The diarylquinoline TMC207 for multidrug-resistant tuberculosis
Diacon, Andreas H.; Pym, Alexander; Grobusch, Martin; Patientia, Ramonde; Rustomjee, Roxana; Page-Shipp, Liesl; Pistorius, Christoffel; Krause, Rene; Bogoshi, Mampedi; Churchyard, Gavin; Venter, Amour; Allen, Jenny; Palomino, Juan Carlos; de Marez, Tine; van Heeswijk, Rolf P. G.; Lounis, Nacer; Meyvisch, Paul; Verbeeck, Johan; Parys, Wim; de Beule, Karel; Andries, Koen; Mc Neeley, David F.
2009-01-01
BACKGROUND: The diarylquinoline TMC207 offers a new mechanism of antituberculosis action by inhibiting mycobacterial ATP synthase. TMC207 potently inhibits drug-sensitive and drug-resistant Mycobacterium tuberculosis in vitro and shows bactericidal activity in patients who have drug-susceptible
Identifying Tm-C82 isomers with density functional theory calculations
International Nuclear Information System (INIS)
Zheng Limin; He Hongqing; Yang Minghui; Zeng Qun; Yang Mingli
2010-01-01
Density functional theory calculations have been performed to study the geometrical and electronic properties of endohedral metallofullerene Tm-C 82 isomers. Three energetically favorable isomers (with C s , C 2 and C 2v symmetry, respectively) are identified which are consistent with the nuclear magnetic resonance (NMR) observations. The simulated ultraviolet photoelectron spectra (UPS) based on the three structures agree well with the measurements. Particularly, the parent cage of the experimentally observed Tm-C 82 isomer with C s symmetry is newly assigned, which matches the experiments better than early assignments. In addition, strong interaction between an endohedral Tm atom and the C 82 cage is discussed and is thought to be responsible for the dramatic change in the relative stability of C 82 isomers when Tm is encapsulated.
Etravirine: R165335, TMC 125, TMC-125, TMC125.
2006-01-01
phase IIb dose-finding study (TMC125 C223) in Europe, Canada and the US found etravirine significantly reduced the HIV viral load in a subset of heavily treatment-experienced patients. Tibotec discontinued a single exploratory open-label phase II trial (TMC 125-C227) of etravirine in November 2005. The discontinuation was a result of 12-week data, which demonstrated a difference in the proportion of patients achieving or maintaining undetectable viral load in favour of the control group, who were receiving protease inhibitor-based treatment. There were no safety concerns and the discontinuation had no effect on phase III registration trials. Phase IIa clinical trials of etravirine for the treatment of HIV infections, initiated in November 2001, have been completed. Tibotec has conducted a phase I trial (TMC125-C157 study) evaluating etravirine + didanosine among healthy volunteers in Belgium; trial results have been presented.
46 CFR 117.207 - Survival craft-vessels operating on lakes, bays, and sounds routes.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-vessels operating on lakes, bays, and... 49 PASSENGERS LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 117.207 Survival craft—vessels operating on lakes, bays, and sounds routes. (a) Each vessel with overnight...
ErgoTMC, A New Tool For Human-Centered TMC Design
2000-04-01
The Federal Highway Administration (FHWA) has recently made available a new tool to assist Transportation Management Center (TMC) managers and designers in incorporating human-centered design principles into their TMCs. ErgoTMC, a web site tailored t...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Mediation. 117.12 Section 117.12... Mediation. (a) SBA shall, after ensuring that the complaint falls within the coverage of this Act and all... clearly within an exception, promptly refer the complaint to the Federal Mediation and Conciliation...
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLH207 (Link to dictyBase) - - - Contig-U11514-1 SLH207P (Link to Original site) SLH2...07F 689 SLH207Z 675 SLH207P 1364 - - Show SLH207 Library SL (Link to library) Clone ID SLH2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/SL/SLH2-A/SLH207Q.Seq.d/ Representative seq. ID SLH2...07P (Link to Original site) Representative DNA sequence >SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2...**yi Homology vs CSM-cDNA Score E Sequences producing significant alignments: (bits) Value SLH207 (SLH207Q) /CSM/SL/SLH2-A/SLH2
Lifescience Database Archive (English)
Full Text Available VH (Link to library) VHK207 (Link to dictyBase) - - - Contig-U16260-1 VHK207P (Link to Original site) VHK2...07F 371 VHK207Z 713 VHK207P 1064 - - Show VHK207 Library VH (Link to library) Clone ID VHK2...e URL http://dictycdb.biol.tsukuba.ac.jp/CSM/VH/VHK2-A/VHK207Q.Seq.d/ Representative seq. ID VHK2...07P (Link to Original site) Representative DNA sequence >VHK207 (VHK207Q) /CSM/VH/VHK2-A/VHK2...ducing significant alignments: (bits) Value N ( BJ446805 ) Dictyostelium discoideum cDNA clone:ddv63k21, 3'
Tactical Mission Command (TMC)
2016-03-01
and TBMCS . Exchange information with coalition digital C2 systems. Display overlays created by MCS and other ABCS Systems Exchange information...Equipment TBMCS - Theater Battle Management Core Systems USMC - United States Marine Corps WARNO - Warning Order TMC 2016 MAR UNCLASSIFIED 10 Cost
13 CFR 117.18 - Judicial review.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Judicial review. 117.18 Section 117.18 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FEDERALLY... reasonable attorney's fees, but that the complainant must demand these costs in the complaint; (iii) That...
Lifescience Database Archive (English)
Full Text Available VS (Link to library) VSH207 (Link to dictyBase) - - - Contig-U12548-1 VSH207P (Link... to Original site) VSH207F 228 VSH207Z 107 VSH207P 335 - - Show VSH207 Library VS (Link to library) Clone ID VSH207 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U12548-1 Original site URL http://dict...ents: (bits) Value N ( AU267072 ) Dictyostelium discoideum vegetative cDNA clone:VS... 206 2e-58 2 ( AC116982 ) Dict...yostelium discoideum chromosome 2 map 3622643... 206 4e-49 1 ( AU267073 ) Dict
Directory of Open Access Journals (Sweden)
Dong-Cheol Kim
2016-04-01
Full Text Available In the course of searching for bioactive secondary metabolites from marine fungi, TMC-256C1 was isolated from an ethyl acetate extract of the marine-derived fungus Aspergillus sp. SF6354. TMC-256C1 displayed anti-neuroinflammatory effect in BV2 microglial cells induced by lipopolysaccharides (LPS as well as neuroprotective effect against glutamate-stimulated neurotoxicity in mouse hippocampal HT22 cells. TMC-256C1 was shown to develop a cellular resistance to oxidative damage caused by glutamate-induced cytotoxicity and reactive oxygen species (ROS generation in HT22 cells, and suppress the inflammation process in LPS-stimulated BV2 cells. Furthermore, the neuroprotective and anti-neuroinflammatory activities of TMC-256C1 were associated with upregulated expression of heme oxygenase (HO-1 and nuclear translocation of nuclear factor-E2-related factor 2 (Nrf2 in HT22 and BV2 cells. We also found that TMC-256C1 activated p38 mitogen-activated protein kinases (MAPK and phosphatidylinositol 3-kinase (PI3K/Akt signaling pathways in HT22 and BV2 cells. These results demonstrated that TMC-256C1 activates HO-1 protein expression, probably by increasing nuclear Nrf2 levels via the activation of the p38 MAPK and PI3K/Akt pathways.
Jobst, Belinda; Weigl, Julia; Michl, Carina; Vivarelli, Fabio; Pinz, Sophia; Amslinger, Sabine; Rascle, Anne
2016-11-01
The JAK/STAT pathway is an essential mediator of cytokine signaling, often upregulated in human diseases and therefore recognized as a relevant therapeutic target. We previously identified the synthetic chalcone α-bromo-2',3,4,4'-tetramethoxychalcone (α-Br-TMC) as a novel JAK2/STAT5 inhibitor. We also found that treatment with α-Br-TMC resulted in a downward shift of STAT5 proteins in SDS-PAGE, suggesting a post-translational modification that might affect STAT5 function. In the present study, we show that a single cysteine within STAT5 is responsible for the α-Br-TMC-induced protein shift, and that this modification does not alter STAT5 transcriptional activity. We also compared the inhibitory activity of α-Br-TMC to that of another synthetic chalcone, α-trifluoromethyl-2',3,4,4'-tetramethoxychalcone (α-CF3-TMC). We found that, like α-Br-TMC, α-CF3-TMC inhibits JAK2 and STAT5 phosphorylation in response to interleukin-3, however without altering STAT5 mobility in SDS-PAGE. Moreover, we demonstrate that both α-Br-TMC and α-CF3-TMC inhibit interferon-α-induced activation of STAT1 and STAT2, by inhibiting their phosphorylation and the expression of downstream interferon-stimulated genes. Together with the previous finding that α-Br-TMC and α-CF3-TMC inhibit the response to inflammation by inducing Nrf2 and blocking NF-κB activities, our data suggest that synthetic chalcones might be useful as anti-inflammatory, anti-cancer and immunomodulatory agents in the treatment of human diseases.
Grijpma, D.W.; Pêgo, A.P.; Feijen, Jan
2004-01-01
The present invention relates to methods for providing shaped biodegradable and elastomeric structures of (co)polymers of 1,3trimethylene carbonate (TMC) with improved (mechanical) properties which can be used for tissue or tissue component support, generation or regeneration. Such shaped
Bouzková, Kateřina; Babinský, Martin; Novosadová, Lucie; Marek, Radek
2013-06-11
An understanding of the role of intermolecular interactions in crystal formation is essential to control the generation of diverse crystalline forms which is an important concern for pharmaceutical industry. Very recently, we reported a new approach to interpret the relationships between intermolecular hydrogen bonding, redistribution of electron density in the system, and NMR chemical shifts (Babinský et al. J. Phys. Chem. A, 2013, 117, 497). Here, we employ this approach to characterize a full set of crystal interactions in a sample of anhydrous theobromine as reflected in (13)C NMR chemical shift tensors (CSTs). The important intermolecular contacts are identified by comparing the DFT-calculated NMR CSTs for an isolated theobromine molecule and for clusters composed of several molecules as selected from the available X-ray diffraction data. Furthermore, electron deformation density (EDD) and shielding deformation density (SDD) in the proximity of the nuclei involved in the proposed interactions are calculated and visualized. In addition to the recently reported observations for hydrogen bonding, we focus here particularly on the stacking interactions. Although the principal relations between the EDD and CST for hydrogen bonding (HB) and stacking interactions are similar, the real-space consequences are rather different. Whereas the C-H···X hydrogen bonding influences predominantly and significantly the in-plane principal component of the (13)C CST perpendicular to the HB path and the C═O···H hydrogen bonding modulates both in-plane components of the carbonyl (13)C CST, the stacking modulates the out-of-plane electron density resulting in weak deshielding (2-8 ppm) of both in-plane principal components of the CST and weak shielding (∼ 5 ppm) of the out-of-plane component. The hydrogen-bonding and stacking interactions may add to or subtract from one another to produce total values observed experimentally. On the example of theobromine, we demonstrate
Energy Technology Data Exchange (ETDEWEB)
Kalabin, G.A. (Siberian Branch of the Academy of Sciences of the USSR); Krivdin, L.B.; Trofimov, B.A.
1982-07-20
In order to elucidate the /sup 13/C-/sup 13/-C SSCC (spin-spin coupling constants) segment with the electronic excitations induced by the R group, a series of phenyl alkyl ethers, PhOAlk, where Alk = Me(I), Et(II), i-Pr(III), and t-Bu(IV), were studied. This series was chosen because in studying the /sup 13/C CS in monosubstituted benzenes it was observed that the intensity of the ..pi..-electron interaction of the unshared electron pairs of oxygen with the ..pi.. system of the benzene ring was practically the same in some compounds, but increased by 30% in others. This is related to the fact that the latter is characterized by an average noncoplanar conformation, with a dihedral angle between the benzene-ring plane and the C-O-C bond of approx. 45/sup 0/, whereas some compounds have an angle < 20/sup 0/. The reason for the difference is significant steric interaction of the alkyl hydrogens with the o-position of the ring. Thus, consideration of the /sup 13/C-/sup 13/C SSCC of a series of quite similar compounds, especially when compared to the whole set of such SSCC for other monosubstituted benzenes, shows that their relationship to the structure of the substituent R is extremely complex.
Verheul, Rolf J; Hagenaars, Niels; van Es, Thomas; van Gaal, Ethlinn V B; de Jong, Pascal H J L F; Bruijns, Sven; Mastrobattista, Enrico; Slütter, Bram; Que, Ivo; Heldens, Jacco G M; van den Bosch, Han; Glansbeek, Harrie L; Hennink, Wim E; Jiskoot, Wim
2012-03-12
Recently we reported that reacetylation of N,N,N-trimethyl chitosan (TMC) reduced the adjuvant effect of TMC in mice after intranasal (i.n.) administration of whole inactivated influenza virus (WIV) vaccine. The aim of the present study was to elucidate the mechanism of this lack of adjuvanticity. Reacetylated TMC (TMC-RA, degree of acetylation 54%) was compared with TMC (degree of acetylation 17%) at six potentially critical steps in the induction of an immune response after i.n. administration in mice. TMC-RA was degraded in a nasal wash to a slightly larger extent than TMC. The local i.n. distribution and nasal clearance of WIV were similar for both TMC types. Fluorescently labeled WIV was taken up more efficiently by Calu-3 cells when formulated with TMC-RA compared to TMC and both TMCs significantly reduced transport of WIV over a Calu-3 monolayer. Murine bone-marrow derived dendritic cell activation was similar for plain WIV, and WIV formulated with TMC-RA or TMC. The inferior adjuvant effect in mice of TMC-RA over that of TMC might be caused by a slightly lower stability of TMC-RA-WIV in the nasal cavity, rather than by any of the other factors studied in this paper. Copyright © 2011 Elsevier B.V. All rights reserved.
Effect of interstitial nitrogen on magnetism and entropy change of LaFe11.7Si1.3 compound
International Nuclear Information System (INIS)
Balli, M.; Rosca, M.; Fruchart, D.; Gignoux, D.
2009-01-01
Crystal structure, magnetism and magnetocaloric properties of LaFe 11.7 Si 1.3 N y (y=0, 1.3) compounds have been studied by X-ray diffraction and magnetic measurements. The LaFe 11.7 Si 1.3 N y compounds present a cubic NaZn 13 -type structure. Insertion of 1.3 nitrogen atoms per LaFe 11.7 Si 1.3 formula increases the lattice parameter and Curie temperature from 11.467 to 11.733 A and from 190 to ∼230 K, respectively. Besides, the absorption of nitrogen drives drastically the magnetic transition from first to second order and accordingly strongly decreases the magnetocaloric effect compared to the parent alloy. Under an external field change of 5 T, the value of isothermal entropy change -ΔS is about 28 and 3.5 J/kg K for LaFe 11.7 Si 1.3 and LaFe 11.7 Si 1.3 N 1.3 , respectively, close to their Curie temperature. However, the relative cooling power RCP(S) of the nitride is about half that of the parent alloy
Directory of Open Access Journals (Sweden)
Kai B Kaufmann
Full Text Available Cell protection against different noxious stimuli like oxidative stress or chemical toxins plays a central role in the treatment of many diseases. The inducible heme oxygenase isoform, heme oxygenase-1 (HO-1, is known to protect cells against a variety of harmful conditions including apoptosis. Because a number of medium strong electrophiles from a series of α-X-substituted 2',3,4,4'-tetramethoxychalcones (α-X-TMCs, X = H, F, Cl, Br, I, CN, Me, p-NO2-C6H4, Ph, p-OMe-C6H4, NO2, CF3, COOEt, COOH had proven to activate Nrf2 resulting in HO-1 induction and inhibit NF-κB downstream target genes, their protective effect against staurosporine induced apoptosis and reactive oxygen species (ROS production was investigated. RAW264.7 macrophages treated with 19 different chalcones (15 α-X-TMCs, chalcone, 2'-hydroxychalcone, calythropsin and 2'-hydroxy-3,4,4'-trimethoxychalcone prior to staurosporine treatment were analyzed for apoptosis and ROS production, as well as HO-1 protein expression and enzyme activity. Additionally, Nrf2 and NF-κB activity was assessed. We found that amongst all tested chalcones only E-α-(4-methoxyphenyl-2',3,4,4'-tetramethoxychalcone (E-α-p-OMe-C6H4-TMC demonstrated a distinct, statistically significant antiapoptotic effect in a dose dependent manner, showing no toxic effects, while its double bond isomer Z-α-p-OMe-C6H4-TMC displayed no significant activity. Also, E-α-p-OMe-C6H4-TMC induced HO-1 protein expression and increased HO-1 activity, whilst inhibition of HO-1 by SnPP-IX abolished its antiapoptotic effect. The only weakly electrophilic chalcone E-α-p-OMe-C6H4-TMC reduced the staurosporine triggered formation of ROS, while inducing the translocation of Nrf2 into the nucleus. Furthermore, staurosporine induced NF-κB activity was attenuated following E-α-p-OMe-C6H4-TMC treatment. Overall, E-α-p-OMe-C6H4-TMC demonstrated its effective cytoprotective potential via a non-toxic induction of HO-1 in RAW264
International Nuclear Information System (INIS)
Wang, Qiujing; Gao, Yuyuan; Sun, Xinlin; Ji, Bin; Cui, Xubo; Liu, Yaqi; Zheng, Tao; Chen, Chengwei; Jiang, Xiaodan; Zhu, Aiping; Quan, Daping
2014-01-01
Since the introduction of the detachable coil in endovascular treatment of intracranial aneurysms, the in-hospital mortality rate has been significantly decreased. Recurrence of the aneurysm remains the major drawback of using detachable coils. We prepared a bioactive coil coated with poly(d,l-lactide)-7co-(1,3-trimethylene carbonate) (P(DLLA-co-TMC)), a novel copolymer for controlling the release of vascular endothelial growth factor (VEGF). Platinum coils were prepared by successive coating with cationic P(DLLA-co-TMC) and anionic heparin. Then, recombinant human VEGF-165 (rhVEGF) was immobilized by affinity binding to heparin. The morphological characteristics and sustained in vitro release of rhVEGF were examined using scanning electron microscopy and enzyme-linked immunosorbent assay, respectively. The efficacy of these novel coils modified by P(DLLA-co-TMC)/rhVEGF was tested using a common carotid artery aneurysm model in rats. Experimental aneurysms were embolized with unmodified, P(DLLA-co-TMC)/heparin-coated or P(DLLA-co-TMC)/rhVEGF-coated platinum coils (n = 18). The coils were removed on days 15, 30 and 90 after insertion, and the histological and immunohistochemical analysis of factor VIII was performed to confirm the presence of endothelial cells in the organized area. In addition, the controlled in vivo release of VEGF was confirmed by Western blotting analysis. The release of VEGF tended to increase during the whole period and no burst release was observed. In the group treated with P(DLLA-co-TMC)/rhVEGF-coated platinum coils, clot organization and endothelial cell proliferation were accelerated. The immunohistochemistry study showed that the expression of factor VIII was found in the P(DLLA-co-TMC)/rhVEGF-coated coil group but not in the other two groups. Furthermore, Western blotting analysis confirmed that the major released VEGF in the aneurysm sac was from the P(DLLA-co-TMC)/VEGF-coated coil. P(DLLA-co-TMC)/rhVEGF-coated platinum coils can
Studies on the obtention and characterization of N,N,N-trimethyl chitosan (TMC)
International Nuclear Information System (INIS)
Curti, Elisabete; Campana Filho, Sergio P.
2001-01-01
In this work, a study was developed on the obtention of N,N,N-trimethyl chitosan (TMC) aiming the preparation of samples with different average degrees of quaternization under controlled experimental conditions. The effects of previous treatments of chitosan on the reactivity toward its N-alkylation were evaluated and it was concluded that the purification method previously applied to chitosan strongly influenced the reaction yield. The average degrees of quaternization of the TMC samples were determined by nuclear magnetic resonance spectroscopy and they ranged from 4,0% to 22%, depending on the previous treatment to which the chitosan was submitted and on the reaction conditions. It was also concluded that an average degree of quaternization close to 4,0% is already high enough to impart water solubility to this chitosan derivative. (author)
TMC-SNPdb: an Indian germline variant database derived from whole exome sequences.
Upadhyay, Pawan; Gardi, Nilesh; Desai, Sanket; Sahoo, Bikram; Singh, Ankita; Togar, Trupti; Iyer, Prajish; Prasad, Ratnam; Chandrani, Pratik; Gupta, Sudeep; Dutt, Amit
2016-01-01
Cancer is predominantly a somatic disease. A mutant allele present in a cancer cell genome is considered somatic when it's absent in the paired normal genome along with public SNP databases. The current build of dbSNP, the most comprehensive public SNP database, however inadequately represents several non-European Caucasian populations, posing a limitation in cancer genomic analyses of data from these populations. We present the T: ata M: emorial C: entre-SNP D: ata B: ase (TMC-SNPdb), as the first open source, flexible, upgradable, and freely available SNP database (accessible through dbSNP build 149 and ANNOVAR)-representing 114 309 unique germline variants-generated from whole exome data of 62 normal samples derived from cancer patients of Indian origin. The TMC-SNPdb is presented with a companion subtraction tool that can be executed with command line option or using an easy-to-use graphical user interface with the ability to deplete additional Indian population specific SNPs over and above dbSNP and 1000 Genomes databases. Using an institutional generated whole exome data set of 132 samples of Indian origin, we demonstrate that TMC-SNPdb could deplete 42, 33 and 28% false positive somatic events post dbSNP depletion in Indian origin tongue, gallbladder, and cervical cancer samples, respectively. Beyond cancer somatic analyses, we anticipate utility of the TMC-SNPdb in several Mendelian germline diseases. In addition to dbSNP build 149 and ANNOVAR, the TMC-SNPdb along with the subtraction tool is available for download in the public domain at the following:Database URL: http://www.actrec.gov.in/pi-webpages/AmitDutt/TMCSNP/TMCSNPdp.html. © The Author(s) 2016. Published by Oxford University Press.
28 CFR 45.3 - Disciplinary proceedings under 18 U.S.C. 207(j).
2010-07-01
.... 207(j). 45.3 Section 45.3 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) EMPLOYEE RESPONSIBILITIES § 45.3 Disciplinary proceedings under 18 U.S.C. 207(j). (a) Upon a determination by the Assistant... authorized by 18 U.S.C. 207(j), or subjected to other appropriate disciplinary action under that statute. The...
Development of level 2 processor for the readout of TMC
International Nuclear Information System (INIS)
Arai, Y.; Ikeno, M.; Murata, T.; Sudo, F.; Emura, T.
1995-01-01
We have developed a prototype 8-bit processor for the level 2 data processing for the Time Memory Cell (TMC). The first prototype processor successfully runs with 18 MHz clock. The operation of same clock frequency as TMC (30 MHz) will be easily achieved with simple modifications. Although the processor is very primitive one but shows its powerful performance and flexibility. To realize the compact TMC/L2P (Level 2 Processor) system, it is better to include the microcode memory within the chip. Encoding logic of the microcode must be included to reduce the microcode memory in this case. (J.P.N.)
Suarez-Mendez, C. A.; Hanemaaijer, M.; ten Pierick, Angela; Wolters, J. C.; Heijnen, J.J.; Wahl, S. A.
2016-01-01
13C labeling experiments in aerobic glucose limited cultures of Saccharomyces cerevisiae at four different growth rates (0.054; 0.101, 0.207, 0.307 h-1) are used for calculating fluxes that include intracellular cycles (e.g., storage carbohydrate cycles, exchange fluxes with amino acids), which are
Weather information integration in transportation management center (TMC) operations.
2011-01-02
This report presents the results of the third phase of an on-going FHWA study on weather integration in Transportation Management Center (TMC) operations. The report briefly describes the earlier phases of the integration study, summarizes the findin...
In vivo dynamic turnover of cerebral 13C isotopomers from [U- 13C]glucose
Xu, Su; Shen, Jun
2006-10-01
An INEPT-based 13C MRS method and a cost-effective and widely available 11.7 Tesla 89-mm bore vertical magnet were used to detect dynamic 13C isotopomer turnover from intravenously infused [U- 13C]glucose in a 211 μL voxel located in the adult rat brain. The INEPT-based 1H → 13C polarization transfer method is mostly adiabatic and therefore minimizes signal loss due to B 1 inhomogeneity of the surface coils used. High quality and reproducible data were acquired as a result of combined use of outer volume suppression, ISIS, and the single-shot three-dimensional localization scheme built in the INEPT pulse sequence. Isotopomer patterns of both glutamate C4 at 34.00 ppm and glutamine C4 at 31.38 ppm are dominated first by a doublet originated from labeling at C4 and C5 but not at C3 (with 1JC4C5 = 51 Hz) and then by a quartet originated from labeling at C3, C4, and C5 (with 1JC3C4 = 35 Hz). A lag in the transition of glutamine C4 pattern from doublet-dominance to quartet dominance as compared to glutamate C4 was observed, which provides an independent verification of the precursor-product relationship between neuronal glutamate and glial glutamine and a significant intercompartmental cerebral glutamate-glutamine cycle between neurons and glial cells.
Pinz, Sophia; Unser, Samy; Brueggemann, Susanne; Besl, Elisabeth; Al-Rifai, Nafisah; Petkes, Hermina; Amslinger, Sabine; Rascle, Anne
2014-01-01
Signal transducer and activator of transcription STAT5 and its upstream activating kinase JAK2 are essential mediators of cytokine signaling. Their activity is normally tightly regulated and transient. However, constitutive activation of STAT5 is found in numerous cancers and a driving force for malignant transformation. We describe here the identification of the synthetic chalcone α-Br-2',3,4,4'-tetramethoxychalcone (α-Br-TMC) as a novel JAK/STAT inhibitor. Using the non-transformed IL-3-dependent B cell line Ba/F3 and its oncogenic derivative Ba/F3-1*6 expressing constitutively activated STAT5, we show that α-Br-TMC targets the JAK/STAT pathway at multiple levels, inhibiting both JAK2 and STAT5 phosphorylation. Moreover, α-Br-TMC alters the mobility of STAT5A/B proteins in SDS-PAGE, indicating a change in their post-translational modification state. These alterations correlate with a decreased association of STAT5 and RNA polymerase II with STAT5 target genes in chromatin immunoprecipitation assays. Interestingly, expression of STAT5 target genes such as Cis and c-Myc was differentially regulated by α-Br-TMC in normal and cancer cells. While both genes were inhibited in IL-3-stimulated Ba/F3 cells, expression of the oncogene c-Myc was down-regulated and that of the tumor suppressor gene Cis was up-regulated in transformed Ba/F3-1*6 cells. The synthetic chalcone α-Br-TMC might therefore represent a promising novel anticancer agent for therapeutic intervention in STAT5-associated malignancies.
Intravaginal ring delivery of the reverse transcriptase inhibitor TMC 120 as an HIV microbicide.
Woolfson, A David; Malcolm, R Karl; Morrow, Ryan J; Toner, Clare F; McCullagh, Stephen D
2006-11-15
TMC 120 (Dapivirine) is a potent non-nucleoside reverse transcriptase inhibitor that is presently being developed as a vaginal HIV microbicide. To date, most vaginal microbicides under clinical investigation have been formulated as single-dose semi-solid gels, designed for application to the vagina before each act of intercourse. However, a clear rationale exists for providing long-term, controlled release of vaginal microbicides in order to afford continuous protection against heterosexually transmitted HIV infection and to improve user compliance. In this study we report on the incorporation of various pharmaceutical excipients into TMC 120 silicone, reservoir-type intravaginal rings (IVRs) in order to modify the controlled release characteristics of the microbicide. The results demonstrate that TMC 120 is released in zero-order fashion from the rings over a 28-day period and that release parameters could be modified by the inclusion of release-modifying excipients in the IVR. The hydrophobic liquid excipient isopropyl myristate had little effect on steady-state daily release rates, but did increase the magnitude and duration of burst release in proportion to excipient loading in the IVR. By comparison, the hydrophobic liquid poly(dimethylsiloxane) had little effect on TMC 120 release parameters. A hydrophilic excipient, lactose, had the surprising effect of decreasing TMC 120 burst release while increasing the apparent steady-state daily release in a concentration-dependent manner. Based on previous cell culture data and vaginal physiology, TMC120 is released from the various ring formulations in amounts potentially capable of maintaining a protective vaginal concentration. It is further predicted that the observed release rates may be maintained for at least a period of 1 year from a single ring device. TMC 120 release profiles and the mechanical properties of rings could be modified by the physicochemical nature of hydrophobic and hydrophilic excipients
TMC125 exerts similar initial antiviral potency as a five-drug, triple class antiretroviral regimen
Sankatsing, Sanjay U. C.; Weverling, Gerrit J.; Peeters, Monika; van't Klooster, Gerben; Gruzdev, Boris; Rakhmanova, Aza; Danner, Sven A.; Jurriaans, Suzanne; Prins, Jan M.; Lange, Joep M. A.
2003-01-01
Objective: TMC125, a next generation, non-nucleoside reverse transcriptase inhibitor (NNRTI), demonstrated a remarkable decline of plasma HIV-1 RNA during a phase IIa study. We compared the initial rate of decline of plasma HIV-1 RNA achieved by TMC125 monotherapy with that of a triple class,
18 CFR 385.207 - Petitions (Rule 207).
2010-04-01
... section 23(b) of the Federal Power Act is treated as a petition for a declaratory order. (c) Except as... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Petitions (Rule 207). 385.207 Section 385.207 Conservation of Power and Water Resources FEDERAL ENERGY REGULATORY COMMISSION...
Baert, Lieven; van 't Klooster, Gerben; Dries, Willy; François, Marc; Wouters, Alfons; Basstanie, Esther; Iterbeke, Koen; Stappers, Fred; Stevens, Paul; Schueller, Laurent; Van Remoortere, Pieter; Kraus, Guenter; Wigerinck, Piet; Rosier, Jan
2009-08-01
Long-acting parenteral formulations of antiretrovirals could facilitate maintenance and prophylactic treatment in HIV. Using the poorly water- and oil-soluble non-nucleoside reverse transcriptase inhibitor (NNRTI) TMC278 (rilpivirine) as base or hydrochloride (HCl), nanosuspensions were prepared by wet milling (Elan NanoCrystal technology) in an aqueous carrier. Laser diffraction showed that the average particles size were (1) close to the targeted size proportionality (200-400-800 nm), with increasing distributions the larger the average particle size, and (2) were stable over 6 months. Following single-dose administration, the plasma concentration profiles showed sustained release of TMC278 over 3 months in dogs and 3 weeks in mice. On comparison of intramuscular and subcutaneous injection of 5mg/kg (200 nm) in dogs, the subcutaneous route resulted in the most stable plasma levels (constant at 25 ng/mL for 20 days, after which levels declined slowly to 1-3 ng/mL at 3 months); 200 nm nanosuspensions achieved higher and less variable plasma concentration profiles than 400 and 800 nm nanosuspensions. In mice, the pharmacokinetic profiles after a single 20mg/kg dose (200 nm) were similar with two different surfactants used (poloxamer 338, or d-alpha-tocopheryl polyethylene glycol 1000 succinate). In conclusion, this study provides proof-of-concept that 200-nm sized TMC278 nanosuspensions may act as long-acting injectable.
International Nuclear Information System (INIS)
Imanishi, B.; Denisov, V.; Motobayashi, T.
1996-10-01
The charge-symmetric scattering systems, 12 C+ 13 N and 12 C+ 13 C have been investigated by using the orthogonalized coupled-reaction-channel (OCRC) method with the basis functions of the elastic, inelastic and transfer channels defined by the single-particle states, 1p1/2, 2s1/2, 1d5/2 and 1d3/2 of the valence nucleon in 13 N or 13 C. The data of the elastic scattering of 13 N on 12 C measured by Lienard et al. have been explained consistently with the data of the elastic and inelastic scattering of the 12 C+ 13 C system. The CRC effects both on the above systems are very strong, although those on the 12 C+ 13 N system are fairly weaker than the 12 C+ 13 C system. The role of the highly excited single-particle states 1d3/2 is particularly important in the formation of a specific CRC scheme, i.e., the formation of the covalent molecules due to the hybridization caused by the mixing of the different parity single-particle states. The fusion cross sections of the 12 C+ 13 C system at energies below the Coulomb barrier are strongly enhanced as a result of the strong CRC effects as compared with those of the 12 C+ 12 C system, while in 12 C+ 13 N system the enhancement of the sub-barrier fusion has not been observed. The above absorption mechanism for the 12 C+ 13 C system explains the lack of the molecular-resonance phenomena observed in the 12 C+ 12 C system. We check the effects of the dipole (E1) transition of the valence nucleon in 13 N (and also in 13 C) due to the core-core Coulomb interaction in the scattering at sub-barrier energies. The effects are not appreciable. (author)
Cordiner, M. A.; Charnley, S. B.; Kisiel, Z.; McGuire, B. A.; Kuan, Y.-J.
2017-12-01
The 100 m Robert C. Byrd Green Bank Telescope K-band (KFPA) receiver was used to perform a high-sensitivity search for rotational emission lines from complex organic molecules in the cold interstellar medium toward TMC-1 (cyanopolyyne peak), focussing on the identification of new carbon-chain-bearing species as well as molecules of possible prebiotic relevance. We report a detection of the carbon-chain oxide species HC7O and derive a column density of (7.8+/- 0.9)× {10}11 cm-2. This species is theorized to form as a result of associative electron detachment reactions between oxygen atoms and C7H-, and/or reaction of C6H2 + with CO (followed by dissociative electron recombination). Upper limits are given for the related HC6O, C6O, and C7O molecules. In addition, we obtained the first detections of emission from individual 13C isotopologues of HC7N, and derive abundance ratios HC7N/HCCC13CCCCN = 110 ± 16 and HC7N/HCCCC13CCCN = 96 ± 11, indicative of significant 13C depletion in this species relative to the local interstellar elemental 12C/13C ratio of 60-70. The observed spectral region covered two transitions of HC11N, but emission from this species was not detected, and the corresponding column density upper limit is 7.4× {10}10 {{cm}}-2 (at 95% confidence). This is significantly lower than the value of 2.8× {10}11 {{cm}}-2 previously claimed by Bell et al. and confirms the recent nondetection of HC11N in TMC-1 by Loomis et al. Upper limits were also obtained for the column densities of malononitrile and the nitrogen heterocycles quinoline, isoquinoline, and pyrimidine.
Enhanced mechanical properties of 1,3-trimethylene carbonate polymers and networks
Pêgo, A.P.; Grijpma, Dirk W.; Feijen, Jan
2003-01-01
Poly(1,3-trimethylene carbonate), poly(TMC), has often been regarded as a rubbery polymer that cannot be applied in the biomedical field due to its poor dimensional stability, tackiness and inadequate mechanical properties. In this study we show that high molecular weight, amorphous poly(TMC) is
Brueggemann, Susanne; Besl, Elisabeth; Al-Rifai, Nafisah; Petkes, Hermina; Amslinger, Sabine; Rascle, Anne
2014-01-01
Signal transducer and activator of transcription STAT5 and its upstream activating kinase JAK2 are essential mediators of cytokine signaling. Their activity is normally tightly regulated and transient. However, constitutive activation of STAT5 is found in numerous cancers and a driving force for malignant transformation. We describe here the identification of the synthetic chalcone α-Br-2′,3,4,4′-tetramethoxychalcone (α-Br-TMC) as a novel JAK/STAT inhibitor. Using the non-transformed IL-3-dependent B cell line Ba/F3 and its oncogenic derivative Ba/F3-1*6 expressing constitutively activated STAT5, we show that α-Br-TMC targets the JAK/STAT pathway at multiple levels, inhibiting both JAK2 and STAT5 phosphorylation. Moreover, α-Br-TMC alters the mobility of STAT5A/B proteins in SDS-PAGE, indicating a change in their post-translational modification state. These alterations correlate with a decreased association of STAT5 and RNA polymerase II with STAT5 target genes in chromatin immunoprecipitation assays. Interestingly, expression of STAT5 target genes such as Cis and c-Myc was differentially regulated by α-Br-TMC in normal and cancer cells. While both genes were inhibited in IL-3-stimulated Ba/F3 cells, expression of the oncogene c-Myc was down-regulated and that of the tumor suppressor gene Cis was up-regulated in transformed Ba/F3-1*6 cells. The synthetic chalcone α-Br-TMC might therefore represent a promising novel anticancer agent for therapeutic intervention in STAT5-associated malignancies. PMID:24595334
Lifescience Database Archive (English)
Full Text Available SL (Link to library) SLA117 (Link to dictyBase) - - - Contig-U15540-1 - (Link to Or...iginal site) - - SLA117Z 649 - - - - Show SLA117 Library SL (Link to library) Clone ID SLA117 (Link to dicty...Base) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15540-1 Original site URL http://dictycdb.b...--EPMHRNYYQPIQFKLPSFPDTSLPITQIDDKTGIFDSQRFLAFNNPQAMSKYESYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTE...SYRI YIHPSLGYSGNAKRFKQQPDVNEKALILDGNVYDGHLNPIYNCKICTEYYQTKSYFSANP HAKGKVLLVKNNILTRVKDGGFTLSLKPMCCSGHNSHIPLYF
Lifescience Database Archive (English)
Full Text Available SF (Link to library) SFD117 (Link to dictyBase) - - - Contig-U16381-1 SFD117F (Link... to Original site) SFD117F 107 - - - - - - Show SFD117 Library SF (Link to library) Clone ID SFD117 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16381-1 Original site URL http://dict...s producing significant alignments: (bits) Value N AC115685 |AC115685.1 Dictyoste...lium discoideum chromosome 2 map 4718821-4752388 strain AX4, complete sequence. 80 2e-21 3 X51892 |X51892.1 Dict
New Molecular Detections in TMC-1 with the Green Bank Telescope: Carbon-Chain and Aromatic Molecules
Burkhardt, Andrew Michael
2018-01-01
Polycyclic aromatic hydrocarbons (PAHs) and polycyclic aromatic nitrogen heterocycles PA(N)Hs are believed to be widespread throughout the Universe, and are likely responsible for the unidentified infrared bands. However, the individual detection of aromatic molecules has been limited to a single weak absorption feature of an infrared bending mode of benzene (c-C6H6). The cold core TMC-1 has long been a source of new molecular detections, particularly for unsaturated carbon-rich molecules that are appealing potential precursors of PA(N)Hs. Through deep observations with the Green Bank Telescope of TMC-1, we report the first rotational detection of an aromatic molecule, benzonitrile (c-C6H5CN), along with 8 new isotopologues of HC5N and HC7N and an entirely new molecular family (HC5O, HC7O). These new detections provide crucial insights to the formation of PAHs and the underlying carbon-chain chemistry of dark clouds.
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFL117 (Link to dictyBase) - G22229 DDB0204982 Contig-U10461-1... - (Link to Original site) - - VFL117Z 591 - - - - Show VFL117 Library VF (Link to library) Clone ID VFL117 (Link to dict...yBase) Atlas ID - NBRP ID G22229 dictyBase ID DDB0204982 Link to Contig Contig-U10461-1 Original site URL http://dict...GMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICTVIEEGIYQFAFEEFSTSTSVQSNFITYLIDTTQMIVVMYILANGKFS NYILFRKVKTTSFNSNEK...k**ytkfkynn**hw Frame B: ---TSMLMDIKFGQAVGFLILLAIYCAMVIGFGMALLRSLQNHKKNTPFQHFQDMIFKTK VLITTVSLVFICT
13C Mrs Studies of the Control of Hepatic Glycogen Metabolism at High Magnetic Fields
Miller, Corin O.; Cao, Jin; Zhu, He; Chen, Li M.; Wilson, George; Kennan, Richard; Gore, John C.
2017-06-01
Introduction: Glycogen is the primary intracellular storage form of carbohydrates. In contrast to most tissues where stored glycogen can only supply the local tissue with energy, hepatic glycogen is mobilized and released into the blood to maintain appropriate circulating glucose levels, and is delivered to other tissues as glucose in response to energetic demands. Insulin and glucagon, two current targets of high interest in the pharmaceutical industry, are well known glucose-regulating hormones whose primary effect in liver is to modulate glycogen synthesis and breakdown. The purpose of these studies was to develop methods to measure glycogen metabolism in real time non-invasively both in isolated mouse livers, and in non-human primates (NHPs) using 13C MRS. Methods: Livers were harvested from C57/Bl6 mice and perfused with [1-13C] Glucose. To demonstrate the ability to measure acute changes in glycogen metabolism ex-vivo, fructose, glucagon, and insulin were administered to the liver ex-vivo. The C1 resonance of glycogen was measured in real time with 13C MRS using an 11.7T (500 MHz) NMR spectrometer. To demonstrate the translatability of this approach, NHPs (male rhesus monkeys) were studied in a 7 T Philips MRI using a partial volume 1H/13C imaging coil. NPHs were subjected to a variable IV infusion of [1-13C] glucose (to maintain blood glucose at 3-4x basal), along with a constant 1 mg/kg/min infusion of fructose. The C1 resonance of glycogen was again measured in real time with 13C MRS. To demonstrate the ability to measure changes in glycogen metabolism in vivo, animals received a glucagon infusion (1 μg/kg bolus followed by 40 ng/kg/min constant infusion) half way through the study on the second study session. Results: In both perfused mouse livers and in NHPs, hepatic 13C-glycogen synthesis (i.e. monotonic increases in the 13C-glycogen NMR signal) was readily detected. In both paradigms, addition of glucagon resulted in cessation of glycogen synthesis
Detection of HC5N and HC7N Isotopologues in TMC-1 with the Green Bank Telescope
Burkhardt, A. M.; Herbst, E.; Kalenskii, S. V.; McCarthy, M. C.; Remijan, A. J.; McGuire, B. A.
2018-03-01
We report the first interstellar detection of DC7N and six 13C-bearing isotopologues of HC7N towards the dark cloud TMC-1 through observations with the Green Bank Telescope, and confirm the recent detection of HC515N. For the average of the 13C isotopomers, DC7N, and HC515N, we derive column densities of 1.9(2) × 1011, 2.5(9) × 1011, and 1.5(4) × 1011 cm-2, respectively. The resulting isotopic ratios are consistent with previous values derived from similar species in the source, and we discuss the implications for the formation chemistry of the observed cyanopolyynes. Within our uncertainties, no significant 13C isotopomer variation is found for HC7N, limiting the significance CN could have in its production. The results further show that, for all observed isotopes, HC5N may be isotopically depleted relative to HC3N and HC7N, suggesting that reactions starting from smaller cyanopolyynes may not be efficient to form HCnN. This leads to the conclusion that the dominant production route may be the reaction between hydrocarbon ions and nitrogen atoms.
International Nuclear Information System (INIS)
Gomez Aleixandre, J. L.
1967-01-01
145 stars with N h >8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c π- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs
International Nuclear Information System (INIS)
Gil Perez, D.
1967-01-01
We present he re an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs
13C MRS Studies of the Control of Hepatic Glycogen Metabolism at High Magnetic Fields
Directory of Open Access Journals (Sweden)
Corin O. Miller
2017-06-01
Full Text Available Introduction: Glycogen is the primary intracellular storage form of carbohydrates. In contrast to most tissues where stored glycogen can only supply the local tissue with energy, hepatic glycogen is mobilized and released into the blood to maintain appropriate circulating glucose levels, and is delivered to other tissues as glucose in response to energetic demands. Insulin and glucagon, two current targets of high interest in the pharmaceutical industry, are well-known glucose-regulating hormones whose primary effect in liver is to modulate glycogen synthesis and breakdown. The purpose of these studies was to develop methods to measure glycogen metabolism in real time non-invasively both in isolated mouse livers, and in non-human primates (NHPs using 13C MRS.Methods: Livers were harvested from C57/Bl6 mice and perfused with [1-13C] Glucose. To demonstrate the ability to measure acute changes in glycogen metabolism ex-vivo, fructose, glucagon, and insulin were administered to the liver ex-vivo. The C1 resonance of glycogen was measured in real time with 13C MRS using an 11.7T (500 MHz NMR spectrometer. To demonstrate the translatability of this approach, NHPs (male rhesus monkeys were studied in a 7 T Philips MRI using a partial volume 1H/13C imaging coil. NPHs were subjected to a variable IV infusion of [1-13C] glucose (to maintain blood glucose at 3-4x basal, along with a constant 1 mg/kg/min infusion of fructose. The C1 resonance of glycogen was again measured in real time with 13C MRS. To demonstrate the ability to measure changes in glycogen metabolism in vivo, animals received a glucagon infusion (1 μg/kg bolus followed by 40 ng/kg/min constant infusion half way through the study on the second study session.Results: In both perfused mouse livers and in NHPs, hepatic 13C-glycogen synthesis (i.e., monotonic increases in the 13C-glycogen NMR signal was readily detected. In both paradigms, addition of glucagon resulted in cessation of glycogen
Buttafoco, L.; Boks, Niels P.; Engbers-Buijtenhuijs, P.; Grijpma, Dirk W.; Poot, Andreas A.; Dijkstra, Pieter J.; Vermes, I.; Feijen, Jan
2006-01-01
Poly (D,L-lactide)-7co-(1,3-trimethylene carbonate) [P(DLLA-co-TMC)] (83 mol % DLLA) was used to produce matrices suitable for tissue engineering of small-diameter blood vessels. The copolymer was processed into tubular structures with a porosity of 98% by melt spinning and fiber winding, thus
Energy Technology Data Exchange (ETDEWEB)
Gomez Aleixandre, J L
1967-07-01
145 stars with N{sub h}>8 produced by the interactions of 13.8 GeV/c protons with Ag and Br nuclei have been analysed. The emulsion stack was irradiated in a 170 K gauss magnetic field. Statistical results concerning the main characteristics of the different particles emitted are given and the energy balance is evaluated. The main features of both 24 GeV/c protons and 17 GeV/c {pi}- interactions are compared with those we have found for 13.8 GeV/c protons interactions. (Author) 27 refs.
Energy Technology Data Exchange (ETDEWEB)
Choi, Yunhee; Lee, Jeong-Eun [School of Space Research, Kyung Hee University, 1732, Deogyeong-daero, Giheung-gu, Yongin-si, Gyeonggi-do 17104 (Korea, Republic of); Bourke, Tyler L. [Square Kilometre Array Organisation, Jodrell Bank Observatory, Lower Withington, Cheshire SK11 9DL (United Kingdom); II, Neal J. Evans, E-mail: yunhee.choi@khu.ac.kr, E-mail: jeongeun.lee@khu.ac.kr [Department of Astronomy, University of Texas at Austin, 2515 Speedway, Stop C1400, Austin, TX 78712-1205 (United States)
2017-04-01
We present observations and analyses of the low-mass star-forming region, Taurus Molecular Cloud-1 (TMC-1). CS ( J = 2–1)/N{sub 2}H{sup +} ( J = 1–0) and C{sup 17}O ( J = 2–1)/C{sup 18}O ( J = 2–1) were observed with the Five College Radio Astronomy Observatory and the Seoul Radio Astronomy Observatory, respectively. In addition, Spitzer infrared data and 1.2 mm continuum data observed with Max-Planck Millimetre Bolometer are used. We also perform chemical modeling to investigate the relative molecular distributions of the TMC-1 filament. Based on Spitzer observations, there is no young stellar object along the TMC-1 filament, while five Class II and one Class I young stellar objects are identified outside the filament. The comparison between column densities calculated from dust continuum and C{sup 17}O 2–1 line emission shows that CO is depleted much more significantly in the ammonia peak than in the cyanopolyyne peak, while the column densities calculated from the dust continuum are similar at the two peaks. N{sub 2}H{sup +} is not depleted much in either peak. According to our chemical calculation, the differential chemical distribution in the two peaks can be explained by different timescales required to reach the same density, i.e., by different dynamical processes.
Non-detection of HC11N towards TMC-1: constraining the chemistry of large carbon-chain molecules
Loomis, Ryan A.; Shingledecker, Christopher N.; Langston, Glen; McGuire, Brett A.; Dollhopf, Niklaus M.; Burkhardt, Andrew M.; Corby, Joanna; Booth, Shawn T.; Carroll, P. Brandon; Turner, Barry; Remijan, Anthony J.
2016-12-01
Bell et al. reported the first detection of the cyanopolyyne HC11N towards the cold dark cloud TMC-1; no subsequent detections have been reported towards any source. Additional observations of cyanopolyynes and other carbon-chain molecules towards TMC-1 have shown a log-linear trend between molecule size and column density, and in an effort to further explore the underlying chemical processes driving this trend, we have analysed Green Bank Telescope observations of HC9N and HC11N towards TMC-1. Although we find an HC9N column density consistent with previous values, HC11N is not detected and we derive an upper limit column density significantly below that reported in Bell et al. Using a state-of-the-art chemical model, we have investigated possible explanations of non-linearity in the column density trend. Despite updating the chemical model to better account for ion-dipole interactions, we are not able to explain the non-detection of HC11N, and we interpret this as evidence of previously unknown carbon-chain chemistry. We propose that cyclization reactions may be responsible for the depleted HC11N abundance, and that products of these cyclization reactions should be investigated as candidate interstellar molecules.
Directory of Open Access Journals (Sweden)
C.A. Suarez-Mendez
2016-12-01
Full Text Available 13C labeling experiments in aerobic glucose limited cultures of Saccharomyces cerevisiae at four different growth rates (0.054; 0.101, 0.207, 0.307 h−1 are used for calculating fluxes that include intracellular cycles (e.g., storage carbohydrate cycles, exchange fluxes with amino acids, which are rearranged depending on the growth rate. At low growth rates the impact of the storage carbohydrate recycle is relatively more significant than at high growth rates due to a higher concentration of these materials in the cell (up to 560-fold and higher fluxes relative to the glucose uptake rate (up to 16%. Experimental observations suggest that glucose can be exported to the extracellular space, and that its source is related to storage carbohydrates, most likely via the export and subsequent extracellular breakdown of trehalose. This hypothesis is strongly supported by 13C-labeling experimental data, measured extracellular trehalose, and the corresponding flux estimations. Keywords: Non-stationary 13C labeling, Flux estimation, Trehalose, Glycogen, Amino acids
Amidi, Maryam; Romeijn, Stefan G.; Verhoef, J. Coos; Junginger, Hans E.; Bungener, Laura; Huckriede, Anke; Crommelin, Daan J. A.; Jiskoot, Wim
2007-01-01
In this study, the potential of N-trimethyl chitosan (TMC) nanoparticles as a carrier system for the nasal delivery of a monovalent influenza subunit vaccine was investigated. The antigen-loaded nanoparticles were prepared by mixing a solution containing TMC and monovalent influenza A subunit H3N2
Correlation between the 12C+12C, 12C+13C, and 13C+13C fusion cross sections
Notani, M.; Esbensen, H.; Fang, X.; Bucher, B.; Davies, P.; Jiang, C. L.; Lamm, L.; Lin, C. J.; Ma, C.; Martin, E.; Rehm, K. E.; Tan, W. P.; Thomas, S.; Tang, X. D.; Brown, E.
2012-01-01
The fusion cross section for 12C+13C has been measured down to Ec.m.=2.6 MeV, at which the cross section is of the order of 20 nb. By comparing the cross sections for the three carbon isotope systems, 12C+12C, 12C+13C, and 13C+13C, it is found that the cross sections for 12C+13C and 13C+13C provide an upper limit for the fusion cross section of 12C+12C over a wide energy range. After calibrating the effective nuclear potential for 12C+12C using the 12C+13C and 13C+13C fusion cross sections, it is found that a coupled-channels calculation with the ingoing wave boundary condition (IWBC) is capable of predicting the major peak cross sections in 12C+12C. A qualitative explanation for this upper limit is provided by the Nogami-Imanishi model and by level density differences among the compound nuclei. It is found that the strong resonance found at 2.14 MeV in 12C+12C exceeds this upper limit by a factor of more than 20. The preliminary result from the most recent measurement shows a much smaller cross section at this energy, which agrees with our predicted upper limit.
Detection of antisymmetric tensor contribution to the magnetic screening of 13C nuclei
International Nuclear Information System (INIS)
Kuhn, W.
1983-01-01
In the present thesis for the first time a practicable way for the detection of antisymmetric contributions to the tensor of the magnetic screening of atomic nuclei is indicated. The detection is based on the relaxation efficiency of the antisymmetric screening. The measurements were performed on the 13 C nuclei of phthalic acid anhydride. Measured were the spin-lattice relaxation times of all 13 C nuclei of the molecule at field strengths between 4.69 T and 11.74 T, this corresponds to 1 H resonance frequencies in the range from 200 MHz to 500 MHz. From this the interaction-specific relaxation rates could be determined without problems. The space-group of the crystal and the molecule geometry were determined by X-ray structure analysis. For the accurate determination of the hydrogen position on a deuterated monocrystal by means of deuterium nuclear resonance measurements the electric field gradient tensors were measured and from the orientation of the main axes of these tensors the bonding angles calculated. On a monocrystal enriched in the C(7) respectively C(8) position with 13 C the symmetric part of the tensor of the magnetic screening of these two nuclei was measured. With these values and the relaxation rates of the 13 C nuclei by an iterative procedure from the equations for the theoretical relaxation rates of all 13 C nuclei of the molecule the main values of the rotation-diffusion tensor could be determined. On the base of the plane molecule geometry from this the tensor element sigmasub(xz)sup(A) could be explicety detected according to an amount of 11.7 ppm. (orig.) [de
Directory of Open Access Journals (Sweden)
Newton Maciel de Oliveira
2016-10-01
Full Text Available Ao longo da história, muitos tratamentos diferentes e, por vezes bizarros, têm sido prescritos para queimaduras. Desde os tempos mais remotos até os dias atuais, existe a necessidade de buscar novas terapias e drogas que funcionem como agentes tópicos para aliviar a dor e controlar a infecção em queimaduras. Dessa maneira, uma alternativa interessante às drogas sintéticas é a utilização de plantas, como um recurso natural, as quais podem ser úteis para o desenvolvimento de novas formulações e estratégias para melhorar a qualidade de vida. Neste trabalho foi utilizado o terpolímero poli (L-co-D, L ácido lático-co-TMC (PLDLA-co-TMC como matriz polimérica para a fabricação do curativo, sendo misturado a esse curativo o extrato de Aloe Vera, uma planta tropical que pertence à família Liliaceae, sendo conhecida por ser a mais antiga planta medicinal na natureza, a qual exibe propriedades anti-cancerígena, anti-oxidante, anti-bacteriana, cicatrizante e anti-viral. Além disso, outra vantagem do uso destes materiais está relacionada ao custo, uma vez que os produtos atualmente disponíveis para o tratamento de queimaduras são importados e apresentam valor elevado, inviabilizando o uso em larga escala. Neste trabalho, o estudo in vivo foi realizado por meio de 30 animais (ratos Wistar, divididos em 02 grupos conforme o tempo dos curativos (7 dias e 15 dias. Cada um, por sua vez, foi subdividido em 03 grupos de acordo com o tratamento aplicado: um grupo controle (sem a membrana PLDLA-co-TMC, tratamento 1 (com a membrana PLDLA-co-TMC sem Aloe Vera e tratamento 2 (com a membrana PLDLA-co-TMC/Aloe Vera com concentração de 10%.
International Nuclear Information System (INIS)
Carmo, Thacyla C. do; Lopes, Grazielle; Silva, Joaquim F.M. da; Nascimento, Regina S.V.
2009-01-01
N,N,N-trimethyl chitosan (TMC) hydrophobically modified can act as an excellent additive for drilling fluids water based, working as inhibitor of reactive shales and rheological modifiers. The cationic chitosan was obtained by reaction of chitosan with CH 3 I in N-methyl-2-pyrrolidone to obtain the TMC and chitosan was also hydrophobically modified with palmitoil chloride to get Quit P. Through another route, Quit P was modified to obtain the cationic TMCP. The derivatives were characterized by FT-IR and 1 HNMR spectrophotometry allowing the calculation of the degree of quaternization of the TMC. The rheology tests showed that the system with TMCP presented pseudo plastic behavior, while the system with TMC behaved as a Newtonian fluid. The results indicated that TMCP can act as rheology modifier for water-based drilling fluids. (author)
Suarez-Mendez, C A; Hanemaaijer, M; Ten Pierick, Angela; Wolters, J C; Heijnen, J J; Wahl, S A
2016-12-01
13 C labeling experiments in aerobic glucose limited cultures of Saccharomyces cerevisiae at four different growth rates (0.054; 0.101, 0.207, 0.307 h -1 ) are used for calculating fluxes that include intracellular cycles (e.g., storage carbohydrate cycles, exchange fluxes with amino acids), which are rearranged depending on the growth rate. At low growth rates the impact of the storage carbohydrate recycle is relatively more significant than at high growth rates due to a higher concentration of these materials in the cell (up to 560-fold) and higher fluxes relative to the glucose uptake rate (up to 16%). Experimental observations suggest that glucose can be exported to the extracellular space, and that its source is related to storage carbohydrates, most likely via the export and subsequent extracellular breakdown of trehalose. This hypothesis is strongly supported by 13 C-labeling experimental data, measured extracellular trehalose, and the corresponding flux estimations.
Directory of Open Access Journals (Sweden)
D.B.C. Lima
2016-08-01
Full Text Available ABSTRACT We aimed to compare fresh sperm and sperm cooled to 4ºC that had been recovered from the epididymides of cats using powdered coconut water (ACP-117c and Tris extenders. Sixty epididymides were divided into 6 groups: 10 fresh epididymides were recovered using Tris (T0h; 10 were kept at 4°C/2h and recovered using Tris (T2h; 10 were kept at 4°C/4h and recovered using Tris (T4h; 10 fresh were recovered using ACP-117c (A0h; 10 were kept at 4°C/2h and recovered using ACP-117c (A2h, and 10 were kept at 4°C/4h and recovered using ACP-117c (A4h. The testis-epididymis complexes (TEC control were not cooled. The others were cooled at 4°C for 2 or 4h. The epididymis was separated and the sperm was recovered by the modified flotation method. Sperm kinetic parameters were evaluated by a computer-system analysis, and vigor, viability, concentration, membrane function and morphology of the sperm were assessed under a light microscope. The progressive motility with ACP-117c declined after 2h of cooling, but did not differ between fresh and 4h. The vigor and membrane function were higher in A4h than A0h. The vigor at T2h and T4h were decreased compared to T0h. T0h was higher than A0h for vigor and sperm membrane function. However, after 4h of cooling, ACP-117c maintained a higher percentage of living cells. Feline epididymal sperm quality can be maintained to the degree necessary for artificial breeding programs following cooling and ACP-117c may be successfully used to recover cat sperm that have been cooled for up to 4h.
International Nuclear Information System (INIS)
Kato, Koichi; Matsunaga, Chigusa; Odaka, Asano; Yamato, Sumie; Takaha, Wakana; Shimada, Ichio; Arata, Yoji
1991-01-01
A 13 C NMR study is reported of switch variant anti-dansyl antibodies, which possess the identical V H , V L , and C L domains in conjunction with highly homologous but not identical heavy-chain constant regions. Each of the antibodies has been selectively labeled with 13 C at the carbonyl carbon of Trp, Tyr, His, or Cys residue by growing hybridoma cells in serum-free medium. Spectral assignments have been made by folowing the procedure described previously for the switch variant antibodies labeled with [1- 13 C]Met. On the basis of the spectral data collected for the antibodies and their proteolytic fragments, the authors discuss how 13 C NMR spectroscopy can be used for the structural analyses of antigen binding and also of domain-domain interactions in the antibody molecule
Polymeric proanthocyanidins 13C NMR studies of procyanidins
Lawrence J. Porter; Roger H. Newman; Lai Yeap Foo; Herbert Wong; Richard W. Hemingway
1982-01-01
Proanthocyanidin polymers have been shown to consist entirely of flavan-3-ol units by a combination of techniques including 13C n.m.r. spectroscopy. The 13C n.m.r. spectra of the polymers and related molecules are now considered in more detail. Prior to this study UC n.m.r. data has been published of procyanidins and...
Energy Technology Data Exchange (ETDEWEB)
Kato, Koichi; Matsunaga, Chigusa; Odaka, Asano; Yamato, Sumie; Takaha, Wakana; Shimada, Ichio; Arata, Yoji (Univ. of Tokyo (Japan))
1991-07-02
A {sup 13}C NMR study is reported of switch variant anti-dansyl antibodies, which possess the identical V{sub H}, V{sub L}, and C{sub L} domains in conjunction with highly homologous but not identical heavy-chain constant regions. Each of the antibodies has been selectively labeled with {sup 13}C at the carbonyl carbon of Trp, Tyr, His, or Cys residue by growing hybridoma cells in serum-free medium. Spectral assignments have been made by folowing the procedure described previously for the switch variant antibodies labeled with (1-{sup 13}C)Met. On the basis of the spectral data collected for the antibodies and their proteolytic fragments, the authors discuss how {sup 13}C NMR spectroscopy can be used for the structural analyses of antigen binding and also of domain-domain interactions in the antibody molecule.
Multisite Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate
Directory of Open Access Journals (Sweden)
Pedro A. Gómez Damián
2014-01-01
Full Text Available Hyperpolarized 13C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1-13C]pyruvate and downstream metabolites [1-13C]alanine, [1-13C]lactate, and [13C]bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multisite, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multisite model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multisite model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues.
Technical advances in neutron polarimetry and studies of the (p,n) reaction in /sup 13/C
Energy Technology Data Exchange (ETDEWEB)
Videla, N G
1985-01-01
The asymmetry in the /sup 4/He(p,n vector)/sup 4/He reaction has been measured at three different incident neutron energies: 19.40; 22.85 and 27.31 MeV, and 120/sup 0/ from forward direction. Values of the asymmetry have been used to calculate the polarization of fast neutrons produced in the /sup 13/C(p,n vector)/sup 13/N. The /sup 13/C(p,n vector)/sup 13/N reaction was studied as part of a program being undertaken at the University of Manitoba Cyclotron Laboratory to study (p,n) reactions linking isobaric analog states of mirror nuclei in the energy range of 22 to 50 MeV. The study involves a comparison of the proton analyzing power A(theta), in the reaction /sup 13/C(vector p,n)/sup 13/N to the neutron polarization in the inverse reaction /sup 13/C(p,n vector)/sup 13/N. The importance of the comparison between these two observables is based in Conzett's theorem for time reversed reactions, the theorem states that the proton analyzing power in the reaction /sup 13/C(vector p,n)/sup 13/N is equal to the neutron polarization in the reaction /sup 13/C(p,n vector)/sup 13/N provided the reaction proceeds between members of an isospin doublet and when charge symmetry and time reversal invariance hold exactly. However, isospin symmetry is broken by the Coulomb interaction. So comparison of these two observables should yield information of the breaking of isospin by the Coulomb force.
The cerebral metabolism of amino acids and related metabolites as studied by 13C and 14C labelling
International Nuclear Information System (INIS)
Hassel, B.
