salivary total protein and total antioxidant level were proved to be statistically significant for male children only. In general, total protein and total antioxidants in saliva were increased with caries activity. Calcium content of saliva was found to be more in caries-free group and increased with age.

  13. Evaluation of body composition and nitrogen content of renal patients on chronic dialysis as determined by total body neutron activation

    International Nuclear Information System (INIS)

    Cohn, S.H.; Brennan, B.L.; Yasumura, S.; Vartsky, D.; Vaswani, A.N.; Ellis, K.J.

    1983-01-01

    Total body protein (nitrogen), body cell mass (potassium), fat, and water were measured in 15 renal patients on maintenance hemodialysis (MHD). Total body nitrogen was measured by means of prompt γ neutron activation analysis; total body water was determined with tritium labeled water; total body potassium was measured by whole body counting. The extracellular water was determined by a technique utilizing the measurement of total body chloride and plasma chloride. When compared with corresponding values of a control group of the same age, sex, and height, the protein content, body cell mass, and total body fat of the MHD patients were within the normal range. The only significant change was an increase in the extracellular water/body cell mass ratio in the male MHD patients compared to the control. The lack of significant difference of the nitrogen values of the MHD patients compared to matched controls suggests that dialysis minimizes any residual effects of uremic toxicity or protein-calorie malnutrition. These findings further suggest that there is a need to reevaluate the traditional anthropometric and biochemical standards of nutritional status for MHD patients. It was concluded that it is particularly important to measure protein stores of MHD patients with low protein intake to ascertain nutritional status. Finally, in vivo measurement of total body nitrogen and potassium for determination of body composition provides a simple, direct, and accurate assessment of the nutritional status of MHD patients

  14. Induction of reactive oxygen species-stimulated distinctive autophagy by chelerythrine in non-small cell lung cancer cells.

    Science.gov (United States)

    Tang, Zheng-Hai; Cao, Wen-Xiang; Wang, Zhao-Yu; Lu, Jia-Hong; Liu, Bo; Chen, Xiuping; Lu, Jin-Jian

    2017-08-01

    Chelerythrine (CHE), a natural benzo[c]phenanthridine alkaloid, shows anti-cancer effect through a number of mechanisms. Herein, the effect and mechanism of the CHE-induced autophagy, a type II programmed cell death, in non-small cell lung cancer (NSCLC) cells were studied for the first time. CHE induced cell viability decrease, colony formation inhibition, and apoptosis in a concentration-dependent manner in NSCLC A549 and NCI-H1299 cells. In addition, CHE triggered the expression of phosphatidylethanolamine-modified microtubule-associated protein light-chain 3 (LC3-II). The CHE-induced expression of LC3-II was further increased in the combination treatment with chloroquine (CQ), an autophagy inhibitor, and large amounts of red-puncta were observed in the CHE-treated A549 cells with stable expression of mRFP-EGFP-LC3, indicating that CHE induces autophagy flux. Silence of beclin 1 reversed the CHE-induced expression of LC3-II. Inhibition of autophagy remarkably reversed the CHE-induced cell viability decrease and apoptosis in NCI-H1299 cells but not in A549 cells. Furthermore, CHE triggered reactive oxygen species (ROS) generation in both cell lines. A decreased level of ROS through pretreatment with N-acetyl-L-cysteine reversed the CHE-induced cell viability decrease, apoptosis, and autophagy. Taken together, CHE induced distinctive autophagy in A549 (accompanied autophagy) and NCI-H1299 (pro-death autophagy) cells and a decreased level of ROS reversed the effect of CHE in NSCLC cells in terms of cell viability, apoptosis, and autophagy. Copyright © 2017 The Authors. Published by Elsevier B.V. All rights reserved.

  15. Evaluation of the Addition liquor with high ammonia and Carbon Dioxide contentin the still 208 of the “Comandante Che Guevara” industry (ECG

    Directory of Open Access Journals (Sweden)

    María Elena Magaña-Haynes

    2015-12-01

    Full Text Available Adding fresh liquor through the 5th ring in still 208 of distilling liquor product (liquor obtained as a result of ammonium carbonate leaching of lateritic ore in the “Comandante Che Guevara” industry, were evaluated with the objective of reducing the dissolved nickel content of the effluent there from, as well as to improve the characteristics of the nickel carbonate which is delivered to the calcinations process. For the development of the survey, the same methodology used in 2001 for the test was applied. The results showed that by adding fresh liquor, it is possible to reduce the dissolved nickel content at the exit of the distillation column, so that the need for precipitation is minimized, thereby reducing the consumption of reagents and the and the cost for their acquisition. It was possible to corroborate the relationship between the content of NH3 at the discharge and the nickel dissolved therein appreciating that to achieve these results it is necessary to maintain the ammonia in the discharge between 1,0-1,8 g/L. The carbonate obtained in the column where liquor is added with high CO2 and NH3 reached high values of this last element in its composition and to the extent that increased sulphur content decreased. It was also seen an increase in the size of the coarse carbonates particles, which will influence in a decrease of energy consumption.