1995-11-01
The present investigations show the feasibility of analyzing the cerebral metabolism of amino acids and related metabolites by 13 C-and 14 C-labelling using labelled acetate and glucose as markers for glial and neuronal metabolism, respectively. Using [ 13 C[acetate, it was shown that glial cells export ∼60% of their TCA cycle intermediates, mostly as glutamine, and that this glutamine is used by neurons partly as an energy reserve, and partly it is converted directly to glutamate and GABA. Using [ 13 C[glucose, the glial process or pyruvate carboxylation was shown to compensate fully for the loss of glutamine. The mechanism of action of two neurotoxins, fluorocitrate and 3-nitropropionate was elucidated. The latter toxin was shown to inhibit the TCA cycle of GABAergic neurons selectively. Formation of pyruvate and lactate from glial TCA cycle intermediates was demonstrated in vivo. This pathway may be important for glial inactivation of transmitter glutamate and GABA. The results illustrate glianeuronal interactions, and they suggest the applicability of 13 CNMR spectroscopy to the detailed study of the cerebral metabolism of amino acids in the intact, unanesthetized human brain. 174 refs
Energy Technology Data Exchange (ETDEWEB)
Gil Perez, D.
1967-07-01
We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.
Energy Technology Data Exchange (ETDEWEB)
Gil Perez, D
1967-07-01
We present here an global study of the interaction between high- energy particles and heavy nuclei, an interaction which holds obvious interest in relation to the problems of nuclear fragmentation and which, up lo now has only been studied piecemeal. We have used three stacks of photographic emulsions which were irradiated by 13.8 GeV/c protons, 17 GeV/c negative pions and 24 GeV/c protons. All three irradiations took place in a 180 K.G. magnetic field using CERN beams. (Author) 20 refs.
Energy Technology Data Exchange (ETDEWEB)
Krivdin, L.B.; Shcherbakov, V.V.; Glukhikh, N.G.; Sigalov, V.M.; Kalabin, G.A.
1987-07-10
Vinyl ethers were prepared by the well-known Favorskii-Shostakovskii method. The purity of the compounds was controlled by GLC and by the PMR and /sup 13/C NMR spectra. The proximity of sp/sup 7/-hybridized unshared pair of oxygen atoms result in a secondary, positive contribution in the constant of spin-spin interaction between neighboring carbon nuclei in the aromatic ring.
24 CFR 207.252c - Premiums-mortgages insured pursuant to section 238(c) of the Act.
2010-04-01
.... All of the provisions of §§ 207.252 and 207.252a governing mortgage insurance premiums shall apply to... insurance premiums due on such mortgages in accordance with §§ 207.252 and 207.252a shall be calculated on... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Premiums-mortgages insured pursuant...
International Nuclear Information System (INIS)
Chaintreau, Alain; Fieber, Wolfgang; Sommer, Horst; Gilbert, Alexis; Yamada, Keita; Yoshida, Naohiro; Pagelot, Alain; Moskau, Detlef; Moreno, Aitor; Schleucher, Jürgen; Reniero, Fabiano; Holland, Margaret; Guillou, Claude; Silvestre, Virginie; Akoka, Serge; Remaud, Gérald S.
2013-01-01
Graphical abstract: -- Highlights: •First ring test on isotopic 13 C NMR spectrometry. •Evaluation of the intra- and inter-variability of the NMR spectrometers used. •Definition of a protocol for qualification of the performance of the spectrometer. -- Abstract: Isotopic 13 C NMR spectrometry, which is able to measure intra-molecular 13 C composition, is of emerging demand because of the new information provided by the 13 C site-specific content of a given molecule. A systematic evaluation of instrumental behaviour is of importance to envisage isotopic 13 C NMR as a routine tool. This paper describes the first collaborative study of intra-molecular 13 C composition by NMR. The main goals of the ring test were to establish intra- and inter-variability of the spectrometer response. Eight instruments with different configuration were retained for the exercise on the basis of a qualification test. Reproducibility at the natural abundance of isotopic 13 C NMR was then assessed on vanillin from three different origins associated with specific δ 13 C i profiles. The standard deviation was, on average, between 0.9 and 1.2‰ for intra-variability. The highest standard deviation for inter-variability was 2.1‰. This is significantly higher than the internal precision but could be considered good in respect of a first ring test on a new analytical method. The standard deviation of δ 13 C i in vanillin was not homogeneous over the eight carbons, with no trend either for the carbon position or for the configuration of the spectrometer. However, since the repeatability for each instrument was satisfactory, correction factors for each carbon in vanillin could be calculated to harmonize the results
Weather integration in TMC operations : a self-evaluation and planning guide.
2009-04-01
This flyer describes how Traffic Management Centers (TMC) can integrate weather information into their daily operations, and is based on the Road Weather Management Program publication, Self-Evaluation and Planning Guide (FHWA-JPO-08-057). The Guide ...
Multi site Kinetic Modeling of 13C Metabolic MR Using [1-13C]Pyruvate
International Nuclear Information System (INIS)
Damian, P.A.G.; Sperl, J.I.; Janich, M.A.; Wiesinger, F.; Schulte, R.F.; Menzel, M.I.; Damian, P.A.G.; Damian, P.A.G.; Haase, A.; Janich, M.A.; Schwaiger, M.; Janich, M.A.; Khegai, O.; Glaser, S.J.
2014-01-01
Hyperpolarized 13 C imaging allows real-time in vivo measurements of metabolite levels. Quantification of metabolite conversion between [1- 13 C]pyruvate and downstream metabolites [1- 13 C]alanine, [1- 13 C]lactate, and [ 13 C] bicarbonate can be achieved through kinetic modeling. Since pyruvate interacts dynamically and simultaneously with its downstream metabolites, the purpose of this work is the determination of parameter values through a multi site, dynamic model involving possible biochemical pathways present in MR spectroscopy. Kinetic modeling parameters were determined by fitting the multi site model to time-domain dynamic metabolite data. The results for different pyruvate doses were compared with those of different two-site models to evaluate the hypothesis that for identical data the uncertainty of a model and the signal-to-noise ratio determine the sensitivity in detecting small physiological differences in the target metabolism. In comparison to the two-site exchange models, the multi site model yielded metabolic conversion rates with smaller bias and smaller standard deviation, as demonstrated in simulations with different signal-to-noise ratio. Pyruvate dose effects observed previously were confirmed and quantified through metabolic conversion rate values. Parameter interdependency allowed an accurate quantification and can therefore be useful for monitoring metabolic activity in different tissues
7 CFR 1942.117 - General requirements.
2010-01-01
... § 1942.117 General requirements. (a) Reserve requirements. Loans under this subpart are subject to the... 7 Agriculture 13 2010-01-01 2009-01-01 true General requirements. 1942.117 Section 1942.117 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS...
International Nuclear Information System (INIS)
Gopher, A.; Lapidot, A.; Vaisman, N.; Mandel, H.
1990-01-01
An inborn deficiency in the ability of aldolase B to split fructose 1-phosphate is found in humans with hereditary fructose intolerance (HFI). A stable isotope procedure to elucidate the mechanism of conversion of fructose to glucose in normal children and in HFI children has been developed. A constant infusion of D-[U- 13 C]fructose was given nasogastrically to control and to HFI children. Hepatic fructose conversion to glucose was estimated by examination of 13 C NMR spectra of plasma glucose. Significantly lower values (∼3-fold) for fructose conversion to glucose were obtained for the HFI patients as compared to the controls. A quantitative determination of the metabolic pathways of fructose conversion to glucose was derived from 13 C NMR measurement of plasma [ 13 C]glucose isotopomer populations. The finding of isotopomer populations of three adjacent 13 C atoms at glucose C-4 ( 13 C 3 - 13 C 4 - 13 C 5 ) suggests that there is a direct pathway from fructose, by-passing fructose-1-phosphate aldolase, to fructose 1,6-bisphosphate. The metabolism of fructose by fructose-1-phosphate aldolase activity accounts for only ∼50% of the total amount of hepatic fructose conversion to glucose. In view of the marked decline by 67% in synthesis of glucose from fructose in HFI subjects found in this study, the extent of [ 13 C]glucose formation from a trace amount of [U- 13 C]fructose infused into the patient can be used as a safe and noninvasive diagnostic test for inherent faulty fructose metabolism
Directory of Open Access Journals (Sweden)
Alicia Pérez-González
Full Text Available hCLE/C14orf166 is a nuclear and cytoplasmic protein that interacts with the RNAP II, modulates nuclear RNA metabolism and is present in cytoplasmic RNA granules involved in localized translation. Here we have studied whether hCLE shares common interactors in the nucleus and the cytosol, which could shed light on its participation in the sequential phases of RNA metabolism. Nuclear and cytoplasmic purified hCLE-associated factors were identified and proteins involved in mRNA metabolism, motor-related proteins, cytoskeletal and translation-related factors were found. Purified hCLE complexes also contain RNAs and as expected some hCLE-interacting proteins (DDX1, HSPC117, FAM98B were found both in the nucleus and the cytoplasm. Moreover, endogenous hCLE fractionates in protein complexes together with DDX1, HSPC117 and FAM98B and silencing of hCLE down-regulates their nuclear and cytosolic accumulation levels. Using a photoactivatable hCLE-GFP protein, nuclear import and export of hCLE was observed indicating that hCLE is a shuttling protein. Interestingly, hCLE nuclear import required active transcription, as did the import of DDX1, HSPC117 and FAM98B proteins. The data indicate that hCLE probably as a complex with DDX1, HSPC117 and FAM98B shuttles between the nucleus and the cytoplasm transporting RNAs suggesting that this complex has a prominent role on nuclear and cytoplasmic RNA fate.
Potapov, A.; Sánchez-Monge, Á.; Schilke, P.; Graf, U. U.; Möller, Th.; Schlemmer, S.
2016-10-01
Context. Almost 200 different species have been detected in the interstellar medium (ISM) during the last decades, revealing not only simple species but complex molecules with more than six atoms. Other exotic compounds, like the weakly-bound dimer (H2)2, have also been detected in astronomical sources like Jupiter. Aims: We aim to detect, for the first time, the CO-H2 van der Waals complex in the ISM, which could be a sensitive indicator for low temperatures if detected. Methods: We used the IRAM 30 m telescope, located in Pico Veleta (Spain), to search for the CO-H2 complex in a cold, dense core in TMC-1C (with a temperature of ~10 K). All the brightest CO-H2 transitions in the 3 mm (80-110 GHz) band were observed with a spectral resolution of 0.5-0.7 km s-1, reaching a rms noise level of ~2 mK. The simultaneous observation of a broad frequency band, 16 GHz, allowed us to conduct a serendipitous spectral line survey. Results: We did not detected any lines belonging to the CO-H2 complex. We set up a new, more stringent upper limit for its abundance to be [CO-H2]/[CO] ~ 5 × 10-6, while we expect the abundance of the complex to be in the range ~10-8-10-3. The spectral line survey has allowed us to detect 75 lines associated with 41 different species (including isotopologues). We detect a number of complex organic species, for example methyl cyanide (CH3CN), methanol (CH3OH), propyne (CH3CCH), and ketene (CH2CO), associated with cold gas (excitation temperatures ~7 K), confirming the presence of these complex species not only in warm objects but also in cold regimes. Based on observations carried out with the IRAM 30 m Telescope. IRAM is supported by INSU/CNRS (France), MPG (Germany) and IGN (Spain).Reduced spectra (FITS files) are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/594/A117
Energy Technology Data Exchange (ETDEWEB)
Hassel, B
1995-11-01
The present investigations show the feasibility of analyzing the cerebral metabolism of amino acids and related metabolites by {sup 13}C-and {sup 14}C-labelling using labelled acetate and glucose as markers for glial and neuronal metabolism, respectively. Using [{sup 13}C]acetate, it was shown that glial cells export {approx}60% of their TCA cycle intermediates, mostly as glutamine, and that this glutamine is used by neurons partly as an energy reserve, and partly it is converted directly to glutamate and GABA. Using [{sup 13}C]glucose, the glial process or pyruvate carboxylation was shown to compensate fully for the loss of glutamine. The mechanism of action of two neurotoxins, fluorocitrate and 3-nitropropionate was elucidated. The latter toxin was shown to inhibit the TCA cycle of GABAergic neurons selectively. Formation of pyruvate and lactate from glial TCA cycle intermediates was demonstrated in vivo. This pathway may be important for glial inactivation of transmitter glutamate and GABA. The results illustrate glianeuronal interactions, and they suggest the applicability of {sup 13}CNMR spectroscopy to the detailed study of the cerebral metabolism of amino acids in the intact, unanesthetized human brain. 174 refs.
Moran, Nancy E.; Rogers, Randy B.; Lu, Chi-Hua; Conlon, Lauren E.; Lila, Mary Ann; Clinton, Steven K.; Erdman, John W.
2013-01-01
While putative disease-preventing lycopene metabolites are found in both tomato (Solanum lycopersicum) products and in their consumers, mammalian lycopene metabolism is poorly understood. Advances in tomato cell culturing techniques offer an economical tool for generation of highly-enriched 13C-lycopene for human bioavailability and metabolism studies. To enhance the 13C-enrichment and yields of labeled lycopene from the hp-1 tomato cell line, cultures were first grown in 13C-glucose media for three serial batches and produced increasing proportions of uniformly labeled lycopene (14.3 +/− 1.2 %, 39.6 +/− 0.5 %, and 48.9 +/− 1.5% with consistent yields (from 5.8 to 9 mg/L). An optimized 9-day-long 13C-loading and 18-day-long labeling strategy developed based on glucose utilization and lycopene yields, yielded 13C-lycopene with 93% 13C isotopic purity, and 55% of isotopomers were uniformly labeled. Furthermore, an optimized acetone and hexane extraction led to a four-fold increase in lycopene recovery from cultures compared to a standard extraction. PMID:23561155
Study of radiophytoremediation
Czech Academy of Sciences Publication Activity Database
Vaněk, Tomáš; Soudek, Petr; Tykva, Richard
2001-01-01
Roč. 13, č. 2 (2001), s. 117-121 ISSN 1120-4826 R&D Projects: GA AV ČR IAA6055902; GA AV ČR IBS4055014; GA MŠk OC 837.10 Institutional research plan: CEZ:AV0Z4055905 Keywords : bioremediation * phytoremediation Subject RIV: CE - Biochemistry Impact factor: 0.207, year: 2001
Immunohistochemistry of a choroidal melanoma: nestin, CD34 and CD117÷c-kit labeling.
Vrapciu, Alexandra Diana; Rusu, Mugurel Constantin; Voinea, Liliana Mary
2014-01-01
In a case of choroidal melanoma (CM) in a 70-year-old male patient, was firstly aimed at studying the processes of angiogenesis by use of nestin and CD34 antibodies. Anti-CD117÷c-kit antibodies were further considered for their progenitor cells specificity. Choroidal melanoma was histopathologically confirmed. Nestin-positive endothelia were found in the CM and the adjacent retina, but not in endothelia elsewhere in that eye. Nestin-positive non-pigmentary cells were found within the CM. Filopodia-projecting endothelial tip cells (ETCs), nestin- and CD34-positive were found in the CM. CD34-positive ETCs were also found in the iridial stroma. There were found two different immune patterns of the retinal Müller cells (MCs). They were nestin-positive in the retina adjacent to the tumor, but negative in any other part of retina. On the other hand, CD117÷c-kit antibodies labeled MCs as follows: (a) discontinuously, or continuously, in the retina adjacent to the CM; (b) only the inner segments of the MCs were labeled in the retina unrelated to the CM. While nestin could be a reliable marker for retinal damage, the CD117÷c-kit phenotype of MCs still needs further investigations. Antiangiogenic therapy appears as a good choice for tumor therapy.
Michnovicz, Michael R.
1997-06-01
A real-time executive has been implemented to control a high altitude pointing and tracking experiment. The track and mode controller (TMC) implements a table driven design, in which the track mode logic for a tracking mission is defined within a state transition diagram (STD). THe STD is implemented as a state transition table in the TMC software. Status Events trigger the state transitions in the STD. Each state, as it is entered, causes a number of processes to be activated within the system. As these processes propagate through the system, the status of key processes are monitored by the TMC, allowing further transitions within the STD. This architecture is implemented in real-time, using the vxWorks operating system. VxWorks message queues allow communication of status events from the Event Monitor task to the STD task. Process commands are propagated to the rest of the system processors by means of the SCRAMNet shared memory network. The system mode logic contained in the STD will autonomously sequence in acquisition, tracking and pointing system through an entire engagement sequence, starting with target detection and ending with aimpoint maintenance. Simulation results and lab test results will be presented to verify the mode controller. In addition to implementing the system mode logic with the STD, the TMC can process prerecorded time sequences of commands required during startup operations. It can also process single commands from the system operator. In this paper, the author presents (1) an overview, in which he describes the TMC architecture, the relationship of an end-to-end simulation to the flight software and the laboratory testing environment, (2) implementation details, including information on the vxWorks message queues and the SCRAMNet shared memory network, (3) simulation results and lab test results which verify the mode controller, and (4) plans for the future, specifically as to how this executive will expedite transition to a fully
Cheng, Jun; Shi, Wenxin; Zhang, Lanhe; Zhang, Ruijun
2017-09-01
A novel polyester thin film composite nanofiltration (NF) membrane was prepared by interfacial polymerization of pentaerythritol (PE) and trimesoyl chloride (TMC) on polyethersulfone (PES) supporting membrane. The performance of the polyester composite NF membrane was optimized by regulating the preparation parameters, including reaction time, pH of the aqueous phase solution, pentaerythritol concentration and TMC concentration. A series of characterization, including permeation experiments, attenuated total reflectance-fourier transform infrared spectroscopy (ATR-FTIR), scanning electron microscope (SEM), atomic force microscopy (AFM), zeta potential analyzer and chlorine resistance experiments, were employed to study the properties of the optimized membrane. The results showed that the optimized polyester composite NF membrane exhibited very high rejection of Na2SO4 (98.1%), but the water flux is relatively low (6.1 L/m2 h, 0.5 MPa, 25 °C). The order of salt rejections is Na2SO4 > MgSO4 > MgCl2 > NaCl, which indicated the membrane was negatively charged, just consistent with the membrane zeta potential results. After treating by NaClO solutions with different concentrations (100 ppm, 500 ppm, 1000 ppm, 2000 ppm, 3000 ppm) for 48 h, the results demonstrated that the polyester NF membrane had good chlorine resistance. Additionally, the polyester TFC NF membrane exhibits good long-term stability.
48 CFR 217.207 - Exercise of options.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Exercise of options. 217..., DEPARTMENT OF DEFENSE CONTRACTING METHODS AND CONTRACT TYPES SPECIAL CONTRACTING METHODS Options 217.207 Exercise of options. (c) In addition to the requirements at FAR 17.207(c), exercise an option only after...
International Nuclear Information System (INIS)
Kalderon, B.; Korman, S.H.; Gutman, A.; Lapidot, A.
1989-01-01
A stable isotope procedure to estimate hepatic glucose carbon recycling and thereby elucidate the mechanism by which glucose is produced in patients lacking glucose 6-phosphatase is described. A total of 10 studies was performed in children with glycogen storage disease type I (GSD-I) and type III (GSD-III) and control subjects. A primed dose-constant nasogastric infusion of D-[U- 13 C]glucose or an infusion diluted with nonlabeled glucose solution was administered following different periods of fasting. Hepatic glucose carbon recycling was estimated from 13 C NMR spectra. The values obtained for GSD-I patients coincided with the standard [U- 13 C]glucose dilution curve. These results indicate that the plasma glucose of GSD-I subjects comprises only a mixture of 99% 13 C-enriched D-[U- 13 C]glucose and unlabeled glucose but lacks any recycled glucose. Significantly different glucose carbon recycling values were obtained for two GSD-III patients in comparison to GSD-I patients. The results eliminate a mechanism for glucose production in GSD-I children involving gluconeogenesis. However, glucose release by amylo-1,6-glucosidase activity would result in endogenous glucose production of non- 13 C-labeled and nonrecycled glucose carbon, as was found in this study. In GSD-III patients gluconeogenesis is suggested as the major route for endogenous glucose synthesis. The contribution of the triose-phosphate pathway in these patients has been determined
Energy Technology Data Exchange (ETDEWEB)
Chaintreau, Alain; Fieber, Wolfgang; Sommer, Horst [Firmenich SA, Corporate R and D Division, P.O. Box 239, 1211 Geneva 8 (Switzerland); Gilbert, Alexis; Yamada, Keita [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Yoshida, Naohiro [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth-Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Pagelot, Alain [Bruker Biospin SAS, 34 rue de l‘Industrie, 67166 Wissembourg Cedex (France); Moskau, Detlef; Moreno, Aitor [Bruker Biospin AG, Industriestrasse 26, 8117 Fällanden (Switzerland); Schleucher, Jürgen [Department of Medical Biochemistry and Biophysics, Umeå University, S-90187 Umeå (Sweden); Reniero, Fabiano; Holland, Margaret; Guillou, Claude [European Commission, Joint Research Centre – Institute for Health and Consumer Protection, via E. Fermi 2749, I-21027 Ispra (Italy); Silvestre, Virginie; Akoka, Serge [EBSI team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 rue de la Houssinière, BP 92208, F-44322 Nantes cedex 3 (France); Remaud, Gérald S., E-mail: gerald.remaud@univ-nantes.fr [EBSI team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 rue de la Houssinière, BP 92208, F-44322 Nantes cedex 3 (France)
2013-07-25
Graphical abstract: -- Highlights: •First ring test on isotopic {sup 13}C NMR spectrometry. •Evaluation of the intra- and inter-variability of the NMR spectrometers used. •Definition of a protocol for qualification of the performance of the spectrometer. -- Abstract: Isotopic {sup 13}C NMR spectrometry, which is able to measure intra-molecular {sup 13}C composition, is of emerging demand because of the new information provided by the {sup 13}C site-specific content of a given molecule. A systematic evaluation of instrumental behaviour is of importance to envisage isotopic {sup 13}C NMR as a routine tool. This paper describes the first collaborative study of intra-molecular {sup 13}C composition by NMR. The main goals of the ring test were to establish intra- and inter-variability of the spectrometer response. Eight instruments with different configuration were retained for the exercise on the basis of a qualification test. Reproducibility at the natural abundance of isotopic {sup 13}C NMR was then assessed on vanillin from three different origins associated with specific δ{sup 13}C{sub i} profiles. The standard deviation was, on average, between 0.9 and 1.2‰ for intra-variability. The highest standard deviation for inter-variability was 2.1‰. This is significantly higher than the internal precision but could be considered good in respect of a first ring test on a new analytical method. The standard deviation of δ{sup 13}C{sub i} in vanillin was not homogeneous over the eight carbons, with no trend either for the carbon position or for the configuration of the spectrometer. However, since the repeatability for each instrument was satisfactory, correction factors for each carbon in vanillin could be calculated to harmonize the results.
46 CFR 117.200 - Survival craft-general.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on a... craft they replace. (c) A summary of survival craft requirements is provided in Table 117.200(c). Table...
In vivo 13C MRS studies of carbohydrate metabolism
International Nuclear Information System (INIS)
Halliday, Jane
2003-01-01
The work described in this thesis was performed by the author, except where indicated, within the Magnetic Resonance Centre at the University of Nottingham during the period between October 1999 and October 2002. Although much is known about the major pathways of carbohydrate metabolism, there is still much to be learnt about the exact mechanisms of many of these pathways. Of particular interest is how these pathways are modified under different physiological conditions and in diseased states. 13 C NMR spectroscopy provides a non-invasive means for studying carbohydrate metabolism in vivo, and the work presented within this thesis gives two such examples of this in human subjects. Natural abundance 13 C NMR spectroscopy was used to measure glycogen levels in gastrocnemius muscle. The diurnal changes in response to mixed meals were measured in both type 2 diabetic subjects and age and weight matched controls. Metabolic studies were performed to complement the NMR measurements. The data obtained in these studies show the effect of the failure of muscle glucose storage upon post-prandial hyperglycaemia despite a supra-normal increase in plasma insulin in type 2 diabetes. 13 C NMR spectroscopy was also used to study cerebral metabolism. Accumulation of 13 C label into glutamate and glutamine following infusion of [1 1 3 C] glucose allows the determination of the rates of the TCA cycle (F TCA ) and neurotransmitter cycling (F cyc ). These rates were measured in the visual cortex under control and activated conditions. The increases seen in F TCA upon activation, together with the lack of label accumulation in lactate, suggest that cerebral glucose metabolism is oxidative, even during strong activation. No conclusion can be made as to whether or not a similar increase is seen in F cyc due to the large associated errors in these values. (author)
30 CFR 250.207 - What ancillary activities may I conduct?
2010-07-01
... surveys; or (c) Studies that model potential oil and hazardous substance spills, drilling muds and... 30 Mineral Resources 2 2010-07-01 2010-07-01 false What ancillary activities may I conduct? 250.207 Section 250.207 Mineral Resources MINERALS MANAGEMENT SERVICE, DEPARTMENT OF THE INTERIOR OFFSHORE...
Energy Technology Data Exchange (ETDEWEB)
Shcherbakov, V.V.; Krivdin, L.B.; Kalabin, G.A.; Trofimov, B.A.
1986-11-20
The authors have previously established that the direct /sup 13/C-/sup 13/C coupling constants are stereospecific relative to the orientation of unshared electron pairs (UEP) of nitrogen and oxygen atoms. Here they show that the nitrogen UEP produces a positive contribution to the direct /sup 13/C-/sup 13/C coupling constant of an adjacent syn-periplanar carbon-carbon bond and not to a negative contribution of the corresponding constant of the anti-periplanar bond. Thus, the observed effect is not a consequence of the interaction of the heteroatom UEP with the anti-bonding orbital of the adjacent anti-periplanar bond (n/sub o-o/* interaction) as in the case of anomeric and related effects.
Yield and enrichment studies of C-13 isotope by multi-photon ...
Indian Academy of Sciences (India)
Abstract. Multi-photon dissociation of Freon-22 (CF2HCl) at low temperatures has been carried out to separate the C-13 isotope using a TEA CO2 laser. Yield and enrichment of C-13 isotope in the product C2F4 are studied at 9P(22) laser line as a function of temperature (–50°C to 30°C). It is observed that at a given fluence ...
Kwon, Yun; Park, Sunghyouk; Shin, Jongheon; Oh, Dong-Chan
2014-08-01
The elucidation of the structures of complex natural products bearing many quaternary carbons remains challenging, even in this advanced spectroscopic era. (13)C-(13)C COSY NMR spectroscopy shows direct couplings between (13)C and (13)C, which comprise the backbone of a natural product. Thus, this type of experiment is particularly useful for natural products bearing consecutive quaternary carbons. However, the low sensitivity of (13)C-based NMR experiments, due to the low natural abundance of the (13)C nucleus, is problematic when applying these techniques. Our efforts in the (13)C labeling of a microbial natural product, cyclopiazonic acid (1), by feeding (13)C-labeled glucose to the fungal culture, enabled us to acquire (13)C-(13)C COSY NMR spectra on a milligram scale that clearly show the carbon backbone of the compound. This is the first application of (13)C-(13)C COSY NMR experiments for a natural product. The results suggest that (13)C-(13)C COSY NMR spectroscopy can be routinely used for the structure determination of microbial natural products by (13)C-enrichment of a compound with (13)C-glucose.
13C and 31P NMR studies of myocardial metabolism
International Nuclear Information System (INIS)
Laughlin, M.R.
1988-01-01
The fluxes through two enzyme systems have been measured in perfused or in in vivo heart using NMR: phosphocreatine kinase, and glycogen synthase and phosphorylase. The rates of synthesis and degradation of glycogen were monitored in vivo in fed, fasted, and diabetic rat heart during infusions of 13 C-1-glucose and insulin using proton-decoupled 13 C-NMR at 1.9 and 4.7 tesla. The enzyme activities of glycogen synthase and glycogen phosphorylase were also measured in this tissue which had been freeze clamped at the end of the experiment, for comparison with the synthetic rates. For normal fed, fasted, and diabetic animals, synthesis rates were 0.28, 0.16, and 0.15 μmol/min.gww respectively. Glycogen synthase i activity was 0.23, 0.14, and 0.14 μmol/min.gww in these hearts at the end of the experiment, when measured at appropriate substrate and activator concentrations, and follow activation time courses that are consistent with being the main rate determinant for net synthesis in all cases. Turnover of glycogen was studied by observing the preformed 13 C-1-glycogen signal during infusion of 12 C-glucose and insulin, and was found to be close to zero. Extracted phosphorylase a activity was approximately ten times that of synthase i under these circumstances. In order to fully interpret the turnover studies, glycogenolysis of preformed 13 C-glycogen was observed after a bolus of glucagon. The glycogen had either been synthesized from 13 C-1-glucose for a single hour, or during an hour of 13 C-glucose and a subsequent hour of 12 C-glucose infusion. The author observed that breakdown follows an exponential time course related to the phosphorylase a activation state and that the last synthesized glycogen breaks down at the rate of 2.5 μmol/min.gww, five times faster than that synthesized an hour earlier
International Nuclear Information System (INIS)
Porwoll, J.P.; Leete, E.
1985-01-01
Potential advanced intermediates in the biosynthesis of delta 9 -tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous 13 C atoms and 14 C. Methyl [5,6- 13 C 2 , 1- 14 C]olivetolate was prepared from lithium [ 13 C 2 ]acetylide and dimethyl [2- 14 C]malonate. Reaction with geranyl bromide afforded methyl [5,6- 13 C 2 , 1- 14 C]cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The 13 C- 13 C couplings observable in the 13 C NMR spectra of these 13 C-enriched compounds and their synthetic precursors are recorded. Methyl [1'- 14 C]olivetolate was prepared from 13 CO 2 to confirm assignments of the 13 C chemical shifts in the pentyl side chain of these compounds. (author)
In vivo {sup 13}C MRS studies of carbohydrate metabolism
Energy Technology Data Exchange (ETDEWEB)
Halliday, Jane
2003-07-01
The work described in this thesis was performed by the author, except where indicated, within the Magnetic Resonance Centre at the University of Nottingham during the period between October 1999 and October 2002. Although much is known about the major pathways of carbohydrate metabolism, there is still much to be learnt about the exact mechanisms of many of these pathways. Of particular interest is how these pathways are modified under different physiological conditions and in diseased states. {sup 13}C NMR spectroscopy provides a non-invasive means for studying carbohydrate metabolism in vivo, and the work presented within this thesis gives two such examples of this in human subjects. Natural abundance {sup 13}C NMR spectroscopy was used to measure glycogen levels in gastrocnemius muscle. The diurnal changes in response to mixed meals were measured in both type 2 diabetic subjects and age and weight matched controls. Metabolic studies were performed to complement the NMR measurements. The data obtained in these studies show the effect of the failure of muscle glucose storage upon post-prandial hyperglycaemia despite a supra-normal increase in plasma insulin in type 2 diabetes. {sup 13}C NMR spectroscopy was also used to study cerebral metabolism. Accumulation of {sup 13}C label into glutamate and glutamine following infusion of [1{sup 13}C] glucose allows the determination of the rates of the TCA cycle (F{sub TCA}) and neurotransmitter cycling (F{sub cyc}). These rates were measured in the visual cortex under control and activated conditions. The increases seen in F{sub TCA} upon activation, together with the lack of label accumulation in lactate, suggest that cerebral glucose metabolism is oxidative, even during strong activation. No conclusion can be made as to whether or not a similar increase is seen in F{sub cyc} due to the large associated errors in these values. (author)
Meshitsuka, Shunsuke; Aremu, David A
2008-02-01
Citrate has been identified as a major tricarboxylic acid (TCA) cycle constituent preferentially released by astrocytes. We undertook the present study to examine further the nature of metabolic compartmentation in central nervous system tissues using (13)C-labeled glucose and to provide new information on the influence of aluminum on the metabolic interaction between neurons and astrocytes. Metabolites released into the culture medium from astrocytes and neuron-astrocyte coculture, as well as the perchloric acid extracts of the cells were analyzed using 2D (1)H and (13)C NMR spectroscopy. Astrocytes released citrate into the culture medium and the released citrate was consumed by neurons in coculture. Citrate release by astrocytes was blocked in the presence of aluminum, with progressive accumulation of citrate within the cells. We propose citrate supply is a more efficient energy source than lactate for neurons to produce ATP, especially in the hypoglycemic state on account of it being a direct component of the TCA cycle. Astrocytes may be the cellular compartment for aluminum accumulation as a citrate complex in the brain.
International Nuclear Information System (INIS)
Yang, Rong; Wang, Liqing; Deng, Kunfa; Lv, Mengni; Xu, Yunhua
2016-01-01
The novel Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C has been successfully synthesized by a feasible solution process in ternary system. The spherical carbon-coated composites are obtained using a heat treatment in the presence of sucrose. X-ray diffraction (XRD) diffractogram displays that the Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C crystallized in an orthorhombic structure with a space group of Pmn21. The energy-dispersive X-ray spectroscopy mappings indicate that Fe, Mn and Ni elements are distributed homogenously in Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C nano-spherical particle with size less than 50 nm. The lithium storage capacity and cycling performance of the Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C presents good results when tested as cathode materials in lithium cells at room temperature. It delivers an initial discharge capacity of 181.4 mAh g"−"1 and a discharge capacity of 172.9 mAh g"−"1 after 20 cycles at 0.1C in the voltage range of 1.5–4.6V. Furthermore, it also exhibits an excellent rate capability with a capacity under different current densities of about 144.0 mAh g"−"1 (0.2 C), 117.9 mAh g"−"1 (0.5 C), 106.1 mAh g"−"1 (1 C), respectively and a good capacity cycling maintenance of 153.7 mAh g"−"1 after 60 cycles. Above results indicate that the spherical Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C becomes a very promising candidate for cathode material in lithium-ion batteries. - Highlights: • Li_2Fe_1_/_3Mn_1_/_3Ni_1_/_3SiO_4/C was obtained by solution process in a ternary system. • The material was pure phase ternary solid solution with tetrahedral morphology. • The spherical particle size was less than 50 nm with graphitized carbon coating. • The nanocomposite revealed high discharge capacity and excellent rate capability.
Unexpected relationships between δ13C and wine grape performance in organic farming
Directory of Open Access Journals (Sweden)
Edoardo Antonio Costantino Costantini
2013-12-01
Significance and impact of the study: Water nutrition is crucial for wine grape performance. δ13C is a method used to assess vine water status during the growing season and to estimate vine performance. A good performance is expected at moderate stress and intermediate δ13C values. A better knowledge of the interaction between water and nutrient scarcity is needed, as it can affect the use of δ13C to predict vine performance.
International Nuclear Information System (INIS)
London, R.E.; Groff, J.P.; Cocco, L.; Blakley, R.L.
1982-01-01
Dihydrofolate reductase from Streptococcus faecium has been labeled with [#betta#- 13 C]tryptophan. We have determined changes occurring in the chemical shifts and line widths of the four resonances of the 13 C NMR spectrum of the labeled enzyme, due to its interaction with various ligands. These include the coenzyme, NPDPH and related nucleotides, folate and its polyglutamate derivatives, and many inhibitors including methotrexate and trimethoprim. In addition, paramagnetic relaxation effects produced by a bound spin-labeled analogue of 2'-phosphoadenosine-5'-diphosphoribose on the tryptophan C/sup #betta#/ carbons have been measured. Distances calculated from the relaxation data have been compared with corresponding distances in the crystallographic model of the NADPH-methotrexate ternary complex of Lactobacillus casei reductase. The paramagnetic relaxation data indicate that the two downfield resonances (1 and 2) correspond to tryptophans (W/sub A/ and W/sub B/) that are more remote from the catalytic site, and from the crystallographic model these are seen to be Trp-115 and Trp-160. The upfield resonances (3 and 4) that show broadening due to chemical exchange correspond to closer residues (W/sub C/ and W/sub D/), and these are identified with Trp-6 and Trp-22. However, the relaxation data do not permit specific assignments within the nearer and farther pairs. Although resonance 3, which is split due to chemical exchange, was formerly assigned to Trp-6, data obtained for the enzyme in the presence of various ligands are better interpreted if resonance 3 is assigned to Trp-22, which is located on a loop that joins elements of secondary structure and forms one side of the ligand-binding cavity
International Nuclear Information System (INIS)
Cohen, S.M.
1987-01-01
The metabolism of 13 C-labeled substrates was followed by 13 C and 31 P NMR in perfused liver from the streptozotocin-treated rat model of insulin-dependent diabetes. Comparison was made with perfused liver from untreated littermates, fasted either 24 or 12 h. The major routes of pyruvate metabolism were followed by a 13 C NMR approach that provided for the determination of the metabolic fate of several substances simultaneously. The rate of gluconeogenesis was 2-4-fold greater and β-hydroxybutyrate production was 50% greater in liver from the chronically diabetic rats as compared with the control groups. Large differences in the distribution of 13 C label in hepatic alanine were measured between diabetic and control groups. The biosyntheses of 13 C-labeled glutathione and N-carbamoylaspartate were monitored in time-resolved 13 C NMR spectra of perfused liver. Assignments for the resonances of glutathione and N-carbamoylaspartate were made with the aid of 13 C NMR studies of perchloric acid extracts of the freeze-clamped livers. 13 C NMR spectroscopy of the perfusates provided a convenient, rapid assay of the rate of oxidation of [2- 13 C]ethanol, the hepatic output of [2- 13 ]acetaldehyde, and the accumulation of [2- 13 C]acetate in the perfusate. By 31 P NMR spectroscopy, carbamoyl phosphate was measured in all diabetic livers and an unusual P,P'-diesterified pyrophosphate was observed in one-fourth of the diabetic livers examined. Neither of these phosphorylated metabolites was detected in control liver. Both 13 C and 31 P NMR were useful in defining changes in hepatic metabolism in experimental diabetes
33 CFR 117.825 - Newport River.
2010-07-01
... the Atlantic and East Carolina Railway bridge, mile 13.0 at Newport, need not be opened for the... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Newport River. 117.825 Section 117.825 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES...
Novak, Brian; Astete, Carlos; Sabliov, Cristina; Moldovan, Dorel
2012-02-01
Poly(lactic-co-glycolic acid) (PLGA) is a biodegradable polymer. Nanoparticles of PLGA are commonly used for drug delivery applications. The interaction of the nanoparticles with the cell membrane may influence the rate of their uptake by cells. Both PLGA and cell membranes are negatively charged, so adding positively charged polymers such as trimethyl chitosan (TMC) which adheres to the PLGA particles improves their cellular uptake. The interaction of 3 nm PLGA and TMC-modified-PLGA nanoparticles with lipid bilayers composed of mixtures of phosphatidylcholine and phosphatidylserine lipids was studied using molecular dynamics simulations. The free energy profiles as function of nanoparticles position along the normal direction to the bilayers were calculated, the distribution of phosphatidylserine lipids as a function of distance of the particle from the bilayer was calculated, and the time scale for particle motion in the directions parallel to the bilayer surface was estimated.
(13)C MR spectroscopy study of lactate as substrate for rat brain.
Qu, H; Håberg, A; Haraldseth, O; Unsgård, G; Sonnewald, U
2000-01-01
In order to address the question whether lactate in blood can serve as a precursor for cerebral metabolites, fully awake rats were injected intravenously with [U-(13)C]lactate or [U-(13)C]glucose followed 15 min later by decapitation. Incorporation of label from [U-(13)C]glucose was seen mainly in glutamate, GABA, glutamine, aspartate, alanine and lactate. More label was found in glutamate than glutamine, underscoring the predominantly neuronal metabolism of pyruvate from [U-(13)C]glucose. It was estimated that the neuronal metabolism of acetyl CoA from glucose accounts for at least 66% and the glial for no more than 34% of the total glucose consumption. When [U-(13)C]lactate was the precursor, label incorporation was similar to that observed from [U-(13)C]glucose, but much reduced. Plasma analysis revealed the presence of approximately equal amounts of [1,2,3-(13)C]- and [1,2-(13)C]glucose, showing gluconeogenesis from [U-(13)C]lactate. It was thus possible that the labeling seen in the cerebral amino acids originated from labeled glucose, not [U-(13)C]lactate. However, the presence of significantly more label in [U-(13)C]- than in [2,3-(13)C]alanine demonstrated that [U-(13)C]lactate did indeed cross the blood-brain barrier, and was metabolized further in the brain. Furthermore, contributions from pyruvate carboxylase (glial enzyme) were detectable in glutamine, glutamate and GABA, and were comparatively more pronounced in the glucose group. This indicated that relatively more pyruvate from lactate than glucose was metabolized in neurons. Surprisingly, the same amount of lactate was synthesized via the tricarboxylic acid cycle in both groups, indicating transfer of neurotransmitters from the neuronal to the astrocytic compartment, as previous studies have shown that this lactate is synthesized primarily in astrocytes. Taking into consideration that astrocytes take up glutamate more avidly than GABA, it is conceivable that neuronal lactate metabolism was more
GPCR Interaction: 207 [GRIPDB[Archive
Lifescience Database Archive (English)
Full Text Available LP2) and secretin (SecR), and interfaces of GLP2 B Glucagon-like peptide Type 2 GLP2 C Secretin ... SecR Experi...ment SecR does not interact with CTR (calcitonin receptor). 18401761 BRET, FRET NP_004237.1 ...
Substitution effect in nuclear magnetic resonance of C-13: α methoxicyclohexanones
International Nuclear Information System (INIS)
Lopez Holland, M.A.G.
1984-01-01
Eletronic and steric interactions between the carbonyl and methoxyl groups in α-methoxicyclohexanones by H-1 and C-13 nuclear magnetic resonance spectroscopy (n.m.r) is studied. Interpretation of H-1 n.m.r measurements based on the carbonyl group anisotropy is made. The asigment of spectral lines to specific nuclear by Lanthanide Shift Reagent Experiments is confirmed. Interpretation of C-13 n.m.r. spectra with respect to molecular effects and emphirical relationships associated with the substituent was analysed. The C-13 chemical shift asignment by comparison with results of partially (SFORD) and fully decompled spectra and also by relating the measured chemical shift with values cited in the literature for similar compounds are made. A qualitative study using I.R. spectroscopy in attempt to evaluate the predominance of one the conformers of the studied compounds in solutions of n-hexan and chloroform is made. (M.J.C.) [pt
CERN PhotoLab
1976-01-01
The photo shows the fast electronics racks of the experiment R207 by the CERN-Holland-Manchester Collaboration. R207 aimed at the study of diffraction dissociation and formation at small momentum transfers. Gerjan Bobbink and Alan Rudge stand in front of the racks.
Li, Shao-jia; Yin, Xue-ren; Xie, Xiu-lan; Allan, Andrew C; Ge, Hang; Shen, Shu-ling; Chen, Kun-song
2016-02-03
Organic acids are essential to fruit flavor. The vacuolar H(+) transporting adenosine triphosphatase (V-ATPase) plays an important role in organic acid transport and accumulation. However, less is known of V-ATPase interacting proteins and their relationship with organic acid accumulation. The relationship between V-ATPase and citric acid was investigated, using the citrus tangerine varieties 'Ordinary Ponkan (OPK)' and an early maturing mutant 'Zaoshu Ponkan (ZPK)'. Five V-ATPase genes (CitVHA) were predicted as important to citric acid accumulation. Among the genes, CitVHA-c4 was observed, using a yeast two-hybrid screen, to interact at the protein level with an ethylene response factor, CitERF13. This was verified using bimolecular fluorescence complementation assays. A similar interaction was also observed between Arabidopsis AtERF017 (a CitERF13 homolog) and AtVHA-c4 (a CitVHA-c4 homolog). A synergistic effect on citric acid levels was observed between V-ATPase proteins and interacting ERFs when analyzed using transient over-expression in tobacco and Arabidopsis mutants. Furthermore, the transcript abundance of CitERF13 was concomitant with CitVHA-c4. CitERF13 or AtERF017 over-expression leads to significant citric acid accumulation. This accumulation was abolished in an AtVHA-c4 mutant background. ERF-VHA interactions appear to be involved in citric acid accumulation, which was observed in both citrus and Arabidopsis.
Diagnostic value of CD117 in differential diagnosis of acute leukemias.
Ahmadi, Abbas; Poorfathollah, Ali-Akbar; Aghaiipour, Mahnaz; Rezaei, Mansour; Nikoo-ghoftar, Mahin; Abdi, Mohammad; Gharib, Alireza; Amini, Amir
2014-07-01
C-kit receptor (CD117) and its ligand, stem cell factor, play a key role in normal hematopoiesis. It has been demonstrated that its expression extremely increases in leukemias with myeloid commitment. We analyzed findings on CD117 expression together with other myeloid related markers in 203 de novo acute leukemias, referred to Iranian immunophenotyping centers: Iranian Blood Transfusion Organization (IBTO) and Baghiatallah Hospital (BH). All cases were characterized based on the French American British cooperative group (FAB) and European Group for Immunological Classification of Leukemias (EGIL). The cases comprised of 111 acute myeloblastic leukemia (AML), 86 acute lymphoblastic leukemia (ALL), and 6 acute undifferentiated leukemia (AUL). CD117 was positive in 75 % of AML and 50 % of AUL, whereas none of the ALL cases was positive for this marker. Although CD117 was positive in 100 % of M5a cases, no M5b positive was found (p = 0.036). The calculated specificity for myeloid involvement was 100 % for CD117 and CD33, and 98 % for CD13 and CD15 (p acute leukemias.
Van Herrewege, Yven; Michiels, Jo; Van Roey, Jens; Fransen, Katrien; Kestens, Luc; Balzarini, Jan; Lewi, Paul; Vanham, Guido; Janssen, Paul
2004-01-01
The nonnucleoside reverse transcriptase inhibitors UC-781 and TMC120-R147681 (Dapivirine) effectively prevented human immunodeficiency virus (HIV) infection in cocultures of monocyte-derived dendritic cells and T cells, representing primary targets in sexual transmission. Both drugs had a favorable therapeutic index. A 24-h treatment with 1,000 nM UC-781 or 100 nM TMC120-R147681 prevented cell-free HIV infection, whereas 10-fold-higher concentrations blocked cell-associated HIV. PMID:14693562
Li, Ningzhi; Li, Shizhe; Shen, Jun
2017-06-01
In vivo 13C magnetic resonance spectroscopy (MRS) is a unique and effective tool for studying dynamic human brain metabolism and the cycling of neurotransmitters. One of the major technical challenges for in vivo 13C-MRS is the high radio frequency (RF) power necessary for heteronuclear decoupling. In the common practice of in vivo 13C-MRS, alkanyl carbons are detected in the spectra range of 10-65ppm. The amplitude of decoupling pulses has to be significantly greater than the large one-bond 1H-13C scalar coupling (1JCH=125-145 Hz). Two main proton decoupling methods have been developed: broadband stochastic decoupling and coherent composite or adiabatic pulse decoupling (e.g., WALTZ); the latter is widely used because of its efficiency and superb performance under inhomogeneous B1 field. Because the RF power required for proton decoupling increases quadratically with field strength, in vivo 13C-MRS using coherent decoupling is often limited to low magnetic fields (protons via weak long-range 1H-13C scalar couplings, which can be decoupled using low RF power broadband stochastic decoupling. Recently, the carboxylic/amide 13C-MRS technique using low power random RF heteronuclear decoupling was safely applied to human brain studies at 7T. Here, we review the two major decoupling methods and the carboxylic/amide 13C-MRS with low power decoupling strategy. Further decreases in RF power deposition by frequency-domain windowing and time-domain random under-sampling are also discussed. Low RF power decoupling opens the possibility of performing in vivo 13C experiments of human brain at very high magnetic fields (such as 11.7T), where signal-to-noise ratio as well as spatial and temporal spectral resolution are more favorable than lower fields.
Study of 12C interactions at HISS
International Nuclear Information System (INIS)
Crawford, H.J.
1982-12-01
Single-particle inclusive measurements in high-energy nuclear physics have provided the foundation for a number of models of interacting nuclear fluids. Such measurements yield information on the endpoints of the evolution of highly excited nuclear systems. However, they suffer from the fact that observed particles can be formed in a large number of very different evolutionary paths. To learn more about how interactions proceed we have performed a series of experiments in which all fast nuclear fragments are analyzed for each individual interaction. These experiments were performed at the LBL Bevalac HISS (Heavy Ion Spectrometer System) facility where we studied the interaction of 1 GeV/nuc 12C nuclei with targets of C, CH 2 , Cu, and U. In this paper we describe HISS and present some preliminary results of the experiment
International Nuclear Information System (INIS)
Maskalick, D.G.
1984-01-01
It is expected that the internal motions of amino acid side chains and protein backbone segments influence and are in turn affected by charge-charge and related interactions, steric constraints, hydrophobic forces, and hydrogen bonding. As an initial test of this theory 13 C-enriched glycine, alanine, and isoleucine have been substituted for the amino terminal valine of sperm whale myoglobin using semisynthetic techniques. 13 C-NMR has been used to analyze the motions of the side chain and the protonation state of the alpha amino group as a function of pH. The addition of a single methyl group to the side chain can alter the alpha amino pK value by as much as 0.3 pH units indicating a delicately balanced set of change-charge interactions between the alpha amino group and the rest of the protein. Further evidence in support of the state theory was found upon examination of the internal motions of seven of nine isoleucine vectors. These motions were extracted from natural abundance 13 C-NMR relaxation data. The results suggest a strong possibility that concerted motions are important. Also, an increase in temperature from 32 0 C to 52 0 C leads to an electrostatically driven tightening of the myoglobin structure as evidenced by no significant increase in motion amplitude of most of the vectors
Hyperpolarized C-13 MRS Cardiac Metabolism Studies in Pigs
DEFF Research Database (Denmark)
Giovannetti, G.; Hartwig, V.; Frijia, F.
2012-01-01
Cardiac metabolism assessment with hyperpolarized 13C magnetic resonance spectroscopy in pig models requires the design of dedicated coils capable of providing large field of view with high signal-to-noise ratio (SNR) data. This work presents a comparison between a commercial 13C quadrature...
Han, Shiwen; Zou, Shiying; He, Xiaoyun; Huang, Kunlun; Mei, Xiaohong
2016-08-01
The food safety of stacked trait genetically modified (GM) maize GH5112E-117C containing insect-resistance gene Cry1Ah and glyphosate-resistant gene G2-aroA was evaluated in comparison to non-GM Hi-II maize fed to Sprague-Dawley rats during a 90-day subchronic feeding study. Three different dietary concentrations (12.5, 25 and 50 %, w/w) of the GM maize were used or its corresponding non-GM maize. No biologically significant differences in the animals' clinical signs, body weights, food consumption, hematology, clinical chemistry, organ weights and histopathology were found between the stacked trait GM maize groups, and the non-GM maize groups. The results of the 90-day subchronic feeding study demonstrated that the stacked trait GM maize GH5112E-117C is as safe as the conventional non-GM maize Hi-II.
International Nuclear Information System (INIS)
Slama, Nedra; Lazim, Hadeer; Barkallah, Insaf; Limam, Ferid
2008-01-01
A distinct streptomyces strains were isolated from Tunisian soil. the isolate designed CN207, was assigned to the genus streptomyces on the basis of morphological and chemotaxonomic criteria. A 16S rDNA sequence of the isolate was determined. Streptomyces sp CN207 secreted large amount antibiotic against gram positive bacteria, gram negative bacteria, yeast and fungi on his barley (HB) medium. (HB) medium was found to be suitable substrate of the medium for CN207 production. Maximum yield of CN207 product (700 mg/ml) after optimize fermentation process. Bioactive molecules from strain CN207 were extracted with ethyl acetate and analyzed by PTLC using silica gel plates.The separated compounds were visualiszed under UV at 254 nm and the active spots were detected by bioautography on silica gel plates using salmonella thyphimurium NRRL B4420 and Staphylococcus aureus CDC 103 as indicator microorganisms. The crude extract (8.36 g) was fractionated on Sep-pack column (C18 cartridge) and elution was performed using a discontinue gradient of methanol-water. Two active fractions eluted by 20% and 40% of methanol were obtained. The bioactive compounds were separated by preparative high performance liquid chromatography (HPLC) on a C18 reversed phase column and eluted with a linear gradient of acetonitrile -water in presence of 0.1% formic acid. The peaks were collected separately, concentrated and bioassayed against the routine indicator microorganisms. The absorption spectrum of the active molecules was determined with a shimadzu UV-160 a spectrophotometer. Determination of the chemical structure of these compounds on the basis on their IR, COSY and H 1: C13 is in progress
/sup 13/C(p vector,d)/sup 12/C and /sup 208/Pb(p vector,d)/sup 207/Pb reactions at 123 MeV
Energy Technology Data Exchange (ETDEWEB)
Kraushaar, J J; Shepard, J R [Colorado Univ., Boulder (USA). Nuclear Physics Lab.; Miller, D W; Jacobs, W W; Jones, W P; Devins, D W [Indiana Univ., Bloomington (USA). Dept. of Physics
1983-02-01
Cross-section and analyzing power angular distributions have been measured for /sup 13/C(p vector,d) and /sup 208/Pb(p vector, d) at 123 MeV to the strong low-lying residual states in both final nuclei. The data have been compared with the results of both zero- and exact-finite-range distorted wave calculations and some serious discrepancies were noted for the analyzing powers. For the case of the /sup 13/C calculations, marked improvement in the description of the data was achieved with the use of a damping factor in the nuclear interior.
Fourier spectroscopy of the 12C2, 13C2, and 12C13C (0-0) swan bands
International Nuclear Information System (INIS)
Amiot, C.
1983-01-01
The (0-0) band of the C 2 Swan electronic system d 3 Pi/sub g/→a 3 Pi/sub u/ has been recorded by Fourier spectroscopy. The three isotopes species 12 C 2 , 13 C 2 , and 12 C 13 C were investigated. The observed wavenumbers were reduced to molecular parameters using a nonlinear least-square fitting procedure. Well-known perturbations at N' = 47 and N' = 51 again observed in the e 12 C 2 d 3 Pi/sub g/ (v = 0) level. Perturbations of the same kind are present in the 13 C 2 spectrum at N' = 34 and N' = 44,48,52. The 12 C 13 C spectrum exhibits in the observed spectral range a unique perturbation for N' = 41
Directory of Open Access Journals (Sweden)
Aparna Ganapathy
Full Text Available Mutations in the autosomal genes TMPRSS3, TMC1, USHIC, CDH23 and TMIE are known to cause hereditary hearing loss. To study the contribution of these genes to autosomal recessive, non-syndromic hearing loss (ARNSHL in India, we examined 374 families with the disorder to identify potential mutations. We found four mutations in TMPRSS3, eight in TMC1, ten in USHIC, eight in CDH23 and three in TMIE. Of the 33 potentially pathogenic variants identified in these genes, 23 were new and the remaining have been previously reported. Collectively, mutations in these five genes contribute to about one-tenth of ARNSHL among the families examined. New mutations detected in this study extend the allelic heterogeneity of the genes and provide several additional variants for structure-function correlation studies. These findings have implications for early DNA-based detection of deafness and genetic counseling of affected families in the Indian subcontinent.
International Nuclear Information System (INIS)
Matwiyoff, N.A.; London, R.E.; Hutson, J.Y.
1982-01-01
Carbon-13 nuclear magnetic resonance spectroscopy, in conjunction with carbon-13 labeling, has become an important analytical technique for the study of biological systems and biologically important molecules. The growing list of its well established applications to isolated molecules in solution includes the investigation of: metabolic pathways; the microenvironments of ligands bound to proteins; the architecture and dynamics of macromolecules; the structures of coenzymes and other natural products; and the mechanisms of reactions. Recently interest has been reawakened in the use of the technique for the study of metabolic pathways and structural components in intact organelles, cells, and tissues. The promise and problems in the use of 13 C labeling in such investigations can be illustrated by the results on suspensions of the yeast, Candida utilis
International Nuclear Information System (INIS)
Hamilton, J.A.; Fujito, D.T.; Hammer, C.F.
1991-01-01
The weakly polar lipids cholesteryl ester, triacylglycerol, and diacylglycerol incorporate to a limited extent into the lamellar structure of small unilamellar vesicles. The localization of the carbonyl group(s) at the aqueous interface was detected by [ 13 C]carbonyl chemical shift changes relative to the neat unhydrated lipid. This study uses 13 C NMR to investigate the interactions of thes lipids with unsonicated (multilamellar) phosphatidylcholine, a model system for cellular membranes and surfaces of emulsion particles with low curvature. Magic angle spinning reduced the broad lines of the unsonicated dispersions to narrow lines comparable to those from sonicated dispersions. [ 13 C]Carbonyl chemical shifts revealed incorporation of the three lipids into the lamellar structure of the unsonicated phospholipids and a partial hydration of the carbonyl groups similar to that observed in small vesicles. Other properties of interfacial weakly polar lipids in multilayers were similar to those in small unilamellar bilayers. There is thus a general tendency of weakly polar lipids to incorparate at least to a small extent into the lamellar structure of phospholipids and take on interfacial properties that are distinct from their bulk-phase properties. This pool of surface-located lipid is likely to be directly involved in enzymatyic transformations and protein-mediated transport. The 13 C magic angle spinning NMR method may be generally useful for determining the orientation of molecules in model membranes
The interaction of M13 coat protein with lipid bilayers : a spectroscopic study
Sanders, J.C.
1992-01-01
In this thesis a small part of the reproductive cycle of the M13 bacteriophage is studied in more detail, namely the interaction of the major coat protein (MW 5240) with lipid bilayers. During the infection process is the major coat protein of M13 bacteriophage stored in the cytoplasm
Biosynthetic studies of the glycopeptide teicoplanin by 1H and 13C NMR
DEFF Research Database (Denmark)
Heydorn, Arne; Petersen, Bent O.; Duus, Jens Øllgaard
2000-01-01
The biosynthesis of the glycopeptide antibiotic teicoplanin was studied by growing a teicoplanin producing strain of Actinoplanes teichomyceticus (ATCC 31121) on glucose containing either 34.0% [1-13C]glucose or 9.7% [U- 13C]glucose. The fractional enrichment pattern of teicoplanin produced in th...
Electron-nuclear interaction in 13C nanotube double quantum dots
DEFF Research Database (Denmark)
Churchill, H O H; Bestwick, A J; Harlow, J W
2009-01-01
For coherent electron spins, hyperfine coupling to nuclei in the host material can either be a dominant source of unwanted spin decoherence or, if controlled effectively, a resource enabling storage and retrieval of quantum information. To investigate the effect of a controllable nuclear...... environment on the evolution of confined electron spins, we have fabricated and measured gate-defined double quantum dots with integrated charge sensors made from single-walled carbon nanotubes with a variable concentration of 13C (nuclear spin I=1/2) among the majority zero-nuclear-spin 12C atoms. We observe...... strong isotope effects in spin-blockaded transport, and from the magnetic field dependence estimate the hyperfine coupling in 13C nanotubes to be of the order of 100 ¿µeV, two orders of magnitude larger than anticipated. 13C-enhanced nanotubes are an interesting system for spin-based quantum information...
Directory of Open Access Journals (Sweden)
Sarah Sonnay
2017-05-01
Full Text Available Cerebral function is associated with exceptionally high metabolic activity, and requires continuous supply of oxygen and nutrients from the blood stream. Since the mid-twentieth century the idea that brain energy metabolism is coupled to neuronal activity has emerged, and a number of studies supported this hypothesis. Moreover, brain energy metabolism was demonstrated to be compartmentalized in neurons and astrocytes, and astrocytic glycolysis was proposed to serve the energetic demands of glutamatergic activity. Shedding light on the role of astrocytes in brain metabolism, the earlier picture of astrocytes being restricted to a scaffold-associated function in the brain is now out of date. With the development and optimization of non-invasive techniques, such as nuclear magnetic resonance spectroscopy (MRS, several groups have worked on assessing cerebral metabolism in vivo. In this context, 1H MRS has allowed the measurements of energy metabolism-related compounds, whose concentrations can vary under different brain activation states. 1H-[13C] MRS, i.e., indirect detection of signals from 13C-coupled 1H, together with infusion of 13C-enriched glucose has provided insights into the coupling between neurotransmission and glucose oxidation. Although these techniques tackle the coupling between neuronal activity and metabolism, they lack chemical specificity and fail in providing information on neuronal and glial metabolic pathways underlying those processes. Currently, the improvement of detection modalities (i.e., direct detection of 13C isotopomers, the progress in building adequate mathematical models along with the increase in magnetic field strength now available render possible detailed compartmentalized metabolic flux characterization. In particular, direct 13C MRS offers more detailed dataset acquisitions and provides information on metabolic interactions between neurons and astrocytes, and their role in supporting neurotransmission. Here
Preliminary Study of 13C/12C Application for the Detection of Adulterated Honey
International Nuclear Information System (INIS)
Loestanatjaroen, S.
2014-01-01
Honey and pollen in natural products derived from the same plant both share the same carbon source; as a result their 13 C isotope signature should be identical. The majority of honey adulteration in Thailand was done particularly by adding cheap sugars such as high sucrose cane syrup (HSCS). The accepted differences in 13 C/ 12 C between honey and its associated protein extract is -1δ/ο deviation, which provides the international benchmark of 7% C4 sugar addition. This study reports the preliminary detection of adulterated Thai honey samples by using isotope ratio mass spectrometer coupled to elemental analyzer (EAIRMS). The 5 Thailand honey samples and the pure honey were adulterated with HSCS dilution as: 0, 0.5, 1, 5, 7, 10, 15 and 50%, respectively. The results were found that two of the Thai honey samples and of 10, 15, and 50% dilution were adulterated. The result of analyzed cane sugar of ten replicates were found -11.2 and -10.8 δdeviation, respectively.
International Nuclear Information System (INIS)
Narayan, R.; Chang, C-j.
1982-01-01
[2- 13 C, 2- 14 C]2-Aminoethanol hydrochloride was prepared in good yield from Na*CN in a two step sequence by first converting the Na*CN to OHCH 2 *CN and then reducing the nitrile directly with a solution of borane-tetrahydrofuran complex. The reaction procedure was simple and the pure product could be obtained readily. Using this specifically labelled precursor, the synthesis of [1- 13 C, 1- 14 C]2-chloroethylamine hydrochloride, N-([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(CNU) and N,N'-bis([1- 13 C, 1- 14 C]2-chloroethyl)-N-nitrosourea(BCNU) in good yield without isotope scrambling was also reported. (author)
Intracellular PHB conversion in a type II methanotroph studied by 13 C NMR
Vecherskaya, M.; Dijkema, C.; Stams, A.J.M.
2001-01-01
Poly-g-hydroxybutyrate (PHB) formation under aerobic conditions via incorporation of [13C-2]acetate as a cosubstrate and its intracellular degradation under anaerobic conditions in a Type II methanotroph was studied by 13C NMR. During PHB synthesis in the presence of labelled acetate, low levels of
Directory of Open Access Journals (Sweden)
Iliana Valdés-Hernández
2018-04-01
Full Text Available La tuberculosis es uno de los mayores problemas que enfrenta la salud mundial en la actualidad. La única vacuna disponible contra esta enfermedad es la BCG, esta protege solo contra la tuberculosis grave de la infancia, lo cual plantea un reto en la búsqueda de nuevos candidatos vacunales. Teniendo en cuenta el antecedente protector de Mycobacterium ´habana´ contra la tuberculosis experimental, nos propusimos aportar elementos que avalen el empleo de M. ´habana´ TMC 5135 como candidato vacunal contra la tuberculosis, mediante estudios de infección en cultivos celulares de macrófagos murinos. Se caracterizó el proceso de fagocitosis de esta micobacteria por cultivos primarios de macrófagos peritoneales murinos y por la línea celular RAW 264.7, para lo cual se determinó el porcentaje de fagocitosis y el número fagocítico. El presente trabajo demostró que el proceso de fagocitosis de M. ´habana´ TMC 5135 está influenciado por la fuente celular empleada como célula hospedadora, así como por la carga bacteriana infectante y el tiempo de exposición a la misma. La presente investigación contribuye a la caracterización de la infección por esta micobacteria en sus principales células blanco de la inmunidad innata y traza el camino de futuras investigaciones para evaluar la activación de mecanismos efectores de la inmunidad innata frente a este candidato.
Steliopoulos, Panagiotis; Wüst, Matthias; Adam, Klaus-Peter; Mosandl, Armin
2002-05-01
The biogenetic origin of the isoprenoid building blocks of the sesquiterpene germacrene D was studied in Solidago canadensis. Feeding experiments were carried out with 1-[5,5-D(2)]deoxy-D-xylulose-5-phosphate (D(2)-DOXP), [5-13C]mevalonolactone (13C-MVL) and [1-13C]-D-glucose. The hydrodistillate of a cut shoot fed with D(2)-DOXP was investigated by enantio-MDGC-MS and the volatile fraction of a shoot supplied with 13C-MVL was examined by GC-C-IRMS. The incorporation of [1-13C]-D-glucose was analyzed by quantitative 13C NMR spectroscopy after isolation of germacrene D from the essential oil. Our labeling studies revealed that the biosynthesis of the C-15 skeleton of sesquiterpene germacrene D in Solidago canadensis proceeds predominantly via the methylerythritol phosphate pathway.
Synthesis of 13C-labeled vitamin E and interaction between vitamin E and phospholipid in liposome
International Nuclear Information System (INIS)
urano, S.; Matsuo, M.
1986-01-01
Vitamin E with a 13 C-labeled isoprenoid side chain, [4'a- 13 C], [6'- 13 C], [8'a- 13 C] and [12'a and 13'- 13 C]α-tocopherols were synthesized. These compounds were incorporated into three kinds of lecithin liposomes from dipalmitoyl phosphatidyl cholin, egg lecithin and rat liver lecithin, of which arachidonic acid contents are 0, 2.6 and 19.0%, respectively. T 1 values, which were measured by NMR for the labeled carbons, indicate that the segmental motion tends to increase with the increase of the distance from the chroman ring. This tendency is not affected with the arachidonic acid contents of phospholipids. This result can not be explained by Lucy's hypothesis. 1 figure; 1 table
Nuclear orientation and NMR/ON of sup(205,207)Po
International Nuclear Information System (INIS)
Herzog, P.; Walitzki, H.; Freitag, K.; Hildebrand, H.; Schloesser, K.
1983-01-01
sup(205,207)Po have been implanted with an isotope separator on-line into cold host matrices of Fe, Ni, Zn and Be. Nuclear magnetic resonance of oriented 207 Po has been observed in Fe and Ni, of 205 Po in Fe. From the dependence of the resonance frequency on external magnetic field the g-factor of 207 Po was derived. Using this value the magnetic hyperfine fields of Po in Fe and Ni were obtained. From the temperature dependence of the anisotropies of #betta#-lines in the decay of sup(205,207)Po the multipole mixing of several transitions was derived. The electric interaction frequencies #betta#sub(Q)=eQVsub(zz)/h in the hosts Zn and Be were measured. (orig./WL)
International Nuclear Information System (INIS)
Katsumi Iida
2013-01-01
The biosynthetic pathways leading to δ-aminolevulinic acid (ALA) from the Shemin precursor glycine via the C5 pathway in Arthrobacter hyalinus were quantitatively evaluated by means of feeding experiments with [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate, followed by analysis of the labeling patterns of coproporphyrinogen III (Copro'gen III) (biosynthesized from ALA) using 13 C NMR spectroscopy. Two biosynthetic pathways leading to ALA from glycine via the C5 pathway were identified: i.e., transformation of glycine to l-serine catalyzed by glycine hydroxymethyltransferase, and glycine synthase-catalyzed catabolism of glycine to N 5 , N 10 -methylene-tetrahydrofolic acid (THF), which reacts with another molecule of glycine to afford l-serine. l-Serine is transformed to acetyl-CoA via pyruvic acid. Acetyl-CoA enters the tricarboxylic acid cycle, affording 2-oxoglutaric acid, which in turn is transformed to l-glutamic acid. The l-glutamic acid enters the C5 pathway, affording ALA in A. hyalinus. A 13 C NMR spectroscopic comparison of the labeling patterns of Copro'gen III obtained after feeding of [2- 13 C]glycine, sodium [1- 13 C]acetate, and sodium [2- 13 C]acetate showed that [2- 13 C]glycine transformation and [2- 13 C]glycine catabolism in A. hyalinus proceed in the ratio of 52 and 48 %. The reaction of [2- 13 C]glycine and N 5 , N 10 -methylene-THF, that of glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF generated from the [2- 13 C]glycine catabolism, and that of [2- 13 C]glycine and N 5 , N 10 -[methylene- 13 C]methylene-THF transformed the fed [2- 13 C]glycine to [1- 13 C]acetyl-CoA, [2- 13 C]acetyl-CoA, and [1,2- 13 C 2 ]acetyl-CoA in the ratios of 42, 37, and 21 %, respectively. These labeled acetyl-CoAs were then incorporated into ALA. Our results provide a quantitative picture of the pathways of biosynthetic transformation to ALA from glycine in A. hyalinus. (author)
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J P; Leete, E [Minnesota Univ., Minneapolis (USA). Dept. of Chemistry
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
2008-10-01
An evaluation of communication technologies for application to TMC-TMS (Transportation Management Center : to Transportation Management Site) communications in Caltrans District 1. Wireless and wired technologies : have been evaluated for prospective...
Synthesis of C-13 labeled vitamin E, [4' a-13C]all-rac-α-tocopherol
International Nuclear Information System (INIS)
Urano, Shiro; Muto, Riko; Matsuo, Mitsuyoshi
1985-01-01
Vitamin E with a 13 C-labeled isoprenoid side chain, [4' a- 13 C]-all-rac-α-tocopherol, was synthesized by the coupling reaction of 6-4-methoxymethoxy-2-([methyl- 13 C]5-bromo-4-methyl-pent-1-yl)chroman (8) with 3,7-dimethyl-1-(thiazolin-2-yl)thio-2,6-octadiene. Compound 8 was prepared using 2-(4,4-di-ethoxycarbonylbut-1-yl)-6-methoxymethoxy-2,5,7,8-tetramethyl-chroman as a key intermediate and [ 13 C]methyl iodide as a 13 C source. The total yield of the labeled α-tocopherol based on [ 13 C]methyl iodide was 58.7%. (author)
C-13 isotopic studies of the surface catalysed reactions of methane
International Nuclear Information System (INIS)
Long, M.A.; He, S.J.X.; Adebajo, M.
1997-01-01
The ability of methane to methylate aromatic compounds, which are considered to be models for coal, is being studied. Related to this reaction, but at higher temperatures, is the direct formation of benzene from methane in the presence of these catalysts. Controversy exists in the literature on the former reaction, and 13 C isotope studies are being used to resolve the question. The interest in this reaction arises because the utilisation of methane, in the form of natural gas, in place of hydrogen for direct coal liquefaction would have major economic advantage. For this reason Isotope studies in this area have contributed significantly to an understanding of the methylation reactions. The paper describes experiments utilising methane 13 C, which show that methylation of aromatics such as naphthalene by the methane 13 C is catalysed by microporous, Cu-exchanged SAPO-5, at elevated pressures (6.8 MPa) and temperatures around 400 degree C. The mass spectrometric analysis and n.m.r. study of the isotopic composition of the products of the methylation reaction demonstrate unequivocally that methane provides the additional carbon atom for the methylated products. Thermodynamic calculations predict that the reaction is favourable at high methane pressures under these experimental conditions. The mechanism as suggested by the isotope study is discussed. The catalysts which show activity for the activation of methane for direct methylation of organic compounds, such as naphthalene, toluene, phenol and pyrene, are substituted aluminophosphate molecular sieves, EIAPO-5 (where El=Pb, Cu, Ni and Si) and a number of metal substituted zeolites. Our earlier tritium studies had shown that these catalysts will activate alkanes, at least as far as isotope hydrogen exchange reactions are concerned
International Nuclear Information System (INIS)
Panter, M.
1982-01-01
In proton-proton interactions at a c.m. energy of 63 GeV events with an identified high transverse momentum particle were studied. The inclusive invariant cross section for the production of charged pions was measured in the transverse momentum range from 3 to 13 GeV/c. (orig.) [de
Synthesis of edatrexate (2-13C-glutamate)
International Nuclear Information System (INIS)
DeGraw, J.I.; Colwell, W.T.; Jue, Thomas
1997-01-01
The experimental antitumor drug Edatrexate, labeled with 99% 13 C at the 2-position of the glutamate acid group was required for 13 C-magnetic resonance spectroscopy studies in biological media. Coupling of 2,4-diamino-4-deoxy-10-ethyl-10-deazapteroic acid with diethyl L-2- 13 C-glutamate as promoted by BOP reagent afforded Edatrexate (2- 13 C-glu) diethyl ester in 60% yield following purification by column chromatography. Saponification by aqueous NaOH in 2-methoxyethanol gave the target molecule in 44% yield or 26% overall. (author)
13C-NMR assignment, structure, and dynamics of deoxyoligonucleotides
International Nuclear Information System (INIS)
Zanatta, N.; Borer, P.N.; Levy, G.C.
1986-01-01
The unique spectral properties of 13 C-NMR for studying nucleic acids and some of the important features of 13 C-NMR in oligonucleotide studies are demostrated. The main difficulty in studying oligonucleotides by 13 C-NMR and recent improvements in NMR instrumentation and advances in oligonucleotide synthesis are presented. The high resolution 13 C-NMR spectra, T 1 relaxation times and NOEs were measured for duplex of the self-complementary oligo-DNAs: d(CG) 3 and d(GGTATACC) are studied. The target of this study is to developed a systematic 13 C-NMR spectral assignment and to investigate the structure and dynamics of these two sequences by this techniques. (M.J.C.) [pt
Directory of Open Access Journals (Sweden)
Zixun Chen
2017-07-01
Full Text Available Previous studies have suggested foliar δ13C generally increases with altitude. However, some observations reported no changes or even decreased trends in foliar δ13C. We noted that all the studies in which δ13C increased with elevation were conducted in the human regions, whereas those investigations in which δ13C did not vary or decreased were conducted in areas with water stress. Thus, we proposed that the pattern of increasing δ13C with elevation is not a general one, and that δ13C may remain unchanged or decrease in plants grown in arid environments. To test the hypothesis, we sampled plants along altitude gradients on the shady and sunny slopes of Mount Tianshan characterized by arid and semiarid climates. The measurements of foliar δ13C showed no altitudinal trends for the plants grown on either of the slopes. Therefore, this study supported our hypothesis. In addition, the present study addressed the effect of atmospheric pressure on plant δ13C by accounting for the effects of temperature and precipitation on δ13C. This study found that the residual foliar δ13C increased with increasing altitude, suggesting that atmospheric pressure played a negative role in foliar δ13C.
Energy Technology Data Exchange (ETDEWEB)
Porwoll, J.P.; Leete, E. (Minnesota Univ., Minneapolis (USA). Dept. of Chemistry)
1985-03-01
Potential advanced intermediates in the biosynthesis of delta/sup 9/-tetrahydrocannabinol, the major psychoactive principle of marijuana, have been synthesized labeled with two contiguous /sup 13/C atoms and /sup 14/C. Methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)olivetolate was prepared from lithium (/sup 13/C/sub 2/)acetylide and dimethyl (2-/sup 14/C)malonate. Reaction with geranyl bromide afforded methyl (5,6-/sup 13/C/sub 2/, 1-/sup 14/C)cannabigerolate, and hydrolysis of these methyl esters with lithium propyl mercaptide yielded the corresponding labeled acids. The /sup 13/C-/sup 13/C couplings observable in the /sup 13/C NMR spectra of these /sup 13/C-enriched compounds and their synthetic precursors are recorded. Methyl (1'-/sup 14/C)olivetolate was prepared from /sup 13/CO/sub 2/ to confirm assignments of the /sup 13/C chemical shifts in the pentyl side chain of these compounds.
5 CFR 532.207 - Time schedule for wage surveys.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Time schedule for wage surveys. 532.207... PREVAILING RATE SYSTEMS Prevailing Rate Determinations § 532.207 Time schedule for wage surveys. (a) Wage... and the collection of wage data by visits to establishments. (c) A wage-change survey shall be made...
International Nuclear Information System (INIS)
Slovinskij, B.; Mulas, Eh.
1981-01-01
The energy spectra of protons (ESP) emitted in reactions p+Xe→kp+... at 2.34 GeV/c (k=1-9) and π - +Xe→kp+... at 9 GeV/c (k=1-17) have been studied. An evidence has been obtained for a unified description of those spectra by an exponential dependence of the invariant cross sections upon the kinetic energy independently of the proton emission angle. It is found that the ESP temperature becomes independent of the proton emission frequency when the energy of the interaction induced hadron is greater than approximately 3 GeV [ru
207Pb and 205Tl NMR on Perovskite Type Crystals APbX3 (A = Cs, Tl, X = Br, I)
Sharma, Surendra; Weiden, Norbert; Weiss, Alarich
1987-11-01
By 205Tl and 207Pb NM R the chemical shift in polycrystalline samples of binary halides AX, BX2 and ternary halides ABX3 (A = Cs, Tl; B = Pb; X = Br, I) was studied at room temperature. The chemical shift tensors δ ( 205Tl) and δ (207Pb) were determined in magnitude and orientation on single crystals of the orthorhombic TlPbI3. The components of the δ(205Tl) tensor are δx (205Tl) || a = 611ppm; δy (205Tl) || b = 680 ppm; δZ(205Tl) || c = 1329 ppm; δiso(205Tl) = 873.3 ppm (with respect to 3.4 molar aqueous solution of TlOOCCH3). The chemical shift tensor of 207Pb in TlPbI3 shows two orientations. One of them is: δx (207Pb) = 3760 ppm, inclined 30° from b towards c, δy(207Pb) || a = 3485 ppm, δz(207Pb) = 2639 ppm inclined 120° from b towards c. δiso(207Pb) = 3295 ppm (with respect to saturated aqueous solution of Pb(NO3)2). The results are discussed with respect to the crystal structure and a model to explain orientation and anisotropy of the tensors δ(205Tl) and δ(207Pb) in TlPbI3 is proposed. In the system CsPbBr3-x Ix δ(207Pb) was studied on polycrystalline samples. The chemical shift increases with increasing x and negative excess shift is observed.
MURATA, Kozue; TOMOSADA, Yohsuke; VILLENA, Julio; CHIBA, Eriko; SHIMAZU, Tomoyuki; ASO, Hisashi; IWABUCHI, Noriyuki; XIAO, Jin-zhong; SAITO, Tadao; KITAZAWA, Haruki
2014-01-01
Bifidobacterium breve MCC-117 is able to significantly reduce the expression of inflammatory cytokines in porcine intestinal epithelial (PIE) cells and to improve IL-10 levels in CD4+CD25high Foxp3+ lymphocytes in response to heat-stable enterotoxigenic Escherichia coli (ETEC) pathogen-associated molecular patterns (PAMPs), while the immunoregulatory effect of B. adolescentis ATCC15705 was significantly lower than that observed for the MCC-117 strain. Considering the different capacities of the two bifidobacterium strains to activate toll-like receptor (TLR)-2 and their differential immunoregulatory activities in PIE and immune cells, we hypothesized that comparative studies with both strains could provide important information regarding the molecular mechanism(s) involved in the anti-inflammatory activity of bifidobacteria. In this work, we demonstrated that the anti-inflammatory effect of B. breve MCC-117 was achieved by a complex interaction of multiple negative regulators of TLRs as well as inhibition of multiple signaling pathways. We showed that B. breve MCC-117 reduced heat-stable ETEC PAMP-induced NF-κB, p38 MAPK and PI3 K activation and expression of pro-inflammatory cytokines in PIE cells. In addition, we demonstrated that B. breve MCC-117 may activate TLR2 synergistically and cooperatively with one or more other pattern recognition receptors (PRRs), and that interactions may result in a coordinated sum of signals that induce the upregulation of A20, Bcl-3, Tollip and SIGIRR. Upregulation of these negative regulators could have an important physiological impact on maintaining or reestablishing homeostatic TLR signals in PIE cells. Therefore, in the present study, we gained insight into the molecular mechanisms involved in the immunoregulatory effect of B. breve MCC-117. PMID:24936377
Synthesis of 1-13C-1-indanone and 2-13C-1,2,3,4-tetrahydroquinoline
International Nuclear Information System (INIS)
Pickering, R.E.; Wysocki, M.A.; Eisenbraun, E.J.
1985-01-01
The synthesis of 2- 13 C-1,2,3,4-tetrahydroquinoline (5) via 1- 13 C-3-phenylpropanoic acid (1), 1- 13 C-1-indanone (2), 1- 13 C-1-indanone hydrazone (3) and 2- 13 C-3,4-dihydro-2(1H)-quinolinone (4) proceeded in 78, 96, 95, 79, and 85% individual yields respectively for 1, 2, 3, 4, 5 and 61% overall yield of the latter from 1. (author)
Magnetic resonance butterfly coils: Design and application for hyperpolarized 13C studies
DEFF Research Database (Denmark)
Giovannetti, Giulio; Frijia, Francesca; Attanasio, Simona
2013-01-01
Hyperpolarized 13C magnetic resonance spectroscopy in pig models enables cardiac metabolism assessment and provides a powerful tool for heart physiology studies, although the low molar concentration of derivate metabolites gives rise to technological limitations in terms of data quality. The desi...... throughout the volume of interest for cardiac imaging in pig. Experimental SNR-vs-depth profiles, extracted from the [1-13C]acetate phantom chemical shift image (CSI), permitted to highlight the performance of the proposed coils configuration. © 2013 Elsevier Ltd. All rights reserved....
Site-selective 13C labeling of proteins using erythrose
International Nuclear Information System (INIS)
Weininger, Ulrich
2017-01-01
NMR-spectroscopy enables unique experimental studies on protein dynamics at atomic resolution. In order to obtain a full atom view on protein dynamics, and to study specific local processes like ring-flips, proton-transfer, or tautomerization, one has to perform studies on amino-acid side chains. A key requirement for these studies is site-selective labeling with 13 C and/or 1 H, which is achieved in the most general way by using site-selectively 13 C-enriched glucose (1- and 2- 13 C) as the carbon source in bacterial expression systems. Using this strategy, multiple sites in side chains, including aromatics, become site-selectively labeled and suitable for relaxation studies. Here we systematically investigate the use of site-selectively 13 C-enriched erythrose (1-, 2-, 3- and 4- 13 C) as a suitable precursor for 13 C labeled aromatic side chains. We quantify 13 C incorporation in nearly all sites in all 20 amino acids and compare the results to glucose based labeling. In general the erythrose approach results in more selective labeling. While there is only a minor gain for phenylalanine and tyrosine side-chains, the 13 C incorporation level for tryptophan is at least doubled. Additionally, the Phe ζ and Trp η2 positions become labeled. In the aliphatic side chains, labeling using erythrose yields isolated 13 C labels for certain positions, like Ile β and His β, making these sites suitable for dynamics studies. Using erythrose instead of glucose as a source for site-selective 13 C labeling enables unique or superior labeling for certain positions and is thereby expanding the toolbox for customized isotope labeling of amino-acid side-chains.
International Nuclear Information System (INIS)
Pahl-Wostl, C.; Seelig, J.
1986-01-01
The hormonal regulation of ketogenesis in the liver of living rat has been studied noninvasively with 13 C nuclear magnetic resonance. The spatial selection for the liver was better than 90%, with extrahepatic adipose tissue contribution only a very small amount of signal. The metabolic activities of the liver were investigated by infusion of 13 C-labeled butyrate in the jugular vein of the anesthetized rat. The rate of butyrate infusion was chosen to be close to the maximum oxidative capacity of the rat liver, and the 13 C signal intensities were enhanced by using doubly labeled [1,3- 13 C]butyrate as a substrate. Different 13 C NMR spectra and hence different metabolites were observed depending on the hormonal state of the animal. The 13 C NMR studies demonstrate that even when rate of acetyl-CoA production are high, the disposal of this compound is not identical in fasted and diabetic animals. This supports previous suggestions that the redox state of the mitochondrion represents the most important factor in regulation. For a given metabolic state of the animal, different signal intensities were obtained depending on whether butyrate was labeled at C-1, C-3, or C-1,3. From the ratios of incorporation of 13 C label into the carbons of 3-hydroxybutyrate, it could be estimated that a large fraction of butyrate evaded β-oxidation to acetyl-CoA but was converted directly to acetoacetyl-CoA. 13 C-labeled glucose could be detected in vivo in the liver of diabetic rats
24 CFR 51.207 - Special circumstances.
2010-04-01
... Handling Conventional Fuels or Chemicals of an Explosive or Flammable Nature § 51.207 Special circumstances..., require the application of this subpart C with respect to a substance not listed in appendix I to this...
MR-1S Interacts with PET100 and PET117 in Module-Based Assembly of Human Cytochrome c Oxidase
Directory of Open Access Journals (Sweden)
Sara Vidoni
2017-02-01
Full Text Available The biogenesis of human cytochrome c oxidase (COX is an intricate process in which three mitochondrial DNA (mtDNA-encoded core subunits are assembled in a coordinated way with at least 11 nucleus-encoded subunits. Many chaperones shared between yeast and humans are involved in COX assembly. Here, we have used a MT-CO3 mutant cybrid cell line to define the composition of assembly intermediates and identify new human COX assembly factors. Quantitative mass spectrometry analysis led us to modify the assembly model from a sequential pathway to a module-based process. Each module contains one of the three core subunits, together with different ancillary components, including HIGD1A. By the same analysis, we identified the short isoform of the myofibrillogenesis regulator 1 (MR-1S as a new COX assembly factor, which works with the highly conserved PET100 and PET117 chaperones to assist COX biogenesis in higher eukaryotes.
MR-1S Interacts with PET100 and PET117 in Module-Based Assembly of Human Cytochrome c Oxidase.
Vidoni, Sara; Harbour, Michael E; Guerrero-Castillo, Sergio; Signes, Alba; Ding, Shujing; Fearnley, Ian M; Taylor, Robert W; Tiranti, Valeria; Arnold, Susanne; Fernandez-Vizarra, Erika; Zeviani, Massimo
2017-02-14
The biogenesis of human cytochrome c oxidase (COX) is an intricate process in which three mitochondrial DNA (mtDNA)-encoded core subunits are assembled in a coordinated way with at least 11 nucleus-encoded subunits. Many chaperones shared between yeast and humans are involved in COX assembly. Here, we have used a MT-CO3 mutant cybrid cell line to define the composition of assembly intermediates and identify new human COX assembly factors. Quantitative mass spectrometry analysis led us to modify the assembly model from a sequential pathway to a module-based process. Each module contains one of the three core subunits, together with different ancillary components, including HIGD1A. By the same analysis, we identified the short isoform of the myofibrillogenesis regulator 1 (MR-1S) as a new COX assembly factor, which works with the highly conserved PET100 and PET117 chaperones to assist COX biogenesis in higher eukaryotes. Copyright © 2017 Elsevier Inc. All rights reserved.
Inhibition of β-Secretase Activity by Monoterpenes, Sesquiterpenes, and C13 Norisoprenoids.
Marumoto, Shinsuke; Okuno, Yoshiharu; Miyazawa, Mitsuo
2017-08-01
Inhibition of β-secretase (BACE1) is currently regarded as the leading treatment strategy for Alzheimer's disease. In the present study, we aimed to screen the in vitro inhibitory activity of 80 types of aroma compounds (monoterpenes, sesquiterpenes, and C 13 norisoprenoids), including plant-based types, at a 200-μM concentration against a recombinant human BACE1. The results showed that the most potent inhibitor of BACE1 was geranyl acetone followed by (+)-camphor, (-)-fenchone, (+)-fenchone, and (-)-camphor with the half-maximal inhibitory concentration (IC 50 ) values of 51.9 ± 3.9, 95.9 ± 11.0, 106.3 ± 14.9, 117.0 ± 18.6, and 134.1 ± 16.4 μM, respectively. Furthermore, the mechanism of inhibition of BACE1 by geranyl acetone was analyzed using Dixon kinetics plus Cornish-Bowden plots, which revealed mixed-type mode. Therefore aroma compounds may be used as potential lead molecules for designing anti-BACE1 agents.
Determination of urea 13C in urea 13C mixed powder by HPLC
International Nuclear Information System (INIS)
Zhong Jianguo; Song Tianqi
2006-01-01
A HPLC method is developed for determination of Urea 13 C in Urea 13 C Mixed Powder. A Alltech Econosphere NH2 column (250 mm x 4.6 mm, 5 μm)is used as stationary phrase, a mixture of V(acetonitrile): V(methanol): V(water) = 900 : 100: 10 is used as mobile phase and the flow rate is l mL·min -1 , UV detection wavelength is performed at 200 nm. The calibration curve shows good linearity in the range of 0.2-1.0 g·L -1 of Urea 13 C, y=2.548 x 10 6 x + 4.005 x 10 4 , r=0.9999, and the averaged recovery is 100.6%. The method is simple and accurate, and can be used for the quality control of Urea 13C Mixed Powder. (authors)
48 CFR 32.207 - Administration and payment of commercial financing payments.
2010-10-01
... contractual information, and the account(s) (see 32.206(d)) to be charged for the payment. (c) Management of... of commercial financing payments. 32.207 Section 32.207 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Commercial Item...
Purwadi, Purwadi; Sunarto, Faisal; Muttaqin, Alfan; Seto, Tri Handoko
2018-01-01
IntisariTelah dilakukan kajian aplikasi mobile zappeline sebagai media teknologi modifikasi cuaca (tmc) dan media penipisan polutan udara (asap) pada sebuah truk Mitsubishi Colt Diesel berukuran 5,960 x 1,970 meter. Dengan kendaraan tersebut, direkomendasikan dimensi zappeline berbentuk bangun ruang eliptical dengan jari-jari diagonal a dan b masing-masing 3,25 dan 0,65 meter. Selanjutnya, karakteristik aerodinamik dan fisika dihitung dengan memecahkan beberapa persamaan fisika secara numerik...
Masuda, Tsuyoshi; Tako, Yasuhiro; Matsushita, Kensaku; Takeda, Hiroshi; Endo, Masahiro; Nakamura, Yuji; Hisamatsu, Shun'ichi
2016-09-01
The retention of 13 C in the human body after oral administration of 13 C-labeled glucose was studied in three healthy volunteer subjects to estimate the 50 year cumulative body burden for 13 C as an index of the committed dose of the radioisotope 14 C. After administration of 13 C-labeled glucose, the volunteers ingested controlled diets with a fixed number of calories for 112 d. Samples of breath and urine were collected up to 112 d after administration. Samples of feces were collected up to 14 d after administration. Hair samples were obtained at 119 d after administration and analyzed as a representative index of the rate of excretion of organic 13 C via pathways such as skin cell exfoliation and mucus secretion. All samples were analyzed for 13 C/ 12 C atomic ratio to determine the rate of excretion via each pathway. We then constructed a metabolic model with a total of four pathways (breath, urine, feces, and other) comprising seven compartments. We determined the values of the biokinetic parameters in the model by using the obtained excretion data. From 74% to 94% of the 13 C administered was excreted in breath, whereas 0.1). In addition, the dataset for one of the three subjects was markedly different from those of the other two. When we estimated the 50 year cumulative body burden for 13 C by using our model and we included non-statistically significant parameters, a considerable cumulative body burden was found in the compartments excreting to the other pathway. Although our results on the cumulative body burden of 13 C from orally administered carbon as glucose were inconclusive, we found that the compartments excreting to the other pathway had a markedly long residence time and therefore should be studied further to clarify the fate of carbon in the human body. In addition to excreta, data for serum and blood cell samples were also collected from the subjects to examine the metabolism of 13 C in human body.
Study of 207Tl126 Produced in Deep-Inelastic Reactions
Directory of Open Access Journals (Sweden)
Wilson E.
2014-03-01
Full Text Available Deep-inelastic collisions of a 208Pb beam on a 208Pb target were performed using the ATLAS accelerator at Argonne National Laboratory. The Gammasphere detector array was used for the detection of prompt and delayed gamma-rays of the reaction products.207Tl is one proton away from the 208Pb doubly-magic nucleus. Its low-energy level structure is dominated by the single proton-hole states πs1/2−1, πd3/2−1 and πh11/2−1. The 11/2− state is isomeric with T1/2 = 1.33(11 s. The reaction partner of 207Tl is 209Bi, which has arelatively well established level scheme compared to 207Tl. Cross-coincidences between these two nuclei were used to confirm or establish levels above the 11/2− isomeric state in 207Tl. These states are obtained via breaking of the neutron core. Angular correlation analysis was performed on known transitions in 208Pb, proving the applicability of this method for multipolarity assignment.
Detection of Interstellar HC5O in TMC-1 with the Green Bank Telescope
McGuire, Brett A.; Burkhardt, Andrew M.; Shingledecker, Christopher N.; Kalenskii, Sergei V.; Herbst, Eric; Remijan, Anthony J.; McCarthy, Michael C.
2017-07-01
We report the detection of the carbon-chain radical HC5O for the first time in the interstellar medium toward the cold core TMC-1 using the 100 m Green Bank Telescope. We observe four hyperfine components of this radical in the J=17/2\\to 15/2 rotational transition that originates from the {}2{{{\\Pi }}}1/2 fine structure level of its ground state and calculate an abundance of n/{n}{H2}=1.7× {10}-10, assuming an excitation temperature of {T}{ex}=7 K. No indication of HC3O, HC4O, or HC6O, is found in these or archival observations of the source, while we report tentative evidence for HC7O. We compare calculated upper limits and the abundance of HC5O to predictions based on (1) the abundance trend of the analogous HC n N family in TMC-1 and (2) a gas-grain chemical model. We find that the gas-grain chemical model well reproduces the observed abundance of HC5O, as well as the upper limits of HC3O, HC6O, and HC7O, but HC4O is overproduced. The prospects for astronomical detection of both shorter and longer HC n O chains are discussed.
Amirnasr, Maryam; Fallah Tafti, Tannan; Sankian, Mojtaba; Rezaei, Abdorrahim; Tafaghodi, Mohsen
2016-08-01
To prevent the spread of HTLV-I (Human T-lymphotropic virus type 1), a safe and effective vaccine is required. To increase immune responses against the peptide antigens can be potentiated with polymer-based nanoparticles, like chitosan (CHT) and trimethylchitosan (TMC), as delivery system/adjuvant. CHT and TMC nanoparticles loaded with recombinant proteins (env23 & env13) of gp46 were prepared by direct coating of antigens with positively charged polymers. The size of CHT and TMC nanoparticles (NPs) loaded with each antigen was about 400 nm. The physical stability of NPs was followed for 4 weeks. Both formulations showed to be stable for about 15 days. The immunogenicity of NPs loaded with antigens was studied after nasal and subcutaneous immunization in mice. Three immunizations (7.5 μg antigen) were performed with 2 weeks intervals. Two weeks after the last booster dose, sera IgG subtypes were measured. After subcutaneous administration, for both nanoparticulate antigens, serum IgG1 and IgGtotal levels were higher than antigen solution (P nanoparticles showed good immunoadjuvant potential. Env23 antigen was a better candidate for vaccination against HTLV-I, as it induced higher cellular immune responses, compared with env13. Copyright © 2016 Elsevier Ltd. All rights reserved.
Olah, George A; Prakash, G K Surya; Rasul, Golam
2016-01-05
The rearrangement pathways of the equilibrating tertiary carbocations, 2,3-dimethyl-2-butyl cation (C6H13(+), 1), 2,3,3-trimethyl-2-butyl cation (C7H15(+), 5) and 2,3-dimethyl-2-pentyl cation (C7H15(+), 8 and 9) were investigated using the ab initio/GIAO-CCSD(T) (13)C NMR method. Comparing the calculated and experimental (13)C NMR chemical shifts of a series of carbocations indicates that excellent prediction of δ(13)C could be achieved through scaling. In the case of symmetrical equilibrating cations (1 and 5) the Wagner-Meerwein 1,2-hydride and 1,2-methide shifts, respectively, produce the same structure. This indicates that the overall (13)C NMR chemical shifts are conserved and independent of temperature. However, in the case of unsymmetrical equilibrating cations (8 and 9) the Wagner-Meerwein shift produces different tertiary structures, which have slightly different thermodynamic stabilities and, thus, different spectra. At the MP4(SDTQ)/cc-pVTZ//MP2/cc-pVTZ + ZPE level structure 8 is only 90 calories/mol more stable than structure 9. Based on computed (13)C NMR chemical shift calculations, mole fractions of these isomers were determined by assuming the observed chemical shifts are due to the weighted average of the chemical shifts of the static ions. © 2015 Wiley Periodicals, Inc.
International Nuclear Information System (INIS)
Viswanatha, V.; Larsen, B.; Hruby, V.J.
1979-01-01
DL-[2- 13 C]Leucine was prepared by condensing the sodium salt of ethyl acetamido-[2- 13 C]cyanoacetate with isobutylbromide in hexamethylphosphoroustriamide followed by acid hydrolysis. N-BOC-DL-[2- 13 C]Leucine was prepared and incorporated into [8-DL-[2- 13 C]leucine]oxytocin by total synthesis. The 13 C-labeled hormone derivative [8-[2- 13 C]leucine]oxytocin was separated from its 8-position diastereoisomer by partition chromatography. The specifically 13 C-labeled peptide hormone diastereoisomeric analog [3-DL-[2- 13 C]leucine]oxytocin also was prepared by solid phase peptide synthesis. No suitable solvent system for partition chromatography separation of the latter diastereoisomeric peptide mixture could be found. However an excellent preparative separation of the diastereoisomers could be obtained by reverse phase high pressure liquid chromatography on a partisil 10 M9 ODS column using the solvent system 0.05 M ammonium acetate (pH 4.0), acetonitrile (81:19, v/v) to give pure [3-[2- 13 C]leucine]oxytocin and [3-D-[2- 13 C]leucine]oxytocin. An excellent separation of [8-[2- 13 C]leucine]oxytocin and the corresponding delata-D-leucine diastereoisomer derivative could also be accomplished by high pressure liquid chromatography. (author)
CD117 expression on blast cells in acute myeloid leukemia
Directory of Open Access Journals (Sweden)
Goryainova N.V.
2015-09-01
Full Text Available The aim of the present work was to analyze the frequency of CD117 (c-KIT antigen expression on the blast cells in acute myeloid leukemia (AML, evaluation of the presence of the relationship between the expression of the c-KIT and leukemia according to the FAB classification and definition of co-expression of the antigen CD117, antigens CD33 and CD34. The data of 47 patients with AML were diagnosed. M0 AML variant was established in 3 (6% patients, M1 – in 2 (4%, M2 – in 9 (20%, M4 – in 22 (47% and M5 – in 11 (23%. For immunophenotypic stu¬dies monoclonal antibodies (mAb that detect antigens of anti-CD34, anti-CD33 and anti-CD117 (Becton Dickinson, USA were used. The presence of the antigen CD117 was detected in 39 people, accounting for 83% of all surveyed. Antigen c-KIT was present in 48.117.0% cells on average: in all 3 cases – AML M0, in2 cases of AML M1, in 6 cases – AML M2, 20 of 22 cases – AML M4 and in 8 of 11 AML M5 cases. Average levels of CD117 in investigated leukemia cases statistically differed significantly (p=0.0067. Among 39 CD117- positive patients in 25 (53% co-expression of CD117+/CD34+ was revealed. Expression of CD117+/CD34- was observed in 14 cases (30%, CD117-/CD34+ – in 4 cases (8,5%, CD117-/CD34- – in 4 cases (8.5%. CD34 had of 64% of cells of myeloid origin. A high positive cor¬relation between expression of CD117 and CD34 (r=+0,5169 was determined, being statistically significant (p0,0067.
13C nuclear magnetic resonance study of the complexation of calcium by taurine
International Nuclear Information System (INIS)
Irving, C.S.; Hammer, B.E.; Danyluk, S.S.; Klein, P.D.
1980-01-01
13 C Nuclear magnetic resonance chemical shifts, 1 J/sub c-c/ scalar coupling constants, spin-lattice relaxation times, and nuclear Overhauser effects were determined for taurine-[1, 2 13 C] and a taurine-[1 13 C] and taurine-[2 13 C] mixture in the presence and absence of calcium. Comparison of taurine titration shifts to values for related compounds reveals some unusual electronic properties of the taurine molecule. Stability constants of 1:1 calcium complexes with taurine zwitterions and anions, as well as their 13 C chemical shifts, were obtained by least squares analysis of titration curves measured in the presence of calcium. The stability constants of calcium-taurine complexes were significantly lower than previous values and led to estimates that only approximately one percent of intracellular calcium of mammalian myocardial cells would exist in a taurine complex
International Nuclear Information System (INIS)
Long, A.; Leavitt, S.W.
1982-07-01
Analysis of delta 13 C in tree rings offers the potential for reconstructing changes in delta 13 C of atmospheric CO 2 , which combined with 14 C trends will be important in evaluating the past and present role of the biosphere as a net carbon dioxide source or sink. One problem with such tree-ring delta 13 C records is that in addition to changes in atmospheric delta 13 C, climatic factors may influence the isotopic composition of the rings. This study examines delta 13 C in cellulose of five-year intervals of juniper tree rings. The sampling sites were near weather stations for which climate data are readily available. delta 13 C vs winter climate relationships were derived from those sites not under the influence of local pollution sources. These relationships facilitated development of a delta 13 C record from which climate effects have been factored out. The resulting 1930-1979 delta 13 C reconstruction shows a pronounced delta 13 C decrease from 1930 to 1960 and then a post-1960 flattening of the curve. We interpret this trend as representing an increasing role of biospheric CO 2 sinks relative to sources, although other interpretations may be possible within the limits of precision of data analysis. Research with this technique is continuing with pinyon pine and dendroclimatological reconstructions to verify these results and to develop a climate-free delta 13 C chronology back to pre-industrial time
Protolytic properties of polyamine wasp toxin analogues studied by 13C NMR spectroscopy
DEFF Research Database (Denmark)
Strømgaard, Kristian; Piazzi, Lorna; Olsen, Christian A
2006-01-01
Acid-base properties of the natural polyamine wasp toxin PhTX-433 (1) and seven synthetic analogues [PhTX-343 (2), PhTX-334 (3), PhTX-443 (4), PhTX-434 (5), PhTX-344 (6), PhTX-444 (7), and PhTX-333 (8)], each having four protolytic sites, were characterized by 13C NMR spectroscopy. Nonlinear......, multiparameter, simultaneous fit of all chemical shift data obtained from the NMR titration curves yielded macroscopic pKa values as well as intrinsic chemical shift data of all differently protonated macrospecies. Analyses of the chemical shift data demonstrated strong interactions between all four sites...
48 CFR 33.207 - Contractor certification.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Contractor certification... CONTRACTING REQUIREMENTS PROTESTS, DISPUTES, AND APPEALS Disputes and Appeals 33.207 Contractor certification. (a) Contractors shall provide the certification specified in paragraph (c) of this section when...
Studies to enhance the hyperpolarization level in PHIP-SAH-produced C13-pyruvate
Cavallari, Eleonora; Carrera, Carla; Aime, Silvio; Reineri, Francesca
2018-04-01
The use of [1-13C]pyruvate, hyperpolarized by dissolution-Dynamic Nuclear Polarization (d-DNP), in in vivo metabolic studies has developed quickly, thanks to the imaging probe's diagnostic relevance. Nevertheless, the cost of a d-DNP polarizer is quite high and the speed of hyperpolarization process is relatively slow, meaning that its use is limited to few research laboratories. ParaHydrogen Induced Polarization Side Arm Hydrogenation (PHIP-SAH) (Reineri et al., 2015) is a cost effective and easy-to-handle method that produces 13C-MR hyperpolarization in [1-13C]pyruvate and other metabolites. This work aims to identify the main determinants of the hyperpolarization levels observed in C13-pyruvate using this method. By dissecting the various steps of the PHIP-SAH procedure, it has been possible to assess the role of several experimental parameters whose optimization must be pursued if this method is to be made suitable for future translational steps. The search for possible solutions has led to improvements in the polarization of sodium [1-13C]pyruvate from 2% to 5%. Moreover, these results suggest that observed polarization levels could be increased considerably by an automatized procedure which would reduce the time required for the work-up passages that are currently carried out manually. The results reported herein mean that the attainment of polarization levels suitable for the metabolic imaging applications of these hyperpolarized substrates show significant promise.
Li, Shizhe; An, Li; Yu, Shao; Ferraris Araneta, Maria; Johnson, Christopher S; Wang, Shumin; Shen, Jun
2016-03-01
Carbon-13 ((13)C) MR spectroscopy (MRS) of the human brain at 7 Tesla (T) may pose patient safety issues due to high radiofrequency (RF) power deposition for proton decoupling. The purpose of present work is to study the feasibility of in vivo (13)C MRS of human brain at 7 T using broadband low RF power proton decoupling. Carboxylic/amide (13)C MRS of human brain by broadband stochastic proton decoupling was demonstrated on a 7 T scanner. RF safety was evaluated using the finite-difference time-domain method. (13)C signal enhancement by nuclear Overhauser effect (NOE) and proton decoupling was evaluated in both phantoms and in vivo. At 7 T, the peak amplitude of carboxylic/amide (13)C signals was increased by a factor of greater than 4 due to the combined effects of NOE and proton decoupling. The 7 T (13)C MRS technique used decoupling power and average transmit power of less than 35 watts (W) and 3.6 W, respectively. In vivo (13)C MRS studies of human brain can be performed at 7 T, well below the RF safety threshold, by detecting carboxylic/amide carbons with broadband stochastic proton decoupling. © 2015 Wiley Periodicals, Inc.
12C(d,p) 13C reaction at Esub(d) = 30 MeV to the positive-parity states in 13C
International Nuclear Information System (INIS)
Ohnuma, H.; Hoshino, N.; Mikoshiba, O.
1985-07-01
The 12 C(d, p) 13 C reaction has been studied at Esub(d) = 30 MeV. All the known positive-parity states of 13 C below 10 MeV in excitation energy, including the 7/2 + and 9/2 + states, are observed in this reaction. The angular distributions for these positive-parity bound and unbound states are analyzed in CCBA frame work. The 13 C wave functions, which reproduce the resonant and non-resonant scattering of neutrons from 12 C, also give good accounts of the experimentally observed angular distributions and energy spectra of outgoing protons in the 12 C(d, p) 13 C reaction. In most cases the cross section magnitude and the angular distribution shape are primarily determined by the 0 + x j component, even if it is only a small fraction of the total wave function. An exception is the 7/2 + state, where the main contribution comes from the 2 + x dsub(5/2) component. The inclusion of the 4 + state in 12 C and the gsub(9/2) and gsub(7/2) neutron components in the n + 12 C system has very small effects on the low-spin states, but is indispensable for a good fit to the 7/2 + and 9/2 + angular distributions. The transitions to the negative-parity states, 1/2 1 - , 3/2 1 - , 5/2 - , 7/2 - and 1/2 3 - , are also observed experimentally, and analyzed by DWBA. (author)
NMR structure analysis of uniformly 13C-labeled carbohydrates.
Fontana, Carolina; Kovacs, Helena; Widmalm, Göran
2014-06-01
In this study, a set of nuclear magnetic resonance experiments, some of them commonly used in the study of (13)C-labeled proteins and/or nucleic acids, is applied for the structure determination of uniformly (13)C-enriched carbohydrates. Two model substances were employed: one compound of low molecular weight [(UL-(13)C)-sucrose, 342 Da] and one compound of medium molecular weight ((13)C-enriched O-antigenic polysaccharide isolated from Escherichia coli O142, ~10 kDa). The first step in this approach involves the assignment of the carbon resonances in each monosaccharide spin system using the anomeric carbon signal as the starting point. The (13)C resonances are traced using (13)C-(13)C correlations from homonuclear experiments, such as (H)CC-CT-COSY, (H)CC-NOESY, CC-CT-TOCSY and/or virtually decoupled (H)CC-TOCSY. Based on the assignment of the (13)C resonances, the (1)H chemical shifts are derived in a straightforward manner using one-bond (1)H-(13)C correlations from heteronuclear experiments (HC-CT-HSQC). In order to avoid the (1) J CC splitting of the (13)C resonances and to improve the resolution, either constant-time (CT) in the indirect dimension or virtual decoupling in the direct dimension were used. The monosaccharide sequence and linkage positions in oligosaccharides were determined using either (13)C or (1)H detected experiments, namely CC-CT-COSY, band-selective (H)CC-TOCSY, HC-CT-HSQC-NOESY or long-range HC-CT-HSQC. However, due to the short T2 relaxation time associated with larger polysaccharides, the sequential information in the O-antigen polysaccharide from E. coli O142 could only be elucidated using the (1)H-detected experiments. Exchanging protons of hydroxyl groups and N-acetyl amides in the (13)C-enriched polysaccharide were assigned by using HC-H2BC spectra. The assignment of the N-acetyl groups with (15)N at natural abundance was completed by using HN-SOFAST-HMQC, HNCA, HNCO and (13)C-detected (H)CACO spectra.
Non-stationary (13)C-metabolic flux ratio analysis.
Hörl, Manuel; Schnidder, Julian; Sauer, Uwe; Zamboni, Nicola
2013-12-01
(13)C-metabolic flux analysis ((13)C-MFA) has become a key method for metabolic engineering and systems biology. In the most common methodology, fluxes are calculated by global isotopomer balancing and iterative fitting to stationary (13)C-labeling data. This approach requires a closed carbon balance, long-lasting metabolic steady state, and the detection of (13)C-patterns in a large number of metabolites. These restrictions mostly reduced the application of (13)C-MFA to the central carbon metabolism of well-studied model organisms grown in minimal media with a single carbon source. Here we introduce non-stationary (13)C-metabolic flux ratio analysis as a novel method for (13)C-MFA to allow estimating local, relative fluxes from ultra-short (13)C-labeling experiments and without the need for global isotopomer balancing. The approach relies on the acquisition of non-stationary (13)C-labeling data exclusively for metabolites in the proximity of a node of converging fluxes and a local parameter estimation with a system of ordinary differential equations. We developed a generalized workflow that takes into account reaction types and the availability of mass spectrometric data on molecular ions or fragments for data processing, modeling, parameter and error estimation. We demonstrated the approach by analyzing three key nodes of converging fluxes in central metabolism of Bacillus subtilis. We obtained flux estimates that are in agreement with published results obtained from steady state experiments, but reduced the duration of the necessary (13)C-labeling experiment to less than a minute. These results show that our strategy enables to formally estimate relative pathway fluxes on extremely short time scale, neglecting cellular carbon balancing. Hence this approach paves the road to targeted (13)C-MFA in dynamic systems with multiple carbon sources and towards rich media. © 2013 Wiley Periodicals, Inc.
Site-selective {sup 13}C labeling of proteins using erythrose
Energy Technology Data Exchange (ETDEWEB)
Weininger, Ulrich, E-mail: ulrich.weininger@physik.uni-halle.de [Lund University, Department of Biophysical Chemistry, Center for Molecular Protein Science (Sweden)
2017-03-15
NMR-spectroscopy enables unique experimental studies on protein dynamics at atomic resolution. In order to obtain a full atom view on protein dynamics, and to study specific local processes like ring-flips, proton-transfer, or tautomerization, one has to perform studies on amino-acid side chains. A key requirement for these studies is site-selective labeling with {sup 13}C and/or {sup 1}H, which is achieved in the most general way by using site-selectively {sup 13}C-enriched glucose (1- and 2-{sup 13}C) as the carbon source in bacterial expression systems. Using this strategy, multiple sites in side chains, including aromatics, become site-selectively labeled and suitable for relaxation studies. Here we systematically investigate the use of site-selectively {sup 13}C-enriched erythrose (1-, 2-, 3- and 4-{sup 13}C) as a suitable precursor for {sup 13}C labeled aromatic side chains. We quantify {sup 13}C incorporation in nearly all sites in all 20 amino acids and compare the results to glucose based labeling. In general the erythrose approach results in more selective labeling. While there is only a minor gain for phenylalanine and tyrosine side-chains, the {sup 13}C incorporation level for tryptophan is at least doubled. Additionally, the Phe ζ and Trp η2 positions become labeled. In the aliphatic side chains, labeling using erythrose yields isolated {sup 13}C labels for certain positions, like Ile β and His β, making these sites suitable for dynamics studies. Using erythrose instead of glucose as a source for site-selective {sup 13}C labeling enables unique or superior labeling for certain positions and is thereby expanding the toolbox for customized isotope labeling of amino-acid side-chains.
Synthesis of ring-13C-labelled and ring-demethylated retinals
International Nuclear Information System (INIS)
Courtin, J.M.L.
1988-01-01
Efficient synthetic schemes are described for the preparation of the required mono- and di- 13 C labelled retinals based on simple 13 C labelled starting materials. Results from solid-state 13 C-NMR spectroscopic studies of the various ring- 13 C labelled bacteriorhodopsins and rhodopsins are discussed. 404 refs.; 74 figs.; 16 tabs
Retrobiosynthetic NMR studies with 13C-labeled glucose. Formation of gallic acid in plants and fungi
International Nuclear Information System (INIS)
Werner, I.; Bacher, A.; Eisenreich, W.
1997-01-01
The biosynthesis of gallic acid was studied in cultures of the fungus Phycomyces blakesleeanus and in leaves of the tree Rhus typhina. Fungal cultures were grown with [1-13C]glucose or with a mixture of unlabeled glucose and [U-13C6]glucose. Young leaves of R. typhina were kept in an incubation chamber and were supplied with a solution containing a mixture of unlabeled glucose and [U-13C6]glucose via the leaf stem. Isotope distributions in isolated gallic acid and aromatic amino acids were analyzed by one-dimensional 1H and 13C NMR spectroscopy. A quantitative analysis of the complex isotopomer composition of metabolites was obtained by deconvolution of the 13C13C coupling multiplets using numerical simulation methods. This approach required the accurate analysis of heavy isotope chemical shift effects in a variety of different isotopomers and the analysis of long range 13C13C coupling constants. The resulting isotopomer patterns were interpreted using a retrobiosynthetic approach based on a comparison between the isotopomer patterns of gallic acid and tyrosine. The data show that both in the fungus and in the plant all carbon atoms of gallic acid are biosynthetically equivalent to carbon atoms of shikimate. Notably, the carboxylic group of gallic acid is derived from the carboxylic group of an early intermediate of the shikimate pathway and not from the side chain of phenylalanine or tyrosine. It follows that the committed precursor of gallic acid is an intermediate of the shikimate pathway prior to prephenate or arogenate, most probably 5-dehydroshikimate. A formation of gallic acid via phenylalanine, the lignin precursor, caffeic acid, or 3,4, 5-trihydroxycinnamic acid can be ruled out as major pathways in the fungus and in young leaves of R. typhina. The incorporation of uniformly 13C-labeled glucose followed by quantitative NMR analysis of isotopomer patterns is suggested as a general method for biosynthetic studies. As shown by the plant experiment, this
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false Aesthetics. 240.207 Section 240.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES GUIDELINES FOR THE THERMAL PROCESSING OF SOLID WASTES Requirements and Recommended Procedures § 240.207 Aesthetics. ...
International Nuclear Information System (INIS)
London, R.E.; Walker, T.E.; Kollman, V.H.; Matwiyoff, N.A.
1978-01-01
13 C NMR studies of the chemical shifts and carbon--carbon spin--spin coupling constants of 90% [U- 13 C]aspartic and -glutamic acids are reported. Effects of titration of the two carboxyl groups are separated computationally and the results compared with those for asparagine and glutamine, aspartate and glutamate containing peptides, and a series of amino-n-butyric acids. The results indicate that the carboxyl carbon shift resulting from titration of the carboxyl group is strongly dependent on its distance (number of bonds) from an amino group. Alternatively, remote methyl groups exhibit a much smaller titration induced shift than carboxyl groups in the corresponding position. Significant remote effects of pH titration on the one-bond carbon-carbon coupling are also observed, particularly for couplings involving the side-chain carboxyl carbons. These results are discussed in terms of polarization of the C--O bonds in response to titration of a remote carboxyl group. Values of 3 J/sub CC/ in asparate and glutamate indicate a strong conformational dependence. Rotamer populations predicted on the basis of the observed couplings and theoretical INDO calculations are in good agreement with values based on analysis of the 3 J/sub HH/ and 3 J/sub CH/ couplings. For a given conformation of glutamic acid, it is found that 3 J 14 is considerably smaller than 3 J 25 . This result is consistent with obsrvations on a number of other 13 C-labeled amino acids. 5 figures, 4 tables
Inference of past atmospheric delta13C and P/sub CO2/ from 13C/12C measurements in tree rings
International Nuclear Information System (INIS)
Leavitt, S.W.
1982-01-01
Carbon dioxide release from fossil-fuel burning is significant enough that we may soon experience perceptible changes in climate with important human consequences. An accurate reconstruction of past 13 C/ 12 C ratios of atmospheric CO 2 may provide key constraints on the historical activity of the biosphere as CO 2 source or sink. Tree rings appear to be a repository of this information but there is much noise in the collection of previous reconstructions, presumably associated with site selection, radial variability, choice of representative wood chemical constituent, and subtle effects of climate on fractionation. This study attempts to avoid these pitfalls and develop a 50-yr delta 13 C/sub ATM/ record from juniper trees (genus Juniperus), in fact, by taking advantage of the influence of climate on fractionation. Trees were harvested from suitable sites in close proximity to weather stations with monthly records of temperature and precipitation. The most useful relationships for at most 7 of the 10 sites were delta 13 C with December temperature or precipitation, because the coefficients were nearly constant from one interval to the next and the intercepts differed. Local pollution effects are believed responsible for the three anomalous sites. The separation of these regression lines of different intervals is interpreted as the response of the trees to the changing delta 13 C of atmospheric CO 2 so that delta 13 C/sub ATM/ curves are constructed from this spacing. The shape of the best-fit reconstruction suggests the biosphere has acted as CO 2 source to about 1965 and may now be a net sink
Wutzke, Klaus D; Forberger, Anke; Wigger, Marianne
2008-06-01
The aim of this study was to investigate the hepatic microsomal and mitochondrial functions by using the 13CO2-breath test in healthy subjects either before or after the consumption of red wine. Fourteen adults received [13C]methacetin and [methyl-13C]methionine together with a standardised dinner. Expired air samples were taken over 6 h. After a wash-out period, the subjects consumed 0.4 ml ethanol/kg/day together with dinner over a 10-day period. Thereafter, 13C-tracer administration was repeated under identical conditions. The 13CO2-enrichments were measured by isotope ratio mass spectrometry. The mean cumulative percentage 13C-dose recovery (CPDR) after administration of [13C]methacetin and [methyl-13C]methionine either without or with red wine consumption amounted to 38.2+/-6.3 vs. 36.3+/-6.7% (p=0.363) and 9.5+/-3.3 vs. 8.8+/-2.5% (p=0.47), respectively. Moderate alcohol consumption does not induce significant short-term changes of the microsomal and the mitochondrial functions of the human liver in healthy subjects.
Synthesis of [21-13C]-cholesterol
International Nuclear Information System (INIS)
Caballero, G.M.; Gros, E.G.
1994-01-01
The synthesis of [21- 13 C]-cholesterol from 3β-O-(t-butyldimethylsilyl)-17β-cyano-androst-5-ene is described. Labelled carbon-atom was introduced by Grignard reaction of nitrile derivative with [ 13 C]-methylmagnesium iodide. Location of label was confirmed by 13 C-NMR spectroscopy. (author)
Energy Technology Data Exchange (ETDEWEB)
Carmo, Thacyla C. do; Lopes, Grazielle; Silva, Joaquim F.M. da; Nascimento, Regina S.V., E-mail: cycyla@hotmail.co [Universidade Federal do Rio de Janeiro (UFRJ), RJ (Brazil). Polo de Xistoquimica
2009-07-01
N,N,N-trimethyl chitosan (TMC) hydrophobically modified can act as an excellent additive for drilling fluids water based, working as inhibitor of reactive shales and rheological modifiers. The cationic chitosan was obtained by reaction of chitosan with CH{sub 3}I in N-methyl-2-pyrrolidone to obtain the TMC and chitosan was also hydrophobically modified with palmitoil chloride to get Quit P. Through another route, Quit P was modified to obtain the cationic TMCP. The derivatives were characterized by FT-IR and {sup 1}HNMR spectrophotometry allowing the calculation of the degree of quaternization of the TMC. The rheology tests showed that the system with TMCP presented pseudo plastic behavior, while the system with TMC behaved as a Newtonian fluid. The results indicated that TMCP can act as rheology modifier for water-based drilling fluids. (author)
International Nuclear Information System (INIS)
Wang, Jingzhu; Yang, Rui; Yang, Wenning; Liu, Xin; Xing, Yanyi; Xu, Youxuan
2014-01-01
Highlights: • 13 C labeled testosterone can be used to adjust the isotope ratio of testosterone. • The novel testosterone cannot be detected by the regular IRMS method in doping test. • A method was explored to remove the labeled 13 C. • The established method can be used to detect the manipulated testosterone. - Abstract: Isotope ratio mass spectrometry (IRMS) is applied to confirm testosterone (T) abuse by determining the carbon isotope ratios (δ 13 C value). However, 13 C labeled standards can be used to control the δ 13 C value and produce manipulated T which cannot be detected by the current method. A method was explored to remove the 13 C labeled atom at C-3 from the molecule of androsterone (Andro), the metabolite of T in urine, to produce the resultant (A-nor-5α-androstane-2,17-dione, ANAD). The difference in δ 13 C values between Andro and ANAD (Δδ 13 C Andro–ANAD , ‰) would change significantly in case manipulated T is abused. Twenty-one volunteers administered T manipulated with different 13 C labeled standards. The collected urine samples were analyzed with the established method, and the maximum value of Δδ 13 C Andro–ANAD post ingestion ranged from 3.0‰ to 8.8‰. Based on the population reference, the cut-off value of Δδ 13 C Andro–ANAD for positive result was suggested as 1.2‰. The developed method could be used to detect T manipulated with 3- 13 C labeled standards
Iminium ion chemistry of mitosene DNA alkylating agents. Enriched 13C NMR and isolation studies.
Ouyang, A; Skibo, E B
2000-05-16
Described herein is a study of the reductive alkylation chemistry of mitosene antitumor agents. We employed a 13C-enriched electrophilic center to probe the fate of the iminium ion resulting from reductive activation. The 13C-labeled center permitted the identification of complex products resulting from alkylation reactions. In the case of DNA reductive alkylation, the type and number of alkylation sites were readily assessed by 13C NMR. Although there has been much excellent work done in the area of mitosene chemistry and biochemistry, the present study provides a number of new findings: (1) The major fate of the iminium ion is head-to-tail polymerization, even in dilute solutions. (2) Dithionite reductive activation results in the formation of mitosene sulfite esters as well as the previously observed sulfonate adducts. (3) The mitosene iminium ion alkylates the adenosine 6-amino group as well as the guanosine 2-amino group. The identification of the latter adduct was greatly facilitated by the 13C-label at the electrophilic center. (4) The mitosene iminium ion alkylates DNA at both nitrogen and oxygen centers without any apparent base selectivity. The complexity of mitosene reductive alkylation of DNA will require continued adduct isolation studies.
Whole-core analysis by 13C NMR
International Nuclear Information System (INIS)
Vinegar, H.J.; Tutunjian, P.N.; Edelstein, W.A.; Roemer, P.B.
1991-01-01
This paper reports on a whole-core nuclear magnetic resonance (NMR) system that was used to obtain natural abundance 13 C spectra. The system enables rapid, nondestructive measurements of bulk volume of movable oil, aliphatic/aromatic ratio, oil viscosity, and organic vs. carbonate carbon. 13 C NMR can be used in cores where the 1 H NMR spectrum is too broad to resolve oil and water resonances separately. A 5 1/4-in. 13 C/ 1 H NMR coil was installed on a General Electric (GE) CSI-2T NMR imager/spectrometer. With a 4-in.-OD whole core, good 13 C signal/noise ratio (SNR) is obtained within minutes, while 1 H spectra are obtained in seconds. NMR measurements have been made of the 13 C and 1 H density of crude oils with a wide range of API gravities. For light- and medium-gravity oils, the 13 C and 1 H signal per unit volume is constant within about 3.5%. For heavy crudes, the 13 C and 1 H density measured by NMR is reduced by the shortening of spin-spin relaxation time. 13 C and 1 H NMR spin-lattice relaxation times were measured on a suite of Cannon viscosity standards, crude oils (4 to 60 degrees API), and alkanes (C 5 through C 16 ) with viscosities at 77 degrees F ranging from 0.5 cp to 2.5 x 10 7 cp. The 13 C and 1 H relaxation times show a similar correlation with viscosity from which oil viscosity can be estimated accurately for viscosities up to 100 cp. The 13 C surface relaxation rate for oils on water-wet rocks is very low. Nonproton decoupled 13 C NMR is shown to be insensitive to kerogen; thus, 13 C NMR measures only the movable hydrocarbon content of the cores. In carbonates, the 13 C spectrum also contains a carbonate powder pattern useful in quantifying inorganic carbon and distinguishing organic from carbonate carbon
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 207.24 Section 207.24 Customs Duties... EXPORTS TO THE UNITED STATES Final Determinations, Short Life Cycle Products § 207.24 Hearing. (a) In general. The Commission shall hold a hearing concerning an investigation before making a final...
Directory of Open Access Journals (Sweden)
Potti Anil
2005-06-01
Full Text Available Abstract Background The rate of detection of HER-2/neu and CD117 (c-kit overexpression in small cell lung cancer (SCLC has varied widely; between 5–35% and 21–70% respectively. Methods To evaluate the relationship between pesticide exposure and HER-2/neu and CD117 overexpression in extensive stage SCLC (ESSCLC, we identified patients with ESSCLC and assessed pesticide exposure using a predetermined questionnaire. An exposure index (hours/day × days/year × years ≥ 2400 hours was considered as 'exposed.' HER-2/neu overexpression was evaluated on archival tissue using the DAKO Hercep test, and CD117 testing was performed using immunohistochemistry (A4052 polyclonal antibody. Results 193 ESSCLC patients were identified. Pesticide exposure data could be obtained on 174 patients (84 females and 109 males with a mean age of 68.5 years. 53/174 (30.4% revealed HER-2/neu overexpression. 54/174 (31.03% specimens showed CD117 overexpression by IHC. On multivariate analysis, HER-2/neu overexpression was associated with diminished survival (p neu overexpression and 47/121 (38.8% patients without overexpression had exposure to pesticides (odds ratio: 5.38; p Conclusion Pesticide exposure affects HER-2/neu but not CD117 overexpression. Future studies are needed to determine specific pesticide(s/pesticide components that are responsible for HER-2/neu overexpression in ESSCLC, and to validate our findings in other solid tumors that overexpress HER-2/neu.