  16. A General Cp*CoIII -Catalyzed Intramolecular C-H Activation Approach for the Efficient Total Syntheses of Aromathecin, Protoberberine, and Tylophora Alkaloids.

    Science.gov (United States)

    Lerchen, Andreas; Knecht, Tobias; Koy, Maximilian; Daniliuc, Constantin G; Glorius, Frank

    2017-09-07

    Herein, we report a Cp*Co III -catalyzed C-H activation approach as the key step to create highly valuable isoquinolones and pyridones as building blocks that can readily be applied in the total syntheses of a variety of aromathecin, protoberberine, and tylophora alkaloids. This particular C-H activation/annulation reaction was achieved with several terminal as well as internal alkyne coupling partners delivering a broad scope with excellent functional group tolerance. The synthetic applicability of this protocol reported herein was demonstrated in the total syntheses of two Topo-I-Inhibitors and two 8-oxyprotoberberine cores that can be further elaborated into the tetrahydroprotoberberine and the protoberberine alkaloid core. Moreover these building blocks were also transformed to six different tylophora alkaloids in expedient fashion. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  17. Informative management system for administrative management; Il sistema informativo per il reporting e il controllo di gestione di un ente complesso. Realizzazione di un prototipo

    Energy Technology Data Exchange (ETDEWEB)

    D' Onofrio, M G; Minelle, F [Rome Univ. La Sapienza, Rome (Italy). Fac. di Scienze Matematiche, Fisiche e Naturali; Di Marco, R A [ENEA, Sede Centrale, Rome (Italy). Funzione Centrale Informatica

    1999-07-01

    The need to optimate the total functionality of the firm, introducing suitable Control System of inherit and merit evaluation concerning the administrative-management results, strengthens the assumption of responsibility from the managerial staff and promotes the operative and management decentralization. In this context assumes a remarkable importance the function of the Informative Management System which has got to assure, in a realistic, qualified and effectual way, a good support to all activities it can make easy, not only the standard working but also the achievement of the programmatic targets. In the present context, where the development of technology often exceeds that one of the organization structures, it is right to redesign the Informative Management System, considering that often the management informatics procedures are obsolete. The statement of the carried out work bases itself on the observation of the business management process: in order to achieve its targets, the firm transform some resources, each one with its own cycle of life, through stages of management classifiable in merit evaluation, decision, execution and control. These stages are carried out by treatment of the Information that represent the link among them, the main resource of the whole organization and the basis of the Informative Management System. Considering the information as an element characterizing the firm, in that it comes from a complicated system which permits to assert that the fulfilment of on effective and efficient management depends largely from its capacity to use the Information. [Italian] La necessita' di ottimizzare la funzionalita' complessiva dell'azienda, introducendo adeguati sistemi di controllo di merito e di valutazione dei risultati a livello amministrativo-gestionale rafforza l'assunzione di responsabilita' da parte della struttura dirigenziale e favorisce il decentramento gestionale e operativo. In questo contesto assume notevole importanza la

  18. Magnetic field effect on growth, arsenic uptake, and total amylolytic activity on mesquite (Prosopis juliflora x P. velutina) seeds

    Science.gov (United States)

    Flores-Tavizón, Edith; Mokgalaka-Matlala, Ntebogeng S.; Elizalde Galindo, José T.; Castillo-Michelle, Hiram; Peralta-Videa, Jose R.; Gardea-Torresdey, Jorge L.

    2012-04-01

    Magnetic field is closely related to the cell metabolism of plants [N. A. Belyavskaya, Adv. Space Res. 34, 1566 (2004)]. In order to see the effect of magnetic field on the plant growth, arsenic uptake, and total amylolytic activity of mesquite (Prosopis juliflora x P. velutina) seeds, ten sets of 80 seeds were selected to be oriented with the long axis parallel or randomly oriented to an external magnetic field. The external magnetic field magnitude was 1 T, and the exposition time t = 30 min. Then, the seeds were stored for three days in a plastic bag and then sown on paper towels in a modified Hoagland's nutrient solution. After three days of germination in the dark and three days in light, seedlings were grown hydroponically in modified Hoagland's nutrient solution (high PO42-) containing 0, 10, or 20 ppm of arsenic as As (III) and (V). The results show that the germination ratios, growth, elongation, arsenic uptake, and total amylolytic activity of the long axis oriented mesquite seeds were much higher than those of the randomly oriented seeds. Also, these two sets of seeds showed higher properties than the ones that were not exposed to external magnetic field.

  19. Income related inequality and influencing factors: a study for the incidence of catastrophic health expenditure in rural China.

    Science.gov (United States)

    Gu, Hai; Kou, Yun; Yan, Zhiwen; Ding, Yilei; Shieh, Jusheng; Sun, Jun; Cui, Nan; Wang, Qianjing; You, Hua

    2017-09-20

    Catastrophic health expenditure (CHE) puts a heavy disease burden on patients' families, aggravating income-related inequality. In an attempt to reduce the financial risks of rural families incurring CHE, China began the New Rural Cooperative Medical System (NCMS) on a trial basis in 2003 and has raised the reimbursement rates continuously since then. Based on statistical data about rural families in sample area of Jiangsu province, this study measures the incidence of CHE, analyzes socioeconomic inequality related to CHE, and explores the influences of the NCMS on the incidence of CHE. Statistical data were acquired from two surveys about rural health care, one conducted in 2009 and one conducted in 2010. In 2009, 1424 rural families were analyzed; in 2010, 1796 rural families were analyzed. An index of CHE is created to enable the evaluation of the associated financial risks. The concentration index and concentration curve are used to measure the income-related inequality involved in CHE. Multiple logistic regression is utilized to explore the factors that influence the incidence of CHE. The incidence of CHE decreased from 13.62% in 2009 to 7.74% in 2010. The concentration index of CHE was changed from -0.298 (2009) to -0.323 (2010). Compared with rural families in which all members were covered by the NCMS, rural families in which some members were not covered by the NCMS had a lower incidence of CHE: The odds ratio is 0.65 with a 95% confidence interval of 0.43 to 1.00. For rural families in which all members were covered by the NCMS, the increase in reimbursement rates is correlated to the decline in the incidence of CHE if other influencing factors were controlled: The odds ratio is 0.48 with a 95% confidence interval of 0.36 to 0.64. Between 2009 and 2010, the incidence rate of CHE in the sampled area decreased sharply, CHE was more concentrated among least wealthy and inequality increased during study period. As of 2010, the poorest rural families still had

  20. Il cielo sopra Roma I luoghi dell’astronomia

    CERN Document Server

    Buonanno, Roberto

    2008-01-01

    L’astronomia a Roma c’è sempre stata, ma un po’ nascosta: era nei palazzi, nelle chiese o, meglio, sopra le chiese, specole disseminate lungo un percorso che oramai conoscono in pochi. I romani hanno assistito, incuriositi ed impauriti, al rogo di Giordano Bruno in un angolo di Campo de' Fiori a loro familiare, ma probabilmente non capirono bene di quale colpa fosse accusato. Non pensarono certo che si trattasse di un filosofo e di uno scienziato che aveva cercato di immaginare in che modo era fatto il mondo. Chi era questo Galileo, di cui si celebrava il processo a S. Maria sopra Minerva? Era un uomo che voleva cambiare la prospettiva del mondo e che, per questo, era stato ammonito da Roberto Bellarmino. E chi era questo gesuita, Secchi, che nel 1870 costringeva gli Italiani a privare Roma del suo Osservatorio Astronomico, visto che il Direttore non riconosceva lo Stato Italiano? Come è possibile che dopo la visita di Hitler a Mussolini alla vigilia della Guerra, la Germania decise di regalare all’...

  1. The distribution of total vitamin b12 holotranscobalamin and the active vitamin b12 fraction in the first 5 weeks postpartum

    NARCIS (Netherlands)

    van der Woude, D.A.A.; Pijnenborg, J.M.A.; de Vries, J.; van Wijk, E.M.

    2018-01-01

    Introduction Total vitamin B12 levels decrease significantly during pregnancy and recover to normal values within 8-week postpartum. Holotranscobalamin (holoTC) reflects the active part of vitamin B12 and has been shown to remain constant during pregnancy and postpartum. A mechanism of

  2. Benefits of using customized instrumentation in total knee arthroplasty: results from an activity-based costing model.

    Science.gov (United States)

    Tibesku, Carsten O; Hofer, Pamela; Portegies, Wesley; Ruys, C J M; Fennema, Peter

    2013-03-01

    The growing demand for total knee arthroplasty (TKA) associated with the efforts to contain healthcare expenditure by advanced economies necessitates the use of economically effective technologies in TKA. The present analysis based on activity-based costing (ABC) model was carried out to estimate the economic value of patient-matched instrumentation (PMI) compared to standard surgical instrumentation in TKA. The costs of the two approaches, PMI and standard instrumentation in TKA, were determined by the use of ABC which measures the cost of a particular procedure by determining the activities involved and adding the cost of each activity. Improvement in productivity due to increased operating room (OR) turn-around times was determined and potential additional revenue to the hospital by the efficient utilization of gained OR time was estimated. Increased efficiency in the usage of OR and utilization of surgical trays were noted with patient-specific approach. Potential revenues to the hospital were estimated with the use of PMI by efficient utilization of time saved in OR. Additional revenues of 78,240 per year were estimated considering utilization of gained OR time to perform surgeries other than TKA. The analysis suggests that use of PMI in TKA is economically effective when compared to standard instrumentation.