{sup 13}C relaxation in an RNA hairpin
Energy Technology Data Exchange (ETDEWEB)
King, G.C. [Univ. of South Wales, Kensington (Australia)]|[Rice Univ., Houston, TX (United States); Akratos, C. [Univ. of South Wales, Kensington (Australia); Xi, Z.; Michnica, M.J. [Rice Univ., Houston, TX (United States)
1994-12-01
This initial survey of {sup 13}C relaxation in the {triangle}TAR RNA element has generated a number of interesting results that should prove generally useful for future studies. The most readily comparable study in the literature monitored {sup 13}C relaxation of the methyl groups from unusual bases in tRNA{sup Phe}. The study, which used T{sub 1} and NOE data only, reported order parameters for the methyl group axis that ranged between 0.51 and 0.97-a range similar to that observed here. However, they reported a breakdown of the standard order parameter analysis at higher (118-MHz {sup 13}C) frequencies, which should serve to emphasize the need for a thorough exploration of suitable motional models.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Moisture. 868.207 Section 868.207 Agriculture... Application of Standards § 868.207 Moisture. Water content in rough rice as determined by an approved device..., “approved device” shall include the Motomco Moisture Meter and any other equipment that is approved by the...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Discovery. 207.109 Section 207.109 Customs Duties... and Committee Proceedings § 207.109 Discovery. (a) Discovery methods. All parties may obtain discovery under such terms and limitations as the administrative law judge may order. Discovery may be by one or...
Probing the possibility of a C-12/C-13 galactic abundance gradient
International Nuclear Information System (INIS)
Hawkins, I.
1990-01-01
High S/N (equal to or greater than 500) observations of interstellar CH+ with the 3.0 m telescope were performed at Lick Observatory and with the 4.0 m telescope at CTIO, of the reddened, early-type stars HD 183143, HD 24432, and HD 157038 in an effort to probe the existence of a C-12/C-13 abundance gradient in our Galaxy. Previous very high quality optical observations of interstellar CH+ toward five stars within 1 kpc of the Sun have yielded a precise weighted mean C-12/C-13 isotope ratio of 43 plus or minus 4 (1 sigma) (Hawkins, Jura, and Meyer 1985; Hawkins and Jura 1987). The isotope ratios derived toward four lines of sight in the local ISM are uniform within 12 percent. The similarity among these carbon isotope ratios determined in diffuse clouds possessing different physical conditions precludes the possibility that the CH+ molecule is suffering from isotope selective effects in these regions. The precise C-12/C-13 derivable from high quality observations of (12)CH+ and (13)CH+ provide the unique opportunity to probe the homogeneity of the ISM in a large scale and the history of nucleosynthesis in our Galaxy. Since CH+ seems to be the most sensitive probe of C-12/C-13 in the diffuse ISM, observations toward more distant stars located up to 2.5 kpc from the Sun are the best way to study the possibility of a Galactic (C-12/C-13) abundance gradient. The researcher obtained 4232 angstrom data toward all three of the stars mentioned above, 3957 angstrom data toward HD 183143 and HD 157038, and 3745 angstrom data toward HD 157038. Because of the poorer quality of the HD 24432 spectrum, and its weaker CH+ absorption lines, the satellite (13)CH+ line was not detected, and thus only a lower limit on the C-12/C-13 ratio toward this star was obtained. The results obtained from careful reduction and analysis of the data toward these stars in the Northern and Southern Hemispheres are presented
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Discovery. 498.207 Section 498.207 Employees... § 498.207 Discovery. (a) For the purpose of inspection and copying, a party may make a request to...) Any form of discovery other than that permitted under paragraph (a) of this section, such as requests...
De TMC à CARTAX ou d'un logiciel de recherche à un logiciel d'enseignement
Directory of Open Access Journals (Sweden)
Marie-Françoise DURAND
1987-03-01
Full Text Available TMC est un logiciel qui permet de transcrire visuellement un tableau de données sous forme de matrice ordonnable. CARTAX est destiné aux enseignants, au sens le plus large du terme. Ainsi la carte devient document de recherche dès l'école: carte à jeter ou carte à refaire. Ne pourrait-on imaginer un logiciel complet mais ouvert prenant en compte la chaîne complète de traitement?
McNair, Laura F; Kornfelt, Rasmus; Walls, Anne B; Andersen, Jens V; Aldana, Blanca I; Nissen, Jakob D; Schousboe, Arne; Waagepetersen, Helle S
2017-03-01
Brain slice preparations from rats, mice and guinea pigs have served as important tools for studies of neurotransmission and metabolism. While hippocampal slices routinely have been used for electrophysiology studies, metabolic processes have mostly been studied in cerebral cortical slices. Few comparative characterization studies exist for acute hippocampal and cerebral cortical slices, hence, the aim of the current study was to characterize and compare glucose and acetate metabolism in these slice preparations in a newly established incubation design. Cerebral cortical and hippocampal slices prepared from 16 to 18-week-old mice were incubated for 15-90 min with unlabeled glucose in combination with [U- 13 C]glucose or [1,2- 13 C]acetate. Our newly developed incubation apparatus allows accurate control of temperature and is designed to avoid evaporation of the incubation medium. Subsequent to incubation, slices were extracted and extracts analyzed for 13 C-labeling (%) and total amino acid contents (µmol/mg protein) using gas chromatography-mass spectrometry and high performance liquid chromatography, respectively. Release of lactate from the slices was quantified by analysis of the incubation media. Based on the measured 13 C-labeling (%), total amino acid contents and relative activity of metabolic enzymes/pathways, we conclude that the slice preparations in the current incubation apparatus exhibited a high degree of metabolic integrity. Comparison of 13 C-labeling observed with [U- 13 C]glucose in slices from cerebral cortex and hippocampus revealed no significant regional differences regarding glycolytic or total TCA cycle activities. On the contrary, results from the incubations with [1,2- 13 C]acetate suggest a higher capacity of the astrocytic TCA cycle in hippocampus compared to cerebral cortex. Finally, we propose a new approach for assessing compartmentation of metabolite pools between astrocytes and neurons using 13 C-labeling (%) data obtained from
12 CFR 207.11 - Other definitions and rules of construction used in this part.
2010-01-01
... THE FEDERAL RESERVE SYSTEM DISCLOSURE AND REPORTING OF CRA-RELATED AGREEMENTS (REGULATION G) § 207.11... (ii) The NGEP that is a party to the agreement makes a CRA communication, as described in § 207.3. (b) Control. “Control” is defined in section 2(a) of the Bank Holding Company Act (12 U.S.C. 1841(a)). (c) CRA...
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Hearing. 207.66 Section 207.66 Customs Duties... EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.66 Hearing. (a) In general. The Commission shall hold a hearing in each full review. The date of the hearing shall be specified in the scheduling notice...
Isotopically (δ13C and δ18O) heavy volcanic plumes from Central Andean volcanoes: a field study
Schipper, C. Ian; Moussallam, Yves; Curtis, Aaron; Peters, Nial; Barnie, Talfan; Bani, Philipson; Jost, H. J.; Hamilton, Doug; Aiuppa, Alessandro; Tamburello, Giancarlo; Giudice, Gaetano
2017-08-01
Stable isotopes of carbon and oxygen in volcanic gases are key tracers of volatile transfer between Earth's interior and atmosphere. Although important, these data are available for few volcanoes because they have traditionally been difficult to obtain and are usually measured on gas samples collected from fumaroles. We present new field measurements of bulk plume composition and stable isotopes (δ13CCO2 and δ18OH2O+CO2) carried out at three northern Chilean volcanoes using MultiGAS and isotope ratio infrared spectroscopy. Carbon and oxygen in magmatic gas plumes of Lastarria and Isluga volcanoes have δ13C in CO2 of +0.76‰ to +0.77‰ (VPDB), similar to slab carbonate; and δ18O in the H2O + CO2 system ranging from +12.2‰ to +20.7‰ (VSMOW), suggesting significant contributions from altered slab pore water and carbonate. The hydrothermal plume at Tacora has lower δ13CCO2 of -3.2‰ and δ18OH2O+CO2 of +7.0‰, reflecting various scrubbing, kinetic fractionation, and contamination processes. We show the isotopic characterization of volcanic gases in the field to be a practical complement to traditional sampling methods, with the potential to remove sampling bias that is a risk when only a few samples from accessible fumaroles are used to characterize a given volcano's volatile output. Our results indicate that there is a previously unrecognized, relatively heavy isotopic signature to bulk volcanic gas plumes in the Central Andes, which can be attributed to a strong influence from components of the subducting slab, but may also reflect some local crustal contamination. The techniques we describe open new avenues for quantifying the roles that subduction zones and arc volcanoes play in the global carbon cycle.
Wang, Jingzhu; Yang, Rui; Yang, Wenning; Liu, Xin; Xing, Yanyi; Xu, Youxuan
2014-12-10
Isotope ratio mass spectrometry (IRMS) is applied to confirm testosterone (T) abuse by determining the carbon isotope ratios (δ(13)C value). However, (13)C labeled standards can be used to control the δ(13)C value and produce manipulated T which cannot be detected by the current method. A method was explored to remove the (13)C labeled atom at C-3 from the molecule of androsterone (Andro), the metabolite of T in urine, to produce the resultant (A-nor-5α-androstane-2,17-dione, ANAD). The difference in δ(13)C values between Andro and ANAD (Δδ(13)CAndro-ANAD, ‰) would change significantly in case manipulated T is abused. Twenty-one volunteers administered T manipulated with different (13)C labeled standards. The collected urine samples were analyzed with the established method, and the maximum value of Δδ(13)CAndro-ANAD post ingestion ranged from 3.0‰ to 8.8‰. Based on the population reference, the cut-off value of Δδ(13)CAndro-ANAD for positive result was suggested as 1.2‰. The developed method could be used to detect T manipulated with 3-(13)C labeled standards. Copyright © 2014 Elsevier B.V. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Krividin, L.B.; Kalabin, G.A.
1985-08-10
The authors measure the direct geminal and vicinal spinspin coupling constants between the C-13 nuclei of the phenyl group in the series of alkyl phenyl sulfides C/sub 6/H/sub 5/SR. It was shown that the variation in most of the discussed constants is determined by the ratio of the planar and orthogonal conformers. Linear relationships were obtained between the C-13-C-13 constants and the fractions of the planar conformer. The C-13-C-13 spin-spin coupling constants in the planar and orthogonal conformers of the compounds were calculated by means of empirical relationships.
13C n.m.r. study of solvation mechanisms in the radiation-induced polymerization of vinyl ethers
International Nuclear Information System (INIS)
Deffieux, A.; Subira, F.; Stannett, V.T.
1984-01-01
A 13 C n.m.r. study of the microstructure of ethyl vinyl ether (EVE) and isopropyl vinyl ether (IPVE) polymers prepared under various experimental conditions and using chemical or γ-ray initiation has been made. Long stereo-sequence assignments were conducted for poly EVE allowing determination of the configurational statistics of propagation in the radiation-induced polymerization of EVE in low polar solvents. Stereo-sequence intensities are found in good agreement with the Markovian model. The results are considered as further support for the occurrence of a specific interaction between the growing active centres and the polymer chains. In the case of IPVE polymers much more important overlappings of the resonance patterns are observed thus preventing any similar detailed study. (author)
Yamanaka, Nodoka; Yamada, Taiichi; Hiyama, Emiko; Funaki, Yasuro
2017-06-01
We calculate for the first time the electric dipole moment (EDM) of 13C generated by the isovector charge conjugation-parity (CP)-odd pion exchange nuclear force in the α -cluster model, which describes well the structures of low-lying states of the 13C nucleus. The linear dependence of the EDM of 13C on the neutron EDM and the isovector CP-odd nuclear coupling is found to be d13C=-0.33 dn-0.0020 G¯π(1 ) . The linear enhancement factor of the CP-odd nuclear coupling is smaller than that of the deuteron, due to the difference of the structure between the 1 /21- state and the opposite-parity (1 /2+ ) states. We clarify the role of the structure played in the enhancement of the EDM. This result provides good guiding principles to search for other nuclei with large enhancement factor. We also mention the role of the EDM of 13C in determining the new physics beyond the standard model.
Characterization of methacetin-methoxy-"1"3C
International Nuclear Information System (INIS)
Lu Weijing; Lu Hao; Yang Weicheng; Liu Weixia; Li Shuai; Xu Zhongjie; Guan Liang; Zhu Chengmo; Chen Suyun; Jiang Lei
2010-01-01
Methacetin-methoxy-"1"3C was synthesized by using methanol-"1"3C with a novel method, and the characterization of it was performed using HPLC, LC-MS and "1HMNR. The results indicated that the synthetic was right. And the yield of methacetin-methoxy-"1"3C was 70.0% with 99% "1"3C abundance and 99.8% purity. Compared with the classical method, there was more benefit. The methacetin "1"3C-breath test was performed with the synthetic on the live mice, which showed a precise reflection of alteration of liver function in liver injury and functional recovery. (authors)
NMR study of the 1-13C glucose colon bacterial metabolism
International Nuclear Information System (INIS)
Briet, F.; Flourie, B.; Pochart, P.; Rambaud, J.C.; Desjeux, J.F.; Dallery, L.; Grivet, J.P.
1994-01-01
The aim of the study is to examine in-vitro and by nuclear magnetic resonance the biological pathways for the fermentation of the 1- 13 C labelled glucose (99 atoms percent) by human colon bacteria. The preparation of the bacterial suspension and the glucose degradation kinetics are presented; the NMR analysis sensitivity and quantification features are discussed and results are presented. 2 figs., 1 ref
International Nuclear Information System (INIS)
Jacob, Jaison; Louis, John M.; Nesheiwat, Issa; Torchia, Dennis A.
2002-01-01
Analysis of 2D [ 13 C, 1 H]-HSQC spectra of biosynthetic fractionally 13 C labeled proteins is a reliable, straightforward means to obtain stereospecific assignments of Val and Leu methyl sites in proteins. Herein we show that the same fractionally labeled protein sample facilitates observation and identification of Phe and Tyr aromatic signals. This is the case, in part, because the fractional 13 C labeling yields aromatic rings in which some of the 13 C- 13 C J-couplings, present in uniformly labeled samples, are absent. Also, the number of homonuclear J-coupling partners differs for the δ-, ε- and ζ-carbons. This enabled us to vary their signal intensities in distinctly different ways by appropriately setting the 13 C constant-time period in 2D [ 13 C, 1 H]-HSQC spectra. We illustrate the application of this approach to an 18 kDa protein, c-VIAF, a modulator of apoptosis. In addition, we show that cancellation of the aromatic 13 C CSA and 13 C- 1 H dipolar interactions can be fruitfully utilized in the case of the fractionally labeled sample to obtain high resolution 13 C constant-time spectra with good sensitivity
13C/12C ratios in human urine concrementes
International Nuclear Information System (INIS)
Hoefs, J.; Armbruster, T.
1978-01-01
Oxalate, uric acid, and phosphate stones have been analyzed for their carbon isotope composition. The oxalate stones show delta 13 C values between -17.0 and -19.5 pro mille, the uric acid stones between -14.9 and -19.4 pro mille, and the phosphate stones between -13.0 and -23.9 pro mille. It is proposed that endogenic rather than exogenic sources are responsible for the 13 C/ 12 C ratios of the stones. The isotopic composition of the phosphate stones seems to be influenced primarily by bacterial activity. (orig.) [de
Evaluation of the Fatigue Performance and Degradability of Resorbable PLDLLA-TMC Osteofixations
Landes, Constantin; Ballon, Alexander; Ghanaati, Shahram; Ebel, Daniel; Ulrich, Dieter; Spohn, Uwe; Heunemann, Ute; Sader, Robert; Jaeger, Raimund
2013-01-01
The fatigue performance of explanted in-situ degraded osteofixations/osteosyntheses, fabricated from poly (70L-lactide-co-24DL-lactide-6-trimethylane-carbonate or PLDLLA-TMC) copolymer was compared to that of virgin products. The fatigue test was performed on 21 explants retrieved from 12 women and 6 men; 16-46 years by a custom-designed three-point bend apparatus using a staircase method and a specified failure criterion (an increase of the deflection of the specimen > 1 mm) with run-out designated as “no failure” after 150,000 loading cycles. While all the virgin products showed run-out at 38N, all of the specimens fabricated from explants failed at this load level. For the explant specimens, although there was a trend of decreased failure load with increased in-situ time, this decrease was pronounced after 4 months in-situ, however, not yet statistically significant, while a 6-month in-situ explant had significantly less failure load. Three and four month in-situ explants had highly significant differences in failure load between measurements close and distant to the osteotomy line: p=0.0017 (the region of maximum load in-situ). In the virgin products, there were only traces of melt joining and cooling, left from a stage in the manufacturing process. For the implants retrieved after 4.5 months in-situ, the fracture surfaces showed signs of degradation of the implants, possibly caused by hydrolysis, and for those retrieved after 9 months in-situ, there were cracks and pores. Thus, the morphological results are consistent with those obtained in the fatigue test. The present results suggest that resorbable osteofixations fabricated from PLDLLA-TMC are stable enough to allow loading of the healing bone and degrade reliably PMID:24363786
Miccheli, Alfredo; Puccetti, Caterina; Capuani, Giorgio; Di Cocco, Maria Enrica; Giardino, Luciana; Calzà, Laura; Battaglia, Angelo; Battistin, Leontino; Conti, Filippo
2003-03-14
Age-related changes in glucose utilization through the TCA cycle were studied using [1-13C]glucose and 13C, 1H NMR spectroscopy on rat brain extracts. Significant increases in lactate levels, as well as in creatine/phosphocreatine ratios (Cr/PCr), and a decrease in N-acetyl-aspartate (NAA) and aspartate levels were observed in aged rat brains as compared to adult animals following glucose administration. The total amount of 13C from [1-13C]glucose incorporated in glutamate, glutamine, aspartate and GABA was significantly decreased in control aged rat brains as compared to adult brains. The results showed a decrease in oxidative glucose utilization of control aged rat brains. The long-term nicergoline treatment increased NAA and glutamate levels, and decreased the lactate levels as well as the Cr/PCr ratios in aged rat brains as compared to adult rats. The total amount of 13C incorporated in glutamate, glutamine, aspartate, NAA and GABA was increased by nicergoline treatment, showing an improvement in oxidative glucose metabolism in aged brains. A significant increase in pyruvate carboxylase/pyruvate dehydrogenase activity (PC/PDH) in the synthesis of glutamate in nicergoline-treated aged rats is consistent with an increase in the transport of glutamine from glia to neurons for conversion into glutamate. In adult rat brains, no effect of nicergoline on glutamate PC/PDH activity was observed, although an increase in PC/PDH activity in glutamine was, suggesting that nicergoline affects the glutamate/glutamine cycle between neurons and glia in different ways depending on the age of animals. These results provide new insights into the effects of nicergoline on the CNS.
13C NMR and EPR spectroscopic evaluation of oil shale mined soil recuperation
International Nuclear Information System (INIS)
Santos, J.V. dos; Mangrich, A.S.; Pereira, B.F.; Pillon, C.N.; Bonagamba, T.J.
2013-01-01
In this work, native forest soil (NFS) organic matter (SOM) sample and SOM samples from a neighboring forest soil area of an oil shale mine which is being rehabilitated for thirty years (RFS) were analyzed. X-band electron paramagnetic resonance (EPR) and solid-state 13 C nuclear magnetic resonance (NMR) spectroscopies were used to evaluate the soil reclamation of the Brazilian oil shale mining process. Two-dimensional heterospectral correlation studies of the results obtained from EPRand 13 C NMR were used to obtain information about SOM structures and their interactions with residual paramagnetic metal ion. The signal of the residual metallic oxycation, VO 2+ correlated positively with uronic acid-type hydrophilic organic structures, determined from the 13 C NMR spectra, and correlated negatively with the organic free radical (OFR) signal associated with oxygen atoms (g = 2.0042). The hydrophobic aromatic structures correlate positively with the EPR OFR signal associated with carbon atoms (g = 2.0022). The data from the two spectroscopic magnetic techniques show that the used recuperation process is effective. (author)
Experimental study of radiative pion capture on 13C, 20Ne, 90Zr, 19F and 12C
International Nuclear Information System (INIS)
Martoff, C.J.
1980-11-01
Photon spectra for 50 13 C, 19 F, 20 Ne, and 90 Zr. The e + e - pair spectrometer system used has resolution 850 keV fwhm and photon detection efficiency 5 x 10 -6 . The total radiative capture branching ratios measured are 13 C (1.66 +- 0.25)%, 19 F (2.40 +- 0.48)%, 20 Ne (1.60 +- 0.24)%, and 90 Zr (2.1 +- 0.5)%. The partial radiative capture branching ratios to four bound states and two resonances in 20 F, and two bound states and three resonances in 13 B have also been measured. The branching ratio for 13 C(π - ,γ) 13 B g.s. is (6.1 +- 1.2) x 10 -4 . Comparison of this result with the beta decay rate of 13 B shows that (84 +- 16)% of the pion capture amplitude is accounted for by the Gamow-Teller matrix element. Further analysis suggests that much of the remaining strength is E2. The measured branching ratios to resonant states in 13 C(π - ,γ) 13 B are shown to be in agreement with detailed shell model calculations. The total single-particle strength in these transitions is shown to be approximately half as large as that of the T = 3/2 part of the E1 photoresonance (the Giant Dipole Resonance) in 13 C. The branching ratio for 20 Ne(π - ,γ) 20 F (T = 1, J/sup π/ = 1 + , E/sub x/ = 1.06 MeV) is 0.91 +- 0.52).10 -4 . Comparison with the electroexcitation of the analog giant M1 state in 20 Ne (11.24 MeV) shows that the M1 transition amplitude is less than (46 +- 14)% Gamow-Teller. This result is in agreement with detailed shell model calculations of the M1 transition. The photon spectrum for radiative pion capture from flight (reaction 12 C(π + T = 44 MeV, γ at 90 0 )) has been measured. 13 figures, 12 tables
Stereoselective synthesis of L-[4-13C]carnitine
International Nuclear Information System (INIS)
Unkefer, C.J.; Ehler, D.S.
1991-01-01
The stereoselective synthesis of L-[4- 13 C]carnitine was achieved in 5 steps. The label was introduced from K 13 CN into an easily separated diastereomeric pair of 3-deoxy-D-[1- 13 C]aldohexoses. Reductive amination of the labeled aldohexose yielded the corresponding D-1-(dimethylamino)[1- 13 C]alditol which was oxidized in two steps and alkylated with iodomethane to yield L-[4- 13 C]carnitine. The stereochemical integrity at C-2 of the 3-deoxy-D-[1- 13 C]glucose precursor was maintained throughout the synthesis of L-[4- 13 C]carnitine. (author)
Directory of Open Access Journals (Sweden)
Lucila González Molina
2012-11-01
Full Text Available El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS, por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC - a sistemas con higuerilla (Ricinus communis: multiestratos (MUL, callejones (CALL y monocultivo de higuerilla (HIG. Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema TMC. Las tasas de cambio de COS estimadas con el RothC, en ambas profundidades de suelo, estuvieron en 0,5-1,2, 0,4-0,8, 0,3-0,5 y 0,04-0,1 Mg ha-1 de C por año en los sistemas HIG, MUL, CALL y TMC, respectivamente, y fueron consistentes con las reportadas en la literatura. El desempeño del RothC tuvo 89% de eficiencia (EF, con R²=0,9, lo que muestra que este modelo puede usarse con información temporal del COS escasa, información de la historia de uso de suelo y mediciones de la entrada de residuos vegetales aéreos y subterráneos en el suelo.The objective of this work was to simulate, by the RothC model, the changes in soil organic carbon (SOC caused by changes of land use - from the traditional maize-squash (TMC association to systems with castor bean (Ricinus communis: multilayer (MUL, alleys (CALL and monoculture (HIG. SOC simulations were performed for 0-20 and 0-40 cm soil depths, for the period 1980-2040, considering the TMC system as the base line. SOC change rates estimated with RothC, for both soil depths, were 0.5-1.2, 0.4-0.8, 0.3-0.5 and 0.04-0.1 Mg ha-1 C per year in the HIG, MUL, CALL and TMC systems, respectively, and were consistent with those reported in the literature. RothC perfomance had 89% efficiency (EF and R² = 0.9, which shows that this model can be used with scarce SOC temporal information, information on the history of land use, and with input measurements of aerial and underground plant residues in the soil.
Yang, Po-Yu; Miao, Nae-Fang; Lin, Chiao-Wen; Chou, Ying-Erh; Yang, Shun-Fa; Huang, Hui-Chuan; Chang, Hsiu-Ju; Tsai, Hsiu-Ting
2016-01-01
The purpose of this study was to identify gene polymorphisms of mammary serine protease inhibitor (Maspin) specific to patients with oral cancer susceptibility and clinicopathological status. Three single-nucleotide polymorphisms (SNPs) of the Maspin gene from 741 patients with oral cancer and 601 non-cancer controls were analyzed by real-time PCR. The participants with G/G homozygotes or with G/C heterozygotes of Maspin rs2289520 polymorphism had a 2.07-fold (p = 0.01) and a 2.01-fold (p = 0.02) risk of developing oral cancer compared to those with C/C homozygotes. Moreover, gene-gene interaction increased the risk of oral cancer susceptibility among subjects expose to oral cancer related risk factors, including areca, alcohol, and tobacco consumption. G allele of Maspin rs2289520 polymorphism may be a factor that increases the susceptibility to oral cancer. The interactions of gene to oral cancer-related environmental risk factors have a synergetic effect that can further enhance oral cancer development.
A study of the carbon dynamics of Japanese grassland and forest using 14C and 13C
International Nuclear Information System (INIS)
Katsuno, Kazumi; Miyairi, Yosuke; Tamura, Kenji; Matsuzaki, Hiroyuki; Fukuda, Kenji
2010-01-01
We quantified the carbon contents of grassland and forest soil using conventional methods and studied the changes in their dynamics by measuring δ 13 C and Δ 14 C. Soil samples were taken from a neighboring Miscanthus sinensis grassland and Pinus densiflora forest in central Japan. Both had been maintained as grassland until the 1960s, when the latter was abandoned and became a pine forest by natural succession. The soil carbon content of the forest was much lower than that of the grassland, implying that the soil carbon decreased as the grassland became forest. The δ 13 C values were very similar in the grassland and forest, at approximately -20 per mille , suggesting that M. sinensis (a C4 plant) contributed to carbon storage, whereas there was little carbon accumulation from P. densiflora (a C3 plant) in forest soil. The Δ 14 C values and calculated soil carbon mean residence time (MRT) showed that the soil carbon in the upper A horizon was older, and that in the lower A horizon was younger in forest than in grassland. From these results, we conclude that young, fast-MRT soil carbon is decomposed in the upper A horizon, and old, stable soil carbon was decomposed in the lower A horizon after the pine invasion.
Delta /sup 13/C fractionation in Tarbela dam fish
International Nuclear Information System (INIS)
Latif, Z.; Sajjad, M.I.; Bilal, R.; Tasneem, M.A.; Khan, I.H.; Ali, M.
1998-01-01
The paper focuses on the study of naturally occurring /sup 13/C fractionation in Tarbela dam fish. Craig noted that gamma /sup 13/C values for animal tissues fall in the range as their food supply. DeNiro and Epstein demonstrated clearly that the carbon isotope composition of an animal greatly depends on its diet. The above mentioned statements were observed while studying the isotopic composition of carbon in different parts of the fish. Living fish was purchased from the Haripur side of the Tarbela lake. Different portions were separated and fish diet was collected from the fish stomach. Samples were dried in the oven at 40-50 deg. C for five days. Ground, homogenized and ignited with research grade oxygen at 900-1000 deg. C. CO and CO /sub 2/ were produced and CO was converted to CO/sub 2/ by circulation over CuO gauge furnace at 900 deg. C. CO/sub 2/ was purified using 70 deg. C slush and analyzed on Varian Mat (GD-150) mass spectrometer for gamma /sup 13/C measurements. The results show that fish flesh sup/13 C value is nearly similar to fish diet gamma /sup 13/C. gamma /sup 13/C values to different parts of the fish departed from that of the diet in the sequence: fish swim bladder (-22.04) >ribs (2-22.26)>skin (122.91)>diet (123.22)>flesh (-23.40)> vertebral column (-24.07). It is concluded that diet is easily metabolized in the fish flesh and skin tissues through blood streams without causing any pronounced fractionation. Fractionation was observed in the fish endo skeleton system due to which fish ribs become enriched in gamma /sup 13/C than vertebral column. Fractionation was also detected in visceral muscles (swim bladder) of the fish as comparison with somatic axial trunk muscle (fish flesh). (author)
13C NMR and relaxation studies of the nanomagnet Mn12-acetate
Achey, Randall M.; Kuhns, Philip L.; Reyes, Arneil P.; Moulton, William G.; Dalal, Naresh S.
2001-08-01
The nanomagnet [Mn12O12(CH3COO)16(H2O)4].2CH3COOH.4H2O, also known as Mn12, has been synthesized with 13C labeling at the CH3 groups, and investigated by 13C NMR at fields up to 23 T. Using oriented samples, it is possible to resolve four distinct 13C peaks at room temperature, located on both sides of the unshifted Larmor frequency. These peaks were assigned to the four hyperfine-shifted, magnetically inequivalent sets of 13CH3 groups in the Mn12 lattice, based on a comparison with the crystal structure and point-dipole and spin-density calculations. These results establish that the unpaired electron spin density of the S=10 system in this cluster extends over the entire molecular framework, not just the core. These results are discussed in relationship to inelastic neutron scattering measurements. The temperature and field dependence of the 13C nuclear-spin-lattice-relaxation time T1 on the least shifted peak was measured. A single weakly field-dependent minimum at about 60 K is observed in the temperature dependence of the measured T1. The relaxation mechanism responsible for the T1 minimum is ascribed mainly to hindered rotation of the methyl group of the acetate ligand at higher temperature, and to electronic spin fluctuations at lower temperature.
Energy Technology Data Exchange (ETDEWEB)
Bayle, Kevin [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Gilbert, Alexis [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth–Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Julien, Maxime [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Yamada, Keita [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Silvestre, Virginie; Robins, Richard J.; Akoka, Serge [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France); Yoshida, Naohiro [Department of Environmental Chemistry and Engineering, Tokyo Institute of Technology, 4259 Nagatsuta-cho, Midori-ku, Yokohama, Kanagawa 226-8503 (Japan); Earth–Life Science Institute, Tokyo Institute of Technology, Meguro, Tokyo 152-8551 (Japan); Remaud, Gérald S., E-mail: gerald.remaud@univ-nantes.fr [EBSI Team, Interdisciplinary Chemistry: Synthesis, Analysis, Modelling (CEISAM), University of Nantes-CNRS UMR 6230, 2 Rue de la Houssinière, BP 92208, F-44322, Nantes Cedex 3 (France)
2014-10-10
Highlights: • Evaluation of the trueness and precision criteria of isotopic {sup 13}C NMR spectrometry. • Use of bi-labelled [1,2-{sup 13}C{sub 2}]acetic acid to determine the performance of the instrumental response. • Inter-calibration of the {sup 13}C intramolecular composition of acetic acid using the technique GC-Py–irm-MS. - Abstract: Intramolecular {sup 13}C composition gives access to new information on the (bio) synthetic history of a given molecule. Isotopic {sup 13}C NMR spectrometry provides a general tool for measuring the position-specific {sup 13}C content. As an emerging technique, some aspects of its performance are not yet fully delineated. This paper reports on (i) the conditions required to obtain satisfactory trueness and precision for the determination of the internal {sup 13}C distribution, and (ii) an approach to determining the “absolute” position-specific {sup 13}C content. In relation to (i), a precision of <1% can be obtained whatever the molecule on any spectrometer, once quantitative conditions are met, in particular appropriate proton decoupling efficiency. This performance is a prerequisite to the measurement of isotope fractionation either on the transformed or residual compound when a chemical reaction or process is being studied. The study of the trueness has revealed that the response of the spectrometer depends on the {sup 13}C frequency range of the studied molecule, i.e. the chemical shift range. The “absolute value” and, therefore, the trueness of the {sup 13}C NMR measurements has been assessed on acetic acid and by comparison to the results obtained on the fragments from COOH and CH{sub 3} by isotopic mass spectrometry coupled to a pyrolysis device (GC-Py–irm-MS), this technique being the reference method for acetic acid. Of the two NMR spectrometers used in this work, one gave values that corresponded to those obtained by GC-Py–irm-MS (thus, the “true” value) while the other showed a bias, which was
[2,4-(13)C]β-hydroxybutyrate metabolism in astrocytes and C6 glioblastoma cells.
Eloqayli, Haytham; Melø, Torun M; Haukvik, Anne; Sonnewald, Ursula
2011-08-01
This study was undertaken to determine if the ketogenic diet could be useful for glioblastoma patients. The hypothesis tested was whether glioblastoma cells can metabolize ketone bodies. Cerebellar astrocytes and C6 glioblastoma cells were incubated in glutamine and serum free medium containing [2,4-(13)C]β-hydroxybutyrate (BHB) with and without glucose. Furthermore, C6 cells were incubated with [1-(13)C]glucose in the presence and absence of BHB. Cell extracts were analyzed by mass spectrometry and media by (1)H magnetic resonance spectroscopy and HPLC. Using [2,4-(13)C]BHB and [1-(13)C]glucose it could be shown that C6 cells, in analogy to astrocytes, had efficient mitochondrial activity, evidenced by (13)C labeling of glutamate, glutamine and aspartate. However, in the presence of glucose, astrocytes were able to produce and release glutamine, whereas this was not accomplished by the C6 cells, suggesting lack of anaplerosis in the latter. We hypothesize that glioblastoma cells kill neurons by not supplying the necessary glutamine, and by releasing glutamate.
Lee, Da Young; Park, Jeongwoon; Choi, Dooah; Ahn, Hong-Yup; Park, Sung-Woo; Park, Cheol-Young
2018-02-26
This randomized, controlled, open-label study conducted in Kangbuk Samsung Hospital evaluated the effectiveness, reproducibility, and durability of tailored mobile coaching (TMC) on diabetes management. The participants included 148 Korean adult policyholders with type 2 diabetes divided into the Intervention-Maintenance (I-M) group (n = 74) and Control-Intervention (C-I) group (n = 74). Intervention was the addition of TMC to typical diabetes care. In the 6-month phase 1, the I-M group received TMC, and the C-I group received their usual diabetes care. During the second 6-month phase 2, the C-I group received TMC, and the I-M group received only regular information messages. After the 6-month phase 1, a significant decrease (0.6%) in HbA1c levels compared with baseline values was observed in only the I-M group (from 8.1 ± 1.4% to 7.5 ± 1.1%, P < 0.001 based on a paired t-test). At the end of phase 2, HbA1c levels in the C-I group decreased by 0.6% compared with the value at 6 months (from 7.9 ± 1.5 to 7.3 ± 1.0, P < 0.001 based on a paired t-test). In the I-M group, no changes were observed. Both groups showed significant improvements in frequency of blood-glucose testing and exercise. In conclusion, addition of TMC to conventional treatment for diabetes improved glycemic control, and this effect was maintained without individualized message feedback.
33 CFR 207.600 - Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation.
2010-07-01
... 33 Navigation and Navigable Waters 3 2010-07-01 2010-07-01 false Rochester (Charlotte) Harbor, N.Y.; use, administration, and navigation. 207.600 Section 207.600 Navigation and Navigable Waters CORPS OF... (Charlotte) Harbor, N.Y.; use, administration, and navigation. (a)-(b) [Reserved] (c) No vessel shall moor or...
5 CFR 430.207 - Monitoring performance.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Monitoring performance. 430.207 Section 430.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT CIVIL SERVICE REGULATIONS PERFORMANCE MANAGEMENT Performance Appraisal for General Schedule, Prevailing Rate, and Certain Other Employees § 430.207...
Energy Technology Data Exchange (ETDEWEB)
Krivdin, L.B.; Shcherbakov, V.V.; Bzhezovskii, V.M.; Kalabin, G.A.
1986-10-10
The /sup 13/C-/sup 13/C spin-spin coupling constants between the carbon nuclei of the vinyl group were measured for a series of vinyl ethers. It was established that the unshared electron pairs of the oxygen atom can make a substantial stereospecific contribution to the direct /sup 13/C-/sup 13/C constants of the adjacent nuclei. The observed effect was used to establish the conformational structure of the compounds.
[Cytogenetic Abnormalities and Outcomes of 117 Patients with Multiple Myeloma Detected by FISH].
Zhai, Bing; Zou, Dan-Dan; Yan, Jian-Jun; Wang, Nan; Wang, Li-Li; Zhu, Hong-Li; Huang, Wen-Rong; Yu, Li
2016-02-01
To analyze the cytogenetic abnormalities and prognostic outcomes of patients with multiple myeloma (MM) detected by fluorescence in situ hybridization (FISH). The clinical record of 117 newly-diagnosed patients with MM treated in department of hematology and geriatric hematology of our hospital for 7 years were collected, and their molecular cytogenetic abnormalities detected by FISH and the clinical outcome were analyzed retrospectively. The detected rate of cytogenetic abnormality was 76.9%(90/117), the most common abnormality deteted by FISH was 1q21+ (71.1%), followed by 13q- (56.6%). The cross comparison method showed that 13q- and 17p13-, t(11;14) and t(4;14) were related respectively. All the patients with cytogenetic abnormalities showed no significant difference in the overall survival from cytogenetic normal patients. The positive rate of molecular cytogenetic abnormalities detected by FISH in MM patients is high, but data from larger and longer studies are needed to evaluate the prognostic outcomes.
Ndao, Moise; Ash, Jason T.; Breen, Nicholas F.; Goobes, Gil; Stayton, Patrick S.; Drobny, Gary P.
2011-01-01
The side chain carboxyl groups of acidic proteins found in the extra-cellular matrix (ECM) of mineralized tissues play a key role in promoting or inhibiting the growth of minerals such as hydroxyapatite (HAP), the principal mineral component of bone and teeth. Among the acidic proteins found in the saliva is statherin, a 43-residue tyrosine-rich peptide that is a potent lubricant in the salivary pellicle and an inhibitor of both HAP crystal nucleation and growth. Three acidic amino acids – D1, E4, and E5 – are located in the N-terminal 15 amino acid segment, with a fourth amino acid, E26, located outside the N-terminus. We have utilized 13C{31P} REDOR NMR to analyze the role played by acidic amino acids in the binding mechanism of statherin to the HAP surface by measuring the distance between the δ-carboxyl 13C spins of the three glutamic acid side chains of statherin (residues E4, E5, E26) and 31P spins of the phosphate groups at the HAP surface. 13C{31P} REDOR studies of glutamic-5-13C acid incorporated at positions E4 and E26 indicate a 13C–31P distance of more than 6.5 Å between the side chain carboxyl 13C spin of E4 and the closest 31P in the HAP surface. In contrast, the carboxyl 13C spin at E5 has a much shorter 13C–31P internuclear distance of 4.25±0.09 Å, indicating that the carboxyl group of this side chain interacts directly with the surface. 13C T1ρ and slow-spinning MAS studies indicate that the motions of the side chains of E4 and E5 are more restricted than that of E26. Together, these results provide further insight into the molecular interactions of statherin with HAP surfaces. PMID:19678690
2010-07-01
... 40 Protection of Environment 5 2010-07-01 2010-07-01 false Test methods. 59.207 Section 59.207 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) NATIONAL... Compound Emission Standards for Consumer Products § 59.207 Test methods. Each manufacturer or importer...
Luengo, Catherine; Azzout-Marniche, Dalila; Fromentin, Claire; Piedcoq, Julien; Lemosquet, Sophie; Tomé, Daniel; Gaudichon, Claire
2009-11-01
We developed a complete method to measure low [(13)C] enrichments in glycogen. Fourteen rats were fed a control diet. Six of them also ingested either [U-(13)C] glucose (n=2) or a mixture of 20 [U-(13)C] amino acids (n=4). Hepatic glycogen was extracted, digested to glucose and purified on anion-cation exchange resins. After the optimization of methylboronic acid derivatization using GC-MS, [(13)C] enrichment of extracted glucose was measured by GC-C-IRMS. The accuracy was addressed by measuring the enrichment excess of a calibration curve, which observed values were in good agreement with the expected values (R=0.9979). Corrected delta values were -15.6+/-1.6 delta(13)C (per thousand) for control rats (n=8) and increased to -5 to 8 delta(13)C (per thousand) per thousand and 12-14 delta(13)C (per thousand) per thousand after the ingestion of [U-(13)C] amino acids or [U-(13)C] glucose as oral tracers, respectively. The method enabled the determination of dietary substrate transfer into glycogen. The sequestration of dietary glucose in liver glycogen 4 h after the meal was 35% of the ingested dose whereas the transfer of carbon skeletons from amino acids was only 0.25 to 1%.
Energy Technology Data Exchange (ETDEWEB)
Martinez, Rodolfo A. (Santa Fe, NM), Unkefer; Clifford J. (Los Alamos, NM), Alvarez; Marc, A [Santa Fe, NM
2012-06-12
The present invention is directed to the labeled compounds, ##STR00001## wherein C* is each either .sup.13C and .sup.12C where at least one C* is .sup.13C, each hydrogen of the methylene group is hydrogen or deuterium, the methyl group includes either zero or three deuterium atoms, Q is sulfide, sulfinyl, or sulfone, Z is an aryl group such as 1-naphthyl, substituted 1-naphthyl, 2-naphthyl, substituted 2-naphthyl, or a phenyl group ##STR00002## wherein R.sub.1, R.sub.2, R.sub.3, R.sub.4 and R.sub.5 are each independently either hydrogen, a C.sub.1-C.sub.4 lower alkyl, a halogen, and an amino group such as NH.sub.2, NHR and NRR' where R and R' are each independently either a C.sub.1-C.sub.4 lower alkyl, a phenyl, and an alkoxy group, and the methyl group can include either zero or three deuterium atoms. The present invention is also directed to the labeled compounds ##STR00003##
32 CFR 536.117 - Statutory authority for maritime claims.
2010-07-01
... 32 National Defense 3 2010-07-01 2010-07-01 true Statutory authority for maritime claims. 536.117... ACCOUNTS CLAIMS AGAINST THE UNITED STATES Maritime Claims § 536.117 Statutory authority for maritime claims. The Army Maritime Claims Settlement Act (AMCSA) (10 U.S.C. 4801-04, 4806, as amended) authorizes the...
Metabolism and transport studies of exogenous compounds thanks to 13C uniform isotopic enrichment
International Nuclear Information System (INIS)
Bravin, F.
2008-12-01
The study of many exogenous compounds does not raise difficulties when they are isolated, purified and in quantities sufficient for the usual detection methods used in biology (Chromatography, NMR, Mass Spectrometry, etc). When they are found in a biological fluid (blood, urines,..), they are often in infinitesimal amount such as the effect of their biological matrices or the background noise that make their detection and their quantification very delicate. The use of internal standards uniformly enriched with carbon 13 and/or nitrogen 15 makes it possible to obtain a signal more easily recognizable and identifiable thanks to the presence of the isotopes (peaks shifted in a mass spectrum for example). This is why, complementary to the analytical and biochemical studies of zearalenone (ZEN) metabolism, we were interested in building mass spectra of molecules enriched (rates between 0 and 1) by various isotopes ( 13 C, 15 N, 18 O and 2 H). In parallel we studied the influence of the 13 C enrichment on the reactivity of a given molecule, from a theoretical and an experimental point of view. (author)
Behera, M.; Ram, S.
2018-03-01
Fourier transform infrared and Raman bands shows a discernible enhancement in band intensity of C–H stretching, C=O stretching, C–N stretching, C–H2 bending, and C–H2 in-plane bending in PVP molecules in the presence of C60 molecules. Amplification in intensity is ascribed to microscopic interactions results when a donation of nonbonding electron (n) occurs from a “>N–C=O” entity of PVP into a lowest unoccupied molecular orbital of the C60 molecule in PVP-C60 charge transfer (CT) complex. The C=O stretching band intensity (integrated) Vs C60 content plot exhibits a peak near a critical 13.9 μM C60 value owing to percolation effect. Light emission spectra show that even a small addition of 4.63 μM C60 able to suppress the band intensity by ~23% as a result of an energy loss. The integrated band intensity also decreases through a peak near 13.9 μM when plotted against the C60-content. In correlation to the vibration spectra, the maximum effect observed both in light emission and excitation spectra suggests a percolation effect in the CT complex. Exhibition of percolation threshold in C60-PVP donor-acceptor complex will be helpful in optimizing the photovoltaic properties vital for solar cell applications.
30 CFR 90.207 - Compliance sampling.
2010-07-01
... MANDATORY HEALTH STANDARDS-COAL MINERS WHO HAVE EVIDENCE OF THE DEVELOPMENT OF PNEUMOCONIOSIS Sampling Procedures § 90.207 Compliance sampling. (a) The operator shall take five valid respirable dust samples for... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Compliance sampling. 90.207 Section 90.207...
Multidrug-Resistant Tuberculosis and Culture Conversion with Bedaquiline
Diacon, Andreas H.; Pym, Alexander; Grobusch, Martin P.; de Los Rios, Jorge M.; Gotuzzo, Eduardo; Vasilyeva, Irina; Leimane, Vaira; Andries, Koen; Bakare, Nyasha; de Marez, Tine; Haxaire-Theeuwes, Myriam; Lounis, Nacer; Meyvisch, Paul; de Paepe, Els; van Heeswijk, Rolf P. G.; Dannemann, Brian; Rolla, Valeria; Dalcomo, Margreth; Gripp, Karla; Escada, Rodrigo; Tavares, Isabel; Borga, Liamar; Thomas, Aleyamma; Rekha, Banu; Nair, Dina; Chandrasekar, Chockalingam; Parthasarathy, Ramavaran Thiruvengadaraj; Sekhar, Gomathi; Ganesh, Krishnamoorthy; Rajagopalan, Krishnakumar; Rajapandian, Gangadevi; Dorairajalu, Rajendran; Sharma, Surendra Kumar; Banavaliker, Jayant; Kadhiravan, Tamilarasu; Gulati, Vinay; Mahmud, Hanif; Gupta, Arvind; Bhatnagar, Anuj; Jain, Vipin; Hari, Smriti; Gupta, Yogesh Kumar; Vaid, Ashok; Cirule, Andra; Dravniece, Gunta; Skripconoka, Vija; Kuksa, Liga; Kreigere, Edite; Ramos, Carlos Rafael Seas; Amat y Leon, Ivan Arapovic
2014-01-01
BACKGROUND Bedaquiline (Sirturo, TMC207), a diarylquinoline that inhibits mycobacterial ATP synthase, has been associated with accelerated sputum-culture conversion in patients with multidrug-resistant tuberculosis, when added to a preferred background regimen for 8 weeks. METHODS In this phase 2b
40 CFR 721.6505 - Polymers of C13C15 oxoalcohol ethoxolates.
2010-07-01
... 40 Protection of Environment 30 2010-07-01 2010-07-01 false Polymers of C13C15 oxoalcohol... Specific Chemical Substances § 721.6505 Polymers of C13C15 oxoalcohol ethoxolates. (a) Chemical substance... polymers of C13C15 oxoalcohol ethoxolates (PMNs P-96-950/951) are subject to reporting under this section...
1975-01-01
With R207 the CERN-Holland-Manchester Collaboration studied proton-proton diffraction dissociation at small momentum transfer. This followed, at Intersection 2, the study of correlations associated with high transverse momentum particles by Daresbury-Liverpool-RHEL Collaboration (R205) and of multiplicity and rapidity distributions in diffractive collisions by CERN-Holland-Lancaster-Manchester (R206), and used part of the previous set-up.
Lifescience Database Archive (English)
Full Text Available ing fra... 76 6e-13 AF134593_1( AF134593 |pid:none) Homo sapiens L-pipecolic acid oxid... 76 6e-13 AX882278_... BC114006 |pid:none) Bos taurus L-pipecolic acid oxidas... 76 8e-13 protein update 2009. 7.15 PSORT psg: 0.6
Comparison on the interaction of Al3+/nano-Al13 with calf thymus DNA /salmon sperm DNA
Ma, Fei; Ma, Yue; Du, Changwen; Yang, Xiaodi; Shen, Renfang
2015-11-01
The conformation change, binding mode and binding site between Al3+/nano-Al13 and calf thymus DNA/salmon sperm DNA were investigated by UV-vis absorption, FTIR spectra, Raman spectroscopy and CD spectra, as well as melting curves measurement. The UV-vis spectra and circular dichroism spectra results suggested that the phosphate group structure was changed when Al3+ interacted with DNA, while the double-helix was distorted when nano-Al13 interacted with DNA. The FTIR and Raman spectroscopy revealed that the binding sites were Al3+ … PO2, Al3+ … N7/guanine PO2 … Al13 … N7-C8/guanine with calf thymus DNA, and Al3+ … N3-O2/cytosine, Al3+ … N7-C8/guanine, PO2 … Al13 … N7-C8/guanine, PO2 … Al13 … N1/adenine with salmon sperm DNA, respectively. The electrostatic binding was existed between Al3+ and DNA, and the electrostatic binding and complexing were found between nano-Al13 and DNA.
Wutzke, Klaus D; Wigger, Marianne
2009-09-01
The aim of this study was to investigate the hepatic microsomal and cytosolic functions by using the 13CO2 breath test in healthy subjects either before or after consumption of red wine. Twelve adults received [13C2]aminopyrine and L-[1-13C]phenylalanine together with a standardised dinner. Expired air samples were taken over 6 h. After a wash-out period, the subjects consumed 0.4 ml ethanol per kg per day together with dinner over a 7.5-day period on average. Thereafter, 13C-tracer administration was repeated under identical conditions. The 13CO2 enrichments were measured by isotope ratio mass spectrometry. The mean cumulative percentage 13C-dose recovery after administration of [13C2]aminopyrine and L-[1-13C]phenylalanine either without or with red wine consumption amounted to 17.0+/-4.4 vs. 14.7+/-3.1% (p=0.170) and 14.0+/-2.8 vs. 11.5+/-3.9% (p=0.084), respectively. Moderate alcohol consumption does not induce significant short-term changes of the microsomal and the cytosolic function of the human liver in healthy subjects.
The C-12/C-13 abundance ratio in Comet Halley
International Nuclear Information System (INIS)
Wyckoff, S.; Lindholm, E.; Wehinger, P.A.; Peterson, B.A.; Zucconi, J.M.
1989-01-01
The individual (C-13)N rotational lines in Comet Halley are resolved using high-resolution spectra of the CN B2Sigma(+)-X2Sigma(+) (0,0) band. The observe C-12/C-13 abundance ratio excludes a site of origin for the comet near Uranus and Neptune and suggests a condensation environment quite distinct from other solar system bodies. Two theories are presented for the origin of Comet Halley. One theory suggest that the comet originated 4.5 Gyr ago in an inner Oort cloud at a heliocentric distance greater than 100 AU where chemical fractionation led to the C-13 enrichment in the CN parent molecule prior to condensation of the comet nucleus. According to the other, more plausible theory, the comet nucleus condensed relatively recently from the interstellar medium which has become enriches in C-13 and was subsequently gravitationally captured by the solar system. 107 refs
Energy Technology Data Exchange (ETDEWEB)
Wang, Jingzhu, E-mail: wangjingzhu@chinada.cn [National Anti-Doping Laboratory, China Anti-Doping Agency, Beijing (China); Yang, Rui [Sport Science College, Beijing Sport University Beijing, Beijing (China); Yang, Wenning [School of Pharmacy, Beijing University of Chinese Medicine, Beijing (China); Liu, Xin; Xing, Yanyi; Xu, Youxuan [National Anti-Doping Laboratory, China Anti-Doping Agency, Beijing (China)
2014-12-10
Highlights: • {sup 13}C labeled testosterone can be used to adjust the isotope ratio of testosterone. • The novel testosterone cannot be detected by the regular IRMS method in doping test. • A method was explored to remove the labeled {sup 13}C. • The established method can be used to detect the manipulated testosterone. - Abstract: Isotope ratio mass spectrometry (IRMS) is applied to confirm testosterone (T) abuse by determining the carbon isotope ratios (δ{sup 13}C value). However, {sup 13}C labeled standards can be used to control the δ{sup 13}C value and produce manipulated T which cannot be detected by the current method. A method was explored to remove the {sup 13}C labeled atom at C-3 from the molecule of androsterone (Andro), the metabolite of T in urine, to produce the resultant (A-nor-5α-androstane-2,17-dione, ANAD). The difference in δ{sup 13}C values between Andro and ANAD (Δδ{sup 13}C{sub Andro–ANAD}, ‰) would change significantly in case manipulated T is abused. Twenty-one volunteers administered T manipulated with different {sup 13}C labeled standards. The collected urine samples were analyzed with the established method, and the maximum value of Δδ{sup 13}C{sub Andro–ANAD} post ingestion ranged from 3.0‰ to 8.8‰. Based on the population reference, the cut-off value of Δδ{sup 13}C{sub Andro–ANAD} for positive result was suggested as 1.2‰. The developed method could be used to detect T manipulated with 3-{sup 13}C labeled standards.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Travel time. 630.207 Section 630.207... and General Provisions for Annual and Sick Leave § 630.207 Travel time. The travel time granted an employee under section 6303(d) of title 5, United States Code, is inclusive of the time necessarily...
Synthesis and purification of 13C labelled xanthine derivatives
International Nuclear Information System (INIS)
Boukraa, M.S.; Deruaz, D.; Bannier, A.; Desage, M.; Brazier, J.L.
1995-01-01
3-[Methyl- 13 )C]xanthine, 7-[Methyl- 13 )C]xanthine, 1,3-[Dimethyl- 13 )C 2 ]xanthine (theophylline-1,3-[ 13 )CH 3 ] 2 ), 1,7-[Dimethyl- 13 )C 2 ]xanthine (paraxanthine-1,7[ 13 )CH 3 ] 2 ), and 3,7-[Dimethyl- 13 )C 2 ]xanthine (theobromine-3,7-[ 13 )CH 3 ] 2 were synthesized by nucleophilic substitution reaction(SN 2 ) from xanthine (X) and iodomethane-[ 13 C]. The 3-isobutylparaxanthine-7-[ 13 CH 3 ] was prepared from 3-isobutyl-1-methylxanthine (IBMX). The compounds were purified by reverse phase semipreparative liquid chromatography and their chemical structure and purity verified by GC-MS. (Author)
O interactions in 1,3-diphenyl-urea
Indian Academy of Sciences (India)
The synthesis, X-ray structure and role of intermolecular interactions have been studied in case of 1,3-diphenyl-urea, owing to its medicinal importance. The compound crystallizes in orthorhombic crystal system (space group, 21) with unit cell parameters, = 9.118(3), = 10.558(2), = 11.780(3) Å and = 4.
Ardiansah; Masykuri, M.; Rahardjo, S. B.
2018-05-01
Students’ conceptual understanding is the most important comprehension to obtain related comprehension. However, they held their own conception. With this need analysis, we will elicit student need of 3TMC diagnostic test to measure students’ conception about acid-base and solubility equilibrium. The research done by a mixed method using questionnaire analysis based on descriptive of quantitative and qualitative. The research subject was 96 students from 4 senior high schools and 4 chemistry teachers chosen by random sampling technique. Data gathering used a questionnaire with 10 questions for student and 28 questions for teachers. The results showed that 97% of students stated that the development this instrument is needed. In addition, there were several problems obtained in this questionnaire include learning activity, teacher’s test and guessing. In conclusion, this is necessary to develop the 3TMC instrument that can diagnose and measure the student’s conception in acid-base and solubility equilibrium.
Directory of Open Access Journals (Sweden)
Fernando César de Macedo Júnior
2007-02-01
Full Text Available During the last five decades, as a result of an interaction between natural product chemistry, synthetic organic chemistry, molecular biology and spectroscopy, scientists reached an extraordinary level of comprehension about the natural processes by which living organisms build up complex molecules. In this context, 13C nuclear magnetic resonance spectroscopy, allied with isotopic labeling, played a determinant role. Nowadays, the widespread use of modern NMR techniques allows an even more detailed picture of the biochemical steps by accurate manipulation of the atomic nuclei. This article focuses on the development of such techniques and their impact on biosynthetic studies.
{sup 13}C NMR and EPR spectroscopic evaluation of oil shale mined soil recuperation
Energy Technology Data Exchange (ETDEWEB)
Santos, J.V. dos, E-mail: mangrich@ufpr.br [Universidade Federal do Parana (UFPR), Curitiba, PR (Brazil); Mangrich, A.S. [Instituto Nacional de Ciencia e Tecnologia: Energia e Ambiente, Salvador, BA (Brazil); Pereira, B.F. [EMBRAPA Clima Temperado, Pelotas, RS (Brazil); Pillon, C.N. [EMBRAPA Clima Temperado, Pelotas, RS (Brazil). Estacao Experimental Cascata; Novotny, E.H. [EMBRAPA Solos, Rio de Janeiro, RJ (Brazil); Bonagamba, T.J. [Universidade de Sao Paulo (USP), Sao Carlos, SP (Brazil). Instituto de Fisica; Abbt-Braun, G.; Frimmel, F.H. [Engler-Bunte-Institut, Universitaet Karlsruhe, TH (Germany)
2013-02-15
In this work, native forest soil (NFS) organic matter (SOM) sample and SOM samples from a neighboring forest soil area of an oil shale mine which is being rehabilitated for thirty years (RFS) were analyzed. X-band electron paramagnetic resonance (EPR) and solid-state {sup 13}C nuclear magnetic resonance (NMR) spectroscopies were used to evaluate the soil reclamation of the Brazilian oil shale mining process. Two-dimensional heterospectral correlation studies of the results obtained from EPRand {sup 13}C NMR were used to obtain information about SOM structures and their interactions with residual paramagnetic metal ion. The signal of the residual metallic oxycation, VO{sup 2+} correlated positively with uronic acid-type hydrophilic organic structures, determined from the {sup 13}C NMR spectra, and correlated negatively with the organic free radical (OFR) signal associated with oxygen atoms (g = 2.0042). The hydrophobic aromatic structures correlate positively with the EPR OFR signal associated with carbon atoms (g = 2.0022). The data from the two spectroscopic magnetic techniques show that the used recuperation process is effective. (author)
Villalpando, Salvador; Del Prado, Martha; Cienfuego, Edith; Morales, Pedro
2014-01-01
C4 plants (e.g. corn and sugar cane) have greater (13)C enrichment than C3 plants (e.g. wheat and sugar beet). To assess whether (13)C enrichment of CO2 in the breath and breast milk of women on diets based on C3 and C4 foods changes from one diet to the other. Six breast-feeding women were studied at 5-6 months postpartum. They ate a controlled C4 diet on days 1 and 2 followed by a C3 diet on days 3 and 4. Diet duplicates, breast milk on days 2 and 4 and hourly breath samples were collected over 4 days. (13)C enrichment was measured by isotope-ratio mass spectrometry. Values of δ(13)C were calculated from the international PDBV standard (δ(13)CPDBV). Differences between means were compared by paired t test or t test for repeated measurements. δ(13)CPDBV values were significantly higher in the C4 diet than in the C3 diet composites (p value was greater on days 1 and 2 (range -15.4 to -13.2, respectively) and declined on days 3 and 4 (range -20.0 to -21.8, respectively, p value in the breath and breast milk fractions, which diminish rapidly on a C3 diet. Further studies focusing on individual nutrients are warranted.
Joshi, Vishal; Banerjee, D. P. K.; Srivastava, Mudit
2017-12-01
We present a series of near-infrared spectra of Nova Ophiuchus 2017 in the K band that record the evolution of the first overtone CO emission in unprecedented detail. Starting from 11.7 days after maximum, when CO is first detected at great strength, the spectra track the CO emission to +25.6 days by which time it is found to have rapidly declined in strength by almost a factor of ∼35. The cause for the rapid destruction of CO is examined in the framework of different mechanisms for CO destruction, namely, an increase in photoionizating flux, chemical pathways of destruction, or destruction by energetic nonthermal particles created in shocks. From LTE modeling of the CO emission, the 12C/13C ratio is determined to be 1.6 ± 0.3. This is consistent with the expected value of this parameter from nucleosynthesis theory for a nova eruption occuring on a low mass (∼ 0.6 {M}ȯ ) carbon–oxygen core white dwarf. The present 12C/13C estimate constitutes one of the most secure estimates of this ratio in a classical nova.
Energy Technology Data Exchange (ETDEWEB)
Kamiya, Yukiko; Yamamoto, Sayoko [National Institutes of Natural Sciences, Okazaki Institute for Integrative Bioscience and Institute for Molecular Science (Japan); Chiba, Yasunori; Jigami, Yoshifumi [National Institute of Advanced Industrial Science and Technology, Research Center for Medical Glycoscience (Japan); Kato, Koichi, E-mail: kkatonmr@ims.ac.jp [National Institutes of Natural Sciences, Okazaki Institute for Integrative Bioscience and Institute for Molecular Science (Japan)
2011-08-15
This report describes a novel method for overexpression of {sup 13}C-labeled oligosaccharides using genetically engineered Saccharomyces cerevisiae cells, in which a homogeneous high-mannose-type oligosaccharide accumulates because of deletions of genes encoding three enzymes involved in the processing pathway of asparagine-linked oligosaccharides in the Golgi complex. Using uniformly {sup 13}C-labeled glucose as the sole carbon source in the culture medium of these engineered yeast cells, high yields of the isotopically labeled Man{sub 8}GlcNAc{sub 2} oligosaccharide could be successfully harvested from glycoprotein extracts of the cells. Furthermore, {sup 13}C labeling at selected positions of the sugar residues in the oligosaccharide could be achieved using a site-specific {sup 13}C-enriched glucose as the metabolic precursor, facilitating NMR spectral assignments. The {sup 13}C-labeling method presented provides the technical basis for NMR analyses of structures, dynamics, and interactions of larger, branched oligosaccharides.
High-power diode-side-pumped rod Tm:YAG laser at 2.07 μm.
Wang, Caili; Niu, Yanxiong; Du, Shifeng; Zhang, Chao; Wang, Zhichao; Li, Fangqin; Xu, Jialin; Bo, Yong; Peng, Qinjun; Cui, Dafu; Zhang, Jingyuan; Xu, Zuyan
2013-11-01
We report a high-power diode-laser (LD) side-pumped rod Tm:YAG laser of around 2 μm. The laser was water-cooled at 8°C and yielded a maximum output power of 267 W at 2.07 μm, which is the highest output power for an all solid-state cw 2.07 μm rod Tm:YAG laser reported as far as we know. The corresponding optical-optical conversion efficiency was 20.7%, and the slope efficiency was about 29.8%, respectively.
Arockia doss, M.; Rajarajan, G.; Thanikachalam, V.; Selvanayagam, S.; Sridhar, B.