  3. Phytochemical screening, total phenolics and antioxidant activities of bark and leaf extracts of Goniothalamus velutinus (Airy Shaw from Brunei Darussalam

    Directory of Open Access Journals (Sweden)

    Erum Iqbal

    2015-07-01

    Full Text Available Goniothalamus velutinus Airy Shaw belongs to the family Annonaceae which is known to have anticancer, antitumor and many other bioactivities. Natives of Sabah and Sarawak use root decoction of G. velutinus for the treatment of headache and food poisoning while the bark was used as a mosquito repellent. Bark and leaf extracts of this plant, obtained from Brunei Darussalam, were tested for phytochemical and antioxidant activities. Phytochemical screening of plant extracts revealed the presence of alkaloids, steroids, terpenoids and cardiac glycosides. Quantitative determination of total phenolics, total flavonoids, and various in vitro antioxidant activities (DPPH, ABTS and FRAP of methanolic extract was carried out using colorimetric methods. The total phenolic content, expressed as mg of gallic acid equivalent (GAE per gram of extract, was found to be 68 mg GAE/g and 78 mg GAE/g for bark and leaves respectively. The radical scavenging activity measurement, expressed in terms of EC50 (effective concentration of extract in μg/mL that reduces DPPH absorbance to 50% as compared to negative control, for leaf and bark extracts was found to be 155 μg/mL and 204 μg/mL respectively. Standards trolox and ascorbic acid show EC50 value of 5 μg/mL and 4 μg/mL respectively. Trolox equivalent antioxidant capacity (TEAC was measured using the ABTS and FRAP method. Result for bark and leaf extracts was 79 mg and 106 mg trolox equivalent (TE/g respectively for the ABTS method. For FRAP assay, results for bark and leaf extracts were 80 and 89 mg TE/g respectively.

  4. Gd-EOB-DTPA enhanced MRI of the liver: Correlation of relative hepatic enhancement, relative renal enhancement, and liver to kidneys enhancement ratio with serum hepatic enzyme levels and eGFR

    Energy Technology Data Exchange (ETDEWEB)

    Talakic, Emina; Steiner, Jürgen; Kalmar, Peter; Lutfi, Andre [Division of General Radiology, Department of Radiology, Medical University of Graz, Auenbruggerplatz 9, 8036 Graz (Austria); Quehenberger, Franz [Institute for Medical Informatics, Statistics and Documentation, Medical University of Graz, Auenbruggerplatz 2, 8036 Graz (Austria); Reiter, Ursula; Fuchsjäger, Michael [Division of General Radiology, Department of Radiology, Medical University of Graz, Auenbruggerplatz 9, 8036 Graz (Austria); Schöllnast, Helmut, E-mail: helmut.schoellnast@medunigraz.at [Division of General Radiology, Department of Radiology, Medical University of Graz, Auenbruggerplatz 9, 8036 Graz (Austria)

    2014-04-15

    Objectives: To assess the correlation of relative hepatic enhancement (RHE), relative renal enhancement (RRE) and liver to kidneys enhancement ratio (LKR) with serum hepatic enzyme levels and eGFR in Gd-EOB-DTPA enhanced MRI of the liver and to assess threshold levels for predicting enhancement of the liver parenchyma. Methods: Data of 75 patients who underwent Gd-EOB-DTPA enhanced MRI of the liver were collected. Images were obtained before contrast injection, during the early arterial phase, late arterial phase, venous phase, delayed phase, and hepatobiliary phase which was 20 min after Gd-EOB-DTPA administration. Signal intensity of the liver and the kidneys in all phases was defined using region-of-interest measurements for relative enhancement calculation. Serum hepatic enzyme levels and eGFR were available in all patients. Spearman correlation test was used to test the correlation of RHE, RRE and LKR with serum hepatic enzyme levels and eGFR. Results: In the hepatobiliary phase all serum hepatic enzymes were significantly correlated with RHE; total bilirubin (TBIL) and cholin esterase (CHE) showed strongest correlations. TBIL and CHE were significantly correlated with RRE in the arterial phases. TBIL and CHE were significantly correlated with LKR in the arterial phase and hepatobiliary phase. eGFR showed no correlation. Conclusions: In Gd-EOB-DTPA enhanced MRI, TBIL and CHE levels may predict RHE, RRE and LKR.

  5. Role of motility and chemotaxis in the pathogenesis of Dickeya dadantii 3937 (ex Erwinia chrysanthemi 3937).

    Science.gov (United States)

    Antúnez-Lamas, María; Cabrera-Ordóñez, Ezequiel; López-Solanilla, Emilia; Raposo, Rosa; Trelles-Salazar, Oswaldo; Rodríguez-Moreno, Andrés; Rodríguez-Palenzuela, Pablo

    2009-02-01

    Dickeya dadantii 3937 (ex Erwinia chrysanthemi), a member of the Enterobacteriaceae, causes soft rot in many economically important crops. A successful pathogen has to reach the interior of the plant in order to cause disease. To study the role of motility and chemotaxis in the pathogenicity of D. dadantii 3937, genes involved in the chemotactic signal transduction system (cheW, cheB, cheY and cheZ) and in the structure of the flagellar motor (motA) were mutagenized. All the mutant strains grew like the wild-type in culture media, and the production and secretion of pectolytic enzymes was not affected. As expected, the swimming ability of the mutant strains was reduced with respect to the wild-type: motA (94%), cheY (80%), cheW (74%), cheB (54%) and cheZ (48%). The virulence of the mutant strains was analysed in chicory, Saintpaulia and potato. The mutant strains were also tested for their capability to enter into Arabidopsis leaves. All the mutants showed a significant decrease of virulence in certain hosts; however, the degree of virulence reduction varied depending on the virulence assay. The ability to penetrate Arabidopsis leaves was impaired in all the mutants, whereas the capacity to colonize potato tubers after artificial inoculation was affected in only two mutant strains. In general, the virulence of the mutants could be ranked as motA<cheYZ, which correlated with the degree to which swimming was affected. These results clearly indicate that motility plays an important role in the pathogenicity of this bacterium.

  6. The content of total polyphenols, ascorbic acid and antioxidant activity in selected varieties of quince (Cydonia oblonga mill.

    Directory of Open Access Journals (Sweden)

    Judita Bystrická

    2017-01-01

    Full Text Available Quince fruit (Cydonia oblonga Miller is an important source of bioactive compounds, especially of polyphenolic compounds, phenolic acids, flavonoids also of minerals and vitamins. This compounds exhibit health promoting properties including antibacterial, anti-inflammatory, anticancer, antidiabetic and cardioprotective properties. Quine fruit have a high therapeutic value, can be used as good sources of antioxidants. This study provides some knowledge about content of total polyphenols, ascorbic acid and antioxidant activity in selected varieties of quince fruit samples. Four quince fruit cultivars (Semenáč, Konstantinopler Apfelquitte, Cydora Robusta, Mammut were analysed. The content of the total polyphenols (TPC was determined by the Folin-Ciocalteu reagent (FCR at 765 nm using spectrophotometer. Ascorbic acid (AsA content was determined using standard HPLC gradient method. Antioxidant activity (AA was measures using a compound DPPH˙(2.2-diphenyl-1-picrylhydrazyl. The content of (TPC in fresh samples of quince fruit ranged from 661 ±11.60 mg.kg-1 to 1044 ±11.03 mg.kg-1 and content of AsA were in interval from 151 ±0.58 mg.kg-1 to 215 ±0.75 mg.kg-1. The values of antioxidant activity in quince fruit samples were in range from 26.90 ±0.61% to 49.14 ±0.38%. Statistically significant highest content TPC, AsA and AA was recorded in cultivar Konstaninopler Apfelquitte and statistically lowest content was recorded in cultivar Semenáč. The content of TPC, AsA and AA beside the variety may be affected by many factors also climatic conditions and the agrochemical composition of the soil. 

  7. Impaired recovery of brain muscarinic receptor sites following an adaptive down-regulation induced by repeated administration of diisopropyl fluorophosphate in aged rats

    International Nuclear Information System (INIS)

    Pintor, A.; Fortuna, S.; De Angelis, S.; Michalek, H.

    1990-01-01

    Potential age-related differences in the recovery rate of brain cholinesterase activity (ChE) and muscarinic acetylcholine receptor binding sites (mAChRs) following reduction induced by repeated treatment with diisopropyl fluorophosphate (DFP) were evaluated in Sprague-Dawley rats. Male 3- and 24-month old rats were s.c. injected with DFP on alternate days for 2 weeks and killed 48 hr and 7, 14, 21, 28 and 35 days after the last treatment. In the hippocampus and striatum, but not in the cerebral cortex, of control rats there as a significant age-related decline of ChE activity and maximal density of 3H-QNB binding sites (Bmax). The repeated administration of DFP during the first week caused a syndrome of cholinergic stimulation both in aged and young rats. The syndrome was more pronounced, in terms of intensity and duration in aged than in young animals resulting in 40 and 12% mortality, respectively; during the second week the syndrome attenuated in the two age-groups. The percentage inhibition of brain ChE at the end of DFP treatment did not differ between young and surviving aged rats. The down-regulation of mACRs was present in the three brain regions of both young and age rats (from 20 to 40%). Factorial analysis of variance showed significant differences for age, recovery rate, and significant interaction between age and recovery rate, both for ChE and mAChRs in young rats the three brain areas

  8. Impaired recovery of brain muscarinic receptor sites following an adaptive down-regulation induced by repeated administration of diisopropyl fluorophosphate in aged rats

    Energy Technology Data Exchange (ETDEWEB)

    Pintor, A.; Fortuna, S.; De Angelis, S.; Michalek, H. (Istituto Superiore di Sanita, Rome (Italy))

    1990-01-01

    Potential age-related differences in the recovery rate of brain cholinesterase activity (ChE) and muscarinic acetylcholine receptor binding sites (mAChRs) following reduction induced by repeated treatment with diisopropyl fluorophosphate (DFP) were evaluated in Sprague-Dawley rats. Male 3- and 24-month old rats were s.c. injected with DFP on alternate days for 2 weeks and killed 48 hr and 7, 14, 21, 28 and 35 days after the last treatment. In the hippocampus and striatum, but not in the cerebral cortex, of control rats there as a significant age-related decline of ChE activity and maximal density of 3H-QNB binding sites (Bmax). The repeated administration of DFP during the first week caused a syndrome of cholinergic stimulation both in aged and young rats. The syndrome was more pronounced, in terms of intensity and duration in aged than in young animals resulting in 40 and 12% mortality, respectively; during the second week the syndrome attenuated in the two age-groups. The percentage inhibition of brain ChE at the end of DFP treatment did not differ between young and surviving aged rats. The down-regulation of mACRs was present in the three brain regions of both young and age rats (from 20 to 40%). Factorial analysis of variance showed significant differences for age, recovery rate, and significant interaction between age and recovery rate, both for ChE and mAChRs in young rats the three brain areas.