2018-04-01
2,4,5-triphenyl-1H-imidazol-3-ium picrate (1), 2-(4-fluorophenyl)-4,5-diphenyl-1H-imidazol-3-ium picrate (2), 2-(4-methylphenyl)-4,5-diphenyl-1H-imidazol-3-ium picrate (3) were synthesised. These compounds 1-3 were characterized by elemental, FT-IR, 1H NMR and 13C NMR analyses. The structure of compound 3 was further confirmed by single crystal X-ray diffraction. The studies reveal that the molecule is associated with weak Nsbnd H⋯O and Csbnd H⋯N and van der Waals interactions which are responsible for the formation and strengthening of supramolecular assembly. The nature of the interactions and their importance are explored using the Hirshfeld surface method. The physicochemical properties of the compounds 1-3 were evaluated by UV-vis spectroscopy, fluorescence spectroscopy, and thermogravimetric analysis. According to thermal data the salts possess excellent thermal stabilities with decomposition temperatures ranging from 220 to 280 °C. Second-harmonic generation (SHG) results exposed that the picrates 1-3 were about 1.13-1.50 times greater than potassium dihydrogen phosphate (KDP). Here we also used Density functional theory (DFT) calculations in order to investigate the opto-electronic properties. The obtained theoretical results validate with available experimental data.
The synthesis of 13C-bilirubin and its use in the validation of bilirubin kinetic studies in rats
International Nuclear Information System (INIS)
Sturrock, E.D.
1994-04-01
The total synthesis of [10- 13 C] bilirubin IXα], the principal waste product of haem degradation, is described. Site specific labelling was accomplished by the Vilsmeier formulation of one of the dipyrrolic fragments using [1- 13 C] dimethylformamide. The penultimate dehydrohalogenation reaction was complicated by a competing elimination reaction which yielded a bridged biliverdin derivative. The base catalysed reaction affords a novel [10- 13 C]-8,12-bis(2-methoxycarbonylethyl)-7,13,17-trimethyl-2,18-propano-3-vinylbilin-1,19(21H,24H)-dione in which the 2 and 18 positions of the macrocycle are bridged with a propano tether, the structure has been established using single crystal X-ray and 1 H nuclear Overhauser effect studies. [ 14 C]bilirubin was prepared, bio synthetically, using [ 14 C]aminolevulinic acid. Bilirubin kinetics in 4 rats were measured by the analysis of the plasma disappearance of [ 14 C]bilirubin in a two-compartment model. The plasma half-life of the first and second exponentials were 1.97 and 32.8 minutes respectively. The data were used to determine model independent parameters k 12 , k 21 , and k 20 . In the proposed model, plasma unconjugated bilirubin exchanges with a hepatic unconjugated bilirubin pool. Bilirubin is eliminated from the system via the proposed hepatic pool. These studies provide an analysis of the kinetics of unconjugated bilirubin in rates and are intended to serve as a reference point for studies using a stable isotope of bilirubin. The plasma disappearance of [10- 13 C]bilirubin IXα in three rats was studied using mass spectrometry to measure the bilirubin δ 13 C. Validation of the experimental procedure in terms of range and reproducibility of the detection method was carried out. The half lives of the initial and terminal exponentials were 2.27±2.5 and 22.8±12.9 minutes. Despite the large 95% confidence limits calculated for these clearance curves they serve as an important foundation for future bilirubin kinetic
Pego, AP; Siebum, B; Van Luyn, MJA; Van Seijen, XJGY; Poot, AA; Grijpma, DW; Feijen, J
2003-01-01
Biodegradable porous scaffolds for heart tissue engineering were prepared from amorphous elastomeric (co)polymers of 1,3-trimethylene carbonate (TMC) and D,L-lactide (DLLA). Leaching of salt from compression-molded polymer-salt composites allowed the preparation of highly porous structures in a
Optical hyperpolarization of 13C nuclear spins in nanodiamond ensembles
Chen, Q.; Schwarz, I.; Jelezko, F.; Retzker, A.; Plenio, M. B.
2015-11-01
Dynamical nuclear polarization holds the key for orders of magnitude enhancements of nuclear magnetic resonance signals which, in turn, would enable a wide range of novel applications in biomedical sciences. However, current implementations of DNP require cryogenic temperatures and long times for achieving high polarization. Here we propose and analyze in detail protocols that can achieve rapid hyperpolarization of 13C nuclear spins in randomly oriented ensembles of nanodiamonds at room temperature. Our protocols exploit a combination of optical polarization of electron spins in nitrogen-vacancy centers and the transfer of this polarization to 13C nuclei by means of microwave control to overcome the severe challenges that are posed by the random orientation of the nanodiamonds and their nitrogen-vacancy centers. Specifically, these random orientations result in exceedingly large energy variations of the electron spin levels that render the polarization and coherent control of the nitrogen-vacancy center electron spins as well as the control of their coherent interaction with the surrounding 13C nuclear spins highly inefficient. We address these challenges by a combination of an off-resonant microwave double resonance scheme in conjunction with a realization of the integrated solid effect which, together with adiabatic rotations of external magnetic fields or rotations of nanodiamonds, leads to a protocol that achieves high levels of hyperpolarization of the entire nuclear-spin bath in a randomly oriented ensemble of nanodiamonds even at room temperature. This hyperpolarization together with the long nuclear-spin polarization lifetimes in nanodiamonds and the relatively high density of 13C nuclei has the potential to result in a major signal enhancement in 13C nuclear magnetic resonance imaging and suggests functionalized and hyperpolarized nanodiamonds as a unique probe for molecular imaging both in vitro and in vivo.
Energy Technology Data Exchange (ETDEWEB)
Ferreira, Marcia Alves; Drumond, Mariza Guimaraes; Veloso, Dorila Pilo [Minas Gerais Univ., Belo Horizonte, MG (Brazil). Dept. de Quimica
1995-12-31
Lignins structural study by NMR has utilized standard-substances spectral comparative analysis. This work has present relaxation time studies for lignin standard-substance, and {sup 13} C NMR chemical shift values were also shown and compared for several compounds. NMR spectra were commented besides experimental data analysis 2 figs., 4 tabs.
The Effect of C-X-C Motif Chemokine 13 on Hepatocellular Carcinoma Associates with Wnt Signaling
Directory of Open Access Journals (Sweden)
Chunyan Li
2015-01-01
Full Text Available Objects. To investigate the effect of CXCL13 (C-X-C motif chemokine 13 on hepatocellular carcinoma and clarify the potential mechanisms. Methods. 32 patients with hepatocellular carcinoma and 12 healthy controls were recruited for analyzing the expression of CXCL13 by RT-PCR (reverse transcription-polymerase chain reaction. ELISA (enzyme-linked immune-sorbent assay was used to test the concentration of serum CXCL13. The interaction between CXCL13 and Wnt signaling was analyzed by western blot. In vitro PBMCs cultured with HepG2 supernatant, the levels of IL-12, IL4, IL-6, and IL-17, and four IgG subclasses were detected by ELISA. Results. The rate of high expression CXCL13 was 63.4% in advanced HCC patients, and the serum CXCL13 was also at a high level in stage IV HCC patients. Meanwhile CXCL13 level was positively correlated with serum ALT (Alanine Transaminase and AST (Aspartate Aminotransferase. CXCL13 and Wnt/β-catenin signaling shared a positive feedback loop. Furthermore, CXCL13 could obviously promote the expressions of IL-12 and IL-17, and induce IgG4 secreted by B cells. Conclusions. The effect of CXCL13 on promoting liver cancer is related to the activation of Wnt/β-catenin pathway and the facilitation of IL-12, IL-17 and IgG4. CXCL13 plays an important role in the progression of HCC, and it may act as a potential target for the diagnosis and treatment of HCC.
DARC PLURIDATA system: the /sup 13/C-N. M. R. data bank
Energy Technology Data Exchange (ETDEWEB)
Dubois, J E; Bonnet, J C [Paris-7 Univ., 75 (France)
1979-09-15
The capabilities of the DARC system are discussed and illustrated by the storage and retrieval functions of the /sup 13/C-N.M.R. data bank of the DARC PLURIDATA system. The data covered by the bank, as well as the input stream to the bank and validation of the spectra, are described. Particular stress is laid on the DARC structural retrieval system, which illustrates the interactive interrogration of a chemical bank by means of the structural diagram of a molecule, i.e. the universal language in chemistry. The potential of the /sup 13/C-N.M.R. data bank in computer-aided structural elucidation is outlined.
38 CFR 1.17 - Evaluation of studies relating to health effects of radiation exposure.
2010-07-01
... relating to health effects of radiation exposure. 1.17 Section 1.17 Pensions, Bonuses, and Veterans' Relief... health effects of radiation exposure. (a) From time to time, the Secretary shall publish evaluations of scientific or medical studies relating to the adverse health effects of exposure to ionizing radiation in the...
13C CPMAS NMR Studies of Anthocyanidins and their Glucosides
International Nuclear Information System (INIS)
Wolniak, M.; Wawer, I.
2005-01-01
Anthocyanins are responsible for red, purple or blue colours of flower petals and can be found in red or black fruits and berries. Many foods, especially red grapes and wines, aronia or blueberries contain large amounts of anthocyanins. Their health beneficial effects are related to antioxidant and radical scavenging properties. Structural analysis of anthocyanins by NMR are few, owing to the difficulty in obtaining analysable spectra for unstable, interconverting compounds, available in small amounts. Compounds studied by us were isolated from fruits and berries. 13 C CPMAS NMR spectra were recorded on a Bruker DSX-400 spectrometer for solid chlorides of: cyanidin, cyanidin 3-O-glucoside, cyanidin 3,5-O-diglucoside, pelargonidin and pelargonidin 3-O-glucoside. Dipolar dephased and short contact pulse sequences were used as an aid in the assignment of resonances in CPMAS spectra of solids. Inspection of the spectra indicates that anthocyanidins are in the form of flavylium (cationic) and not in form of the chalcone.: the resonance of C2 appears at ca. 160 ppm and C3 at ca. 135 ppm, whereas C ring opening produces C2 = O, for which chemical shift of ca. 180 ppm can be expected. A comparison of experimental (CPMAS) and predicted (GIAO DFT) shielding constants for cyanidin provided information about the orientation of OH groups, twist angle of aromatic ring B and the localization of the chloride anion.(author)
3D Hyperpolarized C-13 EPI with Calibrationless Parallel Imaging
DEFF Research Database (Denmark)
Gordon, Jeremy W.; Hansen, Rie Beck; Shin, Peter J.
2018-01-01
With the translation of metabolic MRI with hyperpolarized 13C agents into the clinic, imaging approaches will require large volumetric FOVs to support clinical applications. Parallel imaging techniques will be crucial to increasing volumetric scan coverage while minimizing RF requirements and tem...... strategies to accelerate and undersample hyperpolarized 13C data using 3D blipped EPI acquisitions and multichannel receive coils, and demonstrated its application in a human study of [1-13C]pyruvate metabolism....
Park, Jae Mo; Josan, Sonal; Jang, Taichang; Merchant, Milton; Watkins, Ron; Hurd, Ralph E; Recht, Lawrence D; Mayer, Dirk; Spielman, Daniel M
2016-03-01
MRS of hyperpolarized [2-(13)C]pyruvate can be used to assess multiple metabolic pathways within mitochondria as the (13)C label is not lost with the conversion of pyruvate to acetyl-CoA. This study presents the first MR spectroscopic imaging of hyperpolarized [2-(13)C]pyruvate in glioma-bearing brain. Spiral chemical shift imaging with spectrally undersampling scheme (1042 Hz) and a hard-pulse excitation was exploited to simultaneously image [2-(13)C]pyruvate, [2-(13)C]lactate, and [5-(13)C]glutamate, the metabolites known to be produced in brain after an injection of hyperpolarized [2-(13)C]pyruvate, without chemical shift displacement artifacts. A separate undersampling scheme (890 Hz) was also used to image [1-(13)C]acetyl-carnitine. Healthy and C6 glioma-implanted rat brains were imaged at baseline and after dichloroacetate administration, a drug that modulates pyruvate dehydrogenase kinase activity. The baseline metabolite maps showed higher lactate and lower glutamate in tumor as compared to normal-appearing brain. Dichloroacetate led to an increase in glutamate in both tumor and normal-appearing brain. Dichloroacetate-induced %-decrease of lactate/glutamate was comparable to the lactate/bicarbonate decrease from hyperpolarized [1-(13)C]pyruvate studies. Acetyl-carnitine was observed in the muscle/fat tissue surrounding the brain. Robust volumetric imaging with hyperpolarized [2-(13)C]pyruvate and downstream products was performed in glioma-bearing rat brains, demonstrating changes in mitochondrial metabolism with dichloroacetate. © 2015 Wiley Periodicals, Inc.
Excitation functions of the systems 12C+14C and 13C+12C
International Nuclear Information System (INIS)
Haindl, E.
1975-01-01
The excitation functions of the systems 12 C+ 14 C and 13 C+ 12 C are investigated for different exit channels. The excitation functions measured do not show correlated structures as in the system 12 C+ 12 C. (WL/AK) [de
19 CFR 207.69 - Publication of determinations.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Publication of determinations. 207.69 Section 207.69 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION NONADJUDICATIVE INVESTIGATIONS... SUBSIDIZED EXPORTS TO THE UNITED STATES Five-Year Reviews § 207.69 Publication of determinations. Whenever...
47 CFR 25.207 - Cessation of emissions.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Cessation of emissions. 25.207 Section 25.207 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Technical Standards § 25.207 Cessation of emissions. Space stations shall be made capable of ceasing radio...
International Nuclear Information System (INIS)
Zielinski, M.; Czarnota, G.; Papiernik-Zielinska, H.
1992-01-01
The 13 C kinetic isotope fractionation in the decarbonylation of lactic acid of natural isotopic composition by sulfuric acid has been studied in the temperature range of 20-80 deg C. The 13 C (1) isotope separation in the decarbonylation of lactic acid by concentrated sulfuric acid depends strongly on the temperature above 40 deg C. Below this temperature the 13 C isotope effect in the decarbonylation of lactic acid by concentrated sulfuric acid is normal similarly as has been found in the decarbonylation of lactic [1- 14 C] acid. The experimental values of k (12C) /k (13C) ratios of isotopic rate constants for 12 C and 13 C are close to, but slightly higher than theoretical 13 C-kinetic isotope effects calculated (neglecting tunneling) under the asumption that the C (1) -OH bond is broken in the rate-controlling step of the dehydration reaction. Dilution of concentrated sulfuric acid with water up to 1.4 molar (H 2 O)/(H 2 SO 4 ) ratio caused the increase of the 13 C isotope fractionation from 1.0273 found in concentrated sulfuric acid at 80.5 deg C to 1.0536±0.0008 (at 80.6 deg C). A discussion of the abnormally high temperature dependence of 14 C and 13 C isotope fractionation in this reaction and the discussion of the problem of relative 14 C/ 13 C kinetic isotope effects is given. (author) 18 refs.; 2 tabs
32 CFR 842.117 - Delegations of authority.
2010-07-01
... LITIGATION ADMINISTRATIVE CLAIMS Hospital Recovery Claims (42 U.S.C. 2651-2653) § 842.117 Delegations of... USAFE, and the SJAs of each Air Force base, station, or fixed installation have delegated authority to...
14C and 13C in the atmosphere and soil air at two localities of Slovakia
International Nuclear Information System (INIS)
Sivo, A.; Simon, J.; Richtarikova, M.; Holy, K.; Polaskova, A.; Bulko, M.; Hola, O.
2006-01-01
In this paper there are presented the long-term measurements of 13 R and 14 R in urban and countryside atmosphere. The different conditions and particularities of both the localities which influence on the mentioned characteristics are pointed out. The existence of δ 13 C and δ 14 C variations and their phase correlation were confirmed as well as their origin were qualitatively explained. By means of the non-linear regression and harmonic analysis the trends of δ 13 C and δ 14 C variations was found. The study of δ 13 C and δ 14 C courses has shown that it can be used as an effective tool to determine the level of the anthropogenic CO 2 pollution of the atmosphere. (authors)
Evaluation of carbon transfers in cattle and humans using 13C
International Nuclear Information System (INIS)
Masuda, Tsuyoshi; Tako, Yasuhiro; Nakamura, Yuji
2010-01-01
In the safety assessment made around the spent nuclear fuel reprocessing plant in Rokkasho, Aomori, among radioactive nuclides released from the plant, 14 C is expected to be the largest contributor to radiation dose received by the neighboring population through agricultural and dairy products. The objectives of this study are to clarify the transfer of 14 C from grass to beef and milk and its metabolism in the human body experimentally. (1) 13 C-labeled grass was fed for 28 days to beef cattle and cows. 13 C isotopic ratio was measured in serum and other samples including muscle of beef cattle and milk of dairy cow. The 13 C rations in milk, breath air, urine and feces decreased very rapidly within 3 day after cessation of the administration of 13 C-labeled feed. However, a slow decrease in 13 C ratio was observed in muscle and serum. (2) 13 C isotopic ratios were measured in breath air, urine, feces and serum over 16 weeks in humans who were orally administered of 13 C labeled leucine, palmitic acid, glucose, boiled rice and soymilk, respectively. Residual 13 C in their bodies experimentally observed were lower than the estimates by the ICRP metabolic model for organic carbon ingestion. (author)
42 CFR 50.207 - Sterilization by hysterectomy.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Sterilization by hysterectomy. 50.207 Section 50.207 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS POLICIES OF GENERAL APPLICABILITY Sterilization of Persons in Federally Assisted Family Planning Projects § 50.207...
International Nuclear Information System (INIS)
Yan Weili; Fudan Univ., Shanghai; Lin Xiangtong; Sun Dayu; Jiang Yibin; Sun Xu; Rong Lan; Liang Qi
2006-01-01
Objective: Using a small animal breath test model we designed and L-[1- 13 C] phenylalanine breath test ( 13 C-PheBT) of rats, the authors investigated its feasibility and validity and determined effective parameter of the test. Methods: Twenty male Sprague-Dawley (SD) weighting 280-290 g rats randomized into two groups acute hepatitis rats (n=10) and control rats (n=10). Hepatitis was induced by carbon tetrachloride (CCl 4 ) olive oil administration through intragastric gavage. PheBT was assisted by small mechanical ventilator improved and air samples were collected discontinuously, 20 mg/kg body weight L-[1- 13 C] phenylalanine ( 13 C-Phe) was administered intravenously. Twenty-nine breath samples were taken before and different intervals within sixty minutes after administration. 13 Cenrichment was measured by isotope ratio mass spectrometer. Results: All time phase curves of 13 C enrichment in rat breath reached a peak almost at 2 min after the intravenous administration of 13 C-Phe. The PheBT parameters, 13 C excretion rate constant (PheBT-K), of CCl 4 hepatitis rats were significantly lower than that of normal control rats [(2.45 ± 0.25) x 10 -2 min -1 vs (2.98 ± 0.19) x 10 -2 min -1 , t = 5.40, P 13 C fast phase disposition constant did not statistically differ between the two groups (t=0.58, P>0.05). PheBT-K had significant negative cor-relation with serum ALT, AKP, TBA and total bilirum TBIL (the correlation coefficient r is -0.74, -0.73, -0.82 and -0.67 respectively, P 0.05). Conclusions: It was indicated that the small animal breath test model we designed was a virtual tool to use in experimental study on breath test and PheBT-K was a sensitive index. (authors)
First Spectroscopic Studies and Detection in SgrB2 of 13C-DOUBLY Substitued Ethyl Cyanide
Margulès, L.; Motiyenko, R. A.; Guillemin, J.-C.; Müller, Holger S. P.; Belloche, Arnaud
2015-06-01
Ethyl cyanide (CH_3CH_2CN) is one of the most abundant complex organic molecules in the interstellar medium firstly detected in OMC-1 and Sgr B2 in 1977. The vibrationally excited states are enough populated under ISM conditions and could be detected. Apart from the deuterated ones, all mono-substituted isotopologues of ethyl cyanide (13C and 15N have been detected in the ISM. The detection of isotopologues in the ISM is important: it can give information about the formation process of complex organic molecules, and it is essential to clean the ISM spectra from the lines of known molecules in order to detect new ones. The 12C/13C ratio found in SgrB2: 20-30 suggests that the doubly 13C could be present in the spectral line survey recently obtained with ALMA (EMoCA), but no spectroscopic studies exist up to now. We measured and analyzed the spectra of the 13C-doubly-substitued species up to 1 THz with the Lille solid-state based spectrometer. The spectroscopic results and and the detection of the doubly 13C species in SgrB2 will be presented. This work was supported by the CNES and the Action sur Projets de l'INSU, PCMI. This work was also done under ANR-13-BS05-0008-02 IMOLABS. Support by the Deutsche Forschungsgemeinschaft via SFB 956, project B3 is acknowledged D.~R.~Johnson, et al., Astrophys.~J. 1977, 218, L370 A.~Belloche, et al., A&A 2013, 559, A47 A.M.~Daly, et al., Astrophys.~J. 2013, 768, 81 K.~Demyk, et al. A&A 2007 466, 255 Margulès, et al. A&A 2009, 493, 565 Belloche et al. 2014, Science, 345, 1584
Synthesis and applications of 13C glycerol
International Nuclear Information System (INIS)
Stocking, E.; Khalsa, O.; Martinez, R.; Silks, L.A. III
1994-01-01
The authors are currently developing new synthetic routes to the various isotopomers of glycerol. Labeled glycerol is useful for 13 C enrichment of biomolecules. However, traditional methods of glycerol synthesis are not easily adapted for isotopic enrichment or have poor overall yields (12-15%). In addition, the use of glycerol for enrichment can be prohibitively expensive and its availability depends on the level of demand. The authors have developed a short de novo synthesis of [U- 13 C]glycerol from carbon dioxide (∼53% overall yield for four steps) and are currently examining the feasibility of synthesizing site-specific 13 C labeled glycerol and dihydroxyacetone (DHA) from methanol and carbon dioxide. The authors have examined the enzymatic conversion of [U- 13 C]glycerol to glyceraldehyde-3-monophosphate or dihydroxyacetone monophosphate (DHAP) with yields ranging from 25-50% (as determined by NMR spectroscopy). The authors are also pursuing the chemical conversion of 13 C labeled DHA to DHAP and the results are presented. Labeled DHAP is a possible enzymatic precursor for both labeled 2-deoxyribose and 2-deoxyribonucleic acids
5 CFR 842.207 - Air traffic controllers.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Air traffic controllers. 842.207 Section 842.207 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) FEDERAL EMPLOYEES RETIREMENT SYSTEM-BASIC ANNUITY Eligibility § 842.207 Air traffic controllers. (a) An employee who separates from...
Jamin, Eric; Martin, Frédérique; Martin, Gilles G
2004-01-01
A collaborative study of the carbon-13 isotope ratio mass spectrometry (13C-IRMS) method based on fermentation ethanol for detecting some sugar additions in fruit juices and maple syrup is reported. This method is complementary to the site-specific natural isotope fractionation by nuclear magnetic resonance (SNIF-NMR) method for detecting added beet sugar in the same products (AOAC Official Methods 995.17 and 2000.19), and uses the same initial steps to recover pure ethanol. The fruit juices or maple syrups are completely fermented with yeast, and the alcohol is distilled with a quantitative yield (>96%). The carbon-13 deviation (delta13C) of ethanol is then determined by IRMS. This parameter becomes less negative when exogenous sugar derived from plants exhibiting a C4 metabolism (e.g., corn or cane) is added to a juice obtained from plants exhibiting a C3 metabolism (most common fruits except pineapple) or to maple syrup. Conversely, the delta13C of ethanol becomes more negative when exogenous sugar derived from C3 plants (e.g., beet, wheat, rice) is added to pineapple products. Twelve laboratories analyzed 2 materials (orange juice and pure cane sugar) in blind duplicate and 4 sugar-adulterated materials (orange juice, maple syrup, pineapple juice, and apple juice) as Youden pairs. The precision of that method for measuring delta13C was similar to that of other methods applied to wine ethanol or extracted sugars in juices. The within-laboratory (Sr) values ranged from 0.06 to 0.16%o (r = 0.17 to 0.46 percent per thousand), and the among-laboratories (SR) values ranged from 0.17 to 0.26 percent per thousand (R = 0.49 to 0.73 percent per thousand). The Study Directors recommend that the method be adopted as First Action by AOAC INTERNATIONAL.
(13)C and (15)N solid-state NMR studies on albendazole and cyclodextrin albendazole complexes.
Ferreira, M João G; García, A; Leonardi, D; Salomon, Claudio J; Lamas, M Celina; Nunes, Teresa G
2015-06-05
(13)C and (15)N solid-state nuclear magnetic resonance (NMR) spectra were recorded from albendazole (ABZ) and from ABZ:β-cyclodextrin, ABZ:methyl-β-cyclodextrin, ABZ:hydroxypropyl-β-cyclodextrin and ABZ:citrate-β-cyclodextrin, which were prepared by the spray-drying technique. ABZ signals were typical of a crystalline solid for the pure drug and of an amorphous compound obtained from ABZ:cyclodextrin samples. Relevant spectral differences were correlated with chemical interaction between ABZ and cyclodextrins. The number and type of complexes revealed a strong dependence on the cyclodextrin group substituent. Solid-state NMR data were consistent with the presence of stable inclusion complexes. Copyright © 2015 Elsevier Ltd. All rights reserved.
47 CFR 90.207 - Types of emissions.
2010-10-01
... 47 Telecommunication 5 2010-10-01 2010-10-01 false Types of emissions. 90.207 Section 90.207... MOBILE RADIO SERVICES General Technical Standards § 90.207 Types of emissions. Unless specified elsewhere in this part, stations will be authorized emissions as provided for in paragraphs (b) through (n) of...
Laboratory spectra of C-13 ethane
Kurtz, Joe; Reuter, Dennis C.; Jennings, Donald E.; Hillman, John J.
1991-01-01
The laboratory infrared spectrum of C-13 monosubstituted ethane has been obtained at high resolution (0.0025/cm) using the McMath Fourier transform spectrometer at Kitt Peak National Observatory in May 1990. A preliminary analysis of the nu12 rQ0 branch (substituted species) suggests that its intensity is 1.15 + or - 0.05 times stronger than the equivalent nu9 branch in the normal (C-12)2H6 species. This result leads to a correction of a previously published estimate for the C-12/C-13 ratio in the atmosphere of Jupiter from about 94 to about 106.
The electron spin resonance study of heavily nitrogen doped 6H SiC crystals
Czech Academy of Sciences Publication Activity Database
Savchenko, Dariia
2015-01-01
Roč. 117, č. 4 (2015), "045708-1"-"045708-6" ISSN 0021-8979 R&D Projects: GA ČR GP13-06697P; GA MŠk(CZ) LM2011029 Grant - others:SAFMAT(XE) CZ.2.16/3.1.00/22132 Institutional support: RVO:68378271 Keywords : electron spin resonance * conduction electrons * 6H SiC * insulator-metal transition Subject RIV: BM - Solid Matter Physics ; Magnetism Impact factor: 2.101, year: 2015
8 CFR 207.7 - Derivatives of refugees.
2010-01-01
... 8 Aliens and Nationality 1 2010-01-01 2010-01-01 false Derivatives of refugees. 207.7 Section 207... REFUGEES § 207.7 Derivatives of refugees. (a) Eligibility. A spouse, as defined in section 101(a)(35) of..., shall be granted refugee status if accompanying or following-to-join the principal alien. An...
19 CFR 207.11 - Contents of petition.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Contents of petition. 207.11 Section 207.11... SUBSIDIZED EXPORTS TO THE UNITED STATES Preliminary Determinations § 207.11 Contents of petition. (a) The petition shall be signed by the petitioner or its duly authorized officer, attorney, or agent, and shall...
20 CFR 655.207 - Adverse effect rates.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Adverse effect rates. 655.207 Section 655.207... Agricultural Employment § 655.207 Adverse effect rates. (a) Except as otherwise provided in this section, the adverse effect rates for all agricultural and logging employment shall be the prevailing wage rates in the...
SRS-sensor 13C/12C isotops measurements for detecting Helicobacter Pylori
Grishkanich, Aleksandr; Chubchenko, Yan; Elizarov, Valentin; Zhevlakov, Aleksandr; Konopelko, Leonid
2018-02-01
We developed SRS-sensor 13C/12C isotops measurements detecting Helicobacter Pylori for medical diagnostics of human health. Measuring of absolute 13C/12C isotope amount ratios allows to explore the topical problems of the modern world, alcoholic beverages and tobacco, medical diagnostics of human health. SRS method is used to measure the ratio of carbon isotopes in the exhaled carbon dioxide, which is used to diagnose the human infection of Helicobacter pylori and the influence of the Helicobacter pylori bacterium on the occurrence of gastritis, gastric and duodenal ulcers. A method for the analysis of human infection with Helicobacter pylori was developed on the basis of measurements of the ratio of 13C / 12C carbon isotopes in human exhaled air with a high level of measurement accuracy. The article reviews the work in the field of provision comparability of absolute 13C/12C isotope amount ratios in the environment and food. The analysis of the technical and metrological characteristics of traditional and perspective instruments for measuring isotope ratios is presented. The provision of comparability of absolute 13C/12C isotope amount ratios is carried by gravimetrically prepared reference standards. The key features and emerging issues are discussed.
International Nuclear Information System (INIS)
Resler, D.A.
1987-03-01
The specific purpose of this work is to provide a better understanding of the 14 C level structure; the general purpose is to provide the details for using shell model calculations in R-matrix analyses. Using the TOF facilities of the Ohio University Accelerator Laboratory, the elastic and first 3 inelastic differential scattering cross sections for 13 C + n were measured at 69 energies for 4.5 ≤ E/sub n/ ≤ 11 MeV. A multiple scattering code was developed which provided a simulation of the experimental scattering process allowing accurate corrections to the small inelastic data. The integrated 13 C(n,α) 10 Be cross section is estimated. The sequential 2n-decay of 14 C states populated by 13 C + n was observed. A shell model code was developed. Normal and nonnormal parity calculations were made for the lithium isotopes using a new two-body interaction. The results for 5 Li predict the 2s/sub 1/2/ and 1d/sub 5/2/ single-particle states to be located below the 3/2 + state. Similar calculations were made for 13 C, 13 N, and 14 C. Results for 13 C and 13 N show for E/sub x/ 7 Li and 14 C, 2 h-barω calculations were done. Shell model calculations generated the R-matrix parameters for the elastic and first 3 inelastic channels of 13 C + n. After adjusting some energies, the predicted structure generally agrees with experiment for E/sub n/ 13 C + n data were refit to replace R 0 background terms by more realistic broad states and to get better agreement with model calculations. R-matrix fitting of the full data set produced new 14 C level information. For E/sub n/ > 4 MeV (E/sub x/ > 12 MeV), 5 states are given definite J/sup π/ assignments; 3, tentative assignments. 122 refs., 91 figs., 30 tabs
19 CFR 207.115 - Petition for review.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Petition for review. 207.115 Section 207.115... and Committee Proceedings § 207.115 Petition for review. (a) The petition and responses. (1) Any party... Secretary a petition for review, except that a party who has defaulted may not petition for review of any...
Synthesis and applications of 13C glycerol
International Nuclear Information System (INIS)
Stocking, E.; Khalsa, O.; Martinez, R.A.; Silks, L.A. III
1994-01-01
Due in part to the use of labeled glycerol for the 13 C enrichment of biomolecules, we are currently developing new synthetic routes to various isotopomers of glycerol. Judging from our experience, traditional methods of glycerol synthesis are not easily adapted for isotopic enrichment and/or have poor overall yields (12 to 15%). Furthermore, the use of glycerol for enrichment can be prohibitively expensive and its availability is limited by the level of demand. We are presently developing a short de novo synthesis of glycerol from carbon dioxide (∼53% overall yield for four steps) and are examining the feasibility of synthesizing site-specific 13 C-labeled glycerol and dihydroxyacetone (DHA) from labeled methanol and carbon dioxide. One application of 13 C glycerol we have examined is enzymatic conversion of glycerol to glyceraldehyde-3-monophosphate or dihydroxyacetone monophosphate (DHAP) with yields ranging from 25 to 50% (as determined by NMR spectroscopy). We are also pursuing the chemical conversion of 13 C-labeled DHA to DHAP. We are especially interested in 13 C-labeled DHAP because we are investigating its use as a chemo-enzymatic precursor for both labeled 2-deoxyribose and 2-deoxyribonucleic acids
Neutron orbital radii in {sup 13} C; Radios orbitales neutronicos en {sup 13} C
Energy Technology Data Exchange (ETDEWEB)
Aguilera R, E.F.; Murillo, G.; Ramirez, J.J.; Avila, O.L. [ININ, 52045 Ocoyoacac, Estado de Mexico (Mexico)
1988-01-15
In this work its were carried out experimental measurements of the reaction {sup 12}C(d,p) {sup 13}C at low energy. Preliminary results of a DWBA analysis of the data are presented, and the possibility of using this reaction to obtain the orbital radius of the transferred neutron is investigated. (Author)
Multi-cluster dynamics in CΛ13 and analogy to clustering in 12C
Directory of Open Access Journals (Sweden)
Y. Funaki
2017-10-01
Full Text Available We investigate structure of CΛ13 and discuss the difference and similarity between the structures of C12 and CΛ13 by answering the questions if the linear-chain and gaslike cluster states, which are proposed to appear in C12, survives, or new structure states appear or not. We introduce a microscopic cluster model called, Hyper-Tohsaki–Horiuchi–Schuck–Röpke (H-THSR wave function, which is an extended version of the THSR wave function so as to describe Λ hypernuclei. We obtained two bound states and two resonance (quasi-bound states for Jπ=0+ in CΛ13, corresponding to the four 0+ states in C12. However, the inversion of level ordering between the spectra of C12 and CΛ13, i.e. that the 03+ and 04+ states in CΛ13 correspond to the 04+ and 03+ states in C12, respectively, is shown to occur. The additional Λ particle reduces sizes of the 02+ and 03+ states in CΛ13 very much, but the shrinkage of the 04+ state is only a half of the other states, in spite of the fact that attractive Λ-N interaction makes nucleus contracted so much when the Λ particle occupies an S-orbit. In conclusion, the Hoyle state becomes quite a compact object with BeΛ9+α configuration in CΛ13 and is no more gaslike state composed of the 3α clusters. Instead, the 04+ state in CΛ13, coming from the C12(03+ state, appears as a gaslike state composed of α+α+Λ5He configuration, i.e. the Hoyle analog state. A linear-chain state in a Λ hypernucleus is for the first time predicted to exist as the 03+ state in CΛ13 with more shrunk arrangement of the 3α clusters along z-axis than the 3α linear-chain configuration realized in the C12(04+ state. All the excited states are shown to appear around the corresponding cluster-decay threshold, reflecting the threshold rule.
Ethane's 12C/13C Ratio in Titan: Implications for Methane Replenishment
Jennings, Donald E.; Nixon, C. A.; Romani, P. N.; Bjoraker, G. L.; Sada, P. V.; Lunsford, A. W.; Boyle, R. J.; Hesman, B. E.; McCabe, G. H.
2009-01-01
As the .main destination of carbon in the destruction of methane in the atmosphere of Titan, ethane provides information about the carbon isotopic composition of the reservoir from which methane is replenished. If the amount of methane entering the atmosphere is presently equal to the amount converted to ethane, the 12C/13C ratio in ethane should be close to the ratio in the reservoir. We have measured the 12C/13C ratio in ethane both with Cassini CIRS(exp 1) and from the ground and find that it is very close to the telluric standard and outer planet values (89), consistent with a primordial origin for the methane reservoir. The lower 12C/13C ratio measured for methane by Huygens GCMS (82.3) can be explained if the conversion of CH4 to CH3 (and C2H6) favors 12C over 13C with a carbon kinetic isotope effect of 1.08. The time required for the atmospheric methane to reach equilibrium, i.e., for replenishment to equal destruction, is approximately 5 methane atmospheric lifetimes.
Directory of Open Access Journals (Sweden)
AS Carrijo
2000-09-01
Full Text Available Os isótopos estáveis do carbono que eram utilizados em estudos ecológicos e paleoecológicos apresentaram um incremento nos últimos trinta anos, na utilização em estudos dietéticos em animais. Entretanto, existem poucas informações sobre o padrão metabólico e sobre as taxas de turnover do 13C em aves. O presente experimento estabeleceu curvas de substituição e taxas de movimentação do 13C no ovo e no fígado de aves de postura adultas, pela substituição da ração comercial por dietas compostas de grãos dos ciclos fotossintéticos C3 e C4, durante 50 dias. A diferença no conteúdo isotópico do delta per mil do carbono-13 (delta‰ 13C entre as duas dietas foi de 16,13‰. A taxa de substituição do 13C das dietas, nos tecidos, adequou-se num modelo exponencial, descrevendo o turnover do carbono nos tecidos analisados. As taxas de movimentação do 13C, nas aves alimentadas com dieta baseada em grãos C3, foi maior no fígado em relação ao ovo, com valores para a meia-vida de 2,9 e 3,7 dias, respectivamente. As aves que receberam ração com grãos C4 apresentaram uma taxa de turnover no ovo superior àquela obtida para o fígado, com meia-vida de 4,0 e 5,3 dias, respectivamente. Os valores do delta‰13C observados para ovo e fígado diferiram em aproximadamente 2‰ daqueles referentes às dietas.The stable carbon isotopes used in ecology and paleoecology during the last 30 years has now been used in dietary studies of animals. However, there are not enough studies on the metabolism patterns and turnover rates of the 13C in avian. This experiment established the turnover rates of the 13C in egg and liver tissues of adult laying hens through the substitution of commercial diets by diets containing C3 and C4 photosynthetic cycle grains for 50 days. The delta‰13C difference in two diets contents was 16.13‰. The diets 13C turnover rates in tissues were adapted in an exponential model that describes the isotopic carbon
IMPROVED LINE DATA FOR THE SWAN SYSTEM 12C13C ISOTOPOLOGUE
International Nuclear Information System (INIS)
Ram, Ram S.; Brooke, James S. A.; Bernath, Peter F.; Sneden, Christopher; Lucatello, Sara
2014-01-01
We present new, accurate predictions for rotational line positions, excitation energies, and transition probabilities of the 12 C 13 C isotopologue Swan d 3 Π-a 3 Π system 0-0, 0–1, 0–2, 1–0, 1–1, 1–2, 2–0, 2–1, and 2–2 vibrational bands. The line positions and energy levels were predicted through new analyses of published laboratory data for the 12 C 13 C lines. Transition probabilities were derived from recent computations of transition dipole moments and related quantities. The 12 C 13 C line data were combined with similar data for 12 C 2, reported in a companion paper, and applied to produce synthetic spectra of carbon-rich metal-poor stars that have strong C 2 Swan bands. The matches between synthesized and observed spectra were used to estimate band head positions for a few of the 12 C 13 C vibrational bands and to verify that the new computed line data match observed spectra. The much weaker C 2 lines of the bright red giant Arcturus were also synthesized in the band head regions
Evaluation of [14C] and [13C]Sucrose as Blood-Brain Barrier Permeability Markers.
Miah, Mohammad K; Chowdhury, Ekram A; Bickel, Ulrich; Mehvar, Reza
2017-06-01
Nonspecific quantitation of [ 14 C]sucrose in blood and brain has been routinely used as a quantitative measure of the in vivo blood-brain barrier (BBB) integrity. However, the reported apparent brain uptake clearance (K in ) of the marker varies widely (∼100-fold). We investigated the accuracy of the use of the marker in comparison with a stable isotope of sucrose ([ 13 C]sucrose) measured by a specific liquid chromatography-tandem mass spectrometry method. Rats received single doses of each marker, and the K in values were determined. Surprisingly, the K in value of [ 13 C]sucrose was 6- to 7-fold lower than that of [ 14 C]sucrose. Chromatographic fractionation after in vivo administration of [ 14 C]sucrose indicated that the majority of the brain content of radioactivity belonged to compounds other than the intact [ 14 C]sucrose. However, mechanistic studies failed to reveal any substantial metabolism of the marker. The octanol:water partition coefficient of [ 14 C]sucrose was >2-fold higher than that of [ 13 C]sucrose, indicating the presence of lipid-soluble impurities in the [ 14 C]sucrose solution. Our data indicate that [ 14 C]sucrose overestimates the true BBB permeability to sucrose. We suggest that specific quantitation of the stable isotope ( 13 C) of sucrose is a more accurate alternative to the current widespread use of the radioactive sucrose as a BBB marker. Copyright © 2017 American Pharmacists Association®. Published by Elsevier Inc. All rights reserved.
International Nuclear Information System (INIS)
Szczecinski, P.; Gryff-Keller, A.; Molchanov, S.
2005-01-01
Triketones have been known for many years to be efficient inhibitors of (4-hydroxyphenyl)pyruvate dioxygenase (HPPD), an enzyme very important for plants and animals, which catalyzes the tyrosine catabolism. Inhibition of this process has been used for both herbicidal and medical purposes. The mechanism of inhibition of HPPD by triketones is still under investigation. Recently, an almost complete mechanistic model of interaction between the mentioned enzyme and its inhibitor has been proposed. However, some arguments used by the authors to rationalize the proposed mechanism cannot be accepted. Therefore further developing of the investigation in this field is justified. In the present work the solution structure of 2-formylcyclohexane-1,3-dione, a simple molecular model of HPPD inhibitors, has been investigated using 1 H and 13 C NMR spectroscopic methods and theoretical DFT-based calculations. (author)
Energy Technology Data Exchange (ETDEWEB)
Okamoto, K.; Tsukada, Y. [Toshiba Corp., Tokyo (Japan)
1998-10-10
Carbon-13 magnetic resonance spectroscopy ({sup 13}C-MRS) and research and development efforts for brain metabolism measurement are described. Brain metabolism is a process characterized in that it not only extracts energy by disintegrating grape sugar that is the practically sole source of energy into H2O, CO2, etc., but also vigorously synthesizes amino acids that perform important functions in neural transmission, such as glutamic acid, glutamine, and {gamma}-amino acid. MRS is a technique that utilizes the magnetic resonance, which is generated when an atomic nucleus with a spin is placed in a magnetic field, for the isolation and identification of chemicals in a living body through examining the delicate difference in the magnetic resonance frequencies of the nuclei under observation. Since the signals from {sup 13}C are low in intensity as compared with those from other nuclides, a method was contrived around 1980, which observes {sup 1}H combined with {sup 13}C in grape sugar and amino acids, named the HSQC (heteronuclear single quantum coherence) method. The author et al., combining gradient magnetic pulses with HSQC, actually measure Homo sapiens brain metabolism using {sup 13}C-MRS, and now believe that the technology will be put to practical application. 7 refs., 10 figs., 1 tab.
15 CFR 2011.207 - Suspension of the certificate system.
2010-01-01
..., SYRUPS AND MOLASSES Specialty Sugar § 2011.207 Suspension of the certificate system. (a) Suspension. The.... Notice of such suspension and the effective date thereof shall be published in the Federal Register. (b... such reinstatement and the effective date thereof shall be published in the Federal Register. (c...
Automated 13CO2 analyzing system for the 13C breath test
International Nuclear Information System (INIS)
Suehiro, Makiko; Kuroda, Akira; Maeda, Masahiro; Hinaga, Kou; Watanabe, Hiroyuki.
1987-01-01
An automated 13 CO 2 analyzing system for the 13 C breath test was designed, built and evaluated. The system, which was designed to be controlled by a micro-computer, includes CO 2 purification, 13 CO 2 abundance measurement, data processing and data filing. This article gives the description of the whole system with flow charts. This system has proved to work well and it has become feasible to dispose of 5 to 6 CO 2 samples per hour. With such a system, the 13 C breath test will be carried out much more easily and will obtain much greater popularity. (author)
TMRT OBSERVATIONS OF CARBON-CHAIN MOLECULES IN SERPENS SOUTH 1a
Energy Technology Data Exchange (ETDEWEB)
Li, Juan; Shen, Zhi-Qiang; Wang, Junzhi; Chen, Xi; Wu, Ya-Jun; Zhao, Rong-Bing; Wang, Jin-Qing; Zuo, Xiu-Ting; Fan, Qing-Yuan; Hong, Xiao-Yu; Jiang, Dong-Rong; Li, Bin; Liang, Shi-Guang; Ling, Quan-Bao; Liu, Qing-Hui; Qian, Zhi-Han; Zhang, Xiu-Zhong; Zhong, Wei-Ye; Ye, Shu-Hua, E-mail: lijuan@shao.ac.cn [Department of Radio Science and Technology, Shanghai Astronomical Observatory, 80 Nandan RD, Shanghai 200030 (China)
2016-06-20
We report Shanghai Tian Ma Radio Telescope (TMRT) detections of several long carbon-chain molecules in the C and Ku bands, including HC{sub 3}N, HC{sub 5}N, HC{sub 7}N, HC{sub 9}N, C{sub 3}S, C{sub 6}H, and C{sub 8}H toward the starless cloud Serpens South 1a. We detected some transitions (HC{sub 9}N J = 13–12, F = 12–11, and F = 14–13; H{sup 13}CCCN J = 2–1, F = 1–0, and F = 1–1; HC{sup 13}CCN J = 2–1, F = 2–2, F = 1–0, and F = 1–1; HCC{sup 13}CN J = 2–1, F = 1–0, and F = 1–1) and resolved some hyperfine components (HC{sub 5}N J = 6–5, F = 5–4; H{sup 13}CCCN J = 2–1, F = 2–1) for the first time in the interstellar medium. The column densities of these carbon-chain molecules in the range 10{sup 12}–10{sup 13} cm{sup −2} are comparable to two carbon-chain molecule rich sources, TMC-1 and Lupus-1A. The abundance ratios are 1.00:(1.11 ± 0.15):(1.47 ± 0.18) for [H{sup 13}CCCN]:[HC{sup 13}CCN]:[HCC{sup 13}CN]. This result implies that the {sup 13}C isotope is also concentrated in the carbon atom adjacent to the nitrogen atom in HC{sub 3}N in Serpens South 1a, which is similar to TMC-1. The [HC{sub 3}N]/[H{sup 13}CCCN] ratio of 78 ± 9, the [HC{sub 3}N]/[HC{sup 13}CCN] ratio of 70 ± 8, and the [HC{sub 3}N]/[HCC{sup 13}CN] ratio of 53 ± 4 are also comparable to those in TMC-1. Serpens South 1a proves to be a suitable testing ground for understanding carbon-chain chemistry.
Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate
Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.
2014-01-01
This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197
Membrana de PLDLA-TMC como protetor na regeneração do tendão calcâneo: Estudo in vivo em coelhos
Directory of Open Access Journals (Sweden)
Julia Rezende Duek
2014-06-01
Full Text Available Um dos maiores problemas da cirurgia restauradora dos tendões flexores é evitar a formação de aderências, pois limita seu deslizamento. Assim, é muito desejável que a cicatrização ocorra o mais rápido possível, restaurando a capacidade de deslizamento dos tendões, sem limitações dos movimentos. O objetivo deste trabalho foi analisar a resistência do Tendão calcâneo, utilizando membrana de PLDLA-TMC como protetor da aderência dos tecidos adjacentes após implantes em coelhos New Zeland. Foram utilizados 20 coelhos, divididos em dois grupos, os quais foram submetidos à secção do tendão calcâneo e posterior sutura com técnica de Kessler modificada. No grupo A, logo após sutura o animal foi sacrificado e o tendão foi enviado para ensaio mecânico. Já no grupo B, após três semanas, os animais foram sacrificados e o material foi submetido à análise histológica. Os resultados obtidos a partir do ensaio mecânico mostraram melhora nos valores da resistência à tração dos implantes com a membrana, comparados aos apenas suturados. Na cicatrização da lesão, ocorreu melhor organização das fibras colágenas quando foi utilizado o polímero PLDLA-TMC, além de uma menor aderência cicatricial. Conclui-se que a membrana de PLDLA-TMC é promissora na reparação de lesões tendíneas.
Measurement of the natural variation of 13C/12C isotope ratio in organic samples
International Nuclear Information System (INIS)
Ducatti, C.
1977-01-01
The isotopic ratio analysis for 13 C/ 12 C by mass spectrometry using a 'Working standard' allows the study of 13 C natural variation in organic material, with a total analytical error of less than 0,2%. Equations were derived in order to determine 13 C/ 12 C and 18 O/ 16 O ratios related to the 'working standard' CENA-std and to the international standard PDB. Isotope ratio values obtained with samples prepared in two different combustion apparatus were compared; also the values obtained preparing samples by acid decomposition of carbonaceous materials were compared with the values obtained in different international laboratories. Utilizing the methodology proposed, several leaves collected at different heights of different vegetal species, found 'inside' and 'outside' of the Ducke Forest Reserve, located in the Amazon region, are analysed. It is found that the 13 C natural variation depends upon metabolic process and environmental factors, both being factors which may be qualified as parcial influences on the CO 2 cycle in the forest. (author) [pt
Charged multiplicity distributions in anti np interactions at 6 GeV/c
International Nuclear Information System (INIS)
Batyunya, B.V.; Boguslavskij, I.B.; Gramenitskij, I.M.
1980-01-01
Inelastic topological anti np cross sections at 6 GeV/c have been determined based on a study of the charged multiplicity distribution in antideuteron-proton collisions at 12 GeV/c. The data were obtained in an exposure of the ''Ludmila'' JINR 2 m hydrogen bubble chamber at the Serpukhov accelerator. In anti np interactions average charged multiplicity and its ratio to dispersion, /D, were found to be 3.32+-0.13 and 1.86+-0.16, respectively. Comparison with anti pn, anti pp and pp data was made
Freshwater Mussel Shell δ13C Values as a Proxy for δ13CDIC in a Polluted, Temperate River
Graniero, L. E.; Gillikin, D. P.; Surge, D. M.
2017-12-01
Freshwater mussel shell δ13C values have been examined as an indicator of ambient δ13C composition of dissolved inorganic carbon (DIC) in temperate rivers. However, shell δ13C values may be obscured by the assimilation of respired, metabolic carbon (CM) derived from the organism's diet. Water δ18O and δ13CDIC values were collected fortnightly from August 2015 through July 2017 from three sites (one agricultural, one downstream of a wastewater treatment plant, one urban) in the Neuse River, NC to test the reliability of Elliptio complanata shell δ13C values as a proxy for δ13CDIC values. Muscle, mantle, gill, and stomach δ13C values were analyzed to approximate the %CM incorporated into the shell. All tissue δ13C values were within 2‰ of each other, which equates to a ±1% difference in calculated %CM. As such, muscle tissue δ13C values will be used for calculating the %CM, because they have the slowest turnover rate of the tissues sampled. Water temperature and δ18O values were used to calculate predicted aragonite shell δ18O values (δ18Oar) based on the aragonite-water fractionation relationship. To assign dates to each shell microsample, predicted δ18Oar values were compared to high-resolution serially sampled shell values. Consistent with previous studies, E. complanata cease growth in winter when temperatures are below about 12ºC. Preliminary results indicate that during the growing season, shell δ13C values are lower than expected equilibrium values, reflecting the assimilation of 15% CM, on average. Shell δ13C values are not significantly different than δ13CDIC values, but do not capture the full range of δ13CDIC values during each growing season. Thus, δ13C values of E. complanata shells can be used to reliably reconstruct past δ13CDIC values within 2‰ of coeval values. Further research will investigate how differing land-use affects the relationship between shell δ13C, CM, and δ13CDIC values.
International Nuclear Information System (INIS)
Omar, S.
2001-01-01
Study of the c-kit proto-oncogene (CD117) may be of help for the identification of phenotypic profiles that are absent or present at very low frequencies on normal human blast cells and therefore might be of great value for the detection of leukemic cells displaying such immuno phenotypes in patients in complete remission. Design and methods: Ninety patients with acute myeloid leukemias, diagnosed according to FAB criteria and immunological marker studies, were studied for the dual expression on blast cells of the CD117/CD15 immuno phenotype co expression by direct immunofluorescence assay using dual staining combination flow cytometry. Results: In 69/90 acute myeloid leukemia patients analyzed (77%), blast cells expressed the CD117 antigen. Moreover, in 38 of them (42% of acute myeloid leukemia cases), leukemic blasts co expressed the CD117 and CD15 antigens. There was no significant correlation between the FAB classification and the CD117 and CD15 expression in acute myeloid leukemia cases. Conclusions: These results suggest that immunological methods for the detection of MRD based on the existence of aberrant phenotypes could be used in the majority of AML patients. This phenotype CD117/CD15, present in acute myeloid leukemia cases at a relatively high frequency (42%), represents an aberrant phenotype, because it was not detected on normal human blast cells, suggesting that the use of these combinations of monoclonal antibodies could be of help in detecting residual leukemic blasts among normal blast cells. The use of the CD117 antigen in different monoclonal antibodies combinations may be of great help for the detection of minimal residual disease in a high proportion of acute myeloid leukemia cases, especially in those patients displaying the CD117+/CD15+ immuno phenotype, because cells co expressing both antigens in normal blasts, if present, are at very low frequencies. The simultaneous assessment of two or more markers in single cells has facilitated the
Institute of Scientific and Technical Information of China (English)
杨倩; 黄宛真; 孔凡志
2016-01-01
TiC-H 13 cladding layer was produced by laser cladding on H 13 steel substrate.The effects of TiC on microstructure and electrochemical corrosion behavior of TiC-H13 layer were studied by SEM,EDS,TEM and anodic polarization curve.The results show that good metallurgical bonding is formed between the TiC-H 13 cladding layer and H 13 steel substrate.The new phase of TiC is formed in the laser cladding layer.Compared with H13 steel,the TiC-H13 cladding layer demonstrates much higher corrosion potential and the lower corrosion current,which exhibites significantly higher corrosion resistant.%以H13钢为基体,通过激光熔覆TiC-H13混合粉末获得熔覆层,考察TiC的加入对TiC-H13熔覆层的微观结构以及耐腐蚀性能的影响.采用SEM、EDS和TEM对熔覆层内的微观组成和物相进行表征,利用电化学阳极极化曲线研究熔覆层的耐腐蚀性能.结果表明:TiC-H13粉末和H13钢基体可以形成良好的熔覆层,熔覆层与基体紧密结合,熔覆层中形成新物相TiC.与H13钢相比,TiC-H 13熔覆层的腐蚀电位明显升高,腐蚀电流明显降低,耐腐蚀性能得到显著提高.
Synthesis and applications of selectively {sup 13}C-labeled RNA
Energy Technology Data Exchange (ETDEWEB)
SantaLucia, J. Jr.; Shen, L.X.; Lewis, H.; Cai, Z.; Tinoci, I. Jr. [Univ. of California, Berkeley, CA (United States)
1994-12-01
Spectral overlap is a substantial problem in NMR studies of RNA molecules >30 nucleotides. To overcome this difficulty, we synthesized selectively {sup 13}C-labeled RNAs and adapted several isotope-edited two- and three-dimensional NMR experiments originally developed for protein studies. We optimized protocols for synthesis of multi-gram quantities of CTP, UTp, ATP, and GTP using a combination of synthetic organic and enzymatic methods. Uracil is prepared in 40 to 50% yield from {sup 13}C-cyanide in two steps. Using acetyl- tribenzoyl-ribose and standard chemistry uracil is then attached to the sugar (90% yield). The tribenzoyl-uridine intermediate is converted into uridine or cytidine quantitatively, depending on the deblocking protocol. Labeled purines are synthesized using simple pyrimidine precursors and reacting with {sup 13}C-formic acid (80% yield). Purine nucleosides are then synthesized using uridine phosphorylase and purine nucleoside phosphorylase. The nucleosides were converted to NMPs by treatment with POC1{sub 3} in triethylphosphate. We converted NMPs to NTPs by standard enzymatic methods. Selectively labeled RNAs were synthesized by run-off transcription using {sup 13}C-labeled NTPs. Several different strategies help solve over-lap problems in larger RNAs. Isotope-edited two-dimensional NMR experiments such as {omega}1-1/2 X-filtered NOESY simplify NMR spectra by dividing the normal NOESY spectrum into two subspectra-one involving NOEs from protons bound to {sup 12}C and one from protons bound to {sup 13}C. For example, we labeled A and U residues of a 34-nucleotide pseudoknot, and the {sup 12}C subspectrum of the 1/2 X-filtered NOESY contained NOEs only from G and C residues (along with adenine 2H); the {sup 13}C subspectrum contained NOEs only from A and U residues. Each subspectrum has less overlap than the NOESY of an unlabeled sample; the editing strategy allows each resonance to be identified by residue type (A, C, G, or U).
Resonance capture cross section of 207Pb
Domingo-Pardo, C.; Aerts, G.; Alvarez-Pol, H.; Alvarez-Velarde, F.; Andriamonje, S.; Andrzejewski, J.; Assimakopoulos, P.; Audouin, L.; Badurek, G.; Baumann, P.; Becvar, F.; Berthoumieux, E.; Bisterzo, S.; Calvino, F.; Cano-Ott, D.; Capote, R.; Carrapico, C.; Cennini, P.; Chepel, V.; Chiaveri, E.; Colonna, N.; Cortes, G.; Couture, A.; Cox, J.; Dahlfors, M.; David, S.; Dillman, I.; Dolfini, R.; Dridi, W.; Duran, I.; Eleftheriadis, C.; Embid-Segura, M.; Ferrant, L.; Ferrari, A.; Ferreira-Marques, R.; Fitzpatrick, L.; Frais-Koelbl, H.; Fujii, K.; Furman, W.; Gallino, R.; Goncalves, I.; Gonzalez-Romero, E.; Goverdovski, A.; Gramegna, F.; Griesmayer, E.; Guerrero, C.; Gunsing, F.; Haas, B.; Haight, R.; Heil, M.; Herrera-Martinez, A.; Igashira, M.; Isaev, S.; Jericha, E.; Kadi, Y.; Kappeler, F.; Karamanis, D.; Karadimos, D.; Kerveno, M.; Ketlerov, V.; Koehler, P.; Konovalov, V.; Kossionides, E.; Krticka, M.; Lamboudis, C.; Leeb, H.; Lindote, A.; Lopes, I.; Lozano, M.; Lukic, S.; Marganiec, J.; Marrone, S.; Mastinu, P.; Mengoni, A.; Milazzo, P.M.; Moreau, C.; Mosconi, M.; Neves, F.; Oberhummer, H.; Oshima, M.; O'Brien, S.; Pancin, J.; Papachristodoulou, C.; Papadopoulos, C.; Paradela, C.; Patronis, N.; Pavlik, A.; Pavlopoulos, P.; Perrot, L.; Plag, R.; Plompen, A.; Plukis, A.; Poch, A.; Pretel, C.; Quesada, J.; Rauscher, T.; Reifarth, R.; Rosetti, M.; Rubbia, C.; Rudolf, G.; Rullhusen, P.; Salgado, J.; Sarchiapone, L.; Savvidis, I.; Stephan, C.; Tagliente, G.; Tain, J.L.; Tassan-Got, L.; Tavora, L.; Terlizzi, R.; Vannini, G.; Vaz, P.; Ventura, A.; Villamarin, D.; Vincente, M.C.; Vlachoudis, V.; Vlastou, R.; Voss, F.; Walter, S.; Wendler, H.; Wiescher, M.; Wisshak, K.
2006-01-01
The radiative neutron capture cross section of 207Pb has been measured at the CERN neutron time of flight installation n_TOF using the pulse height weighting technique in the resolved energy region. The measurement has been performed with an optimized setup of two C6D6 scintillation detectors, which allowed us to reduce scattered neutron backgrounds down to a negligible level. Resonance parameters and radiative kernels have been determined for 16 resonances by means of an R-matrix analysis in the neutron energy range from 3 keV to 320 keV. Good agreement with previous measurements was found at low neutron energies, whereas substantial discrepancies appear beyond 45 keV. With the present results, we obtain an s-process contribution of 77(8)% to the solar abundance of 207Pb. This corresponds to an r-process component of 23(8)%, which is important for deriving the U/Th ages of metal poor halo stars.
Synthesis of {sup 14}C-labeled levamisole and {sup 13}C-labeled tetramisole
Energy Technology Data Exchange (ETDEWEB)
Feil, V.J. [US Department of Agriculture, Agricultural Research Service, Biosciences Research Lab., Fargo, ND (United States)
1996-12-01
The syntheses of {sup 14}C-ring labeled levamisole ([-]-2,3,5,6-tetrahydro-6-phenyl [{sup 14}C]-UL imidazo[2,1-b]thiazole) from acetophenone-ring-UL-{sup 14}C in 5 steps plus resolution with a 7.5% overall yield, and {sup 13}C{sub 6}-ring labeled tetramisole ([{+-}]-2,3,5,6-tetrahydro-6-phenyl [{sup 13}C{sub 6}]imidazo[2,1-b]thiazole) from benzene-{sup 13}C{sub 6} in 6 steps with a 9.0% overall yield are described. (author).
Search for biological effects of 13C-enrichment in developing mammalian systems
International Nuclear Information System (INIS)
Gregg, C.; Ott, D.; Deaven, L.; Spielmann, H.; Krowke, R.; Neubert, D.
1975-01-01
Increasing diagnostic use of stable isotopes, especially in children and pregnant women, enhances the importance of studies on the biological isotope effects in sensitive mammalian systems. Experimental data on animal systems are meager. The mouse embryos was studied at various stages and mouse limb buds were studied in organ culture. Limb bud development in vitro was unaffected by incubation with 82 mol percent 13 C-glucose as judged by either morphological or biochemical criteria. Of 271 preimplantation embryos incubated in vitro, 95.2 percent developed normally; in 13 C-enriched medium, 96.5 percent showed normal development. 13 C-Enrichment of the embryos in vitro is over 60 percent. Administration of 1.2 g glucose-U- 13 C to pregnant mice during organogenesis leads to enrichment of maternal liver glycogen to over 17 mol percent 13 C, about one-third this level in the embryo, and a lower level in maternal blood. The absolute 13 C content of the embryo continues to increase for several days after the end of isotope administration, while the enrichment in maternal tissues falls. The lipid fraction of the fetus is most highly labeled shortly after the end of isotope administration []These studies on developing mammalian systems have not yet revealed any alteration of normal development due to stable isotope enrichment. (auth)
DEFF Research Database (Denmark)
Vistisen, Bodil; Høy, Carl-Erik
2004-01-01
the transport of dietary C-13-labelled fatty acids in rat plasma to compare the chylomicron fatty acid metabolism after administration of specific structured, long chain and medium chain triacylglycerols. Rats were fed ML*M, M*LM*, L*L*L* or M*M*M* (L=linoleic acid, 18:2n-6, M=caprylic acid, 8:0, * = C-13......-labelled fatty acid) by gavage. A maximum transport of 0.5% of the administered C-13-labelled 18:2n-6 was observed in 1mL rat plasma both after administration of L*L*L* and ML*M, while approximately 0.04% of the administered C-13-labelled 8:0 was detected in 1mL plasma following administration of M......*M*M* or M*LM*. After L*L*L* administration C-13-labelled 20:4n-6 was observed in plasma, probably formed by elongation and desaturation of 18:2n-6 in the enterocyte or liver cells. Furthermore, C-13-labelled 16:0, 48:0, 18: 1n-9 and 20:4n-6 were observed in plasma of rats fed M*M*M* and M*LM* due...