  9. Habitual Physical Activity After Total Knee Replacement : analysis in 830 patients and comparison with a sex-and age-matched normative population (vol 92, pg 1109, 2012)

    NARCIS (Netherlands)

    Kersten, Roel F. M. R.; Stevens, Martin; van Raay, Jos J. A. M.; Bulstra, Sjoerd K.; van den Akker-Scheek, Inge

    Background. Previous studies on physical activity after total knee arthroplasty (TKA) concentrated mainly on a return to sports activities. Objective. The objectives of this study were to determine the habitual physical activity behavior of people who had undergone TKA (TKA group) 1 to 5 years after

  10. Response Surface Optimized Extraction of Total Triterpene Acids ...

    African Journals Online (AJOL)

    Purpose: To optimize extraction of total triterpene acids from loquat leaf and evaluate their in vitro antioxidant activities. Methods: The independent variables were ethanol concentration, extraction time, and solvent ratio, while the dependent variable was content of total triterpene acids. Composite design and response ...

  11. Rivastigmine alleviates experimentally induced colitis in mice and rats by acting at central and peripheral sites to modulate immune responses.

    Directory of Open Access Journals (Sweden)

    Helena Shifrin

    Full Text Available The cholinergic anti-inflammatory system and α7 nicotinic receptors in macrophages have been proposed to play a role in neuroimmunomodulation and in the etiology of ulcerative colitis. We investigated the ability of a cholinesterase (ChE inhibitor rivastigmine, to improve the pathology of ulcerative colitis by increasing the concentration of extracellular acetylcholine in the brain and periphery. In combination with carbachol (10 µM, rivastigmine (1 µM significantly decreased the release of nitric oxide, TNF-α, IL-1β and IL-6 from lipopolysaccharide-activated RAW 264.7 macrophages and this effect was abolished by α7 nicotinic receptor blockade by bungarotoxin. Rivastigmine (1 mg/kg but not (0.5 mg/kg, injected subcutaneously once daily in BALB/c mice with colitis induced by 4% dextran sodium sulphate (DSS, reduced the disease activity index (DAI by 60% and damage to colon structure. Rivastigmine (1 mg/kg also reduced myeloperoxidase activity and IL-6 by >60%, and the infiltration of CD11b expressing cells by 80%. These effects were accompanied by significantly greater ChE inhibition in cortex, brain stem, plasma and colon than that after 0.5 mg/kg. Co-administration of rivastigmine (1 mg/kg with the muscarinic antagonist scopolamine significantly increased the number of CD11b expressing cells in the colon but did not change DAI compared to those treated with rivastigmine alone. Rivastigmine 1 and 2 mg given rectally to rats with colitis induced by rectal administration of 30 mg dintrobezene sulfonic acid (DNBS also caused a dose related reduction in ChE activity in blood and colon, the number of ulcers and area of ulceration, levels of TNF-α and in MPO activity. The study revealed that the ChE inhibitor rivastigmine is able to reduce gastro-intestinal inflammation by actions at various sites at which it preserves ACh. These include ACh released from vagal nerve endings that activates alpha7 nicotinic receptors on circulating macrophages

  12. Total - annual report 2005

    International Nuclear Information System (INIS)

    2006-01-01

    This annual report presents the activities and results of TOTAL S.A., french society on oil and gas. It deals with statistics, the managers, key information on financial data and risk factors, information on the Company, unresolved Staff Comments, employees, major Shareholders, consolidated statements, markets, security, financial risks, defaults dividend arrearages and delinquencies, controls and procedures, code of ethics and financial statements. (A.L.B.)

  13. Total and free insulin-like growth factor I, insulin-like growth factor binding protein 3 and acid-labile subunit reflect clinical activity in acromegaly

    DEFF Research Database (Denmark)

    Sneppen, S B; Lange, Merete Wolder; Pedersen, L M

    2001-01-01

    The aim was to evaluate, markers of disease activity in acromegaly in relation to perceived disease activity. Thirty-seven consecutively treated, acromegalic patients, classified by clinical symptoms as inactive (n=16), slightly active (n=10) and active (n=11), entered the study. When evaluating......-like growth factor binding protein-3 (IGFBP-3) with PV(pos) of 0.69 and 0.71 and PV(neg) of 0.91 and 0.92 respectively. We conclude that free IGF-I is more closely related than total IGF-I to perceived disease activity and is as such useful when evaluating previously treated acromegaly for disease activity...

  14. Agronomic performance of new open pollinated experimental lines of broccoli (Brassica oleracea L. var. italica evaluated under organic farming.

    Directory of Open Access Journals (Sweden)

    Samira Sahamishirazi

    Full Text Available In order to develop new open pollinating cultivars of broccoli for organic farming, two experiments were conducted during fall 2015 and spring 2016. This study was aimed at comparing the agronomic performance of eleven new open pollinating breeding lines of broccoli to introduce new lines and to test their seasonal suitability for organic farming. Field experiments were carried out at the organic research station Kleinhohenheim of the University of Hohenheim (Stuttgart-Germany. Different agronomic traits total biomass fresh weight, head fresh weight, head diameter, hollow-stem, fresh weight harvest index and marketable yield were assessed together with commercial control cultivars. The data from both experiments were analyzed using a two-stage mixed model approach. In our study, genotype, growing season and their interaction had significant effects on most traits. Plants belonging to the fall growing season had bigger sizes in comparison to spring with significantly (p< 0.0001 higher biomass fresh weight. Some experimental lines had significant lower head fresh weight in spring in comparison to the fall season. The high temperature during the harvest period for the spring season affected the yield negatively through decreasing the firmness of broccoli heads. The low average minimum temperatures during the spring growing season lead to low biomass fresh weight but high fresh weight harvest index. Testing the seasonal suitability of all open pollinating lines showed that the considered fall season was better for broccoli production. However, the change in yield between the fall and the spring growing season was not significant for "Line 701" and "CHE-MIC". Considering the expression of different agronomic traits, "CHE-GRE-G", "Calinaro" and "CAN-SPB" performed the best in the fall growing season, and "CHE-GRE-G", "CHE-GRE-A", "CHE-BAL-A" and "CHE-MIC" and "Line 701" were best in the spring growing season, specifically due to the highest marketable

  15. Il potere di Prometeo e il dovere di Kant

    Directory of Open Access Journals (Sweden)

    Stefano Picchetti

    2006-10-01

    Full Text Available Kant ci suggerisce qualcosa che Prometeo e il mito greco avevano già accennato. L'imperativo che pone freno al fare, è già in sé nel soggetto ed è per questo che egli che egli è responsabile delle proprie azioni, indipendentemente dalla legge scritta.

  16. Analyse de l’effet du type de tâche sur l’évolution des connaissances à la suite d’un processus d’apprentissage collaboratif

    Directory of Open Access Journals (Sweden)

    Sabine Pohl

    2009-04-01

    Full Text Available L’article analyse l’effet du type de tâche sur le partage des connaissances à la suite d’un processus d’interaction dans un contexte d’apprentissage collaboratif. Cet apprentissage collaboratif est réalisé dans le cadre d’une formation universitaire. Deux types de tâches sont réalisés par les apprenants. Ils se distinguent selon que la solution nécessite ou non la confrontation de points de vue portant sur le champ conceptuel lié à l’apprentissage à réaliser. La méthode de collecte des données consiste en un entretien semi-directif. Les résultats montrent un effet du type de tâches sur l’évolution des connaissances partagées des apprenants.This longitudinal research analyses the effect of the type of task on the development of knowledge following an interaction process in a collaborative learning context. The framework for this collaborative learning is a university education. Two types of tasks are provided to the learners. They differ depending on whether or not the solution requires the comparison of points of view on the conceptual scope of what is to be learned. The data are collected through a semi-directive interview. The results show that the type of task has an effect on the development of shared knowledge.

  17. Total and inorganic arsenic in foods of the first Hong Kong total diet study.

    Science.gov (United States)

    Chung, Stephen Wai-cheung; Lam, Chi-ho; Chan, Benny Tsz-pun

    2014-04-01

    Arsenic (As) is a metalloid that occurs in different inorganic and organic forms, which are found in the environment from both natural occurrence and anthropogenic activity. The inorganic forms of As (iAs) are more toxic as compared with the organic As, but so far most of the occurrence data in food collected in the framework of official food control are still reported as total As without differentiating the various As species. In this paper, total As and iAs contents of 600 total diet study (TDS) samples, subdivided into 15 different food groups, were quantified by high-resolution inductively coupled plasma mass spectrometry (HR-ICP/MS) and hydride generation (HG) ICP/MS respectively. The method detection limits for both total As and iAs were 3 μg As kg(-1). As the samples were prepared for TDS, food items were purchased directly from the market or prepared as for normal consumption, i.e. table ready, in the manner most representative of and consistent with cultural habits in Hong Kong as far as practicable. The highest total As and iAs content were found in 'fish, seafood and their products' and 'vegetables and their products' respectively. Besides, this paper also presents the ratios of iAs and total As content in different ready-to-eat food items. The highest ratio of iAs to total As was found in 'vegetables and their products'. It is likely that iAs in vegetables maintained its status even after cooking.