Simultaneous hyperpolarized 13C-pyruvate MRI and 18F-FDG-PET in cancer (hyperPET)
DEFF Research Database (Denmark)
Gutte, Henrik; Hansen, Adam E.; Henriksen, Sarah T.
2015-01-01
named this concept hyper PET. Intravenous injection of the hyperpolarized 13C-pyruvate results in an increase of 13C-lactate, 13C-alanine and 13CCO2 (13C-HCO3) resonance peaks relative to the tissue, disease and the metabolic state probed. Accordingly, with dynamic nuclear polarization (DNP) and use......In this paper we demonstrate, for the first time, the feasibility of a new imaging concept - combined hyperpolarized 13C-pyruvate magnetic resonance spectroscopic imaging (MRSI) and 18F-FDG-PET imaging. This procedure was performed in a clinical PET/MRI scanner with a canine cancer patient. We have...... of 13C-pyruvate it is now possible to directly study the Warburg Effect through the rate of conversion of 13C-pyruvate to 13C-lactate. In this study, we combined it with 18F-FDG-PET that studies uptake of glucose in the cells. A canine cancer patient with a histology verified local recurrence...
Ecosystem differences in the trophic enrichment of 13C in aquatic food webs
International Nuclear Information System (INIS)
France, R.L.; Peters, R.H.
1997-01-01
Data from 35 published studies were collated to examine patterns in the trophic enrichment of 13 C of consumers. Because both δ 13 C and δ 14 N vary systematically across ecosystems, it was necessary to standardize for such differences before combining data from numerous sources. Relationships of these measures of ecosystem-standardized δ 13 C to ecosystem-standardized trophic position (Δδ 15 N) for freshwater, estuarine, coastal, and open-ocean and for all aquatic ecosystems yielded regression equations of low predictive capability (average of 20% explained variance in δ 13 C). However, differences were observed in the slopes between δ 13 C and standardized trophic position when data were examined study-specifically: the average trophic fractionation of 13 C was found to increase from +0.2micron for freshwater to +0.5micron for estuarine to +0.8micron for coastal, and to +1.1micron for open-ocean food webs. This ecosystem-specific gradient in 13 C enrichment for consumers supports previous findings of a similar continuum existing for zooplankton - particulate organic matter differences in δ 13 C. Possible mechanisms to explain these ecosystem-specific patterns in 13 C enrichment may be related to the relative importance of detritus, heterotrophic respiration, partial reliance on alternative food sources, and lipid influences in the different ecosystems. (author)
Synthesis and characterization of "1"3C_3-tristearin
International Nuclear Information System (INIS)
Wu Hangyu; Lin Lin; Li Lei; Chen Dazhou
2011-01-01
A highly efficient synthesis of "1"3C_3 labeled triglycerides of stearic acids from "1"3C_3-glycerol and stearic acids, by immobilized lipase-catalyzed in solvent-free medium was described. The structure of the product were characterized by fourier transform infrared spectrum (FT-IR), nuclear magnetic resonance (NMR), mass spectra (MS). The results showed that triglycerides of stearic acids contained three "1"3C atoms. The isotope abundance of "1"3C_3-tristearin was more than 99% and the yield was 80% of "1"3C_3-tristearin through calculation. Chemical purity (> 98%) was obtained by differential scanning calorimetry (DSC). (authors)
Lai, Marta; Lanz, Bernard; Poitry-Yamate, Carole; Romero, Jackeline F; Berset, Corina M; Cudalbu, Cristina; Gruetter, Rolf
2017-01-01
In vivo 13 C magnetic resonance spectroscopy (MRS) enables the investigation of cerebral metabolic compartmentation while, e.g. infusing 13 C-labeled glucose. Metabolic flux analysis of 13 C turnover previously yielded quantitative information of glutamate and glutamine metabolism in humans and rats, while the application to in vivo mouse brain remains exceedingly challenging. In the present study, 13 C direct detection at 14.1 T provided highly resolved in vivo spectra of the mouse brain while infusing [1,6- 13 C 2 ]glucose for up to 5 h. 13 C incorporation to glutamate and glutamine C4, C3, and C2 and aspartate C3 were detected dynamically and fitted to a two-compartment model: flux estimation of neuron-glial metabolism included tricarboxylic acid cycle (TCA) flux in astrocytes (V g = 0.16 ± 0.03 µmol/g/min) and neurons (V TCA n = 0.56 ± 0.03 µmol/g/min), pyruvate carboxylase activity (V PC = 0.041 ± 0.003 µmol/g/min) and neurotransmission rate (V NT = 0.084 ± 0.008 µmol/g/min), resulting in a cerebral metabolic rate of glucose (CMR glc ) of 0.38 ± 0.02 µmol/g/min, in excellent agreement with that determined with concomitant 18 F-fluorodeoxyglucose positron emission tomography ( 18 FDG PET).We conclude that modeling of neuron-glial metabolism in vivo is accessible in the mouse brain from 13 C direct detection with an unprecedented spatial resolution under [1,6- 13 C 2 ]glucose infusion.
Lukenda, Adrian; Dotlic, Snjezana; Vukojevic, Nenad; Saric, Borna; Vranic, Semir; Zarkovic, Kamelija
2016-03-01
The aim of the present study was to immunohistochemically investigate the expression and prognostic significance of putative cancer stem cell markers CD117 (c-kit), CD34, CD20 and CD15 in a cohort of patients with primary choroidal and ciliary body melanoma. The immunohistochemical expression of these markers was evaluated using 3,3'-diaminobenzidine tetrahydrochloride (DAB) and 3-amino-9-ethylcarbazole (AEC) chromogens on paraffin-embedded tissue samples from 40 patients who underwent enucleation in the period from 1985 through 2000. Thirty-one patients had adequate tissue specimens for the analysis. CD117 overexpression was observed in 12 of the 31 samples (39%) when AEC chromogen was used and in 14 of 26 (54%) samples when DAB was used. CD15 positivity was seen in three out of 30 (10%) samples with AEC and in six out of 26 (23%) samples with DAB. CD20 and CD34 exhibited no positivity in the tested samples. During the average follow-up time of 8.7 years (range 0.5-22 years), 17 patients (55%) died due to metastatic disease. The Kaplan-Meier plots showed a significantly shorter overall and disease-free survival in CD117-positive patients when the AEC chromogen was used. CD15 expression was not associated with patients' survival. In multivariate analysis, patients expressing the CD117 AEC had 4.13 times higher risk of lethal outcome in comparison with CD117 AEC negative patients. Our retrospective cohort study has for the first time demonstrated a small proportion of CD15-positive uveal melanomas. CD117 AEC overexpression was associated with a worse outcome in patients with choroidal and ciliary body melanoma. Further studies should confirm the validity of these observations and their potential for targeted treatment modalities. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/
Energy Technology Data Exchange (ETDEWEB)
Minami, Masayo, E-mail: minami@nendai.nagoya-u.ac.jp [Center for Chronological Research, Nagoya University, Nagoya 464-8602 (Japan); Kato, Tomomi [Graduate School of Environmental Studies, Nagoya University, Nagoya 464-8601 (Japan); Horikawa, Keiji [Department of Environmental Biology and Chemistry, Toyama University, Toyama 930-8555 (Japan); Nakamura, Toshio [Center for Chronological Research, Nagoya University, Nagoya 464-8602 (Japan)
2015-11-01
Speleothem {sup 14}C has recently emerged as a potentially powerful proxy for hydrology changes in comparison with atmospheric {sup 14}C calibration curve, rather than as a direct dating tool, apart from a time marker using bomb peak of {sup 14}C. Some possible causes for the relationship between speleothem {sup 14}C content (or dead carbon fraction: DCF) and karst hydrology have been proposed, such as changes in temperature, precipitation, drip water flow dynamics, cave air ventilation, soil air pCO{sub 2}. In this study, we investigated seasonal variation in {sup 14}C and δ{sup 13}C of drip water in Ryugashi Cave, Shizuoka Prefecture, central Japan, to examine the causes of the {sup 14}C and δ{sup 13}C variations in a speleothem. The results show that different {sup 14}C concentrations and δ{sup 13}C values of drip water from the Ryugashi Cave, were exhibited at different sites of the Caves No. 1, No. 3, and No. 4, which have different temperature, air pCO{sub 2}, and flow paths. Further, the {sup 14}C and δ{sup 13}C of drip waters showed seasonal variations at all sites, which were lower in fall and winter, and higher in spring and summer, though the extent of the variations was different among the sites. The {sup 14}C in drip waters tended to be correlated with the drip rates: {sup 14}C tended to be higher in drip waters with higher drip rates, and also correlated with rainfall amount around the Ryugashi Cave, especially for the drip waters in Cave No. 3, which are considered to have simpler flow paths. The increase in rainfall amount could bring the increase in drip rate of drip water, and then the decrease in interaction between solution and karst, resulting in {sup 14}C increase (DCF decrease) in drip water. Accordingly, the reconstruction of precipitation could be performed using {sup 14}C variation in a speleothem formed by drip water with simple flow dynamics.
Calculation of the 13C NMR shieldings of the C0 2 complexes of aluminosilicates
Tossell, J. A.
1995-04-01
complexation are much smaller. Complexation with CO 2 greatly increases the electric field gradient at the bridging oxygen of H 3AlOAlH 3-2, raising it to a value similar to that found for SiOSi linkages. Comparison of these results with the experimental 13C NMR spectra support the formation of CO 2-like complexes at SiOSi bridges in albite glasses and CO 3-like complexes at SiOAl and AlOAl bridges in albite and nepheline glasses. Changes in the calculated shieldings as Na + ions are added to the complexes suggest that some of the observed complexes may be similar in their CO 2-aluminosilicate interactions, but different with respect to the positions of the charge-compensating Na + ions.
Identification of degradation routes of metamitron in soil microcosms using 13C-isotope labeling.
Wang, Shizong; Miltner, Anja; Nowak, Karolina M
2017-01-01
Metamitron is one of the most commonly used herbicide in sugar beet and flower bulb cultures. Numerous laboratory and field studies on sorption and degradation of metamitron were performed. Detailed biodegradation studies in soil using 13 C-isotope labeling are still missing. Therefore, we aimed at providing a detailed turnover mass balance of 13 C 6 -metamitron in soil microcosms over 80 days. In the biotic system, metamitron mineralized rapidly, and 13 CO 2 finally constituted 60% of the initial 13 C 6 -metamitron equivalents. In abiotic control experiments CO 2 rose to only 7.4% of the initial 13 C 6 -metamitron equivalents. The 13 C label from 13 C 6 -metamitron was incorporated into microbial amino acids that were ultimately stabilized in the soil organic matter forming presumably harmless biogenic residues. Finally, 13 C label from 13 C 6 -metamitron was distributed between the 13 CO 2 and the 13 C-biogenic residues indicating nearly complete biodegradation. The parallel increase of 13 C-alanine, 13 C-glutamate and 13 CO 2 indicates that metamitron was initially biodegraded via the desamino-metamitron route suggesting its relevance in the growth metabolism. In later phases of biodegradation, the "Rhodococcus route" was indicated by the low 13 CO 2 evolution and the high relevance of the pyruvate pathway, which aims at biomolecule synthesis and seems to be related to starvation. This is a first report on the detailed degradation route of metamitron in soil. Copyright © 2016 Elsevier Ltd. All rights reserved.
48 CFR 207.172 - Human research.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Human research. 207.172... OF DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.172 Human research. Any DoD component sponsoring research involving human subjects— (a) Is responsible for oversight of...
Monovacancy paramagnetism in neutron-irradiated graphite probed by 13C NMR.
Zhang, Z T; Xu, C; Dmytriieva, D; Molatta, S; Wosnitza, J; Wang, Y T; Helm, M; Zhou, Shengqiang; Kühne, H
2017-10-20
We report on the magnetic properties of monovacancy defects in neutron-irradiated graphite, probed by 13 C nuclear magnetic resonance spectroscopy. The bulk paramagnetism of the defect moments is revealed by the temperature dependence of the NMR frequency shift and spectral linewidth, both of which follow a Curie behavior, in agreement with measurements of the macroscopic magnetization. Compared to pristine graphite, the fluctuating hyperfine fields generated by the defect moments lead to an enhancement of the 13 C nuclear spin-lattice relaxation rate [Formula: see text] by about two orders of magnitude. With an applied magnetic field of 7.1 T, the temperature dependence of [Formula: see text] below about 10 K can well be described by a thermally activated form, [Formula: see text], yielding a singular Zeeman energy of ([Formula: see text]) meV, in excellent agreement with the sole presence of polarized, non-interacting defect moments.
DEFF Research Database (Denmark)
Junghans, Peter; Larsson, Caroline; Jensen, Rasmus Bovbjerg
2015-01-01
2 production calculated by the (13)C-BM, RaCO2((13)C) is compared to the result from the indirect calorimetry, RCO2(IC). In an interspecies comparison (dog, goat, horse, cattle, children, adult human; body mass ranging from 15 to 350 kg, resting and fasting conditions) we found an excellent...
International Nuclear Information System (INIS)
Boutin, D.
2005-08-01
The first experimental observation of bound-state beta-decay showed, that due solely to the electron stripping, a stable nuclide, e.g. 163 Dy, became unstable. Also a drastic modification of the half-life of bare 187 Re, from 4.12(2) x 10 10 years down to 32.9(20) years, could be observed. It was mainly due to the possibility for the mother nuclide to decay into a previously inaccessible nuclear level of the daughter nuclide. It was proposed to study a nuclide where this decay mode was competing with continuum-state beta-decay, in order to measure their respective branchings. The ratio β b /β c could also be evaluated for the first time. 207 Tl was chosen due to its high atomic number, and Q-value of about 1.4 MeV, small enough to enhance the β b probability and large enough to allow the use of time-resolved Schottky Mass Spectrometry (SMS) to study the evolution of mother and bound-state beta-decay daughter ions. The decay properties of the ground state and isomeric state of 207 Tl 81+ have been investigated at the GSI accelerator facility in two separate experiments. For the first time β-decay where the electron could go either to a bound state (atomic orbitals) and lead to 207 Pb 81+ as a daughter nuclide, or to a continuum state and lead to 207 Pb 82+ , has been observed. The respective branchings of these two processes could be measured as well. The deduced total nuclear half-life of 255(17) s for 207 Tl 81+ , was slightly modified with respect to the half-life of the neutral atom of 286(2) s. It was nevertheless in very good agreement with calculations based on the assumption that the beta-decay was following an allowed type of transition. The branching β b /β c =0.192(20), was also in very good agreement with the same calculations. The application of stochastic precooling allowed to observe in addition the 1348 keV short-lived isomeric state of 207 Tl. The half-life of this isomeric state was measured as 1.47(32) s, which shows a small deviation
International Nuclear Information System (INIS)
Bortiatynski, J.M.; Minard, R.D.; Hatcher, P.G.
1993-01-01
13 C NMR has recently been shown to be a powerful technique for the examination of the covalent binding of pollutants to humic materials when the latter are enriched with 13 C. Enhanced signals are observed for the carbons that are highly enriched with 13 C while the remaining signals due to naturally abundant 13 C form unlabeled pollutant carbons or humic substances are at the baseline noise level. If covalent bonding and/or non covalent associations take place at or near the site of the 13 C label(s), the nature of the bonding or association can be discerned and the adsorption coefficients can be calculated. In this paper, the authors present the results of such binding studies which demonstrate the great potential of this technique
Recent trend of δ13C of C4 plant cellulose as an indicator of atmospheric CO2 change
International Nuclear Information System (INIS)
Minagawa, Masao; Egawa, Saho
1993-01-01
Natural carbon isotope composition ( 13 C/ 12 C) of C4 plant have been analyzed to trace the 13 C content of atmospheric carbon dioxide. Cellulose fraction, kernel coat and starch fraction were separated from two group of Zea mays (corn) which were grown and harvested at Hokkaido and Nagano prefecture in Japan during 1963 and 1989, and each component was analyzed for 13 C/ 12 C isotope ratios. The purpose of this study is to assess if these components are useful for tracing 13 C/ 12 C ratio of atmospheric CO 2 and how such isotopic composition of C4 plants can be modified from original isotopic signals of global circulating carbon. (author)
28 CFR 2.207 - Supervision reports to Commission.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Supervision reports to Commission. 2.207 Section 2.207 Judicial Administration DEPARTMENT OF JUSTICE PAROLE, RELEASE, SUPERVISION AND RECOMMITMENT OF PRISONERS, YOUTH OFFENDERS, AND JUVENILE DELINQUENTS District of Columbia Supervised Releasees § 2.207 Supervision reports to Commission. A...
Solid state 13 C NMR quantitative study of wood tar pitches
International Nuclear Information System (INIS)
Prauchner, Marcos Juliano; Pasa, Vanya Marcia Duarte; Menezes, Sonia Maria Cabral de
1999-01-01
In this work, solid-state 13 C NMR is used with other techniques to characterize Eucalyptus tar pitches and to follow their polymerization reactions. The pitches are the residues of distillation (about 50% m;m) of the tar generated in Eucalyptus slow pyrolysis for charcoal production in metal industry
Nisbet, Mark A.; Tobias, Herbert J.; Brenna, J. Thomas; Sacks, Gavin L.; Mansfield, Anna Katharine
2016-01-01
Many fermentation volatiles important to wine aroma potentially arise from yeast metabolism of hexose sugars, but assessing the relative importance of these pathways is challenging due to high endogenous hexose substrate concentrations. To overcome this problem, gas chromatography combustion isotope ratio mass spectrometry (GC-C-IRMS) was used to measure high-precision 13C/12C isotope ratios of volatiles in wines produced from juices spiked with tracer levels (0.01–1 APE) of uniformly labeled [U-13C]-glucose. The contribution of hexose to individual volatiles was determined from the degree of 13C enrichment. As expected, straight-chain fatty acids and their corresponding ethyl esters were derived almost exclusively from hexoses. Most fusel alcohols and their acetate esters were also majority hexose-derived, indicating the importance of anabolic pathways for their formation. Only two compounds were not derived primarily from hexoses (hexanol and isobutyric acid). This approach can be extended to other food systems or substrates for studying precursor–product relationships. PMID:24960193
31 CFR 800.207 - Covered transaction.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Covered transaction. 800.207 Section 800.207 Money and Finance: Treasury Regulations Relating to Money and Finance (Continued) OFFICE OF..., which could result in control of a U.S. business by a foreign person. ...
Abu Elella, Mahmoud H; Mohamed, Riham R; Abdel-Aziz, Marwa M; Sabaa, Magdy W
2018-05-01
The present study is imported to solve two critical problems we face in our daily life which are microbial pollution and colon cancer. One pot green synthesis of a water soluble polyelectrolyte complex (PEC) between cationic polysaccharide as N,N,N-trimethyl chitosan chloride (TMC) and anionic polymer as poly (acrylic acid) (PAA) in presence of silver nanoparticles to yield (TMC/PAA/Ag) nanocomposites with different Ag weight ratios. Structure of TMC, PAA and TMC/PAA (PEC) were proved via different analysis tools. TMC/PAA and its Ag nanocomposites are used as antimicrobial agents against different pathogenic bacteria and fungi to solve microbial pollution. TMC/PAA-Silver nanocomposites had the highest antimicrobial activity which increases with increasing Ag %. Cytotoxicity data confirmed also that TMC/PAA/Ag (3%) had the most cytotoxic effect (the less cell viability %) towards colon cancer. TMC/PAA (PEC) was formed through electrostatic interactions between N-quaternized (-N + R 3 ) groups in TMC and carboxylate (-COO - ) groups in PAA. Copyright © 2018 Elsevier B.V. All rights reserved.
The 12C/ 13C isotopic ratio in Titan hydrocarbons from Cassini/CIRS infrared spectra
Nixon, C. A.; Achterberg, R. K.; Vinatier, S.; Bézard, B.; Coustenis, A.; Irwin, P. G. J.; Teanby, N. A.; de Kok, R.; Romani, P. N.; Jennings, D. E.; Bjoraker, G. L.; Flasar, F. M.
2008-06-01
We have analyzed infrared spectra of Titan recorded by the Cassini Composite Infrared Spectrometer (CIRS) to measure the isotopic ratio 12C/ 13C in each of three chemical species in Titan's stratosphere: CH 4, C 2H 2 and C 2H 6. This is the first measurement of 12C/ 13C in any C 2 molecule on Titan, and the first measurement of 12CH 4/ 13CH 4 (non-deuterated) on Titan by remote sensing. Our spectra cover five widely-spaced latitudes, 65° S to 71° N and we have searched for both latitude variability of 12C/ 13C within a given species, and also for differences between the 12C/ 13C in the three gases. For CH 4 alone, we find C12/C13=76.6±2.7 (1- σ), essentially in agreement with the 12CH 4/ 13CH 4 measured by the Huygens Gas Chromatograph/Mass Spectrometer instrument (GCMS) [Niemann, H.B., and 17 colleagues, 2005. Nature 438, 779-784]: 82.3±1.0, and also with measured values in H 13CN and 13CH 3D by CIRS at lower precision [Bézard, B., Nixon, C., Kleiner, I., Jennings, D., 2007. Icarus 191, 397-400; Vinatier, S., Bézard, B., Nixon, C., 2007. Icarus 191, 712-721]. For the C 2 species, we find C12/C13=84.8±3.2 in C 2H 2 and 89.8±7.3 in C 2H 6, a possible trend of increasingly value with molecular mass, although these values are both compatible with the Huygens GCMS value to within error bars. There are no convincing trends in latitude. Combining all fifteen measurements, we obtain a value of C12/C13=80.8±2.0, also compatible with GCMS. Therefore, the evidence is mounting that 12C/ 13C is some 8% lower on Titan than on the Earth (88.9, inorganic standard), and lower than typical for the outer planets ( 88±7 [Sada, P.V., McCabe, G.H., Bjoraker, G.L., Jennings, D.E., Reuter, D.C., 1996. Astrophys. J. 472, 903-907]). There is no current model for this enrichment, and we discuss several mechanisms that may be at work.
Energy Technology Data Exchange (ETDEWEB)
Takeuchi, Koh [National Institute of Advanced Industrial Science and Technology (AIST), Biomedicinal Information Research Center (BIRC) (Japan); Frueh, Dominique P.; Sun, Zhen-Yu J.; Hiller, Sebastian; Wagner, Gerhard, E-mail: gerhard_wagner@hms.harvard.ed [Harvard Medical School, Department of Biological Chemistry and Molecular Pharmacology (United States)
2010-05-15
We present a {sup 13}C direct detection CACA-TOCSY experiment for samples with alternate {sup 13}C-{sup 12}C labeling. It provides inter-residue correlations between {sup 13}C{sup {alpha}} resonances of residue i and adjacent C{sup {alpha}s} at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C{sup {alpha}} nuclei separated by more than one residue. The experiment also provides C{sup {alpha}}-to-side chain correlations, some amino acid type identifications and estimates for {psi} dihedral angles. The power of the experiment derives from the alternate {sup 13}C-{sup 12}C labeling with [1,3-{sup 13}C] glycerol or [2-{sup 13}C] glycerol, which allows utilizing the small scalar {sup 3}J{sub CC} couplings that are masked by strong {sup 1}J{sub CC} couplings in uniformly {sup 13}C labeled samples.
13C separation by IRMPD of halogenated difluoromethanes
International Nuclear Information System (INIS)
Ma Peihua; Chen Guancheng; Wu Bin; Liu Julin; Jing Yan; Chu Minxiong; Arai, Shigeyoshi.
1995-01-01
Isotopically-selective consecutive two-stage infrared multiphoton dissociation (IRMPD) of halogenated difluoromethanes in the presence of scavengers produces carbon-13 over 95 %. The reaction mechanism for the IRMPD of mixture of CHClF 2 and HI can be explained by a series of first-order dissociation reactions and followed radical-scavenger reactions occurred in a continuous irradiation procedure. Furthermore, 13 C enrichment at laboratory scaling-up level by the 13 C selective IRMPD of CHClF 2 /Br 2 mixture has been investigated in a flow reactor. The 13 C production rates, 13 C atomic fractions in the CBr 2 F 2 products and 13 C depletions in the CHClF 2 reactants at different flow rates and laser repetition frequencies were examined to optimize the parameters suitable for large-scale production of carbon isotope. The data obtained from the flow tests demonstrated a 40 mg h -1 production rate for CB 2 F 2 at 65 % carbon-13 by using a 40 W (4J, 10 Hz) laser beam focused with a lens of focal length 120 cm. If a reliable TEA CO 2 laser can be operated with 100 W (10 J, 10 Hz) output, the production rate of CBr 2 F 2 for carbon-13 at 60 % can attain 200 mg h -1 . The measurements of spatial profile of focused laser beam imply a 2 g h -1 production rate for the 60 % carbon-13 product for an incident power of 200 W (20 J, 10 Hz). (author)
Relationships between tobacco leaf δ"1"3C and physiological characteristics
International Nuclear Information System (INIS)
Wang Yi; Song Pengfei; Yan Kan; Tan Shuwen; Wu Xiaoxiao; Chen Zongyu
2013-01-01
In this paper, the flue-cured tobacco K326 was employed to study the abundance of carbon isotope composition, photosynthetic pigment content, soluble protein content and leaf mass per area (LMA) of tobacco leaf which were grown at four testing sites of different altitude (T_1, T_2, T_3, T_4). The correlations of carbon isotope composition with altitude, leaf position and physiological measures were understood as well. Results showed that δ"1"3C of those samples varied from -27.4‰ to -23.4‰. The δ"1"3C of samples from T_1, T_2and T_3 were increased with rising of the leaf position. δ"1"3C of middle and upper leaves from T_1, T_2and T_3 were positively correlated with altitude. However, δ"1"3C of samples from T_4 ranging from -26.8‰ to -26.4‰ was lower than the values from previous samples. The δ"1"3C also decreased with the increasing of leaf position, and was significantly negatively correlated with chlorophyll content and chlorophyll/carotinoid ratio (P < 0.05). The δ"1"3C was not significantly correlated with carotinoid content and chlorophyll a/b ratio. Meanwhile, it was positively correlated with soluble protein content and LMA significantly (P < 0.01). Generally, our findings indicated that chlorophyll content, chlorophyll/carotenoid ratio, soluble protein content, and LMA had strong relationships with δ"1"3C, whereas the relationship of δ"1"3C with altitude and leaf position was still unclear. (authors)
Labeling of BCNU with 11C and 13N and its in vivo pharmacokinetics study with PET
International Nuclear Information System (INIS)
Diksic, M.; Farrokhzad, S.; Yamamoto, L.; Feindel, W.
1982-01-01
1,3-bis(2-chloroethyl)-1-nitrosourea(BCNU) is an antitumor drug. 13 N and 11 C labeled BCNU were synthesized and made suitable for in vivo studies with positron emission tomography (PET). The optimization of the labeling procedures were discussed with an emphasis on the radiochemical yield and specific activity of the final product
26 CFR 1.381(c)(13)-1 - Involuntary conversions.
2010-04-01
... 26 Internal Revenue 4 2010-04-01 2010-04-01 false Involuntary conversions. 1.381(c)(13)-1 Section 1.381(c)(13)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES Insolvency Reorganizations § 1.381(c)(13)-1 Involuntary conversions...
31 CFR 560.207 - Prohibited investment.
2010-07-01
... 31 Money and Finance: Treasury 3 2010-07-01 2010-07-01 false Prohibited investment. 560.207... § 560.207 Prohibited investment. Except as otherwise authorized pursuant to this part, and... investment by a United States person in Iran or in property (including entities) owned or controlled by the...
50 CFR 223.207 - Approved TEDs.
2010-10-01
... 50 Wildlife and Fisheries 7 2010-10-01 2010-10-01 false Approved TEDs. 223.207 Section 223.207 Wildlife and Fisheries NATIONAL MARINE FISHERIES SERVICE, NATIONAL OCEANIC AND ATMOSPHERIC ADMINISTRATION, DEPARTMENT OF COMMERCE MARINE MAMMALS THREATENED MARINE AND ANADROMOUS SPECIES Restrictions Applicable to Threatened Marine and Anadromous Specie...
2010-07-01
... 40 Protection of Environment 18 2010-07-01 2010-07-01 false [Reserved] 86.207-94 Section 86.207-94 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) AIR PROGRAMS (CONTINUED) CONTROL OF... Year Gasoline-Fueled New Light-Duty Vehicles, New Light-Duty Trucks and New Medium-Duty Passenger...
Santos, Sónia Sá; Gibson, Gary E; Cooper, Arthur J L; Denton, Travis T; Thompson, Charles M; Bunik, Victoria I; Alves, Paula M; Sonnewald, Ursula
2006-02-15
Diminished activity of the alpha-ketoglutarate dehydrogenase complex (KGDHC), an important component of the tricarboxylic acid (TCA) cycle, occurs in several neurological diseases. The effect of specific KGDHC inhibitors [phosphonoethyl ester of succinyl phosphonate (PESP) and the carboxy ethyl ester of succinyl phosphonate (CESP)] on [1-13C]glucose and [U-13C]glutamate metabolism in intact cerebellar granule neurons was investigated. Both inhibitors decreased formation of [4-13C]glutamate from [1-13C]glucose, a reduction in label in glutamate derived from [1-13C]glucose/[U-13C]glutamate through a second turn of the TCA cycle and a decline in the amounts of gamma-aminobutyric acid (GABA), aspartate, and alanine. PESP decreased formation of [U-13C]aspartate and total glutathione, whereas CESP decreased concentrations of valine and leucine. The findings are consistent with decreased KGDHC activity; increased alpha-ketoglutarate formation; increased transamination of alpha-ketoglutarate with valine, leucine, and GABA; and new equilibrium position of the aspartate aminotransferase reaction. Overall, the findings also suggest that some carbon derived from alpha-ketoglutarate may bypass the block in the TCA cycle at KGDHC by means of the GABA shunt and/or conversion of valine to succinate. The results suggest the potential of succinyl phosphonate esters for modeling the biochemical and pathophysiological consequences of reduced KGDHC activity in brain diseases.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Reports. 171.117 Section 171.117... FACILITIES NON-FEDERAL NAVIGATION FACILITIES Simplified Directional Facility (SDF) § 171.117 Reports. The owner of each facility to which this subpart applies shall make the following reports, at the time...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Smith Creek. 117.841 Section 117.841 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements North Carolina § 117.841 Smith Creek. The draw of the S117-S133...
Misra, Santosh K; Kondaiah, Paturu; Bhattacharya, Santanu; Rao, C N R
2012-01-09
A cationic amphiphile, cholest-5en-3β-oxyethyl pyridinium bromide (PY(+) -Chol), is able to efficiently disperse exfoliated graphene (GR) in water by the physical adsorption of PY(+) -Chol on the surface of GR to form stable, dark aqueous suspensions at room temperature. The GR-PY(+) -Chol suspension can then be used to solubilize Tamoxifen Citrate (TmC), a breast cancer drug, in water. The resulting TmC-GR-PY(+) -Chol is stable for a long time without any precipitation. Fluorescence emission and UV absorption spectra indicate the existence of noncovalent interactions between TmC, GR, and PY(+) -Chol in these suspensions. Electron microscopy shows the existence of segregated GR sheets and TmC 'ribbons' in the composite suspensions. Atomic force microscopy indicates the presence of 'extended' structures of GR-PY(+) -Chol, which grows wider in the presence of TmC. The slow time-dependent release of TmC is noticed in a reconstituted cell culture medium, a property useful as a drug carrier. TmC-GR-PY(+) -Chol selectively enhanced the cell death (apoptosis) of the transformed cancer cells compared to normal cells. This potency is found to be true for a wide range of transformed cancer cells viz. HeLa, A549, ras oncogene-transformed NIH3T3, HepG2, MDA-MB231, MCF-7, and HEK293T compared to the normal cell HEK293 in vitro. Confocal microscopy confirmed the high efficiency of TmC-GR-PY(+) -Chol in delivering the drug to the cells, compared to the suspensions devoid of GR. Copyright © 2012 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
DEFF Research Database (Denmark)
Daugaard, Søren; Christensen, Lise H; Høgdall, Estrid
2009-01-01
(s) for the different subgroups. Archival material from three extraskeletal myxoid chondrosarcomas, five chordomas, five chondromyxoid fibromas, five chondroblastomas and 25 chondrosarcomas was stained with antibodies against osteonectin, bcl-2, cox-2, actin, calponin, D2-40 (podoplanin), mdm-2, CD117 (c-kit) and YKL......-40. All 25 chondrosarcomas showed a positive staining reaction for D2-40, none for actin and CD117, and a partial reactivity for bcl-2 (36%). Chondroblastomas (5/5) and chondromyxoid fibromas (2/5) were the only tumors with a positive reaction for actin, and all chondroblastomas (n=5...... chondrosarcomas. A convincing immunoreactivity for calponin and/or actin in chondromyxoid fibromas and chondroblastomas may also be helpful in differentiating these tumors from chondrosarcomas....
Cukras, Anthony R; Green, Rachel
2005-05-27
The ribosomal protein S13 is found in the head region of the small subunit, where it interacts with the central protuberance of the large ribosomal subunit and with the P site-bound tRNA through its extended C terminus. The bridging interactions between the large and small subunits are dynamic, and are thought to be critical in orchestrating the molecular motions of the translation cycle. S13 provides a direct link between the tRNA-binding site and the movements in the head of the small subunit seen during translocation, thereby providing a possible pathway of signal transduction. We have created and characterized an rpsM(S13)-deficient strain of Escherichia coli and have found significant defects in subunit association, initiation and translocation through in vitro assays of S13-deficient ribosomes. Targeted mutagenesis of specific bridge and tRNA contact elements in S13 provides evidence that these two interaction domains play critical roles in maintaining the fidelity of translation. This ribosomal protein thus appears to play a non-essential, yet important role by modulating subunit interactions in multiple steps of the translation cycle.
Energy Technology Data Exchange (ETDEWEB)
Bzhezovskii, V.M.; Valeev, R.B.; Kalabin, G.A.; Aliev, I.A.
1987-06-20
The /sup 13/C, /sup 17/O, and /sup 33/S NMR spectra of alkyl phenyl sulfones C/sub 6/H/sub 5/SO/sub 2/Alk were obtained. The changes in the screening of the /sup 13/C, /sup 17/O, and /sup 33/S nuclei in these compounds are determined by the effect of the alkyl substituents, which alternates in sign and decreases along the chain of atoms in the order: CH/sub 3/, C/sub 2/H/sub 5/, iso-C/sub 3/H/sub 7/, and tert-C/sub 4/H/sub 9/. In the alkyl phenyl sulfides C/sub 6/H/sub 5/SAlk the additional effect of disruption in the p,..pi.. interaction between the sulfur atom and the benzene ring as a result of conformational changes is superimposed on the screening of the /sup 13/C/sup ortho/ nuclei. For the changes in the screening of the /sup 13/C/sup para/ nuclei in C/sub 6/H/sub 5/SAlk the steric disruption of the p,..pi.. conjugation by the alkyl substituents is determining.
2010-10-01
... 48 Federal Acquisition Regulations System 3 2010-10-01 2010-10-01 false Policy. 207.171-3 Section... DEFENSE ACQUISITION PLANNING ACQUISITION PLANNING Acquisition Plans 207.171-3 Policy. DoD policy is to... it is anticipated that a prime contract will be awarded without adequate price competition, and the...
The transformation and fate of sub-Arctic microphytobenthos carbon revealed through 13C-labeling
DEFF Research Database (Denmark)
Oakes, Joanne M.; Rysgaard, Søren; Glud, Ronnie N.
2016-01-01
Microphytobenthos (MPB) at higher latitudes has been poorly studied. This study used pulse-chase C-13-labeling to investigate the production, processing, and fate of MPB-derived carbon (MPB-C) in sub-Arctic intertidal sediments over 31 d. Gross primary production (2.1 mmolCm(-2)h(-1)+/- 0.4 mmol...... accounted for49.8% of this C-13. The C-13 content of sediment organic carbon declined over time, but>31% of the C-13 fixed within the first tidal cycle remained after 31 d, suggesting that sub-Arctic MPB may contribute to coastal carbon retention during the productive season. Over 21 d, 10.6% of the fixed C......-13 was removed via DIC fluxes and 0.3% via DOC fluxes from inundated sediment, and 0.6% as CO2 from exposed sediment. The greatest loss of C-13 (38.2%) was via unmeasured pathways, including resuspension and/or removal by mobile consumers. The rates of MPB-C production and the relative importance...
Nuclear interaction study around beam pipe region in the Tracker system at CMS with 13 TeV data
CMS Collaboration
2015-01-01
Analysis is presented to study the material in the Tracker system with nuclear interactions from proton-proton collisions recorded by the CMS experiment at the CERN LHC. The data correspond to an integrated luminosity of 7.3 pb$^{-1}$ at a centre-of-mass energy of 13 TeV collected at 3.8 Tesla magnetic field. With reconstructed nuclear interactions we observe the structure of the material, including beam pipe, in the Tracker system.
International Nuclear Information System (INIS)
Thornton, Steven F.; Bottrell, Simon H.; Spence, Keith H.; Pickup, Roger; Spence, Michael J.; Shah, Nadeem; Mallinson, Helen E.H.; Richnow, Hans H.
2011-01-01
Highlights: → Carbon isotope fractionation for MTBE varies with dissolved oxygen concentration. → Carbon isotope fractionation can underestimate MTBE biodegradation at plume fringes. → Fractionation factors must be for specific biodegradation mechanisms and conditions. → Specific microbial populations influence carbon isotope fractionation in groundwater. - Abstract: Radiolabelled assays and compound-specific stable isotope analysis (CSIA) were used to assess methyl tert-butyl ether (MTBE) biodegradation in an unleaded fuel plume in a UK chalk aquifer, both in the field and in laboratory microcosm experiments. The 14 C-MTBE radiorespirometry studies demonstrated widespread potential for aerobic and anaerobic MTBE biodegradation in the aquifer. However, δ 13 C compositions of MTBE in groundwater samples from the plume showed no significant 13 C enrichment that would indicate MTBE biodegradation at the field scale. Carbon isotope enrichment during MTBE biodegradation was assessed in the microcosms when dissolved O 2 was not limiting, compared with low in situ concentrations (2 mg/L) in the aquifer, and in the absence of O 2 . The microcosm experiments showed ubiquitous potential for aerobic MTBE biodegradation in the aquifer within hundreds of days. Aerobic MTBE biodegradation in the microcosms produced an enrichment of 7 per mille in the MTBE δ 13 C composition and an isotope enrichment factor (ε) of -1.53 per mille when dissolved O 2 was not limiting. However, for the low dissolved O 2 concentration of up to 2 mg/L that characterizes most of the MTBE plume fringe, aerobic MTBE biodegradation produced an enrichment of 0.5-0.7 per mille, corresponding to an ε value of -0.22 per mille to -0.24 per mille. No anaerobic MTBE biodegradation occurred under these experimental conditions. These results suggest the existence of a complex MTBE-biodegrading community in the aquifer, which may consist of different aerobic species competing for MTBE and dissolved O 2
International Nuclear Information System (INIS)
Takeuchi, Koh; Frueh, Dominique P.; Sun, Zhen-Yu J.; Hiller, Sebastian; Wagner, Gerhard
2010-01-01
We present a 13 C direct detection CACA-TOCSY experiment for samples with alternate 13 C- 12 C labeling. It provides inter-residue correlations between 13 C α resonances of residue i and adjacent C α s at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C α nuclei separated by more than one residue. The experiment also provides C α -to-sidechain correlations, some amino acid type identifications and estimates for ψ dihedral angles. The power of the experiment derives from the alternate 13 C- 12 C labeling with [1,3- 13 C] glycerol or [2- 13 C] glycerol, which allows utilizing the small scalar 3 J CC couplings that are masked by strong 1 J CC couplings in uniformly 13 C labeled samples.
13C, 1H spin-spin coupling constants. Pt. 4
International Nuclear Information System (INIS)
Aydin, R.; Guenther, H.
1979-01-01
One-bond, geminal, and vicinal 13 C, 1 H coupling constants have been determined for adamantane using α-and β-[D]adamantane and the relation sup(n)J( 13 C, 1 H)=6,5144sup(n)J( 13 C, 2 H) for the conversion of the measured sup(n)J( 13 C, 2 H) values. It is shown that the magnitude of 3 Jsub(trans) is strongly influenced by the substitution pattern. Relative H,D isotope effects for 13 C chemical shifts are given. (orig.) [de
Sup(13)C NMR studies of glucose disposal in normal and non-insulin-dependent diabetic humans
International Nuclear Information System (INIS)
Shulman, G.I.; Rothman, D.L.; Shulman, R.G.
1990-01-01
To examine the extent to which the defect in insulin action in subjects with non-insulin-dependent diabetes mellitus (NIDDM) can be accounted for by impairment of muscle glycogen synthesis, we performed combined hyperglycemic-hyperinsulinemic clamp studies with [ 13 C]glucose in five subjects with NIDDM and in six age- and weight-matched healthy subjects. The rate of incorporation of intravenously infused [1- 13 C]glucose into muscle glycogen was measured directly in the gastrocnemius muscle by means of a nuclear magnetic resonance (NMR) spectrometer with a 15.5 min time resolution and a 13 C surface coil. The steady-state plasma concentrations of insulin and glucose were similar in both study groups. The mean (±SE) rate of glycogen synthesis, as determined by 13 C NMR, was 78±28 and 183±39 μmol-glucosyl units (kg muscle tissue (wet mass)) -1 min -1 in the diabetic and normal subjects, respectively. The mean glucose uptake was markedly reduced in the diabetic as compared with the normal subjects. The mean rate of non-oxidative glucose metabolism was 22±4 μmol kg -1 min -1 in the diabetic subjects and 42±4 μmol kg -1 min -1 in the normal subjects. When these rates are extrapolated to apply to the whole body, the synthesis of muscle glycogen would account for most of the total-body glucose uptake and all of the non-oxidative glucose metabolism in both normal and diabetic subjects. We conclude that muscle glycogen synthesis is the principal pathway of glucose disposal in both normal and diabetic subjects and that defects in muscle glycogen synthesis have a dominant role in the insulin resistance that occurs in persons with NIDDM. (author)
Monovacancy paramagnetism in neutron-irradiated graphite probed by 13C NMR.
Zhang, Zhi Tao; Xu, C; Dmytriieva, Daryna; Molatta, Sebastian; Wosnitza, J; Wang, Y T; Helm, Manfred; Zhou, Shengqiang; Kuehne, Hannes
2017-09-18
We report on the magnetic properties of monovacancy defects in neutron-irradiated graphite, probed by $^{13}$C nuclear magnetic resonance spectroscopy. The bulk paramagnetism of the defect moments is revealed by the temperature dependence of the NMR frequency shift and spectral linewidth, both of which follow a Curie behavior, in agreement with measurements of the macroscopic magnetization. Compared to pristine graphite, the fluctuating hyperfine fields generated by the defect moments lead to an enhancement of the $^{13}$C nuclear spin-lattice relaxation rate $1/T_{1}$ by about two orders of magnitude. With an applied magnetic field of 7.1 T, the temperature dependence of $1/T_{1}$ below about 10 K can well be described by a thermally activated form, $1/T_{1}\\propto\\exp(-\\Delta/k_{B}T)$, yielding a singular Zeeman energy of ($0.41\\pm0.01$) meV, in excellent agreement with the sole presence of polarized, non-interacting defect moments. © 2017 IOP Publishing Ltd.
49 CFR 393.207 - Suspension systems.
2010-10-01
... braking system. The vehicle shall be level (not tilting to the left or right). Air leakage shall not be... 49 Transportation 5 2010-10-01 2010-10-01 false Suspension systems. 393.207 Section 393.207... NECESSARY FOR SAFE OPERATION Frames, Cab and Body Components, Wheels, Steering, and Suspension Systems § 393...
24 CFR 207.259 - Insurance benefits.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance benefits. 207.259 Section... Contract of Insurance § 207.259 Insurance benefits. (a) Method of payment. Upon either an assignment of the... of mortgage. If the mortgage is assigned to the Commissioner, the insurance benefits shall be paid in...
Directory of Open Access Journals (Sweden)
Ping Chai
2016-12-01
Full Text Available Ternary intermetallics R117Co52+δSn112+γ (R = Y, La, Pr, Nd, and Ho have been prepared by arc-melting followed by annealing at 800 °C. All the compounds belong to the Tb117Fe52Ge112 structure type (space group Fm 3 ¯ m characterized by a complex giant cubic unit cell with a ~ 30 Å. The single-crystal structure determination of Y- and La-containing compounds reveals a significant structural disorder. A comparison of these and earlier reported crystal structures of R117Co52+δSn112+γ suggests that more extensive disorder occurs for structures that contain larger lanthanide atoms. This observation can be explained by the need to maintain optimal bonding interactions as the size of the unit cell increases. Y117Co56Sn115 exhibits weak paramagnetism due to the Co sublattice and does not show magnetic ordering in the 1.8–300 K range. Ho117Co55Sn108 shows ferromagnetic ordering at 10.6 K. Both Pr117Co54Sn112 and Nd117Co54Sn111 exhibit antiferromagnetic ordering at 17 K and 24.7 K, respectively, followed by a spin reorientation transition at lower temperature.
Buonanno, Manuela; Stanislauskas, Milda; Ponnaiya, Brian; Bigelow, Alan W; Randers-Pehrson, Gerhard; Xu, Yanping; Shuryak, Igor; Smilenov, Lubomir; Owens, David M; Brenner, David J
2016-01-01
UVC light generated by conventional germicidal lamps is a well-established anti-microbial modality, effective against both bacteria and viruses. However, it is a human health hazard, being both carcinogenic and cataractogenic. Earlier studies showed that single-wavelength far-UVC light (207 nm) generated by excimer lamps kills bacteria without apparent harm to human skin tissue in vitro. The biophysical explanation is that, due to its extremely short range in biological material, 207 nm UV light cannot penetrate the human stratum corneum (the outer dead-cell skin layer, thickness 5-20 μm) nor even the cytoplasm of individual human cells. By contrast, 207 nm UV light can penetrate bacteria and viruses because these cells are physically much smaller. To test the biophysically-based hypothesis that 207 nm UV light is not cytotoxic to exposed mammalian skin in vivo. Hairless mice were exposed to a bactericidal UV fluence of 157 mJ/cm2 delivered by a filtered Kr-Br excimer lamp producing monoenergetic 207-nm UV light, or delivered by a conventional 254-nm UV germicidal lamp. Sham irradiations constituted the negative control. Eight relevant cellular and molecular damage endpoints including epidermal hyperplasia, pre-mutagenic UV-associated DNA lesions, skin inflammation, and normal cell proliferation and differentiation were evaluated in mice dorsal skin harvested 48 h after UV exposure. While conventional germicidal UV (254 nm) exposure produced significant effects for all the studied skin damage endpoints, the same fluence of 207 nm UV light produced results that were not statistically distinguishable from the zero exposure controls. As predicted by biophysical considerations and in agreement with earlier in vitro studies, 207-nm light does not appear to be significantly cytotoxic to mouse skin. These results suggest that excimer-based far-UVC light could potentially be used for its anti-microbial properties, but without the associated hazards to skin of conventional
Buonanno, Manuela; Stanislauskas, Milda; Ponnaiya, Brian; Bigelow, Alan W.; Randers-Pehrson, Gerhard; Xu, Yanping; Shuryak, Igor; Smilenov, Lubomir; Owens, David M.; Brenner, David J.
2016-01-01
Background UVC light generated by conventional germicidal lamps is a well-established anti-microbial modality, effective against both bacteria and viruses. However, it is a human health hazard, being both carcinogenic and cataractogenic. Earlier studies showed that single-wavelength far-UVC light (207 nm) generated by excimer lamps kills bacteria without apparent harm to human skin tissue in vitro. The biophysical explanation is that, due to its extremely short range in biological material, 207 nm UV light cannot penetrate the human stratum corneum (the outer dead-cell skin layer, thickness 5–20 μm) nor even the cytoplasm of individual human cells. By contrast, 207 nm UV light can penetrate bacteria and viruses because these cells are physically much smaller. Aims To test the biophysically-based hypothesis that 207 nm UV light is not cytotoxic to exposed mammalian skin in vivo. Methods Hairless mice were exposed to a bactericidal UV fluence of 157 mJ/cm2 delivered by a filtered Kr-Br excimer lamp producing monoenergetic 207-nm UV light, or delivered by a conventional 254-nm UV germicidal lamp. Sham irradiations constituted the negative control. Eight relevant cellular and molecular damage endpoints including epidermal hyperplasia, pre-mutagenic UV-associated DNA lesions, skin inflammation, and normal cell proliferation and differentiation were evaluated in mice dorsal skin harvested 48 h after UV exposure. Results While conventional germicidal UV (254 nm) exposure produced significant effects for all the studied skin damage endpoints, the same fluence of 207 nm UV light produced results that were not statistically distinguishable from the zero exposure controls. Conclusions As predicted by biophysical considerations and in agreement with earlier in vitro studies, 207-nm light does not appear to be significantly cytotoxic to mouse skin. These results suggest that excimer-based far-UVC light could potentially be used for its anti-microbial properties, but without
Synthesis and applications of {sup 13}C glycerol
Energy Technology Data Exchange (ETDEWEB)
Stocking, E.; Khalsa, O.; Martinez, R.A.; Silks, L.A. III [Los Alamos National Laboratory, NM (United States)
1994-12-01
Due in part to the use of labeled glycerol for the {sup 13}C enrichment of biomolecules, we are currently developing new synthetic routes to various isotopomers of glycerol. Judging from our experience, traditional methods of glycerol synthesis are not easily adapted for isotopic enrichment and/or have poor overall yields (12 to 15%). Furthermore, the use of glycerol for enrichment can be prohibitively expensive and its availability is limited by the level of demand. We are presently developing a short de novo synthesis of glycerol from carbon dioxide ({approximately}53% overall yield for four steps) and are examining the feasibility of synthesizing site-specific {sup 13}C-labeled glycerol and dihydroxyacetone (DHA) from labeled methanol and carbon dioxide. One application of {sup 13}C glycerol we have examined is enzymatic conversion of glycerol to glyceraldehyde-3-monophosphate or dihydroxyacetone monophosphate (DHAP) with yields ranging from 25 to 50% (as determined by NMR spectroscopy). We are also pursuing the chemical conversion of {sup 13}C-labeled DHA to DHAP. We are especially interested in {sup 13}C-labeled DHAP because we are investigating its use as a chemo-enzymatic precursor for both labeled 2-deoxyribose and 2-deoxyribonucleic acids.
Synthetic Swan band profile of (1,0) of 12C12C and (0,0) of 12C12C and 12C13C in comets
International Nuclear Information System (INIS)
Swamy, K.S.K.
1987-01-01
The statistical equilibrium calculations of the 12 C 13 C molecule based on the resonance fluorescence process give similar results to those of the normal molecule. Therefore the assumption that the observed intensities of bands of the normal and the isotopic molecule differ only by their abundance ratio is reasonable. The synthetic profile of the (1,0) Swan band of 12 C 13 C (0,0) band of 12 C 12 C and 12 C 13 C have been calculated. The relative merits of using the rotational structure of the (1,0) or (0,0) band for the determination of the isotopic ratio 12 C/ 13 C is discussed briefly. (author)
Core breaking and octupole low-spin states in $^{207}$ Tl
We propose to study the low-spin level structure of the $^{207}$Tl nucleus populated by the $\\beta$- decay of $^{207}$Hg. While $^{207}$Tl is a single-proton hole nucleus, the majority of the observed states will have a three-particle structure thus requiring the breaking of the neutron or proton core, or a collective octupole phonon coupled to the single proton hole. Thus information will be obtained on the single particle orbitals in the vicinity of the N=126 and Z=82 magic numbers, and on the size of the shell gap. The results will be used to improve the predictive power of the shell model for more exotic nuclei as we move to lighter N=126 nuclei.The experiment will use the ISOLDE Decay station, and will take advantage of the $^{207}$Hg beam from the molten lead target. A test on the feasibility to produce an $^{208}$Hg beam from the same target, with the aim to study the $\\beta$-decay into $^{208}$Tl, could be performed at the same time.
Directory of Open Access Journals (Sweden)
Chen Tingfu
2010-07-01
Full Text Available Abstract Background The novel gene HA117 is a multidrug resistance (MDR gene expressed by all-trans retinoic acid-resistant HL-60 cells. In the present study, we compared the multidrug resistance of the HA117 with that of the classical multidrug resistance gene 1 (MDR1 in breast cancer cell line 4T1. Methods Transduction of the breast cancer cell line 4T1 with adenoviral vectors encoding the HA117 gene and the green fluorescence protein gene (GFP (Ad-GFP-HA117, the MDR1 and GFP (Ad-GFP-MDR1 or GFP (Ad-GFP was respectively carried out. The transduction efficiency and the multiplicity of infection (MOI were detected by fluorescence microscope and flow cytometry. The transcription of HA117 gene and MDR1 gene were detected by reverse transcription polymerase chain reaction (RT-PCR. Western blotting analysis was used to detect the expression of P-glycoprotein (P-gp but the expression of HA117 could not be analyzed as it is a novel gene and its antibody has not yet been synthesized. The drug-excretion activity of HA117 and MDR1 were determined by daunorubicin (DNR efflux assay. The drug sensitivities of 4T1/HA117 and 4T1/MDR1 to chemotherapeutic agents were detected by Methyl-Thiazolyl-Tetrazolium (MTT assay. Results The transducted efficiency of Ad-GFP-HA117 and Ad-GFP-MDR1 were 75%-80% when MOI was equal to 50. The transduction of Ad-GFP-HA117 and Ad-GFP-MDR1 could increase the expression of HA117 and MDR1. The drug resistance index to Adriamycin (ADM, vincristine (VCR, paclitaxel (Taxol and bleomycin (BLM increased to19.8050, 9.0663, 9.7245, 3.5650 respectively for 4T1/HA117 and 24.2236, 11.0480, 11.3741, 0.9630 respectively for 4T1/MDR1 as compared to the control cells. There were no significant differences in drug sensitivity between 4T1/HA117 and 4T1/MDR1 for the P-gp substrates (ADM, VCR and Taxol (P Conclusions These results confirm that HA117 is a strong MDR gene in both HL-60 and 4T1 cells. Furthermore, our results indicate that the MDR
Takeuchi, Koh; Frueh, Dominique P; Sun, Zhen-Yu J; Hiller, Sebastian; Wagner, Gerhard
2010-05-01
We present a (13)C direct detection CACA-TOCSY experiment for samples with alternate (13)C-(12)C labeling. It provides inter-residue correlations between (13)C(alpha) resonances of residue i and adjacent C(alpha)s at positions i - 1 and i + 1. Furthermore, longer mixing times yield correlations to C(alpha) nuclei separated by more than one residue. The experiment also provides C(alpha)-to-sidechain correlations, some amino acid type identifications and estimates for psi dihedral angles. The power of the experiment derives from the alternate (13)C-(12)C labeling with [1,3-(13)C] glycerol or [2-(13)C] glycerol, which allows utilizing the small scalar (3)J(CC) couplings that are masked by strong (1)J(CC) couplings in uniformly (13)C labeled samples.
Biodegradable elastomeric scaffolds for soft tissue engineering
Pêgo, A.P.; Poot, Andreas A.; Grijpma, Dirk W.; Feijen, Jan
2003-01-01
Elastomeric copolymers of 1,3-trimethylene carbonate (TMC) and ε-caprolactone (CL) and copolymers of TMC and D,L-lactide (DLLA) have been evaluated as candidate materials for the preparation of biodegradable scaffolds for soft tissue engineering. TMC-DLLA copolymers are amorphous and degrade more
20 CFR 725.207 - Determination of dependency; divorced spouse.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Determination of dependency; divorced spouse. 725.207 Section 725.207 Employees' Benefits EMPLOYMENT STANDARDS ADMINISTRATION, DEPARTMENT OF LABOR...) § 725.207 Determination of dependency; divorced spouse. For the purpose of augmenting benefits, an...
Microscopic investigation of the 12C + 12C interaction
International Nuclear Information System (INIS)
Baye, D.; Pecher, N.; Brussels Univ.
1982-01-01
The 12 C + 12 C system is studied in the framework of the generator coordinate method. Each 12 C nucleus is described by a closed psub(3/2) subshell. Phase shifts and resonances are determined for several effective two-body interactions involving a spin-orbit term. The existence and properties of simple local equivalent potentials for the 12 C + 12 C collision are discussed. The 12 C + 12 C system is too light to be well described by potentials independent of the angular momentum or weakly dependent on it. (orig.)
A study of serum levels of B cell-attracting chemokine-13 (CXCL 13 ...
African Journals Online (AJOL)
A study of serum levels of B cell-attracting chemokine-13 (CXCL 13) and rheumatologic manifestations of chronic hepatitis C virus infection in a cohort of Egyptian ... manifestations have been associated with Hepatitis C virus (HCV) infection including; arthralgia, myalgia, fatigue, fibromyalgia, vasculitis, and sicca syndrome.
International Nuclear Information System (INIS)
Liu, Jing; Liu, Chang; Fan, Ying; Munro, Rachel A.; Ladizhansky, Vladimir; Brown, Leonid S.; Wang, Shenlin
2016-01-01
We demonstrate a novel sparse "1"3C labelling approach for methylotrophic yeast P. pastoris expression system, towards solid-state NMR studies of eukaryotic membrane proteins. The labelling scheme was achieved by co-utilizing natural abundance methanol and specifically "1"3C labelled glycerol as carbon sources in the expression medium. This strategy improves the spectral resolution by 1.5 fold, displays site-specific labelling patterns, and has advantages for collecting long-range distance restraints for structure determination of large eukaryotic membrane proteins by solid-state NMR.
DEFF Research Database (Denmark)
Straadt, Ida K; Young, Jette F; Petersen, Bent O
2010-01-01
In this study, stress in relation to slaughter was investigated in a model system by the use of (13)C, (1)H, and (31)P nuclear magnetic resonance (NMR) spectroscopy for elucidating changes in the metabolites in C2C12 myotubes exposed to H(2)O(2)-induced stress. Oxidative stress resulted in lower...... to lower levels of the unlabeled ((12)C) lactate were identified in the (1)H spectra after stress exposure. These data indicate an increase in de novo synthesis of alanine, concomitant with a release of lactate from the myotubes to the medium at oxidative stress conditions. The changes in the metabolite...
NMR studies of bent DNA using {sup 13}C-enriched samples
Energy Technology Data Exchange (ETDEWEB)
Zimmer, D.P.; Crothers, D.M. [Yale Univ., New Haven, CT (United States)
1994-12-01
Bending of the DNA double helix can be brought about by introducing runs of adenines (A-tracts) in phase with the helical repeat of the DNA. The requirements for bending of DNA by A-tracts are that the length of the A-tract be greater than 3 base pairs and that the A-tracts must be in phase with the helical repeat (every 10 or 11 bp). Other factors, such as the number of adenines in the run, flanking sequences, and whether the A-tracts are phased with respect to the 5{prime}A or the 3{prime}A, have effects upon the degree of bending as assayed by electrophoretic mobility on native polyacrylamide gels. There are a number of models for bending A-tract DNA. The junction-bending model postulates that the structure of A-tracts is similar to the fiber diffraction structure of poly A, in which there is a significant degree of base pair tilt with respect to the helix axis. In this model, bending occurs at the junction between the A-tract and the B-form helix to allow favorable stacking interactions to occur. The bend of the helix could arise as a result of some other perturbation of B-form DNA by A-tracts, such as propeller twist; bending also could be due to a combination of factors. Our goal is to find the structural features of A-tracts responsible for bending of the helix by performing NMR on oligonucleotides containing A-tracts to obtain higher resolution structural data. One of the problems encountered in NMR structure determination of nucleic acids and other macromolecules is the assignment of resonances to nuclei. This procedure can be greatly facilitated through the use of {sup 13}C-enriched nucleic acid samples. We are developing a technique for the enzymatic synthesis of labeled DNA for NMR. The technique we are developing is similar to RNA labeling techniques already in use. The technique involves growth of methylotrophic bacteria on {sup 13}CH{sub 3}OH.
Pienkina, A.; Motiyenko, R. A.; Margulès, L.; Müller, Holger S. P.; Guillemin, J.-C.
2016-06-01
This study of the 13C-triply labeled species of ethyl cyanide (CH_3CH_2CN) follows our recent work on the three 13C-doubly-labeled that allowed their detection in the line survey recently obtained with ALMA (EMoCA). The detection of isotopologues could improve the knowledge of the astrochemistry. The other goal is to clean the surveys from the lines of known molecules in order to detect new ones, this is especially important for the abundant complex organic molecules like ethyl cyanide. As in the case of the doubly substitued species, no spectroscopic studies exist up to now for 13CH_313CH_213CN, the first predictions were thus obtained from scaled ab initio calculations. The spectra were recorded and analyzed up to 1 THz. More than 5500 lines were fitted with quantum numbers J and K_a up to 95 and 25 respectively. The spectra were obtained with the new version of the Lille's solid state spectrometers. This new version used Direct Digital Synthesizer in order to speed up acquisition time. We constructed a spectrometer covering a decade, from 150 to 1500 GHz, it scans the full range in 24 hours with high sensitivity and accuracy. This work was supported by the CNES and the Action sur Projets de l'INSU, PCMI. This work was also done under ANR-13-BS05-0008-02 IMOLABS Margules, L.; et al. 2015, 69th International Symposium on Molecular Spectroscopy, RI06 Belloche, A.; et al. 2014, Science, 345, 1584
Energy Technology Data Exchange (ETDEWEB)
Ramaraju, Bhargavi; McFeeters, Hana; Vogler, Bernhard; McFeeters, Robert L., E-mail: robert.mcfeeters@uah.edu [University of Alabama in Huntsville, Department of Chemistry (United States)
2017-01-15
Nuclear magnetic resonance spectroscopy studies of ever larger systems have benefited from many different forms of isotope labeling, in particular, site specific isotopic labeling. Site specific {sup 13}C labeling of methyl groups has become an established means of probing systems not amenable to traditional methodology. However useful, methyl reporter sites can be limited in number and/or location. Therefore, new complementary site specific isotope labeling strategies are valuable. Aromatic amino acids make excellent probes since they are often found at important interaction interfaces and play significant structural roles. Aromatic side chains have many of the same advantages as methyl containing amino acids including distinct {sup 13}C chemical shifts and multiple magnetically equivalent {sup 1}H positions. Herein we report economical bacterial production and one-step purification of phenylalanine with {sup 13}C incorporation at the Cα, Cγ and Cε positions, resulting in two isolated {sup 1}H-{sup 13}C spin systems. We also present methodology to maximize incorporation of phenylalanine into recombinantly overexpressed proteins in bacteria and demonstrate compatibility with ILV-methyl labeling. Inexpensive, site specific isotope labeled phenylalanine adds another dimension to biomolecular NMR, opening new avenues of study.