  18. Are Total, Intensity- and Domain-Specific Physical Activity Levels Associated with Life Satisfaction among University Students?

    Science.gov (United States)

    Pedišić, Željko; Greblo, Zrinka; Phongsavan, Philayrath; Milton, Karen; Bauman, Adrian E.

    2015-01-01

    Background Thorough information about the relationship between physical activity (PA) and life satisfaction is still lacking. Therefore, this study examined the cross-sectional relationships between life satisfaction and meeting the World Health Organization (WHO) moderate to vigorous-intensity PA recommendations, total volume and duration of PA, intensity-specific PA (walking, moderate- and vigorous-intensity), domain-specific PA (work, transport-related, domestic, and leisure-time), and 11 domain and intensity-specific PA types among university students. Additionally, we examined the associations between life satisfaction and gender, age, disposable income, community size, smoking, alcohol intake, body mass index (BMI), and self-rated health. Methods The study included a random sample of 1750 university students in Zagreb, Croatia (response rate = 71.7%; 62.4% females; mean age 21.5 ± 1.8 years), using the International Physical Activity Questionnaire — long form and the Satisfaction with Life Scale. Results Higher life satisfaction was associated with female gender (β = 0.13; p = life satisfaction and size of community (p = 0.567), smoking status (p = 0.056), alcohol consumption (p = 0.058), or BMI (p = 0.508). Among all PA variables, only leisure-time vigorous-intensity PA was significantly associated with life satisfaction after adjustments for socio-demographic characteristics, lifestyle and self-rated general health (β = 0.06; p = 0.045). Conclusions This study indicated a weak positive relationship between leisure-time vigorous-intensity PA and life satisfaction, whilst no such association was found for other PA variables. These findings underscore the importance of analyzing domain and intensity-specific PA levels in future studies among university students, as drawing conclusions about the relationship between PA and life satisfaction based on total PA levels only may be misleading. PMID:25695492

  19. Total flavonoid and phenolic contents of n-butanol extract of Samanea saman leaf and the antibacterial activity towards Escherichia coli and Staphylococcus aureus

    Science.gov (United States)

    Rita, Wiwik Susanah; Swantara, I. Made Dira; Asih, I. A. Raka Astiti; Sinarsih, Ni Ketut; Suteja, I. Kadek Pater

    2016-03-01

    Total flavonoid and phenolic contents in some natural products was suspected of having a positive correlation to its activity in inhibiting the growth of bacteria. The aim of this study was to determine the total flavonoid and phenolic contents of n-butanol extract of Samanea saman leaf, and to evaluate the antibacterial activity towards Escherechia coli and Staphylococcus aureus. Extraction of compounds was done by ethanol 96%, followed by fractionation into n-hexane, ethyl acetate, and n-butanol. Determination of total flavonoid and phenolic contents was done by UV-Vis Spectrophotometer using standard of quersetin and galic acid respectively. In addition, antibacterial activity was evaluated by agar disc diffusion method. Extraction of 1000 g of Samanea saman leaf was obtained 80 g of ethanol extracts, fractionation of the extract was obtained 8.02 g of n-hexane extracts, 7.11 g of ethyl acetate extracts, 13.5 g of n-butanol extracts, and 14.16 g of aqueous extracts. Phytochemical screening of the n-butanol extracts revealed the presence of flavonoid and phenolic compounds. Total flavonoid and phenolic contents were successively 43.5798 mg QE/100g and 34.0180 mg GAE/100g. The butanol extracts inhibited the growth of S.aureus higher than the growth of E.coli. At the concentration of 2, 4, 6, 8 % (b/v), and positive control (meropenem μg/disc), inhibition zone towards S. aureus was successively 5.67, 9.33, 10.33, 12.00, and 32.33 mm, while the inhibition zone towards E. coli was1.33, 3.33, 4.33, 5.43, and 34.00 mm.

  20. [Study on the separation process of pharmacological active total alkaloids from Chelidonium majus L. growing in Georgia].

    Science.gov (United States)

    Bozhadze, A D; Vachnadze, V Iu; Dzhokhadze, M S; Berashvili, D T; Bakuridze, A Dzh

    2013-04-01

    In present article was studied the separation process of pharmacological active total alkaloids from Chelidonium majus L. growing in Georgia. Alkaloids were extracted from medicinal herbal material and separated by liquid extraction, diluents gas and a microfiltration through membrane equipment. The obtained A1, A2, A3 fractions were analyzed by GC/MS method; in all cases separation proceeds by the principle of extraction of the target alkaloids. It was concluded that the A1 is enriched with α and β cryptopins, and protopin, but homochelidonine and chelidonine are in low contents. As accompanying alkaloid is identified dihydrosanguinarine as an artifact; the A2 is enriched with the maximum contents of stylopine and protopin, but the poor contents of chelidonine and homochelidonine; the A3 is enriched with α and β cryptopins and maximum content of chelidonine. Extraction of alkaloids from Chelidonium majus L. proceeds selectively, but depending on a way of separation of the total alkaloids allows varying qualitative and quantitative consistence of the final product.