Energy Technology Data Exchange (ETDEWEB)
Klaus, Valentin H., E-mail: v.klaus@uni-muenster.de [Münster University, Institute for Landscape Ecology, Heisenbergstr. 2, 48149 Münster (Germany); Hölzel, Norbert [Münster University, Institute for Landscape Ecology, Heisenbergstr. 2, 48149 Münster (Germany); Prati, Daniel; Schmitt, Barbara [University of Bern, Institute of Plant Sciences, Altenbergrain 21, 3013 Bern (Switzerland); Schöning, Ingo; Schrumpf, Marion; Solly, Emily F. [Max-Planck-Institute for Biogeochemistry, Hans-Knöll-Str. 10, 07745 Jena (Germany); Hänsel, Falk [University Marburg, Environmental Informatics, Faculty of Geography, Deutschhausstr. 12, 35037 Marburg (Germany); Fischer, Markus [University of Bern, Institute of Plant Sciences, Altenbergrain 21, 3013 Bern (Switzerland); Kleinebecker, Till [Münster University, Institute for Landscape Ecology, Heisenbergstr. 2, 48149 Münster (Germany)
2016-10-01
Land-use change and intensification play a key role in the current biodiversity crisis. The resulting species loss can have severe effects on ecosystem functions and services, thereby increasing ecosystem vulnerability to climate change. We explored whether land-use intensification (i.e. fertilization intensity), plant diversity and other potentially confounding environmental factors may be significantly related to water use (i.e. drought stress) of grassland plants. Drought stress was assessed using δ{sup 13}C abundances in aboveground plant biomass of 150 grassland plots across a gradient of land-use intensity. Under water shortage, plants are forced to increasingly take up the heavier {sup 13}C due to closing stomata leading to an enrichment of {sup 13}C in biomass. Plants were sampled at the community level and for single species, which belong to three different functional groups (one grass, one herb, two legumes). Results show that plant diversity was significantly related to the δ{sup 13}C signal in community, grass and legume biomass indicating that drought stress was lower under higher diversity, although this relation was not significant for the herb species under study. Fertilization, in turn, mostly increased drought stress as indicated by more positive δ{sup 13}C values. This effect was mostly indirect by decreasing plant diversity. In line with these results, we found similar patterns in the δ{sup 13}C signal of the organic matter in the topsoil, indicating a long history of these processes. Our study provided strong indication for a positive biodiversity-ecosystem functioning relationship with reduced drought stress at higher plant diversity. However, it also underlined a negative reinforcing situation: as land-use intensification decreases plant diversity in grasslands, this might subsequently increases drought sensitivity. Vice-versa, enhancing plant diversity in species-poor agricultural grasslands may moderate negative effects of future
International Nuclear Information System (INIS)
Klaus, Valentin H.; Hölzel, Norbert; Prati, Daniel; Schmitt, Barbara; Schöning, Ingo; Schrumpf, Marion; Solly, Emily F.; Hänsel, Falk; Fischer, Markus; Kleinebecker, Till
2016-01-01
Land-use change and intensification play a key role in the current biodiversity crisis. The resulting species loss can have severe effects on ecosystem functions and services, thereby increasing ecosystem vulnerability to climate change. We explored whether land-use intensification (i.e. fertilization intensity), plant diversity and other potentially confounding environmental factors may be significantly related to water use (i.e. drought stress) of grassland plants. Drought stress was assessed using δ"1"3C abundances in aboveground plant biomass of 150 grassland plots across a gradient of land-use intensity. Under water shortage, plants are forced to increasingly take up the heavier "1"3C due to closing stomata leading to an enrichment of "1"3C in biomass. Plants were sampled at the community level and for single species, which belong to three different functional groups (one grass, one herb, two legumes). Results show that plant diversity was significantly related to the δ"1"3C signal in community, grass and legume biomass indicating that drought stress was lower under higher diversity, although this relation was not significant for the herb species under study. Fertilization, in turn, mostly increased drought stress as indicated by more positive δ"1"3C values. This effect was mostly indirect by decreasing plant diversity. In line with these results, we found similar patterns in the δ"1"3C signal of the organic matter in the topsoil, indicating a long history of these processes. Our study provided strong indication for a positive biodiversity-ecosystem functioning relationship with reduced drought stress at higher plant diversity. However, it also underlined a negative reinforcing situation: as land-use intensification decreases plant diversity in grasslands, this might subsequently increases drought sensitivity. Vice-versa, enhancing plant diversity in species-poor agricultural grasslands may moderate negative effects of future climate change. - Highlights
DEFF Research Database (Denmark)
Dalsgaard, Anne Johanne Tang; St. John, Michael
2004-01-01
A key issue in marine science is parameterizing trophic interactions in marine food webs, thereby developing an understanding of the importance of top-down and bottom-up controls on populations of key trophic players. This study validates the utility of fatty acid food web and trophic markers usi......), respectively. Lack of temporal trends in nonlabelled fatty acids confirmed the conservative incorporation of labelled fatty acids by the fish.......A key issue in marine science is parameterizing trophic interactions in marine food webs, thereby developing an understanding of the importance of top-down and bottom-up controls on populations of key trophic players. This study validates the utility of fatty acid food web and trophic markers using...... C-13-labelled fatty acids to verify the conservative incorporation of fatty acid tracers by juvenile sandeel (Ammodytes tobianus) and assess their uptake, clearance, and metabolic turnover rates. Juvenile sandeel were fed for 16 days in the laboratory on a formulated diet enriched in (13)C16...
Directory of Open Access Journals (Sweden)
Himanshu Singh
Full Text Available Cellular metabolite analyses by (13C-NMR showed that C. reinhardtii cells assimilate acetate at a faster rate in heterotrophy than in mixotrophy. While heterotrophic cells produced bicarbonate and CO2aq, mixotrophy cells produced bicarbonate alone as predominant metabolite. Experiments with singly (13C-labelled acetate ((13CH(3-COOH or CH(3-(13COOH supported that both the (13C nuclei give rise to bicarbonate and CO2(aq. The observed metabolite(s upon further incubation led to the production of starch and triacylglycerol (TAG in mixotrophy, whereas in heterotrophy the TAG production was minimal with substantial accumulation of glycerol and starch. Prolonged incubation up to eight days, without the addition of fresh acetate, led to an increased TAG production at the expense of bicarbonate, akin to that of nitrogen-starvation. However, such TAG production was substantially high in mixotrophy as compared to that in heterotrophy. Addition of mitochondrial un-coupler blocked the formation of bicarbonate and CO2(aq in heterotrophic cells, even though acetate uptake ensued. Addition of PSII-inhibitor to mixotrophic cells resulted in partial conversion of bicarbonate into CO2(aq, which were found to be in equilibrium. In an independent experiment, we have monitored assimilation of bicarbonate via photoautotrophy and found that the cells indeed produce starch and TAG at a much faster rate as compared to that in mixotrophy and heterotrophy. Further, we noticed that the accumulation of starch is relatively more as compared to TAG. Based on these observations, we suggest that acetate assimilation in C. reinhardtii does not directly lead to TAG formation but via bicarbonate/CO2(aq pathways. Photoautotrophic mode is found to be the best growth condition for the production of starch and TAG and starch in C. reinhardtii.
49 CFR 195.207 - Transportation of pipe.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Transportation of pipe. 195.207 Section 195.207 Transportation Other Regulations Relating to Transportation (Continued) PIPELINE AND HAZARDOUS MATERIALS SAFETY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) PIPELINE SAFETY TRANSPORTATION OF HAZARDOUS LIQUIDS BY...
Gryff-Keller, A.; Kraska-Dziadecka, A.
2011-12-01
13C NMR spectra of 1,3-dimethylbarbituric acid in aqueous solutions of various acidities and for various solute concentrations have been recorded and interpreted. The spectra recorded at pH = 2 and below contain the signals of the neutral solute molecule exclusively, while the ones recorded at pH = 7 and above only the signals of the appropriate anion, which has been confirmed by theoretical GIAO-DFT calculations. The signals in the spectra recorded for solutions of pH pH variation have been observed for the parent barbituric acid.
Survival and compound nucleus probability of super heavy element Z = 117
International Nuclear Information System (INIS)
Manjunatha, H.C.; Sridhar, K.N.
2017-01-01
As a part of a systematic study for predicting the most suitable projectile-target combinations for heavy-ion fusion experiments in the synthesis of "2"8"9"-"2"9"7Ts, we have calculated the transmission probability (T_l), compound nucleus formation probabilities (P_C_N) and survival probability (P_s_u_r) of possible projectile-target combinations. We have also studied the fusion cross section, survival cross section and fission cross sections for different projectile-target combination of "2"8"9"-"2"9"7Ts. These theoretical parameters are required before the synthesis of the super heavy element. The calculated probabilities and cross sections show that the production of isotopes of the super heavy element with Z = 117 is strongly dependent on the reaction systems. The most probable reactions to synthetize the super heavy nuclei "2"8"9"-"2"9"7Ts are worked out and listed explicitly. We have also studied the variation of P_C_N and P_s_u_r with the mass number of projectile and target nuclei. This work is useful in the synthesis of the super heavy element Z = 117. (orig.)
Genetic and Biochemical Characterization of the MinC-FtsZ Interaction in Bacillus subtilis
Castellen, Patricia; Nogueira, Maria Luiza C.; Bettini, Jefferson; Portugal, Rodrigo V.; Zeri, Ana Carolina M.; Gueiros-Filho, Frederico J.
2013-01-01
Cell division in bacteria is regulated by proteins that interact with FtsZ and modulate its ability to polymerize into the Z ring structure. The best studied of these regulators is MinC, an inhibitor of FtsZ polymerization that plays a crucial role in the spatial control of Z ring formation. Recent work established that E. coli MinC interacts with two regions of FtsZ, the bottom face of the H10 helix and the extreme C-terminal peptide (CTP). Here we determined the binding site for MinC on Bacillus subtilis FtsZ. Selection of a library of FtsZ mutants for survival in the presence of Min overexpression resulted in the isolation of 13 Min-resistant mutants. Most of the substitutions that gave rise to Min resistance clustered around the H9 and H10 helices in the C-terminal domain of FtsZ. In addition, a mutation in the CTP of B. subtilis FtsZ also produced MinC resistance. Biochemical characterization of some of the mutant proteins showed that they exhibited normal polymerization properties but reduced interaction with MinC, as expected for binding site mutations. Thus, our study shows that the overall architecture of the MinC-FtsZ interaction is conserved in E. coli and B. subtilis. Nevertheless, there was a clear difference in the mutations that conferred Min resistance, with those in B. subtilis FtsZ pointing to the side of the molecule rather than to its polymerization interface. This observation suggests that the mechanism of Z ring inhibition by MinC differs in both species. PMID:23577149
Study of α-monosubstituted methyl acetates by C-13 and H-1 Nuclear Magnetic resonance
International Nuclear Information System (INIS)
Silva, E.L.
1987-01-01
The substituents effects on the methylene and carbonyl carbons chemical shifts of some α-monosubstituted methyl acetates Z-CH 2 -COOMe(Z=H,Cl,Br,I,OME,SMe,NMe 2 and Me) is studied. Some data of Carbon 13 NMr in the light of the substituents empirical and electronic effects are shown. Solvent and concentration effects on the hydrogen-1 chemical shifts of methyl acetate, bromoacetate and Iodoacetate were interpreted in the light of the Cα-C(O)-bond rotational isomerism. (M.J.C.) [pt
The adsorption of 117Snm(IV)-EDTMP on collagen
International Nuclear Information System (INIS)
Yang Yuqing; Luo Shunzhong; Pu Manfei; Bing Wenzeng; He Jiaheng; Wang Guanquan
2002-01-01
The adsorption and desorption characteristics of 117 Sn m (IV)-EDTMP on collage are studied, and compared with that on HA. The results show that the effects of pH and temperature on adsorption of 117 Sn m (IV)-EDTMP on collagen are similar to those on HA, and that the adsorption equilibrium and adsorption model of 117 Sn m (IV)-EDTMP on collagen are completely different from those on HA; 117 Sm m -EDTMP absorbed on collagen are extremely stable and almost could not be desorbed with normal saline or EDTMP
PEDOGENIC CARBONATE δ13C AND ENVIRONMENTAL PRECIPITATION CONDITIONS
Directory of Open Access Journals (Sweden)
Marcella Catoni
2011-12-01
Full Text Available Carbon isotopic analysis is a useful tool for investigating paleoenvironments, as the pedogenic carbonate δ13C is related to δ13CSOM and to the proportions of C3/C4 plants. In this work we interpreted the paleoenvironmental conditions at the time of carbonate precipitation in soils formed under different climates and during different geological ages. Samples were taken from a Bk (PR1, Holocene and from two Bkm horizons (PR2 and PR3, Pleistocene. When the mean δ13C plant values and the most plausible paleotemperatures were used in the evaluation, PR1 showed a lower percentage of C4 plants (48% than Pleistocene soils (~53%, in agreement with paleoclimate changes. When instead the δ13C values of current plants were used for PR1, C4 plants ranged from 59 (12°C to 66% (18°C, suggesting two possible interpretations: either plant species changed during the Holocene, or the plant mean values normally used in the literature are not suitable for Pleistocene reconstructions
Late pleistocene-recent atmospheric δ13C record in C4 grasses
International Nuclear Information System (INIS)
Toolin, L.J.; Eastoe, C.
1993-01-01
Samples of Setaria species from packrat middens, herbarium specimens and modern plants preserve a record of δ 13 C of atmospheric CO 2 from 12,600 Bp to the present. No secular trend is detected between 12,600 and 1,800 Bp, when the mean value of δ 13 C during that period was -6.5 ± 0.1 per-thousand (the error is the standard deviation of the mean). The value agrees with δ 13 C averages of pre-industrial CO 2 from polar ice cores, and differs significantly from modern regional (-8.2 ± 0.1 per-thousand) and global (-7.7 per-thousand) values, which are higher because of fossil fuel burning
Directory of Open Access Journals (Sweden)
Marta Socka
2018-01-01
Full Text Available The effect of configuration of an asymmetric bulky initiator 2,2′-[1,1′-binaphtyl-2,2′-diyl- bis-(nitrylomethilidyne]diphenoxy aluminum isopropoxide (Ini on structure of copolymer of asymmetric monomer l,l-lactide (Lac with symmetric comonomer trimethylene carbonate (Tmc was studied using polarimetry, dilatometry, Size Exclusion Chromatography (SEC, and Carbon Nuclear Magnetic Resonance (13C NMR. When the S-enantiomer of Ini was used the distribution in copolymer chains at the beginning of polymerization is statistical, with alternacy tendency, changing next through a gradient region to homoblocks of Tmc. However, when R-Ini was used, the product formed was a gradient oligoblock one, with Tmc blocks prevailing at the beginning, changing to Lac blocks dominating at the end part of chains. Initiation of copolymerization with the mixture of both initiator enantiomers (S:R = 6:94 gave a multiblock copolymer of similar features but shorter blocks. Analysis of copolymerization progress required complex analysis of dilatometric data, assuming different molar volume contraction coefficients for units located in different triads. Comonomer reactivity ratios of studied copolymerizations were determined.
Detection of interstellar (C-13)N toward Zeta Ophiuchi
International Nuclear Information System (INIS)
Crane, P.; Hegyi, D.J.
1988-01-01
Observations of a diffuse interstellar cloud toward Zeta Oph, obtained with resolution 100,000-150,000 near the 3874.608-A R(0) line of (C-12)N using a coude echelle spectrograph on the 1.4-m telescope at ESO during 1984 and 1985, are reported. Data from 54 20-min runs were fitted to Gaussian line shapes using the line center, depth, and width of the R(0) and R(1) lines of (C-12)N and the line center and depth of the R(0) line of (C-13)N as fitting parameters. The (C-13)N R(0) line, with equivalent width 0.190 + or - 0.020 mA, was detected 173.7 + or - 0.8 mA to the red of (C-12)N R(0); the corresponding isotope abundance ratio, (C-12)N/(C-13)N = 47.3 + 5.5 or -4.4, is shown to be in good agreement with previous measurements for CH(+) (Hawkins et al., 1985). 13 references
The interaction of oxygen with TiC(001): Photoemission and first-principles studies
International Nuclear Information System (INIS)
Rodriguez, J.A.; Liu, P.; Dvorak, J.; Jirsak, T.; Gomes, J.; Takahashi, Y.; Nakamura, K.
2004-01-01
High-resolution photoemission and first-principles density-functional slab calculations were used to study the interaction of oxygen with a TiC(001) surface. Atomic oxygen is present on the TiC(001) substrate after small doses of O 2 at room temperature. A big positive shift (1.5-1.8 eV) was detected for the C 1s core level. These photoemission studies suggest the existence of strong O↔C interactions. A phenomenon corroborated by the results of first-principles calculations, which show a CTiTi hollow as the most stable site for the adsorption of O. Ti and C atoms are involved in the adsorption and dissociation of the O 2 molecule. In general, the bond between O and the TiC(001) surface contains a large degree of ionic character. The carbide→O charge transfer is substantial even at high coverages (>0.5 ML) of oxygen. At 500 K and large doses of O 2 , oxidation of the carbide surface occurs with the removal of C and formation of titanium oxides. There is an activation barrier for the exchange of Ti-C and Ti-O bonds which is overcome only by the formation of C-C or C-O bonds on the surface. The mechanism for the removal of a C atom as CO gas involves a minimum of two O adatoms, and three O adatoms are required for the formation of CO 2 gas. Due to the high stability of TiC, an O adatom alone cannot induce the generation of a C vacancy in a flat TiC(001) surface
International Nuclear Information System (INIS)
Abd el-Kariem, S.E.S.
1984-01-01
In the framework of a systematic analysis of many-particle transfer reactions on light nuclei in the present thesis the two-particle transfer reactions of the type (d,α) on the nucleus 10 B at Esub(d) = 16 MeV and on the nuclei 11 B, 12 C and 13 C at Esub(d) = 24 MeV as well as the three-particle transfer reaction 13 C(p,α) 10 B at eight incident energies between 16 and 45 MeV have been studied. In the case of the residual nuclei 10 B and 11 B transitions up to an excitation energy Esub(x) approx.= 7.5 respectively approx.= 9,0 MeV, in the case of the residual nuclei 8 Be and 9 Be transitions up to Esub(x) approx.= 17 respectively 2.5 MeV were evaluated. Under the assumption that the studied reactions behave as direct one-stage transfer processes the measurement results were analyzed in the framework of the DWBA theory in zero-range approximation. The parameters for the optical potentials used in the DWBA calculations were taken from literature and partly modified by fitting to the angular distributions of the reactions studied here. Microscopic and semimicroscopic calculations were performed. In the semimicroscopic calculations the spectroscopic amplitudes calculated microscopically or in SU(3) approximation were used together with a cluster form factor, in the other case with a microscopically calculated form factor. For the residual nucleus for some higher excited states results on spin, parity, and isospin could be partly obtained, partly confirmed. (orig./HSI) [de
Optoacoustic 13C-breath test analyzer
Harde, Hermann; Helmrich, Günther; Wolff, Marcus
2010-02-01
The composition and concentration of exhaled volatile gases reflects the physical ability of a patient. Therefore, a breath analysis allows to recognize an infectious disease in an organ or even to identify a tumor. One of the most prominent breath tests is the 13C-urea-breath test, applied to ascertain the presence of the bacterium helicobacter pylori in the stomach wall as an indication of a gastric ulcer. In this contribution we present a new optical analyzer that employs a compact and simple set-up based on photoacoustic spectroscopy. It consists of two identical photoacoustic cells containing two breath samples, one taken before and one after capturing an isotope-marked substrate, where the most common isotope 12C is replaced to a large extent by 13C. The analyzer measures simultaneously the relative CO2 isotopologue concentrations in both samples by exciting the molecules on specially selected absorption lines with a semiconductor laser operating at a wavelength of 2.744 μm. For a reliable diagnosis changes of the 13CO2 concentration of 1% in the exhaled breath have to be detected at a concentration level of this isotope in the breath of about 500 ppm.
Miah, Mohammad K; Bickel, Ulrich; Mehvar, Reza
2017-12-01
Hepatic encephalopathy that is associated with severe liver failure may compromise the blood-brain barrier (BBB) integrity. However, the effects of less severe liver diseases, in the absence of overt encephalopathy, on the BBB are not well understood. The goal of the current study was to investigate the effects of hepatic ischemia-reperfusion (IR) injury on the BBB tight junction permeability to small, hydrophilic molecules using the widely used [ 14 C]sucrose and recently-proposed alternative [ 13 C]sucrose as markers. Rats were subjected to 20 min of hepatic ischemia or sham surgery, followed by 8 h of reperfusion before administration of a single bolus dose of [ 14 C] or [ 13 C]sucrose and collection of serial (0-30 min) blood and plasma and terminal brain samples. The concentrations of [ 14 C] and [ 13 C]sucrose in the samples were determined by measurement of total radioactivity (nonspecific) and LC-MS/MS (specific), respectively. IR injury significantly increased the blood, plasma, and brain concentrations of both [ 14 C] and [ 13 C]sucrose. However, when the brain concentrations were corrected for their respective area under the blood concentration-time curve, only [ 14 C]sucrose showed significantly higher (30%) BBB permeability values in the IR animals. Because [ 13 C]sucrose is a more specific BBB permeability marker, these data indicate that our animal model of hepatic IR injury does not affect the BBB tight junction permeability to small, hydrophilic molecules. Methodological differences among studies of the effects of liver diseases on the BBB permeability may confound the conclusions of such studies.
The synthesis of Org 3770 labelled with 3H, 13C and 14C
International Nuclear Information System (INIS)
Kaspersen, F.M.; Rooij, F.A.M. van; Sperling, E.G.M.; Wieringa, J.H.
1989-01-01
The syntheses of 1,2,3,4,10,14b-hexahydro-2-methylpyrazino[2,1-a]pyrido[2,3-c][2]benazepine (Org 3770) labelled with 3 H (and 2 H), 13 C and 14 C are described. Tritiated Org 3770 was prepared either by exchange under alkaline conditions with tritiated water or catalytic reductive dehalogenation of a chloro analogue with 3 H 2 . 13 C-labelled material was obtained in a seven-step synthesis starting from 13 C-labelled benzene whereas 14 C-Org 3770 was prepared in a three-step synthesis starting with 14 CO 2 . All labelled compounds were analyzed by TLC, HPLC, MS and NMR. (author)
International Nuclear Information System (INIS)
Campos, H.S.
1976-01-01
Calcium carbonate-cemented beach sands or beach rocks have been observed to occur in the inter tidal zone of many tropical beaches. Near Salvador (Brazil) occurrences are found in several locations on the island of Itaparica. A study of the stable isotope composition (C 13 / C 12 and O 18 / O 16 ) of the cement and the local groundwater was carried out to determine the origin of the carbonate cement. (author)
7 CFR 1280.207 - Term of office.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Term of office. 1280.207 Section 1280.207 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... INFORMATION ORDER Lamb Promotion, Research, and Information Order Lamb Promotion, Research, and Information...
Trans and surface membrane bound zervamicin IIB: 13C-MAOSS-NMR at high spinning speed
International Nuclear Information System (INIS)
Raap, J.; Hollander, J.; Ovchinnikova, T. V.; Swischeva, N. V.; Skladnev, D.; Kiihne, S.
2006-01-01
Interactions between 15 N-labelled peptides or proteins and lipids can be investigated using membranes aligned on a thin polymer film, which is rolled into a cylinder and inserted into the MAS-NMR rotor. This can be spun at high speed, which is often useful at high field strengths. Unfortunately, substrate films like commercially available polycarbonate or PEEK produce severe overlap with peptide and protein signals in 13 C-MAOSS NMR spectra. We show that a simple house hold foil support allows clear observation of the carbonyl, aromatic and C α signals of peptides and proteins as well as the ester carbonyl and choline signals of phosphocholine lipids. The utility of the new substrate is validated in applications to the membrane active peptide zervamicin IIB. The stability and macroscopic ordering of thin PC10 bilayers was compared with that of thicker POPC bilayers, both supported on the household foil. Sidebands in the 31 P-spectra showed a high degree of alignment of both the supported POPC and PC10 lipid molecules. Compared with POPC, the PC10 lipids are slightly more disordered, most likely due to the increased mobilities of the shorter lipid molecules. This mobility prevents PC10 from forming stable vesicles for MAS studies. The 13 C-peptide peaks were selectively detected in a 13 C-detected 1 H-spin diffusion experiment. Qualitative analysis of build-up curves obtained for different mixing times allowed the transmembrane peptide in PC10 to be distinguished from the surface bound topology in POPC. The 13 C-MAOSS results thus independently confirms previous findings from 15 N spectroscopy [Bechinger, B., Skladnev, D.A., Ogrel, A., Li, X., Rogozhkina, E.V., Ovchinnikova, T.V., O'Neil, J.D.J. and Raap, J. (2001) Biochemistry, 40, 9428-9437]. In summary, application of house hold foil opens the possibility of measuring high resolution 13 C-NMR spectra of peptides and proteins in well ordered membranes, which are required to determine the secondary and
27 CFR 26.207 - Destruction of marks and brands.
2010-04-01
... brands. 26.207 Section 26.207 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... Products Coming Into the United States From the Virgin Islands § 26.207 Destruction of marks and brands. The marks, brands, and serial numbers required by this part to be placed on barrels, casks, or similar...
Solution NMR study of the yeast cytochrome c peroxidase: cytochrome c interaction
Energy Technology Data Exchange (ETDEWEB)
Volkov, Alexander N., E-mail: ovolkov@vub.ac.be; Nuland, Nico A. J. van [Vrije Universiteit Brussel, Jean Jeener NMR Centre, Structural Biology Brussels (Belgium)
2013-07-15
Here we present a solution NMR study of the complex between yeast cytochrome c (Cc) and cytochrome c peroxidase (CcP), a paradigm for understanding the biological electron transfer. Performed for the first time, the CcP-observed heteronuclear NMR experiments were used to probe the Cc binding in solution. Combining the Cc- and CcP-detected experiments, the binding interface on both proteins was mapped out, confirming that the X-ray structure of the complex is maintained in solution. Using NMR titrations and chemical shift perturbation analysis, we show that the interaction is independent of the CcP spin-state and is only weakly affected by the Cc redox state. Based on these findings, we argue that the complex of the ferrous Cc and the cyanide-bound CcP is a good mimic of the catalytically-active Cc-CcP compound I species. Finally, no chemical shift perturbations due to the Cc binding at the low-affinity CcP site were observed at low ionic strength. We discuss possible reasons for the absence of the effects and outline future research directions.
Flórez, Edison; Maldonado, Alejandro F; Aucar, Gustavo A; David, Jorge; Restrepo, Albeiro
2016-01-21
Hartree-Fock (HF) and second order perturbation theory (MP2) calculations within the scalar and full relativistic frames were carried out in order to determine the equilibrium geometries and interaction energies between cationic methylmercury (CH3Hg(+)) and up to three water molecules. A total of nine structures were obtained. Bonding properties were analyzed using the Quantum Theory of Atoms In Molecules (QTAIM). The analyses of the topology of electron densities reveal that all structures exhibit a partially covalent HgO interaction between methylmercury and one water molecule. Consideration of additional water molecules suggests that they solvate the (CH3HgOH2)(+) unit. Nuclear magnetic shielding constants σ((199)Hg), σ((13)C) and σ((17)O), as well as indirect spin-spin coupling constants J((199)Hg-(13)C), J((199)Hg-(17)O) and J((13)C-(17)O), were calculated for each one of the geometries. Thermodynamic stability and the values of NMR constants correlate with the ability of the system to directly coordinate oxygen atoms of water molecules to the mercury atom in methylmercury and with the formation of hydrogen bonds among solvating water molecules. Relativistic effects account for 11% on σ((13)C) and 14% on σ((17)O), which is due to the presence of Hg (heavy atom on light atom, HALA effect), while the relativistic effects on σ((199)Hg) are close to 50% (heavy atom on heavy atom itself, HAHA effect). J-coupling constants are highly influenced by relativity when mercury is involved as in J((199)Hg-(13)C) and J((199)Hg-(17)O). On the other hand, our results show that the values of NMR constants for carbon and oxygen, atoms which are connected through mercury (C-HgO), are highly correlated and are greatly influenced by the presence of water molecules. Water molecules introduce additional electronic effects to the relativistic effects due to the mercury atom.
Configurations and conformations in acyclic, unsaturated hydrocarbons. A 13C NMR study
Haan, de J.W.; Ven, van de L.J.M.
1973-01-01
13C NMR (CMR) spectra of a number of di- and trisubstituted ethylenes have been measured. Very consistent values are found for the differential shieldings of allylic carbons in a number of linear, (Z)- and (E)-disubstituted ethylenes. The discrepancies between the several structural elements are
Analisis Film Horor Indonesia Produksi Tahun 2014 (Studi Kasus: Mall Klender dan Kamar 207
Directory of Open Access Journals (Sweden)
Dedi Sukatno Sembiring Meliala
2016-02-01
Full Text Available Abstrak Film horor erat kaitannya dengan tokoh antagonis yang menimbulkan ketakutan pada penonton dalam bentuk makhluk supranatural seperti hantu, roh jahat dan sebagainya. Karakteristik film dengan genre horor membuat penonton terbawa suasana dengan alur ceritanya yang menakutkan. Namun, beberapa dari film horor Indonesia menyajikan adegan-adegan yang kurang sopan bahkan tergolong asusila atau porno. Untuk itu, penelitian ini ingin melihat apakah terdapat konten pornografi pada film Mall Klender dan Kamar 207 yang merupakan film horor Indonesia terlaris di tahun 2014. Analisis dilakukan dengan melihat pandangan dan penilaian 30 responden dengan karakteristik yaitu penonton film horor Indonesia yang berusia 20-40 tahun. Berdasarkan hasil analisis, tidak didapatkan konten pornografi pada film Mall Klender dan Kamar 207. Adegan-adegan yang terindikasi sebagai konten pornografi ternyata masih dapat diterima oleh penonton sebagai adegan yang berada dalam batas kewajaran dan mendukung pembawaan suasana dan kesan dalam cerita yang disampaikan. Kata Kunci: film horror Indonesia, analisis konten, pornografi Abstract The horror film is closely related to the antagonist that causes fear for audience in the form of supernatural creatures such as ghosts, demons and so on. Characteristic of the horor film is to make the audience carried away with the scary plot. However, some of the existing Indonesian horror film presents scenes that classified as obscene or pornographic. Therefore, this study wanted to see if there are any pornographic content on the film Klender Mall and Room 207 is the best-selling Indonesian horror movie in 2014. The analysis was done by looking at the view and assessment of 30 respondents which are Indonesian horror movie goers aged 20-40 years. Based on the analysis, there is no founding of pornographic content on the film Klender Mall and Room 207. The scenes that indicated as pornographic content was still acceptable by the audience
Tali, Suhail A.; Kumar, Harish; Ansari, M. Afzal; Ali, Asif; Singh, D.; Ali, Rahbar; Giri, Pankaj K.; Linda, Sneha B.; Parashari, Siddharth; Kumar, R.; Singh, R. P.; Muralithar, S.
2018-02-01
The excitation functions for the evaporation residues populated in the interaction of 13C +165 Ho system have been measured at projectile energies ≈ 4-7 MeV/nucleon. Stacked foil activation technique followed by off-line γ-ray spectroscopy have been employed in the present work. The experimentally measured cross-sections are analyzed in the frame work of statistical model code PACE4, which takes into account only the complete fusion reaction cross-sections. The evaporation residues populated via xn and pxn channels were found to be in good agreement with the PACE4 predictions, while a significant enhancement in the measured cross-sections over PACE4 predictions is observed in case of α-emitting channels, which may be attributed to the incomplete fusion process. For the better understanding of incomplete fusion dynamics, the incomplete fusion fraction has also been deduced and its sensitivity with various entrance channel parameters like: projectile energy, mass-asymmetry, projectile structure in terms of Qα-value and Coulomb effect has been studied in the present work. The incomplete fusion fraction is found to increase with increasing the projectile energy and a strong projectile structure dependent mass-asymmetry systematic is also observed. The incomplete fusion fraction is also found to be small for more negative Qα-value projectile (13C) induced reactions as compared to less negative Qα-value projectiles (12C, 16O and 20Ne) induced reactions with the same target nucleus 165Ho. An interesting trend is obtained on further investigation of incomplete fusion dependence on Coulomb effect (ZPZT).
Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos
2015-01-01
In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis. PMID:26146832
Rossoni, Rodnei Dennis; Barbosa, Júnia Oliveira; Vilela, Simone Furgeri Godinho; dos Santos, Jéssica Diane; de Barros, Patrícia Pimentel; Prata, Márcia Cristina de Azevedo; Anbinder, Ana Lia; Fuchs, Beth Burgwyn; Jorge, Antonio Olavo Cardoso; Mylonakis, Eleftherios; Junqueira, Juliana Campos
2015-01-01
In this study, we evaluated the interactions between Candida albicans, Candida krusei and Candida glabrata in mixed infections. Initially, these interactions were studied in biofilms formed in vitro. CFU/mL values of C. albicans were lower in mixed biofilms when compared to the single biofilms, verifying 77% and 89% of C. albicans reduction when this species was associated with C. glabrata and C. krusei, respectively. After that, we expanded this study for in vivo host models of experimental candidiasis. G. mellonella larvae were inoculated with monotypic and heterotypic Candida suspensions for analysis of survival rate and quantification of fungal cells in the haemolymph. In the groups with single infections, 100% of the larvae died within 18 h after infection with C. albicans. However, interaction groups achieved 100% mortality after 72 h of infection by C. albicans-C. glabrata and 96 h of infection by C. albicans-C. krusei. C. albicans CFU/mL values from larvae hemolymph were lower in the interacting groups compared with the monoespecies group after 12 h of infection. In addition, immunosuppressed mice were also inoculated with monotypic and heterotypic microbial suspensions to induce oral candidiasis. C. albicans CFU/mL values recovered from oral cavity of mice were higher in the group with single infection by C. albicans than the groups with mixed infections by C. albicans-C. glabrata and C. albicans-C. krusei. Moreover, the group with single infection by C. albicans had a higher degree of hyphae and epithelial changes in the tongue dorsum than the groups with mixed infections. We concluded that single infections by C. albicans were more harmful for animal models than mixed infections with non-albicans species, suggesting that C. albicans establish competitive interactions with C. krusei and C. glabrata during biofilm formation and development of experimental candidiasis.
Mode selectivity in cluster-molecule interactions: Ni13 + D2
International Nuclear Information System (INIS)
Jellinek, J.; Guevenc, Z.B.
1991-01-01
Results of a detailed quasiclassical simulation study of the Ni 13 + D 2 collision system are presented. The dissociative adsorption of the molecule as well as its scattering from the cluster are analyzed as functions of the initial rovibrational molecular state, collision energy and structure of the cluster. Mode-specific features of the reactive and nonreactive channels of the cluster-molecule interaction are displayed and discussed. Evidence for resonances and for a strong cluster structure-reactivity correlation is presented. 13 refs., 6 figs
Synthesis and characterization of poly(L-co-D,L lactide-co-trimethylene carbonate)
International Nuclear Information System (INIS)
Motta, Adriana C.; Martins, Kelly F.; Messias, Andre D.; Duek, Eliana A.R.
2011-01-01
Polylactides are widely investigated as materials for tissue engineering. However characteristics such as low flexibility and elongation before fracture can be improved by trimethylene carbonate (TMC) addition to lactic acid copolymer (PLDLA). The objective of this work was to synthesize and characterize the terpolymer of L-lactic acid, D,L-lactic acid and TMC. Thus, the terpolymer was synthesized with 20 and 30% of TMC as confirmed by FTIR and 1H and 13 C NMR. The GPC analysis showed that the terpolymers had average molar weight (Mw) in the order of 105 g/mol, an important feature that allows the attainment of minimum mechanical properties for structural applications. The thermal investigation of material showed a slight decrease of Tg comparing to PLDLA. Furthermore, the one step degradation of the terpolymer was initiated around 290 deg C, as seen by TGA. These results shows that it was possible to produce a terpolymer from L-lactide, D,L-lactide and trimethylene carbonate. (author)
5 CFR 362.207 - Withdrawal and readmission.
2010-01-01
... 5 Administrative Personnel 1 2010-01-01 2010-01-01 false Withdrawal and readmission. 362.207... PRESIDENTIAL MANAGEMENT FELLOWS PROGRAM Program Administration § 362.207 Withdrawal and readmission. (a...) An agency must notify OPM when a Fellow or Senior Fellow withdraws from the Program. (b) Readmission...
40 CFR 6.207 - Environmental impact statements.
2010-07-01
... 40 Protection of Environment 1 2010-07-01 2010-07-01 false Environmental impact statements. 6.207... ACTIONS EPA's NEPA Environmental Review Procedures § 6.207 Environmental impact statements. (a) The Responsible Official will prepare an environmental impact statement (EIS) (see 40 CFR 1508.11) for major...
Interstellar C2 molecules in a Taurus dark cloud
International Nuclear Information System (INIS)
Hobbs, L.M.; Black, J.H.; van Dishoeck, E.F.
1983-01-01
Five relatively strong interstellar absorption lines of the 2--0) Phillips band of C 2 near lambda8760 are detected in the spectrum of HD 29647, a late B star which lies behind a substantial part of the Taurus molecular cloud complex about 20triangle-solid from TMC-1. In combination with newly determined oscillator strengths, the observations yield a column density N(C 2 )roughly-equal9 x 10 13 cm -2 , which is comparable to those of widely distributed molecules like CH and H 2 O. Theoreticl models of the observed C 2 rotational level populations indicate a kinetic temperature T = 14 +8 /sub -/ 5 K and a mean density n 3 cm -3 . A narrow, anomalous strong, stellar Mn II line yields for HD 29647 a project rotational velocity v sin i -1 and is explained by previous identifications HD 29647 as a Hg-Mn peculiar star. Similar spectra of ν Cyg and omicron And give an upper limit W/sub lambda/ 2 lines in the 2--0) band, toward both stars
Asante, Emmanuel A; Linehan, Jacqueline M; Smidak, Michelle; Tomlinson, Andrew; Grimshaw, Andrew; Jeelani, Asif; Jakubcova, Tatiana; Hamdan, Shyma; Powell, Caroline; Brandner, Sebastian; Wadsworth, Jonathan D F; Collinge, John
2013-01-01
Prions are infectious agents causing fatal neurodegenerative diseases of humans and animals. In humans, these have sporadic, acquired and inherited aetiologies. The inherited prion diseases are caused by one of over 30 coding mutations in the human prion protein (PrP) gene (PRNP) and many of these generate infectious prions as evidenced by their experimental transmissibility by inoculation to laboratory animals. However, some, and in particular an extensively studied type of Gerstmann-Sträussler-Scheinker syndrome (GSS) caused by a PRNP A117V mutation, are thought not to generate infectious prions and instead constitute prion proteinopathies with a quite distinct pathogenetic mechanism. Multiple attempts to transmit A117V GSS have been unsuccessful and typical protease-resistant PrP (PrP(Sc)), pathognomonic of prion disease, is not detected in brain. Pathogenesis is instead attributed to production of an aberrant topological form of PrP, C-terminal transmembrane PrP ((Ctm)PrP). Barriers to transmission of prion strains from one species to another appear to relate to structural compatibility of PrP in host and inoculum and we have therefore produced transgenic mice expressing human 117V PrP. We found that brain tissue from GSS A117V patients did transmit disease to these mice and both the neuropathological features of prion disease and presence of PrP(Sc) was demonstrated in the brains of recipient transgenic mice. This PrP(Sc) rapidly degraded during laboratory analysis, suggesting that the difficulty in its detection in patients with GSS A117V could relate to post-mortem proteolysis. We conclude that GSS A117V is indeed a prion disease although the relative contributions of (Ctm)PrP and prion propagation in neurodegeneration and their pathogenetic interaction remains to be established.
Directory of Open Access Journals (Sweden)
Emmanuel A Asante
Full Text Available Prions are infectious agents causing fatal neurodegenerative diseases of humans and animals. In humans, these have sporadic, acquired and inherited aetiologies. The inherited prion diseases are caused by one of over 30 coding mutations in the human prion protein (PrP gene (PRNP and many of these generate infectious prions as evidenced by their experimental transmissibility by inoculation to laboratory animals. However, some, and in particular an extensively studied type of Gerstmann-Sträussler-Scheinker syndrome (GSS caused by a PRNP A117V mutation, are thought not to generate infectious prions and instead constitute prion proteinopathies with a quite distinct pathogenetic mechanism. Multiple attempts to transmit A117V GSS have been unsuccessful and typical protease-resistant PrP (PrP(Sc, pathognomonic of prion disease, is not detected in brain. Pathogenesis is instead attributed to production of an aberrant topological form of PrP, C-terminal transmembrane PrP ((CtmPrP. Barriers to transmission of prion strains from one species to another appear to relate to structural compatibility of PrP in host and inoculum and we have therefore produced transgenic mice expressing human 117V PrP. We found that brain tissue from GSS A117V patients did transmit disease to these mice and both the neuropathological features of prion disease and presence of PrP(Sc was demonstrated in the brains of recipient transgenic mice. This PrP(Sc rapidly degraded during laboratory analysis, suggesting that the difficulty in its detection in patients with GSS A117V could relate to post-mortem proteolysis. We conclude that GSS A117V is indeed a prion disease although the relative contributions of (CtmPrP and prion propagation in neurodegeneration and their pathogenetic interaction remains to be established.
Backward emission of protons in Au+Au collisions at 11.7 A.GeV/c
International Nuclear Information System (INIS)
Ahle, L.; Akiba, Y.
1993-08-01
We present preliminary results for the emission of target rapidity protons in minimum bias and central 11.7 A.GeV/c Au+Au collisions. The data span the pseudo-rapidity range |η| ≤ 0.76 and proton kinetic energy range of 50 ≤ E ≤ 200 MeV. The slopes of the kinetic energy spectra and dN/dη values for central and minimum bias collisions are strikingly similar. Comparison of the results to results for Si+Au and p+A shows that the shape of the dN/dη distribution is independent of the reaction system or centrality suggesting that the spectator matter does not play a decisive role in determining the shape of the proton distributions at back angles for these systems at AGS energies
Study on neutron interactions with protons and carbon nuclei at p=4.2 GeV/c
International Nuclear Information System (INIS)
Bekmirzaev, R.N.; Muminov, M.M.; Sultanov, M.U.; Grishina, O.V.; Dolejsi, J.; Tas, P.; Trka, Z.
1988-01-01
The production of neutrons with p=4.2 GeV/c in d(C 3 H 8 ) collisions and their interaction with proton and carbon nuclei are studied. The experimental material has been obtained using the 2m propane bubble chamber irradiated by deuterons with p=4.2 GeV/c per nucleon at the Dubna synchrophasotron, JINR. The data on multiplicity and momentum characteristics of secondary particles in np and nC interactions compared with the calculations on the LUND model are obtained
Atmospheric studies of C2 white dwarfs
Swanson, Steven Roger
Model atmosphere and line formation calculations for the delta nu = + 1 Swan bands of the C2 molecule are presented for seven white dwarfs and are compared to high resolution optical spectra. Limits on the C-12 to C-13 ratio are computed for highly pressure broadened lines and are used to analyze the observed spectra for any sign of absorption by the (C-12)(C-13) molecule. The metal abundances in cool white dwarf atmospheres and the usefulness of the determination of the C-12 to C-13 ratio are discussed. The line center shift and the pressure broadening are used to determine a value for the van der Waals interaction constant, C6. This is done using a detailed line modelling program which explicitly includes approximately 2000 rotational transition lines within the vibrational bands, in conjunction with atmospheric models calculated by the LUCIFER atmosphere modelling program. The isotopic shift of the vibrational and rotational lines is also included in the model to compare the detectability of various C-12 to C-13 ratios. The line models fit the observed spectra with varying degrees of accuracy. One star, WD0548-001, shows an unusually small pressure shift and broadening for the high pressures that the atmospheric model predicts. The results show that only in the hottest stars with the least pressure broadened lines in this study can the isotopic effect be seen. With the data available, the best limit on the C-12 to C-13 ratio is a minimum of 40 for WD0856 + 331. The models show that even for very high signal to noise data, the isotopic shift in the Swan bands in very cool white dwarfs would be difficult to separate from the pressure broadening effects. It is shown that the isotopic ratio is high enough to rule out the possibility that the carbon is a relic from previous CNO burning.
Atmospheric studies of C2 white dwarfs
International Nuclear Information System (INIS)
Swanson, S.R.
1989-01-01
Model atmosphere and line formation calculations for the delta nu = + 1 Swan bands of the C2 molecule are presented for seven white dwarfs and are compared to high resolution optical spectra. Limits on the C-12 to C-13 ratio are computed for highly pressure broadened lines and are used to analyze the observed spectra for any sign of absorption by the (C-12)(C-13) molecule. The metal abundances in cool white dwarf atmospheres and the usefulness of the determination of the C-12 to C-13 ratio are discussed. The line center shift and the pressure broadening are used to determine a value for the van der Waals interaction constant, C6. This is done using a detailed line modelling program which explicitly includes approximately 2000 rotational transition lines within the vibrational bands, in conjunction with atmospheric models calculated by the LUCIFER atmosphere modelling program. The isotopic shift of the vibrational and rotational lines is also included in the model to compare the detectability of various C-12 to C-13 ratios. The line models fit the observed spectra with varying degrees of accuracy. One star, WD0548-001, shows an unusually small pressure shift and broadening for the high pressures that the atmospheric model predicts. The results show that only in the hottest stars with the least pressure broadened lines in this study can the isotopic effect be seen. With the data available, the best limit on the C-12 to C-13 ratio is a minimum of 40 for WD0856 + 331. The models show that even for very high signal to noise data, the isotopic shift in the Swan bands in very cool white dwarfs would be difficult to separate from the pressure broadening effects. It is shown that the isotopic ratio is high enough to rule out the possibility that the carbon is a relic from previous CNO burning
The 12C/13C Isotopic Ratio in Planetary Nebulae as Deduced from IUE Data
Miskey, C. L.; Feibelman, W. A.; Bruhweiler, F. C.
2000-05-01
The relative abundances of C, N, and O and the isotopic ratio of 12C/13C represent tracers of nucleosynthesis in intermediate stars with main-sequence masses between 0.6 and 8.0 solar masses in our Galaxy. Determining these abundances and the isotopic 12C/13C ratio in planetary nebulae (PNe) represent perhaps the best means to discern exactly how the ISM is enriched by CNO stellar nucleosynthesis. Walsh et al. (1996) and Clegg et al. (1997), using the Hubble Space Telescope, have derived the isotopic 12C/13C abundance ratio in the galactic carbon-rich PN, NGC 3918, and placed marginal constraints on it for the Magellanic PNe, N2 (SMC) and N122 (LMC). This was done using the well-known 12C 3P-1S (J=1-0 and J=2-0) transitions of C+2 at 1906.68 Angstroms and 1908.77 Angstroms and a J=0-0 transition at 1909.6 Angstroms, which is strictly forbidden in 12C. The finite nuclear spin of 13C (I=1/2) permits a corresponding F=1/2-1/2 electric dipole transition not seen in 12C. Since the 1909.6 Angstroms line is well separated from the other two 12C transitions, it provides an important means of determining 12C/13C in planetary nebulae. We have just completed a search of archival International Ultraviolet Explorer (IUE) high-dispersion spectra of approximately three dozen PNe, and derived 12C/13C ratios of 39 and 23 for the galactic PNe, NGC 2440 and NGC 6302, respectively. These are values much lower than the solar value of 89. In the other objects, the limited S/N of the IUE data indicate 12C/13C ratio upper limits much higher than 50. The implications of these results and their pertinence to stellar evolution are discussed.
33 CFR 117.917 - Battery Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Battery Creek. 117.917 Section 117.917 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.917 Battery Creek. The draw of...
33 CFR 117.959 - Chocolate Bayou.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Chocolate Bayou. 117.959 Section 117.959 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.959 Chocolate Bayou. The draw of the Union...
32 CFR 724.117 - Discharge review.
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Discharge review. 724.117 Section 724.117 National Defense Department of Defense (Continued) DEPARTMENT OF THE NAVY PERSONNEL NAVAL DISCHARGE REVIEW BOARD Definitions § 724.117 Discharge review. A nonadversary administrative reappraisal at the level of...
33 CFR 117.457 - Houston River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Houston River. 117.457 Section 117.457 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Louisiana § 117.457 Houston River. The draw of the...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Rice Creek. 117.324 Section 117.324 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.324 Rice Creek. The CSX Railroad Swingbridge, mile...
33 CFR 117.231 - Brandywine Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Brandywine Creek. 117.231 Section 117.231 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Delaware § 117.231 Brandywine Creek. The draw of the...
Nizovtsev, A. P.; Kilin, S. Ya; Pushkarchuk, A. L.; Pushkarchuk, V. A.; Kuten, S. A.; Zhikol, O. A.; Schmitt, S.; Unden, T.; Jelezko, F.
2018-02-01
Single NV centers in diamond coupled by hyperfine interaction (hfi) to neighboring 13C nuclear spins are now widely used in emerging quantum technologies as elements of quantum memory adjusted to a nitrogen-vacancy (NV) center electron spin qubit. For nuclear spins with low flip-flop rate, single shot readout was demonstrated under ambient conditions. Here we report on a systematic search for such stable NV-13C systems using density functional theory to simulate the hfi and spatial characteristics of all possible NV-13C complexes in the H-terminated cluster C510[NV]-H252 hosting the NV center. Along with the expected stable ‘NV-axial-13C’ systems wherein the 13C nuclear spin is located on the NV axis, we found for the first time new families of positions for the 13C nuclear spin exhibiting negligible hfi-induced flipping rates due to near-symmetric local spin density distribution. Spatially, these positions are located in the diamond bilayer passing through the vacancy of the NV center and being perpendicular to the NV axis. Analysis of available publications showed that, apparently, some of the predicted non-axial near-stable NV-13C systems have already been observed experimentally. A special experiment performed on one of these systems confirmed the prediction made.
Turki, Abrar; Murthy, Gayathri; Ueda, Keiko; Cheng, Barbara; Giezen, Alette; Stockler-Ipsiroglu, Sylvia; Elango, Rajavel
2015-01-01
Phenylketonuria (PKU) is an autosomal recessive disorder caused by deficiency of hepatic phenylalanine hydroxylase (PAH) leading to increased levels of phenylalanine in the plasma. Phenylalanine levels and phenylalanine hydroxylase (PAH) activity monitoring are currently limited to conventional blood dot testing. 1-(13)C-phenylalanine, a stable isotope can be used to examine phenylalanine metabolism, as the conversion of phenylalanine to tyrosine occurs in vivo via PAH and subsequently releases the carboxyl labeled (13)C as (13)CO2 in breath. Our objective was to examine phenylalanine metabolism in children with PKU using a minimally-invasive 1-(13)C-phenylalanine breath test ((13)C-PBT). Nine children (7 M: 2 F, mean age 12.5 ± 2.87 y) with PKU participated in the study twice: once before and once after sapropterin supplementation. Children were provided 6 mg/kg oral dose of 1-(13)C-phenylalanine and breath samples were collected at 20 min intervals for a period of 2h. Rate of CO2 production was measured at 60 min post-oral dose using indirect calorimetry. The percentage of 1-(13)C-phenylalanine exhaled as (13)CO2 was measured over a 2h period. Prior to studying children with PKU, we tested the study protocol in healthy children (n = 6; 4M: 2F, mean age 10.2 ± 2.48 y) as proof of principle. Production of a peak enrichment (Cmax) of (13)CO2 (% of dose) in all healthy children occurred at 20 min ranging from 17-29% of dose, with a subsequent return to ~5% by the end of 2h. Production of (13)CO2 from 1-(13)C-phenylalanine in all children with PKU prior to sapropterin treatment remained low. Following sapropterin supplementation for a week, production of (13)CO2 significantly increased in five children with a subsequent decline in blood phenylalanine levels, suggesting improved PAH activity. Sapropterin treatment was not effective in three children whose (13)CO2 production remained unchanged, and did not show a reduction in blood phenylalanine levels and improvement
{sup 13}C-NMR studies on disulfide bond isomerization in bovine pancreatic trypsin inhibitor (BPTI)
Energy Technology Data Exchange (ETDEWEB)
Takeda, Mitsuhiro [Kumamoto University, Department of Structural BioImaging, Faculty of Life Sciences (Japan); Miyanoiri, Yohei [Nagoya University, Structural Biology Research Center, Graduate School of Science (Japan); Terauchi, Tsutomu [Tokyo Metropolitan University, Graduate School of Science and Engineering (Japan); Kainosho, Masatsune, E-mail: kainosho@tmu.ac.jp [Nagoya University, Structural Biology Research Center, Graduate School of Science (Japan)
2016-09-15
Conformational isomerization of disulfide bonds is associated with the dynamics and thus the functional aspects of proteins. However, our understanding of the isomerization is limited by experimental difficulties in probing it. We explored the disulfide conformational isomerization of the Cys14–Cys38 disulfide bond in bovine pancreatic trypsin inhibitor (BPTI), by performing an NMR line-shape analysis of its Cys carbon peaks. In this approach, 1D {sup 13}C spectra were recorded at small temperature intervals for BPTI samples selectively labeled with site-specifically {sup 13}C-enriched Cys, and the recorded peaks were displayed in the order of the temperature after the spectral scales were normalized to a carbon peak. Over the profile of the line-shape, exchange broadening that altered with temperature was manifested for the carbon peaks of Cys14 and Cys38. The Cys14–Cys38 disulfide bond reportedly exists in equilibrium between a high-populated (M) and two low-populated states (m{sub c14} and m{sub c38}). Consistent with the three-site exchange model, biphasic exchange broadening arising from the two processes was observed for the peak of the Cys14 α-carbon. As the exchange broadening is maximized when the exchange rate equals the chemical shift difference in Hz between equilibrating sites, semi-quantitative information that was useful for establishing conditions for {sup 13}C relaxation dispersion experiments was obtained through the carbon line-shape profile. With respect to the m{sub c38} isomerization, the {sup 1}H-{sup 13}C signals at the β-position of the minor state were resolved from the major peaks and detected by exchange experiments at a low temperature.
Anttila, Matthew; Strangman, Wendy; York, Robert; Tomas, Carmelo; Wright, Jeffrey L C
2016-03-25
Understanding the biosynthesis of dinoflagellate polyketides presents many unique challenges. Because of the remaining hurdles to dinoflagellate genome sequencing, precursor labeling studies remain the only viable way to investigate dinoflagellate biosynthesis. However, prior studies have shown that polyketide chain assembly does not follow any of the established processes. Additionally, acetate, the common precursor for polyketides, is frequently scrambled, thus compromising interpretation. These factors are further compounded by low production yields of the compounds of interest. A recent report on the biosynthesis of spirolides, a group belonging to the growing class of toxic spiroimines, provided some insight into the polyketide assembly process based on acetate labeling studies, but many details were left uncertain. By feeding (13)C methyl-labeled methionine to cultures of Alexandrium ostenfeldii, the producing organism of 13-desmethylspirolide C, and application of the odd-even methylation rule, the complete biosynthetic pathway has been established.
33 CFR 117.309 - Nassau Sound.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Nassau Sound. 117.309 Section 117.309 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.309 Nassau Sound. The draw of the Fernandina Port...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake Creek. 117.331 Section 117.331 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.331 Snake Creek. The draw of the Snake Creek...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cow Bayou. 117.965 Section 117.965 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.965 Cow Bayou. The draws of the Orange County...
33 CFR 117.263 - Banana River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Banana River. 117.263 Section 117.263 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.263 Banana River. (a) The draw of the Mathers (SR...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Test animals. 117.4 Section 117.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS ANIMALS AT LICENSED ESTABLISHMENTS § 117.4...
33 CFR 117.861 - Blind Slough.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Blind Slough. 117.861 Section 117.861 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Oregon § 117.861 Blind Slough. The draws of the Portland and...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Fox River. 117.1087 Section 117.1087 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1087 Fox River. (a) The draws of the Canadian...
33 CFR 117.987 - Taylor Bayou.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Bayou. 117.987 Section 117.987 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Texas § 117.987 Taylor Bayou. The draws of the Union Pacific...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Bear Creek. 117.543 Section 117.543 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Maryland § 117.543 Bear Creek. (a) The draws of the Baltimore...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Mud Slough. 117.177 Section 117.177 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.177 Mud Slough. The draw of the Union Pacific...
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Root River. 117.1095 Section 117.1095 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Wisconsin § 117.1095 Root River. (a) The draw of the Main Street...
33 CFR 117.925 - Cooper River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.925 Section 117.925 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements South Carolina § 117.925 Cooper River. The draw of the Seaboard...
33 CFR 117.713 - Cooper River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Cooper River. 117.713 Section 117.713 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements New Jersey § 117.713 Cooper River. (a) The drawspans for the...
International Nuclear Information System (INIS)
Rodrigues, M. R. D.; Borello-Lewin, T.; Horodynski-Matsushigue, L. B.; Duarte, J. L. M.; Rodrigues, C. L.; Souza, M. A.; Miyake, H.; Cunsolo, A.; Cappuzzello, F.; Ukita, G. M.
2011-01-01
The 9 Be( 6 Li,d) 13 C reaction was used to investigate alpha resonant states in 13 C up to 15 MeV of excitation. The reaction was measured at a bombarding energy of 25.5 MeV employing the Sao Paulo Pelletron-Enge-Spectrograph facility and the nuclear emulsion detection technique. An energy resolution of 50 keV was obtained. Several narrow alpha resonant states not previously measured were detected, in particular the one at the (3α+n) threshold populated by an L = 2 transfer, revealing a 9 Be+α component for the 1/2 - cluster state candidate at this threshold. Experimental angular distributions are presented in comparison with DWBA predictions.
5 CFR 2606.207 - Accounting of disclosures.
2010-01-01
... 5 Administrative Personnel 3 2010-01-01 2010-01-01 false Accounting of disclosures. 2606.207... ACT RULES Access to Records and Accounting of Disclosures § 2606.207 Accounting of disclosures. (a... accounting of disclosures will be retained for at least five years or for the life of the record, whichever...
Preparation of 15N-13C-fulminic acid
International Nuclear Information System (INIS)
Wilmes, R.; Winnewisser, M.
1993-01-01
The precursor for the title compound was prepared in a three-step synthesis. The 13 C-label was incorporated in the first step employing 2- 13 C-ethyl acetate and the 15 N-label in the last step, using 15 N-sodium nitrite. Upon pyrolysis the precursor forms three fragments, one of them being the title compound. (Author)
13C/14C dual isotope breath test measurement of gastric emptying in normal subjects and patients
International Nuclear Information System (INIS)
Chew, G.; Bartholomeusz, F.D.L.; Bellon, M.; Chatterton, B.E.
2000-01-01
Full text: A more flexible alternative to dual isotope scintigraphy for gastric emptying involves measuring breath C0 2 after administration of absorbable tracers. Method: six patients were given 100g hamburger labelled with 25 MBq 99 Tc m sulphur colloid and 74 KBq 14 C octanoic acid, and 150 ml 10% glucose drink labelled with 8 MBq 67 Ga citrate and ISO mg 13 C acetate and seven normals with 14 C and 13 C labels only. Breath was collected at baseline and then regularly for four hours. The 14 CO 2 and 13 CO 2 activity was measured with liquid scintillation counting and mass spectroscopy. The times to maximum 14 CO 2 , and 13 CO 2 , T max, were determined. Results: Comparison was made between 14 CO 2 T max with scintigraphic retention of 99 Tc m at 100 minutes (SR100m) and 13 CO 2 T max with the scintigraphic half-clearance time of 67 Ga (scint T1/2). In conclusion 14 CO 2 T max and 13 CO 2 T max correlate significantly with SR100m and scint T1/2 respectively. The normal threshold is between 165 and 180 minutes for 14 Co 2 T max; probably > 40 minutes for 13 CO 2 T max but overlap exists between normal and abnormal results in this small preliminary study. Recruitment is to continue to better define normal ranges. Copyright (2000) The Australian and New Zealand Society of Nuclear Medicine Inc
Rubino, Mauro; Milin, Sylvie; D'Onofrio, Antonio; Signoret, Patrick; Hatté, Christine; Balesdent, Jérôme
2014-01-01
In this study, we evaluated trimethylsilyl (TMS) derivatives as derivatization reagents for the compound-specific stable carbon isotope analysis of soil amino acids by gas chromatography-combustion-isotope ratio mass spectrometry (GC-C-IRMS). We used non-proteinogenic amino acids to show that the extraction-derivatization-analysis procedure provides a reliable method to measure δ(13)C values of amino acids extracted from soil. However, we found a number of drawbacks that significantly increase the final total uncertainty. These include the following: production of multiple peaks for each amino acid, identified as di-, tri- and tetra-TMS derivatives; a number of TMS-carbon (TMS-C) atoms added lower than the stoichiometric one, possibly due to incomplete combustion; different TMS-C δ(13)C for di-, tri- and tetra-TMS derivatives. For soil samples, only four amino acids (leucine, valine, threonine and serine) provide reliable δ(13)C values with a total average uncertainty of 1.3 ‰. We conclude that trimethylsilyl derivatives are only suitable for determining the (13)C incorporation in amino acids within experiments using (13)C-labelled tracers but cannot be applied for amino acids with natural carbon isotope abundance until the drawbacks described here are overcome and the measured total uncertainty significantly decreased.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.385 Section 117.385 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Idaho § 117.385 Snake River. The drawspan of the U.S. 12 bridge...
14 CFR 415.117 - Ground safety.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Ground safety. 415.117 Section 415.117... TRANSPORTATION LICENSING LAUNCH LICENSE Safety Review and Approval for Launch of an Expendable Launch Vehicle From a Non-Federal Launch Site § 415.117 Ground safety. (a) General. An applicant's safety review...
28 CFR 11.7 - Salary adjustments.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Salary adjustments. 11.7 Section 11.7 Judicial Administration DEPARTMENT OF JUSTICE DEBT COLLECTION Administration of Debt Collection § 11.7 Salary adjustments. The following debts shall not be subject to the salary offset procedures of § 11.8...
33 CFR 117.335 - Taylor Creek.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Taylor Creek. 117.335 Section 117.335 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Florida § 117.335 Taylor Creek. The draw of US441 bridge, mile 0...
Species specific and environment induced variation of δ13C and δ15N in alpine plants
Directory of Open Access Journals (Sweden)
Yang eYang
2015-06-01
Full Text Available Stable carbon and nitrogen isotope signals in plant tissues integrate plant-environment interactions over long periods. In this study, we hypothesized that humid alpine life conditions are narrowing the scope for significant deviations from common carbon, water and nitrogen relations as captured by stable isotope signals. We explored the variation in δ13C and δ15N in 32 plant species from tissue type to ecosystem scale across a suite of locations at c. 2500 m elevation in the Swiss Alps. Foliar δ13C and δ15N varied among species by about 3-4 ‰ and 7-8 ‰ respectively. However, there was no overall difference in means of δ13C and δ15N for species sampled in different plant communities or when bulk plant dry matter harvests of different plant communities were compared. δ13C was found to be highly species specific, so that the ranking among species was mostly maintained across 11 habitats. However, δ15N varied significantly from place to place in all species (a range of 2.7 ‰ except in Fabaceae (Trifolium alpinum and Juncaceae (Luzula lutea. There was also a substantial variation among individuals of the same species collected next to each other. No difference was found in foliar δ15N of non-legumes, which were either collected next to or away from the most common legume, T. alpinum. δ15N data place Cyperaceae and Juncaceae, just like Fabaceae, in a low discrimination category, well separated from other families. Soil δ15N was higher than in plants and increased with soil depth. The results indicate a high functional diversity in alpine plants that is similar to that reported for low elevation plants. We conclude that the surprisingly high variation in δ13C and δ15N signals in the studied high elevation plants is largely species specific (genetic and insensitive to obvious environmental cues.
13C Kinetic isotopic effect of polymerization on monomers with multiple bond
International Nuclear Information System (INIS)
Berman, E.L.; Polyakov, V.B.; Makovetskij, K.L.; Golenko, T.G.; Galimov, Eh.M.; AN SSSR, Moscow. Inst. Organicheskoj Khimii; AN SSSR, Moscow. Inst. Geokhimii i Analiticheskoj Khimii)
1988-01-01
13 C kinetic isotopic effect (KIE) of anionic and radical polymerization and metathesis reaction of monomers with multiple bonds are studied and correlation between the found KIE values of polymerization and the structure of transition state is established. 13 C KIE of polymerization reactions are investigated using monomers with natural content of the isotope. Polymerization was carried out using high-vacuum equipment: radical polymerization of methyl acrylate (MA) and vinyl acetate in benzene solution under the effect of benzoyl peroxide (60 deg C); anionic polymerization of MA, initiated by potassium butyl cellosolvolate, was realized in mass at 25 deg C; cyclopentene metathesis reaction was conducted in benzene under the effect of initiating system WCl 6 - (C 3 H 5 ) 2 Si(CH 3 ) 2 at -30 deg C; phenylacetylene polymers were prepared by polymerization in benzene solution at 20 deg C under the effect of WCl 6 . It is ascertained that 13 C KIE of radical and anionic polymerization of olefins and cycloolefin metathesis constitutes 2.0 -2.4%. Polymerization of compound with ternary bond is accompanied by a lower value of 13 C KIE (<1%), which is explained by double bond of reacting bond in transition state
DEFF Research Database (Denmark)
Brekke, Eva Marie; Walls, Anne Byriel; Schousboe, Arne
2012-01-01
is known about the PPP in neurons. The activity of the PPP was quantified in cultured cerebral cortical and cerebellar neurons after incubation in the presence of [2-(13)C]glucose or [3-(13)C]glucose. The activity of the PPP was several fold lower than glycolysis in both types of neurons. While metabolism...
1H-NMR/13C-NMR studies of branched structures in PVC obtained at atmospheric pressure
International Nuclear Information System (INIS)
Braun, D.; Holzer, G.; Hjertberg, T.
1981-01-01
The 1 H-NMR-spectra of raw poly (vinyl cloride) obtained at atmospheric pressure (U-PVC) have revealed the presence of high concentrations of branches. The content of labile chlorine was determined by reaction with phenole in order to estimate the branch points with tertiary chlorine. The branch length of reductively dehalogenated U-PVC by 13 C-NMR analysis have provided evidence for both short chain branches including chloromethyl groups and 2.4-dichloro-n-butyl groups and long chain branching. For a number of U-polymers the total amount of branching ranges from 7.5 to 13.5/1000 C. The 13 C-NMR measurements point to a ratio of methyl/butyl branches of 1:1 and short chains/long chains of 6:1. (orig.)
Clinical study of FT-207 suppository for head and neck malignancies
International Nuclear Information System (INIS)
Tomioka, Masashi; Usami, Masami; Sakamoto, Ayako
1982-01-01
Futraful suppository 1.5g per day was administered to 33 patients with head and neck malignancies. Among 33 cases which entered into the study, 16 cases were evaluated. Out of 16 evaluable cases, complete responses (CRs) were obtained in 4 cases and partial responses (PRs) in 7 cases. An overall response rate including 4 CRs and 7 PRs was 68.8%. Side effects due to FT-207 suppository were developed in 14 cases out of 33 patients (42.4%) Side effects such as anal pain, anorexia, diarrhea, pigmentation, exanthema and nail change were observed. No severe side effect was encountered. (author)
33 CFR 117.1058 - Snake River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Snake River. 117.1058 Section 117... OPERATION REGULATIONS Specific Requirements Washington § 117.1058 Snake River. (a) The draw of the Burlington Northern Santa Fe railroad bridge across the Snake River at mile 1.5 between Pasco and Burbank is...
33 CFR 117.537 - Townsend Gut.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Townsend Gut. 117.537 Section 117... OPERATION REGULATIONS Specific Requirements Maine § 117.537 Townsend Gut. The draw of the Southport (SR27) Bridge, at mile 0.7, across Townsend Gut between Boothbay Harbor and Southport, Maine shall open on...
Galactose oxidation using 13C in healthy and galactosemic children
Directory of Open Access Journals (Sweden)
D.R. Resende-Campanholi
2015-03-01
Full Text Available Galactosemia is an inborn error of galactose metabolism that occurs mainly as the outcome of galactose-1-phosphate uridyltransferase (GALT deficiency. The ability to assess galactose oxidation following administration of a galactose-labeled isotope (1-13C-galactose allows the determination of galactose metabolism in a practical manner. We aimed to assess the level of galactose oxidation in both healthy and galactosemic Brazilian children. Twenty-one healthy children and seven children with galactosemia ranging from 1 to 7 years of age were studied. A breath test was used to quantitate 13CO2 enrichment in exhaled air before and at 30, 60, and 120 min after the oral administration of 7 mg/kg of an aqueous solution of 1-13C-galactose to all children. The molar ratios of 13CO2 and 12CO2 were quantified by the mass/charge ratio (m/z of stable isotopes in each air sample by gas-isotope-ratio mass spectrometry. In sick children, the cumulative percentage of 13C from labeled galactose (CUMPCD in the exhaled air ranged from 0.03% at 30 min to 1.67% at 120 min. In contrast, healthy subjects showed a much broader range in CUMPCD, with values from 0.4% at 30 min to 5.58% at 120 min. The study found a significant difference in galactose oxidation between children with and without galactosemia, demonstrating that the breath test is useful in discriminating children with GALT deficiencies.
Varelis, P; Jeskelis, R
2008-10-01
For the determination of melamine and cyanuric acid the labelled internal standards [(13)C(3)]-melamine and [(13)C(3)]-cyanuric acid were synthesized using the common substrate [(13)C(3)]-cyanuric chloride by reaction with ammonia and acidified water, respectively. Standards with excellent isotopic and chemical purities were obtained in acceptable yields. These compounds were used to develop an isotope dilution liquid chromatography/mass spectrometry (LC/MS) method to determine melamine and cyanuric acid in catfish, pork, chicken, and pet food. The method involved extraction into aqueous methanol, liquid-liquid extraction and ion exchange solid phase clean-up, with normal phase high-performance liquid chromatography (HPLC) in the so-called hydrophilic interaction mode. The method had a limit of detection (LOD) of 10 microg kg(-1) for both melamine and cyanuric acid in the four foods with a percentage coefficient of variation (CV) of less than 10%. The recovery of the method at this level was in the range of 87-110% and 96-110% for melamine and cyanuric acid, respectively.
Study of ketone body kinetics in children by a combined perfusion of 13C and 2H3 tracers
International Nuclear Information System (INIS)
Bougneres, P.F.; Ferre, P.
1987-01-01
Ketone body kinetics were quantified in six children (3-5 yr old), who were fasted for 13-22 h, by a combined perfusion of [3- 13 C]acetoacetate ([ 13 C]AcAc) and D-(-)-beta-[4,4,4- 2 H3]hydroxybutyrate (beta-[ 2 H3]OHB) and gas chromatography-mass spectrometry analysis. Results were analyzed according to the single-pool (combined enrichments) or the two-accessible pools models. After 20-22 h of fasting, ketone body turnover rate was 30-50 mumol.kg-1.min-1, a rate achieved after several days of fasting in adults. At low ketosis, acetoacetate was the ketone body preferentially synthesized de novo and utilized irreversibly. When ketosis increased, acetoacetate irreversible disposal was not enhanced, since it was largely converted into beta-OHB, whereas beta-OHB irreversible disposal was very much increased. The single-pool and two-pool models gave similar ketone body turnover rates when [ 13 C]AcAc was the tracer, whereas the use of beta-[ 2 H3]OHB gave some more divergent results, especially at low ketosis. These studies demonstrate that ketogenesis is very active in short-term fasted children and that the use of a combined infusion of [ 13 C]AcAc and beta-[ 2 H3]OHB is a convenient way to give insight into individual ketone body kinetics
42 CFR 435.117 - Newborn children.
2010-10-01
... 42 Public Health 4 2010-10-01 2010-10-01 false Newborn children. 435.117 Section 435.117 Public..., Children Under 8, and Newborn Children § 435.117 Newborn children. (a) The agency must provide Medicaid eligibility to a child born to a woman who has applied for, has been determined eligible and is receiving...
Charm production in 400 GeV/c proton-emulsion interactions
International Nuclear Information System (INIS)
Aziz, T.; Daniel, R.R.; Ganguli, S.N.; Gurtu, A.; Malhorta, P.K.; Aggarwal, M.M.; Beri, S.B.; Bhatia, V.S.; Mittra, I.S.; Singh, G.
1982-01-01
5032 proton-emulsion interactions at 400 GeV/c momentum have been carefully scrutinized for production and decay of charged charm particles. In order to detect these decays, shower tracks from 3056 stars have been followed to a maximum length of 1 mm and those from 1976 stars up to 2 mm. A total of 23 three-prong charm-like candidates have been recorded in the forward cone. The background due to γ-overlap on a shower track, trident:pseudo-trident production and secondary interactions is estimated to be 15. Attributing the signal of 8 events to Λ + sub(c) and assuming the branching ratio of Λ + sub(X) → 3 prong to be 0.6 and tausub(lambdac) to be 10 -13 sec we obtain the production cross section to be 106 +- 39 μb/nucleon. Out of these 8 events one example of semileptonic decay of Λ + sub(c) is seen. (orig.)
Synthesis of 13N and/or 11C single or doubly labelled urea
International Nuclear Information System (INIS)
Emran, A.M.
1989-01-01
Utilization of nitrogen by plants encounters two important problems which are denitrification and deficiency or inactivation of certain enzyme. In the first process the fertilizer is affected by certain bacteria to produce nitrogen or its oxides which cannot be utilized by plants. In the second process, transformation of urea nitrogen into forms usable by plants depends on abundance and activity of the enzyme urease. Study of inorganic nitrogen transport has been underway using 13 N-nitrate as a tracer. Behavior of organic nitrogen can be studied using labelled urea. [ 13 N] and/or [ 11 C] single or doubly labelled urea are good tracers for this purpose. Reaction of trace amounts of potassium cyanate with 13 N-ammonium sulfate produced 13 N-ammonium cyanate which was thermally transformed into [ 13 N]-urea with no added carrier. Similarly, [ 11 C]-potassium cyanate reacted with 13 N-ammonium sulfate to produce 13 N/ 11 C-doubly labelled urea. Thin layer and high performance liquid chromatography were used to identify the products and determine the yields
Charest, Mathieu; Bélair, Marc-André
2017-06-01
Helicobacter pylori infection is the leading cause of peptic ulcer disease. The purpose of this study was, first, to assess the difference in the distribution of negative versus positive results between the older 14 C-urea breath test and the newer 13 C-urea breath test and, second, to determine whether use of an indeterminate-results category is still meaningful and what type of results should trigger repeated testing. Methods: A retrospective survey was performed of all consecutive patients referred to our service for urea breath testing. We analyzed 562 patients who had undergone testing with 14 C-urea and 454 patients who had undergone testing with 13 C-urea. Results: In comparison with the wide distribution of negative 14 C results, negative 13 C results were distributed farther from the cutoff and were grouped more tightly around the mean negative value. Distribution analysis of the negative results for 13 C testing, compared with those for 14 C testing, revealed a statistically significant difference between the two. Within the 13 C group, only 1 patient could have been classified as having indeterminate results using the same indeterminate zone as was used for the 14 C group. This is significantly less frequent than what was found for the 14 C group. Discussion: Borderline-negative results do occur with 13 C-urea breath testing, although less frequently than with 14 C-urea breath testing, and we will be carefully monitoring differences falling between 3.0 and 3.5 %Δ. 13 C-urea breath testing is safe and simple for the patient and, in most cases, provides clearer positive or negative results for the clinician. © 2017 by the Society of Nuclear Medicine and Molecular Imaging.
Energy Technology Data Exchange (ETDEWEB)
Boutin, D.
2005-08-01
The first experimental observation of bound-state beta-decay showed, that due solely to the electron stripping, a stable nuclide, e.g. {sup 163}Dy, became unstable. Also a drastic modification of the half-life of bare {sup 187}Re, from 4.12(2) x 10{sup 10} years down to 32.9(20) years, could be observed. It was mainly due to the possibility for the mother nuclide to decay into a previously inaccessible nuclear level of the daughter nuclide. It was proposed to study a nuclide where this decay mode was competing with continuum-state beta-decay, in order to measure their respective branchings. The ratio {beta}{sub b}/{beta}{sub c} could also be evaluated for the first time. {sup 207}Tl was chosen due to its high atomic number, and Q-value of about 1.4 MeV, small enough to enhance the {beta}{sub b} probability and large enough to allow the use of time-resolved Schottky Mass Spectrometry (SMS) to study the evolution of mother and bound-state beta-decay daughter ions. The decay properties of the ground state and isomeric state of {sup 207}Tl{sup 81+} have been investigated at the GSI accelerator facility in two separate experiments. For the first time {beta}-decay where the electron could go either to a bound state (atomic orbitals) and lead to {sup 207}Pb{sup 81+} as a daughter nuclide, or to a continuum state and lead to {sup 207}Pb{sup 82+}, has been observed. The respective branchings of these two processes could be measured as well. The deduced total nuclear half-life of 255(17) s for {sup 207}Tl{sup 81+}, was slightly modified with respect to the half-life of the neutral atom of 286(2) s. It was nevertheless in very good agreement with calculations based on the assumption that the beta-decay was following an allowed type of transition. The branching {beta}{sub b}/{beta}{sub c}=0.192(20), was also in very good agreement with the same calculations. The application of stochastic precooling allowed to observe in addition the 1348 keV short-lived isomeric state of {sup
International Nuclear Information System (INIS)
Rana, J.; Robins, D.J.
1985-01-01
The labelling patterns in (+)-lupanine, (+)-13-hydroxylupanine, and (+)-angustifoline derived biosynthetically from [1-amino- 15 N,1- 13 C]-1,5-diaminopentane (cadaverine) have been established by 13 C n.m.r. spectroscopy. Three cadaverine units are incorporated to about the same extent into each of these three alkaloids. The presence of two doublets due to 13 C- 15 N coupling in the 13 C brace 1 H brace n.m.r. spectra associated with C-2 and C-15 of lupanine and 13-hydroxylupanine, and one 13 C- 15 N doublet at C-2 of angustifoline, indicate that two of the cadaverine units are converted into the outer rings of the tetracyclic quinolizidine alkaloids in a specific fashion. (author)
International Nuclear Information System (INIS)
Inbar, L.; Lapidot, A.
1988-01-01
Recent studies have suggested that the onset of synthesis of actinomycin D in Streptomyces is due to a release from L-glutamate catabolic repression. In the present investigation we showed that S. parvulus has the capacity to maintain high levels of intracellular glutamate during the synthesis of actinomycin D. The results seem contradictory, since actinomycin D synthesis cannot start before a release from L-glutamate catabolic repression, but a relatively high intracellular pool of glutamate is needed for the synthesis of actinomycin D. Utilizing different labeled precursors, D-[U- 13 C]fructose and 13 C- and 15 N-labeled L-glutamate, and nuclear magnetic resonance techniques, we showed that carbon atoms of an intracellular glutamate pool of S. parvulus were not derived biosynthetically from the culture medium glutamte source but rather from D-fructose catabolism. A new intracellular pyrimidine derivative whose nitrogen and carbon skeletons were derived from exogenous L-glutamate was obtained as the main glutamate metabolite. Another new pyrimidine derivative that had a significantly reduced intracellular mobility and that was derived from D-fructose catabolism was identified in the cell extracts of S. parvulus during actinomycin D synthesis. These pyrimidine derivatives may serve as a nitrogen store for actinomycin D synthesis. In the present study, the N-trimethyl group of a choline derivative was observed by 13 C nuclear magnetic resonance spectroscopy in growing S. parvulus cells. The choline group, as well as the N-methyl groups of sarcosine, N-methyl-valine, and the methyl groups of an actinomycin D chromophore, arose from D-fructose catabolism. The 13 C enrichments found in the peptide moieties of actinomycin D were in accordance with a mechanism of actinomycin D synthesis from L-glutamate and D-fructose
Joseph, Jobin; Külls, Christoph
2014-05-01
The δ13C and δ18O of CO2 has enormous potential as tracers to study and quantify the interaction between the water and carbon cycles. Isotope ratio mass spectrometry (IRMS) being the conventional method for stable isotopic measurements, has many limitations making it impossible for deploying them in remote areas for online or in-situ sampling. New laser based absorption spectroscopy approaches like Cavity Ring Down Spectroscopy (CRDS) and Integrated Cavity Output Spectroscopy (ICOS) have been developed for online measurements of stable isotopes at an expense of considerably less power requirement but with precision comparable to IRMS. In this research project, we introduce a new calibration system for an Off- Axis ICOS (Los Gatos Research CCIA-36d) for a wide range of varying concentrations of CO2 (800ppm - 25,000ppm), a typical CO2 flux range at the plant-soil continuum. The calibration compensates for the concentration dependency of δ13C and δ18O measurements, and was performed using various CO2 standards with known CO2 concentration and δC13 and δO18 values. A mathematical model was developed after the calibration procedure as a correction factor for the concentration dependency of δ13C and δ18O measurements. Temperature dependency of δ13C and δ18O measurements were investigated and no significant influence was found. Simultaneous calibration of δ13C and δ18O is achieved using this calibration system with an overall accuracy of (~ 0.75±0.24 ‰ for δ13C, ~ 0.81 ±0.26‰ for δ18O). This calibration procedure is found to be appropriate for making Off-Axis ICOS suitable for measuring CO2 concentration and δ13C and δ18O measurements at atmosphere-plant-soil continuum.
A 13C NMR Study of 7-Norbornadienyl Cation by Modified Hammett-Brown Equation
International Nuclear Information System (INIS)
Park, Jeong Kyu; Shin, Jung Hyu
1999-01-01
A series of the para-substituted 7-aryl-norbornadienyl cation (3) was prepared in FSO 3 H/SO 2 ClF solution at -100 .deg. C and their 13 C NMR shifts were measured at -80 .deg. C. The plots of the chemical shifts (changes in chemical shifts) of cationic carbon, Δδ C+ , against our calculated new substituent constant, σ c+ s, gave an excellent correlation (r = 0.994), with a p c+ value of 12.63. These results indicate that the new substituent onstants, σ c+ s, can be successfully employed to compare the relative charge demand of the carbonium ion by π- and πσ-participation
The 12C/13C ratio in stellar atmospheres. VI. Five luminous cool stars
International Nuclear Information System (INIS)
Hinkle, K.H.; Lambert, D.L.; Snell, R.L.
1976-01-01
The isotopic abundance ratio, 12 C/ 13 C, is derived from the CO vibration rotation lines at 1.6 and 2.3 μ for five cool luminous stars by a simple curve-of-growth technique. A new analysis of CN lines at 8000 A is also described for α Sco and α Ori. Results derived independently from CO and CN are in agreement. Final results are 12 C/ 13 C=7 +- 2(α Ori), 12 +- 3(α Sco), 7 +- 3(β Peg), 25 +- 7(chi Cyg), 17 +- 4(α Her), and 7 +- 1.5(α Boo). The α Boo analysis provides a check on the CO curve-of-growth technique; the 12 C/ 13 C ratio from the 2.3 μ CO lines is in good agreement with the previously determined ratio from CN and CH lines
Sugiura, Tomoko; Kawaguchi, Yasushi; Goto, Kanako; Hayashi, Yukiko; Gono, Takahisa; Furuya, Takefumi; Nishino, Ichizo; Yamanaka, Hisashi
2014-01-01
Accumulating evidence has shown that several non-HLA genes are involved in the susceptibility to polymyositis/dermatomyositis. This study aimed to investigate the involvement of C8orf13-BLK, one of the strongest candidate genes for autoimmune diseases, in susceptibility to polymyositis/dermatomyositis in the Japanese population. A possible gene-gene interaction between C8orf13-BLK and STAT4, which we recently showed to be associated with Japanese polymyositis/dermatomyositis, was also analyzed. A single-nucleotide polymorphism in C8orf13-BLK (dbSNP ID: rs13277113) was investigated in the Japanese population using a TaqMan assay in 283 polymyositis patients, 194 dermatomyositis patients, and 656 control subjects. The C8orf13-BLK rs13277113A allele was associated with overall polymyositis/dermatomyositis (Prs7574865 T alleles had an additive effect on polymyositis/dermatomyositis susceptibility. The strongest association was observed in dermatomyositis, with an OR of 3.07 (95% CI; 1.57-6.02) for the carriers of four risk alleles at the two SNP sites, namely, rs1327713 and rs7574865. This study established C8orf13-BLK as a new genetic susceptibility factor for polymyositis/dermatomyositis. Both C8orf13-BLK and STAT4 exert additive effects on disease susceptibility. These observations suggested that C8orf13-BLK, in combination with STAT4, plays a pivotal role in creating genetic susceptibility to polymyositis/dermatomyositis in Japanese individuals.
Energy Technology Data Exchange (ETDEWEB)
Enkovich, P. V., E-mail: enkovich@hppi.troitsk.ru; Brazhkin, V. V.; Lyapin, S. G.; Novikov, A. P. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation); Kanda, H. [National Institute for Materials Science (Japan); Stishov, S. M. [Russian Academy of Sciences, Troitsk, Institute for High-Pressure Physics (Russian Federation)
2016-09-15
The Raman scattering by isotopically pure {sup 12}C and {sup 13}C diamond single crystals and by isotopically mixed {sup 12.5}C diamond single crystals is studied at a high accuracy. The studies are performed over a wide pressure range up to 73 GPa using helium as a hydrostatic pressure-transferring medium. It is found that the quantum effects, which determine the difference between the ratio of the Raman scattering frequencies in the {sup 12}C and {sup 13}C diamonds and the classical ratio (1.0408), increase to 30 GPa and then decrease. Thus, inversion in the sign of the quantum contribution to the physical properties of diamond during compression is detected. Our data suggest that the maximum possible difference between the bulk moduli of the {sup 12}C and {sup 13}C diamonds is 0.15%. The investigation of the isotopically mixed {sup 12.5}C diamond shows that the effective mass, which determines the Raman frequency, decreases during compression from 12.38 au at normal pressure to 12.33 au at 73 GPa.
Interaction of pepsin-[C16mim]Br system: interfacial dilational rheology and conformational studies.
Huang, Tian; Cao, Chong; Liu, Zi-lin; Li, Yang; Du, Feng-pei
2014-09-21
The interfacial rheological property is closely related to the stabilities of foams and emulsions, yet there have been limited studies on the interaction between proteins with ionic liquid-type imidazolium surfactants at the decane-water interface as well as in the bulk. Herein, we investigated the interfacial and bulk properties of pepsin (PEP) and an ionic liquid (IL), 1-hexadecyl-3-methylimidazolium bromide, [C(16)mim]Br. The interfacial pressure and dilational rheology studies were performed to describe the formation of [C(16)mim]Br-pepsin complexes. The influence of the oscillating frequency and the bulk concentration of [C(16)mim]Br on the dilational properties were explored. The conformational changes were studied by monitoring the fluorescence and far UV-CD spectra. The results reveal that the globular structure of pepsin is one of the decisive factors controlling the nature of the interfacial film. The monotonous increase in the dilational elastic modulus of pepsin-[C(16)mim]Br solutions with the surface age indicates that no loops and tails had formed. Interestingly, with an increase in the concentration of [C(16)mim]Br, the εd-c curve first passes through a plateau value due to steric hindrance and the electrostatic barrier of already absorbed tenacious pepsin-[C(16)mim]Br complexes. With the further addition of [C(16)mim]Br, the remarkable decrease in dilational elastic modulus indicates that the compact structure is destroyed gradually. The results of the fluorescence spectra and far UV-CD spectra confirm that [C(16)mim]Br did not produce perceptible changes in pepsin at the concentrations studied in the dilational experiment. Possible schematic programs of the pepsin-[C(16)mim]Br interaction model at the interface and in bulk phase are proposed.
Migration and deposition of 13C in the full-tungsten ASDEX Upgrade tokamak
International Nuclear Information System (INIS)
Hakola, A; Aho-Mantila, L; Groth, M; Kurki-Suonio, T; Makkonen, T; Likonen, J; Koivuranta, S; Krieger, K; Mayer, M; Mueller, H W; Neu, R; Rohde, V
2010-01-01
The migration of carbon in low-density, low-confinement plasmas of ASDEX Upgrade was studied by injecting 13 C into the main chamber of the torus at the end of the 2007 experimental campaign. A selection of standard tungsten-coated lower-divertor and main-chamber tiles as well as a complete set of lower-divertor tiles with an uncoated poloidal marker stripe were removed from one poloidal cross section and analysed using secondary ion mass spectrometry. The poloidal deposition profiles of 13 C on both the tungsten-coated tiles and on the uncoated graphite areas of the marker tiles were measured and compared. For the W-coated lower-divertor tiles, 13 C was deposited mainly on the high-field side tiles, while barely detectable amounts of 13 C were observed on low-field side samples. In contrast, on the uncoated marker stripes the deposition was equally pronounced in the high-field and low-field side divertor. The marker-tile results are in agreement with those obtained from graphite tiles after the 2003 and 2005 13 C experiments in ASDEX Upgrade. In the case of W-coated tiles, the 13 C measurements were complemented by determining the total amount of deposited carbon ( 12 C) on the tiles, which also shows strong deposition at the inner parts of the lower divertor. The estimated deposition of 13 C on W at the divertor areas was less than 1.5% of the injected amount of 13 C atoms. The 13 C analyses of the main-chamber tiles and small silicon samples mounted in remote areas revealed significant deposition in the upper divertor, in upper parts of the heat shield, in the limiter region close to the injection valve, and below the roof baffle. Approximately 8% of the injected 13 C is estimated to have accumulated in these regions. Possible reasons for the different deposition patterns on W and on graphite in different regions of the torus are discussed.
DEFF Research Database (Denmark)
Mishkovsky, Mor; Anderson, Brian; Karlsson, Magnus
2017-01-01
The mammalian brain relies primarily on glucose as a fuel to meet its high metabolic demand. Among the various techniques used to study cerebral metabolism, C-13 magnetic resonance spectroscopy (MRS) allows following the fate of C-13-enriched substrates through metabolic pathways. We herein...... glucose is split into 3-carbon intermediates by aldolase. This unique method allows direct detection of glycolysis in vivo in the healthy brain in a noninvasive manner....... demonstrate that it is possible to measure cerebral glucose metabolism in vivo with sub-second time resolution using hyperpolarized C-13 MRS. In particular, the dynamic C-13-labeling of pyruvate and lactate formed from C-13-glucose was observed in real time. An ad-hoc synthesis to produce [2,3,4,6,6-H-2(5), 3...
34 CFR 682.207 - Due diligence in disbursing a loan.
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Due diligence in disbursing a loan. 682.207 Section 682.207 Education Regulations of the Offices of the Department of Education (Continued) OFFICE OF... § 682.207 Due diligence in disbursing a loan. (a)(1) This section prescribes procedures for lenders to...
Near-degeneracy in Excited Vibrational States of 207PbF
Mawhorter, Richard; Nguyen, Alexander; Kim, Yongrak; Biekert, Andreas; Sears, Trevor; Grabow, Jens-Uwe; Kudashov, A. D.; Skripnikov, L. V.; Titov, A. V.; Petrov, A. N.
2017-04-01
High-resolution Fourier transform microwave (FTMW) spectroscopy studies of 207PbF have demonstrated the near-degeneracy of two levels of opposite parity. These have attracted attention for the study of parity violation effects and the variation of fundamental constants using 207PbF. Further theoretical work has improved our detailed understanding of both 207PbF and 208PbF, and furthermore recently indicated that the finely split +/- parity levels grow monotonically closer for higher vibrational states. Our experimental results for v = 0-3 confirm this, and are in excellent agreement with our extended theoretical calculations up to v = 4; both will be presented. TJS acknowledges support from Contract No. DE-SC0012704 with the U.S. Department of Energy, Office of Science, supported by its Division of Chemical Sciences, Geosciences and Biosciences within the Office of Basic Energy Sciences., as do RM, AB, YK, & AN from Pomona College & J-UG from the Deutsche Forschungsgemeinschaft (DFG).
International Nuclear Information System (INIS)
Antusch, Stefan; Gross, Christian; Maurer, Vinzenz; Sluka, Constantin
2013-01-01
The recent observations of the leptonic mixing angle θ 13 PMNS are consistent with θ 13 PMNS =θ C /√(2) (with θ C being the Cabibbo angle θ 12 CKM ). We discuss how this relation can emerge in Grand Unified Theories (GUTs) via charged lepton corrections. The key ingredient is that in GUTs the down-type quark Yukawa matrix and the charged lepton Yukawa matrix are generated from the same set of GUT operators, which implies that the resulting entries are linked and differ only by group-theoretical Clebsch factors. This allows a link θ 12 e ≈θ C to be established, which can induce θ 13 PMNS ≈θ C /√(2) provided that the 1–3 mixing in the neutrino mass matrix is much smaller than θ C . We find simple conditions under which θ 13 PMNS ≈θ C /√(2) can arise via this link in SU(5) GUTs and Pati–Salam models. We also discuss possible corrections to the exact relation. Using lepton mixing sum rules different neutrino mixing patterns can be distinguished by their predictions for the Dirac CP phase δ PMNS .
A lower limit on the surface C-12/C-13 ratio in Alpha Orionis
Gautier, T. N., III; Fink, U.; Larson, H. P.; Thompson, R. I.
1976-01-01
The second overtone CO bands near 1.6 microns were analyzed in Alpha Ori using synthetic spectra. No firm identification of (C-13)O was made, which allowed a lower limit of 20 to be set on the C-12/C-13 ratio. A rather low microturbulent velocity of 2 km/s was found to match the spectrum of Alpha Ori best.
International Nuclear Information System (INIS)
Rochman, D.; Ferroukhi, H.; Koning, A.J.; Sjostrand, H.; Helgesson, P.; Gilbert, M.; Sublet, J.C.
2016-01-01
Full text: The TENDL library (Talys Evaluated Nuclear Data Library) contains the necessary information (e.g. recoil spectra, double differential data) to calculate quantities of interest for the material damage. Additionally, it is one of the most complete libraries in terms of number of isotopes and format-wise: 2800 isotopes (ground states and isomers) and all ENDF-6 sections from MF1 to MF40. It can then be naturally used for the estimation of “DPA” and “PKA”, given the correct NJOY processing. Details of the library, its production, formatting and processing are given during the technical meeting. Comparison with other libraries indicated the importance of including all the “MT” sections for the correct processing with NJOY, but also it showed the difference obtained depending of the format chosen to store the decay data. Regarding the uncertainties on DPA and PKA, the TMC method seems to be one of the most convenient methods. As presented during the meeting, the uncertainty propagation using random ENDF-6 files produced from variations of model parameters leads to non-Gaussian distributions for the damage quantities. As a function of the incident neutron energy, the skewness of such distributions can strongly vary and be far from 0. This indicates that the standard deviation alone cannot represent, well enough, the dispersion of the calculated data. A viable alternative is the production of so-called random ENDF-6 files based on given covariance information. This method is limited by the available information given in the covariance files, but can help to capture part of the uncertainties for the DPA and PKA quantities. For TENDL-2016, the covariance format MF32 will be less used and efforts will be devoted to produce MF33, which will facilitate the production of random ENDF-6 files with SCK codes such as SANDY. A PSI internal project to link the nuclear data with the atomistic simulation of damage formation and microstructure evolution was also
El Hamdani, H.; El Amane, M.; Duhayon, C.
2018-03-01
Co-crystal of 1,10-phenanthrolin-1-ium-caffeine-hexafluorophosphate was synthesized, studied by FTIR, 1H, 13C NMR, DSC and X-ray structure and crystallized in the monoclinic space group C2/c. The unit cell parameters are a = 19.3761 (3), b = 17.9548 (3), c = 13.8074 (3) with β = 117.8132 (10). The final R value is 0.069 for 29,522 measured reflections. The co-crystal structure analysis indicate the 1,10-phenanthroline is protonated by one nitrogen atom and formed the 1,10-phenanthrolin-1-ium cation, which is stabilized by hydrogen bonds N+-H…Odbnd C interaction with carbonyl and imidazol ring in caffeine molecule. The intermolecular hydrogen bonds: Csbnd H...O, Csbnd H...N, Nsbnd H...O, Csbnd H...F and intramolecular hydrogen bond: C1sbnd H12...O14, together play a vital role in stabilizing the structure of co-crystal. The X-ray structural analysis confirm the assignments of the structure from infrared, 1H, 13C NMR, spectroscopic data DSC and molar conductivity analysis. The antimicrobial activity of the co-crystal was studied.
International Nuclear Information System (INIS)
Saxena, Sunil K.; Horiuchi, Hisanori; Fukuda, Mitsunori
2006-01-01
Liddle's syndrome (excessive absorption of sodium ions) and PHA-1 (pseudohypoaldosteronism type 1) with decreased sodium absorption are caused by the mutations in the amiloride-sensitive epithelial sodium channel ENaC. Rab proteins are small GTPases involved in vesicle transport, docking, and fusion. Earlier, we reported that Rab27a inhibits ENaC-mediated currents through protein-protein interaction in HT-29 cells. We hereby report that Rab27a-dependent inhibition is associated with the GTP/GDP status as constitutively active or GTPase-deficient mutant Q78L inhibits amiloride-sensitive currents whereas GDP-locked inactive mutant T23N showed no effect. In order to further explore the molecular mechanism of this regulation, we performed competitive assays with two Rab27a-binding proteins: synaptotagmin-like protein (SLP-5) and Munc13-4 (a putative priming factor for exocytosis). Both proteins eliminate negative modulation of Rab27a on ENaC function. The SLP-5 reversal of Rab27a effect was restricted to C-terminal C2A/C2B domains assigned for putative phospholipids-binding function while the Rab27a-binding SHD motif imparted higher inhibition. The ENaC-mediated currents remain unaffected by Rab27a though SLP-5 appears to strongly bind it. The immunoprecipitation experiments suggest that in the presence of excessive Munc13-4 and SLP-5 proteins, Rab27a interaction with ENaC is diminished. Munc13-4 and SLP-5 limit the Rab27a availability to ENaC, thus minimizing its effect on channel function. These observations decisively prove that Rab27a inhibits ENaC function through a complex mechanism that involves GTP/GDP status, and protein-protein interactions involving Munc13-4 and SLP-5 effector proteins
Catalytic dehydration of ethanol for poly 13 C compounds synthesis
International Nuclear Information System (INIS)
Almasan, Valer; Marginean, Petru; Lazar, Mihaela; Tusa, Florina
2003-01-01
Classical methods for the synthesis of organic compounds are not very well applied in the case of 13 C labeled compounds. One of the principal demands is to find the best method to transform a small quantity of isotopic reagent with a very high yield. In this case to obtain 13 C 2 chloroethanol from 13 C 2 ethanol there are two synthesis steps: - catalytic dehydration of ethanol to ethylene; - ethylene double bounding saturation: either via ethylene oxide (30% yield) or in diluted solution of chlorine. For the first step of synthesis we choose the thermal dehydration over alumina catalyst at 400 deg C. There were tested 2 samples of g alumina with 255 m 2 /g and 355 m 2 /g with very good results. In the second step of the synthesis we used the chlorine addition to ethylene in very diluted water solution. We have built a reactor which combined the two steps of this synthesis method to produce 13 C 2 chloroethanol from 13 C 2 ethanol. The global yield of method was 42%. (authors)
Deelchand, Dinesh K.; Nelson, Christopher; Shestov, Alexander A.; Uğurbil, Kâmil; Henry, Pierre-Gilles
2009-02-01
In this work the feasibility of measuring neuronal-glial metabolism in rat brain in vivo using co-infusion of [1,6- 13C 2]glucose and [1,2- 13C 2]acetate was investigated. Time courses of 13C spectra were measured in vivo while infusing both 13C-labeled substrates simultaneously. Individual 13C isotopomers (singlets and multiplets observed in 13C spectra) were quantified automatically using LCModel. The distinct 13C spectral pattern observed in glutamate and glutamine directly reflected the fact that glucose was metabolized primarily in the neuronal compartment and acetate in the glial compartment. Time courses of concentration of singly and multiply-labeled isotopomers of glutamate and glutamine were obtained with a temporal resolution of 11 min. Although dynamic metabolic modeling of these 13C isotopomer data will require further work and is not reported here, we expect that these new data will allow more precise determination of metabolic rates as is currently possible when using either glucose or acetate as the sole 13C-labeled substrate.
Molecular motion of micellar solutes: a 13C NMR relaxation study
International Nuclear Information System (INIS)
Stark, R.E.; Kasakevich, M.L.; Granger, J.W.
1982-01-01
A series of simple NMR relaxation experiments have been performed on nitrobenzene and aniline dissolved in the ionic detergents sodium dodecyl sulfate (SDS) and hexadecyltrimethylammonium bromide (CTAB). Using 13 C relaxation rates at various molecular sites, and comparing data obtained in organic media with those for micellar solutions, the viscosity at the solubilization site was estimated and a detailed picture of motional restrictions imposed by the micellar enviroment was derived. Viscosities of 8 to 17 cp indicate a rather fluid environment for solubilized nitrobenzene; both additives exhibit altered motional preferences in CTAB solutions only. As an aid in interpretation of the NMR data, quasi-elastic light scattering and other physical techniques have been used to evaluate the influence of organic solutes on micellar size and shape. The NMR methods are examined critically in terms of their general usefulness for studies of solubilization in detergent micelles. 48 references
Topology of transmembrane channel-like gene 1 protein.
Labay, Valentina; Weichert, Rachel M; Makishima, Tomoko; Griffith, Andrew J
2010-10-05
Mutations of transmembrane channel-like gene 1 (TMC1) cause hearing loss in humans and mice. TMC1 is the founding member of a family of genes encoding proteins of unknown function that are predicted to contain multiple transmembrane domains. The goal of our study was to define the topology of mouse TMC1 expressed heterologously in tissue culture cells. TMC1 was retained in the endoplasmic reticulum (ER) membrane of five tissue culture cell lines that we tested. We used anti-TMC1 and anti-HA antibodies to probe the topologic orientation of three native epitopes and seven HA epitope tags along full-length TMC1 after selective or complete permeabilization of transfected cells with digitonin or Triton X-100, respectively. TMC1 was present within the ER as an integral membrane protein containing six transmembrane domains and cytosolic N- and C-termini. There is a large cytoplasmic loop, between the fourth and fifth transmembrane domains, with two highly conserved hydrophobic regions that might associate with or penetrate, but do not span, the plasma membrane. Our study is the first to demonstrate that TMC1 is a transmembrane protein. The topologic organization revealed by this study shares some features with that of the shaker-TRP superfamily of ion channels.
DEFF Research Database (Denmark)
Sperlich, Peter
Ice core records of δ13C-CH4 reflect the variability of CH4 biogeochemistry in response to climate change and show this system is far more complex than expected. The first part of this work is concerned with the development of analytical techniques that allow 1) precise referencing and 2) measure......Ice core records of δ13C-CH4 reflect the variability of CH4 biogeochemistry in response to climate change and show this system is far more complex than expected. The first part of this work is concerned with the development of analytical techniques that allow 1) precise referencing and 2......) measurements of δ13C-CH4 in ice core samples as is required when δ13C-CH4 records that are measured in several laboratories are merged for analysis. Both the referencing and measurement techniques have been compared to further laboratories which proofed the accuracy of the analytical systems. The second part...
2010-07-01
... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Notice. 117.21 Section 117.21 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) WATER PROGRAMS DETERMINATION OF... knowledge of any discharge of a designated hazardous substance from such vessel or facility in quantities...
Directory of Open Access Journals (Sweden)
Guyon Francois
2017-01-01
Full Text Available Measurements performed on a set of 32 authentic wines (not submitted to any oenological treatment and their ethanol, recovered by distillation, show high correlation between δ13C of bulk wine and its ethanol. These measurements were performed by isotope ratio monitoring by mass spectrometry coupled to an elemental analyzer (irm-EA/MS. Then a series of wines produced by vines of which water status was assessed during the growing season with predawn leaf water potential measurements, was studied by irm-EA/MS. As expected δ13C is correlated to vine water status conditions, as a result of stomatal closure. The ethanol of these specific wines was also analyzed by isotope ratio monitoring and by nuclear magnetic resonance (irm-13C NMR to determine carbon-13 composition on the two specific sites of the ethanol skeleton. If these measurements confirm the correlation between 13C composition and vine growth conditions, the 13C stereospecific information does not make vine water status assessment more precise.
27 CFR 44.207a - To a foreign-trade zone.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 2 2010-04-01 2010-04-01 false To a foreign-trade zone. 44.207a Section 44.207a Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE... of Shipment § 44.207a To a foreign-trade zone. Where tobacco products, and cigarette papers and tubes...
In vivo assessment of intracellular redox state in rat liver using hyperpolarized [1-13 C]Alanine.
Park, Jae Mo; Khemtong, Chalermchai; Liu, Shie-Chau; Hurd, Ralph E; Spielman, Daniel M
2017-05-01
The intracellular lactate to pyruvate concentration ratio is a commonly used tissue assay biomarker of redox, being proportional to free cytosolic [NADH]/[NAD + ]. In this study, we assessed the use of hyperpolarized [1- 13 C]alanine and the subsequent detection of the intracellular products of [1- 13 C]pyruvate and [1- 13 C]lactate as a useful substrate for assessing redox levels in the liver in vivo. Animal experiments were conducted to measure in vivo metabolism at baseline and after ethanol infusion. A solution of 80-mM hyperpolarized [1- 13 C]alanine was injected intravenously at baseline (n = 8) and 45 min after ethanol infusion (n = 4), immediately followed by the dynamic acquisition of 13 C MRS spectra. In vivo rat liver spectra showed peaks from [1- 13 C] alanine and the products of [1- 13 C]lactate, [1- 13 C]pyruvate, and 13 C-bicarbonate. A significantly increased 13 C-lactate/ 13 C-pyruvate ratio was observed after ethanol infusion (8.46 ± 0.58 at baseline versus 13.58 ± 0.69 after ethanol infusion; P alanine is presented, with the validity of the proposed 13 C-pyruvate/ 13 C-lactate metric tested using an ethanol challenge to alter liver redox state. Magn Reson Med 77:1741-1748, 2017. © 2017 International Society for Magnetic Resonance in Medicine. © 2017 International Society for Magnetic Resonance in Medicine.
Probable alpha and 14C cluster emission from hyper Ac nuclei
International Nuclear Information System (INIS)
Santhosh, K.P.
2013-01-01
A systematic study on the probability for the emission of 4 He and 14 C cluster from hyper Λ 207-234 Ac and non-strange normal 207-234 Ac nuclei are performed for the first time using our fission model, the Coulomb and proximity potential model (CPPM). The predicted half lives show that hyper Λ 207-234 Ac nuclei are unstable against 4 He emission and 14 C emission from hyper Λ 217-228 Ac are favorable for measurement. Our study also show that hyper Λ 207-234 Ac are stable against hyper Λ 4 He and Λ 14 C emission. The role of neutron shell closure (N = 126) in hyper Λ 214 Fr daughter and role of proton/neutron shell closure (Z ∼ 82, N = 126) in hyper Λ 210 Bi daughter are also revealed. As hyper-nuclei decays to normal nuclei by mesonic/non-mesonic decay and since most of the predicted half lives for 4 He and 14 C emission from normal Ac nuclei are favourable for measurement, we presume that alpha and 14 C cluster emission from hyper Ac nuclei can be detected in laboratory in a cascade (two-step) process. (orig.)
23 CFR 633.207 - Construction labor and materials.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction labor and materials. 633.207 Section 633... OPERATIONS REQUIRED CONTRACT PROVISIONS Federal-Aid Contracts (Appalachian Contracts) § 633.207 Construction labor and materials. (a) Construction and materials shall be in accordance with the State highway...
Preliminary study on the relationship between trends of tree-ring δ 13C series and site conditions
International Nuclear Information System (INIS)
Chen Tuo; Qin Dahe; Liu Xiaohong; Ren Jiawen
2001-01-01
The long-term trends of tree-ring δ 13 C series, taken respectively from Qilian of Qinghai and Zhaosu and Aleitai of xinjiang were compared. The results showed that a similar trend existed between Qilian series and Zhaosu series, while there was a significant difference between them and Aleitai series. The authors' analysis indicated that the site difference of the trends of tree-ring δ 13 C series was mainly associated with 'canopy effects' of tree growth. It is suggested that tree samples should be selected from sparse forests or the sampled tree foliage high above the whole canopy when the history of δ 13 C of atmospheric CO 2 was reconstructed by tree-ring series
Experimental (FT-IR, FT-Raman, 1H, 13C NMR) and theoretical study of alkali metal 2-aminobenzoates
Samsonowicz, M.; Świsłocka, R.; Regulska, E.; Lewandowski, W.
2008-09-01
The influence of lithium, sodium, potassium, rubidium and cesium on the electronic system of the 2-aminobenzoic acid was studied by the methods of molecular spectroscopy. The vibrational (FT-IR, FT-Raman) and NMR ( 1H and 13C) spectra for 2-aminobenzoic acid and its alkali metal salts were recorded. The assignment of vibrational spectra was done on the basis of literature data, theoretical calculations and our previous experience. Characteristic shifts of bands and changes in intensities of bands along the metal series were observed. The changes of chemical shifts of protons ( 1H NMR) and carbons ( 13C NMR) in the series of studied alkali metal 2-aminobenzoates were observed too. Optimized geometrical structures of studied compounds were calculated by B3LYP method using 6-311++G ∗∗ basis set. Geometric aromaticity indices, dipole moments and energies were also calculated. The theoretical wavenumbers and intensities of IR and Raman spectra were obtained. The calculated parameters were compared to experimental characteristic of studied compounds.
Singh, Upendra Kumar; Patel, Rajan
2018-05-25
In vitro refolding of denatured protein and the influence of the alkyl chain on the refolding of a protein were tested using long chain imidazolium chloride salts, 1-methyl-3-octylimidazolium chloride [C 8 mim][Cl], and 1-decyl-3-methylimidazolium chloride [C 10 mim][Cl]. The horse heart cytochrome c (h-cyt c) was denatured by urea and guanidinium hydrochloride (GdnHCl), as well as by base-induced denaturation at pH 13, to provide a broad overview of the overall refolding behavior. The variation in the alkyl chain of the ionic liquids (ILs) showed a profound effect on the refolding of denatured h-cyt c. The ligand-induced refolding was correlated to understand the mechanism of the conformational stability of proteins in aqueous solutions of ILs. The results showed that the long chain ILs having the [C 8 mim] + and [C 10 mim] + cations promote the refolding of alkali-denatured h-cyt c. The IL having the [C 10 mim] + cation efficiently refolded the alkali-denatured h-cyt c with the formation of the MG state, whereas the IL having the [C 8 mim] + cation, which is known to be compatible for protein stability, shows slight refolding and forms a different transition state. The lifetime results show successful refolding of alkaline-denatured h-cyt c by both of the ILs, however, more refolding was observed in the case of [C 10 mim][Cl], and this was correlated with the fast and medium lifetimes (τ 1 and τ 2 ) obtained, which show an increase accompanied by an increase in secondary structure. The hydrophobic interactions plays an important role in the refolding of chemically and alkali-denatured h-cyt c by long chain imidazolium ILs. The formation of the MG state by [C 10 mim][Cl] was also confirmed, as some regular structure exists far below the CMC of IL. The overall results suggested that the [C 10 mim] + cation bound to the unfolded h-cyt c triggers its refolding by electrostatic and hydrophobic interactions that stabilize the MG state.
Applications of the nuclear Techniques in medicine: 13C or 14C respiration tests
International Nuclear Information System (INIS)
Rivero Santamaria, Alejandro
2008-01-01
The 14 C or 13 C respiration tests have been applied to the study of metabolic and infectious processes, but most of them have not entered yet the clinical practice stage. In this paper, it is offered an overview of the present and future of respiration tests and how they are taking part and will take part in a future in the non-invasive diagnosis of diverse pathologies
Studies on /sup 13/C-NMR spectroscopy of carbohydrates. Application of selective deuteration
Energy Technology Data Exchange (ETDEWEB)
Mizutani, Kenji; Kajita, Hitomi; Tashima, Takako; Tanaka, Osamu (Hiroshima Univ. (Japan). School of Medicine)
1982-10-01
Recently, Stuart et al. have reported that on heating with deuterated Raney nickel in D/sub 2/O, hexopyranosides and oligosaccharides were deuterated selectively at carbon atoms bound to a free hydroxyl group. For the application of this procedure to chemistry and biochemistry of more complex carbohydrates, further study on this reaction was conducted. On prolonged treatment with Raney nickel (24h), methyl ..cap alpha..-L-arabinopyranoside (4) and ..beta..-D-xylopyranoside (5) were partially epimerized to give (5) and methyl ..cap alpha..-L-lyxopyranoside (6) from (4), and methyl ..beta..-D-ribopyranoside (7) and (4) from (5), respectively. Methyl ..cap alpha..-L-rhamnopyranoside (8) was epimerized more slowly to yield methyl 6-deoxy-..cap alpha..-L-glucopyranoside (9). The best conditions for the deuteration under minimizing the epimerization was refluxing with W-7 type deuterated Raney nickel in D/sub 2/O-dioxane (1 : 1) or methanol-d/sub 4/-D/sub 2/O (1 : 1) for about 9h. Methyl ..beta..-sophoroside (13), methyl ..beta..-cellobioside (23) and ..beta..-sophorosyl and ..beta..-gentiobiosyl units of ginsenoside-Rb/sub 1/ (24), a Ginseng-saponin, were deuterated as expected under these conditions, while C-2 and 4 of the inner ..beta..-glucopyranosyl moiety of methyl ..beta..-laminaribioside (18) and C-4 of the inner ..beta..-glucopyranosyl moiety of methyl 2,3-di-O-..beta..-D-glucopyranosyl-..beta..-D-glucopyranoside (22) remained almost undeuterated. Deuteration of ..cap alpha..-1,6-glucan (25) proceeded rather slowly than those of mono- and oligosaccharide to obtain the expected deuteration after treatment for 24h. In the case of the deuteration of cis- and dl-trans-1, 2-cyclohexanediols (11) and ( (12), both deuteration and epimerization proceeded very fast to give an equilibrated mixture of (11-d/sub 2/) and (12-d/sub 2/) within 9h, while the isolated carbinyl carbon (C-12) of (24) was not deuterated. Further, by means of the above selective deuteration, /sup 13
33 CFR 117.225 - Yellow Mill Channel.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Yellow Mill Channel. 117.225 Section 117.225 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Connecticut § 117.225 Yellow Mill Channel. The...
Directory of Open Access Journals (Sweden)
Lucila González Molina
2012-11-01
Full Text Available El objetivo del presente trabajo fue la simulación de los cambios del carbono orgánico del suelo (COS, por el modelo RothC, en razón del cambio de uso de suelo del sistema tradicional - asociación maíz-calabaza (TMC - a sistemas con higuerilla (Ricinus communis: multiestratos (MUL, callejones (CALL y monocultivo de higuerilla (HIG. Las simulaciones del COS se hicieron para las profundidades de suelo 0-20 y 0-40 cm, para el periodo de 1980-2040, considerándose como línea base al sistema TMC. Las tasas de cambio de COS estimadas con el RothC, en ambas profundidades de suelo, estuvieron en 0,5-1,2, 0,4-0,8, 0,3-0,5 y 0,04-0,1 Mg ha-1 de C por año en los sistemas HIG, MUL, CALL y TMC, respectivamente, y fueron consistentes con las reportadas en la literatura. El desempeño del RothC tuvo 89% de eficiencia (EF, con R²=0,9, lo que muestra que este modelo puede usarse con información temporal del COS escasa, información de la historia de uso de suelo y mediciones de la entrada de residuos vegetales aéreos y subterráneos en el suelo.
Triaxiality in the odd-A nuclei 109−117I studied through a microscopic rotationparticle coupling
Directory of Open Access Journals (Sweden)
Modi Swati
2018-01-01
Full Text Available A systematic study of ground state spectrum with the triaxial deformation γ for odd-A Iodine isotopes 109−117I is carried out with the nonadiabatic quasiparticle approach. The rotation-particle coupling is accomplished microscopically such that the matrix elements of a particle-plus-rotor system are written in terms of the rotor energies. The 5/2+ state is confirmed as ground state for odd-A 111−117I and also coming out as lowest in energy for 109I.
41 CFR 101-39.207 - Reimbursement for services.
2010-07-01
... sufficient to recover applicable costs. Failure by using agencies to reimburse GSA for vehicle services will... or neglect. (e) Agencies may be charged for recovery of expenses for repairs or services to GSA IFMS... services. 101-39.207 Section 101-39.207 Public Contracts and Property Management Federal Property...
Asakura, Tetsuo; Isobe, Kotaro; Kametani, Shunsuke; Ukpebor, Obehi T; Silverstein, Moshe C; Boutis, Gregory S
2017-03-01
The mechanical properties of Bombyx mori silk fibroin (SF), such as elasticity and tensile strength, change remarkably upon hydration. However, the microscopic interaction with water is not currently well understood on a molecular level. In this work, the dynamics of water molecules interacting with SF was studied by 2 H solution NMR relaxation and exchange measurements. Additionally, the conformations of hydrated [3- 13 C]Ala-, [3- 13 C]Ser-, and [3- 13 C]Tyr-SF fibers and films were investigated by 13 C DD/MAS NMR. Using an inverse Laplace transform algorithm, we were able to identify four distinct components in the relaxation times for water in SF fiber. Namely, A: bulk water outside the fiber, B: water molecules trapped weakly on the surface of the fiber, C: bound water molecules located in the inner surface of the fiber, and D: bound water molecules located in the inner part of the fiber were distinguishable. In addition, four components were also observed for water in the SF film immersed in methanol for 30s, while only two components for the film immersed in methanol for 24h. The effects of hydration on the conformation of Ser and Tyr residues in the site-specific crystalline and non-crystalline domains of 13 C selectively labeled SF, respectively, could be determined independently. Our measurements provide new insight relating the characteristics of water and the hydration structure of silk, which are relevant in light of current interest in the design of novel silk-based biomaterials. The mechanical properties of Bombyx mori silk fibroin (SF) change remarkably upon hydration. However, the microscopic interaction between SF and water is not currently well understood on a molecular level. We were able to identify four distinct components in the relaxation times for water in SF fiber by 2 H solution NMR relaxation and exchange measurements. In addition, the effects of hydration on the conformation of Ser and Tyr residues in the site-specific crystalline and
Brekke, Eva M F; Walls, Anne B; Schousboe, Arne; Waagepetersen, Helle S; Sonnewald, Ursula
2012-09-01
The brain is highly susceptible to oxidative injury, and the pentose phosphate pathway (PPP) has been shown to be affected by pathological conditions, such as Alzheimer's disease and traumatic brain injury. While this pathway has been investigated in the intact brain and in astrocytes, little is known about the PPP in neurons. The activity of the PPP was quantified in cultured cerebral cortical and cerebellar neurons after incubation in the presence of [2-(13)C]glucose or [3-(13)C]glucose. The activity of the PPP was several fold lower than glycolysis in both types of neurons. While metabolism of (13)C-labeled glucose via the PPP does not appear to contribute to the production of releasable lactate, it contributes to labeling of tricarboxylic acid (TCA) cycle intermediates and related amino acids. Based on glutamate isotopomers, it was calculated that PPP activity accounts for ~6% of glucose metabolism in cortical neurons and ~4% in cerebellar neurons. This is the first demonstration that pyruvate generated from glucose via the PPP contributes to the synthesis of acetyl CoA for oxidation in the TCA cycle. Moreover, the fact that (13)C labeling from glucose is incorporated into glutamate proves that both the oxidative and the nonoxidative stages of the PPP are active in neurons.
Lamade, Emmanuelle; Tcherkez, Guillaume; Darlan, Nuzul Hijri; Rodrigues, Rosario Lobato; Fresneau, Chantal; Mauve, Caroline; Lamothe-Sibold, Marlène; Sketriené, Diana; Ghashghaie, Jaleh
2016-01-01
Oil palm has now become one of the most important crops, palm oil representing nearly 25% of global plant oil consumption. Many studies have thus addressed oil palm ecophysiology and photosynthesis-based models of carbon allocation have been used. However, there is a lack of experimental data on carbon fixation and redistribution within palm trees, and important C-sinks have not been fully characterized yet. Here, we carried out extensive measurement of natural (13) C-abundance (δ(13) C) in oil palm tissues, including fruits at different maturation stages. We find a (13) C-enrichment in heterotrophic organs compared to mature leaves, with roots being the most (13) C-enriched. The δ(13) C in fruits decreased during maturation, reflecting the accumulation in (13) C-depleted lipids. We further used observed δ(13) C values to compute plausible carbon fluxes using a steady-state model of (13) C-distribution including metabolic isotope effects ((12) v/(13) v). The results suggest that fruits represent a major respiratory loss (≈39% of total tree respiration) and that sink organs such as fruits are fed by sucrose from leaves. That is, glucose appears to be a quantitatively important compound in palm tissues, but computations indicate that it is involved in dynamic starch metabolism rather that C-exchange between organs. © 2015 John Wiley & Sons Ltd.
Energy Technology Data Exchange (ETDEWEB)
Rennella, Enrico; Schuetz, Anne K.; Kay, Lewis E., E-mail: kay@pound.med.utoronto.ca [University of Toronto, Departments of Molecular Genetics, Biochemistry and Chemistry (Canada)
2016-06-15
Methyl groups have emerged as powerful probes of protein dynamics with timescales from picoseconds to seconds. Typically, studies involving high molecular weight complexes exploit {sup 13}CH{sub 3}- or {sup 13}CHD{sub 2}-labeling in otherwise highly deuterated proteins. The {sup 13}CHD{sub 2} label offers the unique advantage of providing {sup 13}C, {sup 1}H and {sup 2}H spin probes, however a disadvantage has been the lack of an experiment to record {sup 13}C Carr–Purcell–Meiboom–Gill relaxation dispersion that monitors millisecond time-scale dynamics, implicated in a wide range of biological processes. Herein we develop an experiment that eliminates artifacts that would normally result from the scalar coupling between {sup 13}C and {sup 2}H spins that has limited applications in the past. The utility of the approach is established with a number of applications, including measurement of ms dynamics of a disease mutant of a 320 kDa p97 complex.
Simultaneous hyperpolarized 13C-pyruvate MRI and 18F-FDG-PET in cancer (hyperPET)
DEFF Research Database (Denmark)
Borgwardt, Henrik Gutte; Hansen, Adam Espe; Henriksen, Sarah T.
2015-01-01
have named this concept hyper PET. Intravenous injection of the hyperpolarized (13)C-pyruvate results in an increase of (13)C-lactate, (13)C-alanine and (13)C-CO2 ((13)C-HCO3) resonance peaks relative to the tissue, disease and the metabolic state probed. Accordingly, with dynamic nuclear polarization......In this paper we demonstrate, for the first time, the feasibility of a new imaging concept - combined hyperpolarized (13)C-pyruvate magnetic resonance spectroscopic imaging (MRSI) and (18)F-FDG-PET imaging. This procedure was performed in a clinical PET/MRI scanner with a canine cancer patient. We...... (DNP) and use of (13)C-pyruvate it is now possible to directly study the Warburg Effect through the rate of conversion of (13)C-pyruvate to (13)C-lactate. In this study, we combined it with (18)F-FDG-PET that studies uptake of glucose in the cells. A canine cancer patient with a histology verified...
13C-NMR of diterpenes with pimarane skeleton
International Nuclear Information System (INIS)
Garcez, W.S.; Pereira, A.L.; Silva Queiroz, P.P. da; Silva, R.S. da; Valente, L.M.M.; Peixoto, E.M.; Cunha Pinto, A. da
1981-01-01
The effect of substituent groups on the chemical shift of carbons using nuclear magnetic resonance spectra of carbon 13 ( 13 C-NMR) is discussed. Diterpenes having pimarane skeleton, isolated from plants of Velloziaceae family are analysed. (ARHC) [pt
International Nuclear Information System (INIS)
Namvar-Mahboub, Mahdieh; Pakizeh, Majid
2014-01-01
Separation performance of polyamide composite membranes is affected by several parameters during formation of thin upper layer via interfacial polymerization. We investigated the effect of various polyamide synthesis conditions on the performance of organic solvent resistant polyamide composite membranes through the model equations designed by 2-level fractional factorial design. The dewaxing solvent recovery was selected as separation process. Five factors were changed in two level includin; TMC concentration (0.05-0.1%), MPD concentration (1-2%), support immersion time in organic solution (2-4 min), support immersion time in aqueous solution (1-2 min), and curing temperature (70-80 .deg. C). The resultant equations showed 93.48% and 94.82% of the variability (R 2 adj ) in data used to fit oil rejection and permeate flux models, respectively. The analysis of variance revealed that both models were high significant. It was also observed that TMC concentration, MPD concentration and immersion time in TMC have more pronounced effect on the oil rejection and permeate flux than other factors and interactions. Optimal polyamide preparation conditions were obtained using multiple response method for 94% oil rejection as target value. According to the results, the best value of permeate flux (8.86 l/(m 2 ·h)) was found at TMC concentration of 0.1%, MPD concentration of 1.94%, immersion time in TMC of 3.88 min, immersion time in MPD of 1.95 min and curing temperature of 71.96 .deg. C with desirability factor of 1
33 CFR 117.677 - Big Sunflower River.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Big Sunflower River. 117.677 Section 117.677 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements Mississippi § 117.677 Big Sunflower River. The draw of...
33 CFR 117.167 - Little Potato Slough.
2010-07-01
... 33 Navigation and Navigable Waters 1 2010-07-01 2010-07-01 false Little Potato Slough. 117.167 Section 117.167 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY BRIDGES DRAWBRIDGE OPERATION REGULATIONS Specific Requirements California § 117.167 Little Potato Slough. The draw of...
7 CFR 400.117 - Determination of delinquency.
2010-01-01
... 7 Agriculture 6 2010-01-01 2010-01-01 false Determination of delinquency. 400.117 Section 400.117 Agriculture Regulations of the Department of Agriculture (Continued) FEDERAL CROP INSURANCE CORPORATION... Succeeding Crop Years § 400.117 Determination of delinquency. Prior to disclosing information about a debt to...