Time to unsuccessful tuberculosis treatment outcome, Cambodia, China, and Viet Nam.

Science.gov (United States)

Hoa, N B; Sokun, C; Wei, C; Lauritsen, J M; Rieder, H L

2012-03-21

To determine the frequency and characteristics of patients with unsuccessful tuberculosis (TB) treatment. Random selection of TB case registers among all treatment units in Cambodia, two provinces in China, and Viet Nam. The data of two calendar years were analyzed to assess unsuccessful outcomes and their time of occurrence. Among the 33 309 TB patients, treatment was unsuccessful in respectively 10.1%, 3.0% and 9.1% of patients in Cambodia, China and Viet Nam. The risk of death was highest in Cambodia, higher among males than females, increased with age, and was more common among retreatment cases than new cases, and among patients with a high than a low sputum smear microscopy grade. Half of all deaths occurred in the first 2 months in Cambodia and within 11 weeks in China and Viet Nam. Median time to default was 3 months in Cambodia and Viet Nam, and about 2 months in China. Treatment was highly successful in the three study countries, with a low proportion of death and default. As the majority of defaulting occurs at the beginning of treatment, all countries should critically review their current policy of treatment support in this period.

Recent increase in sex ratio at birth in Viet Nam.

Directory of Open Access Journals (Sweden)

Christophe Z Guilmoto

Full Text Available INTRODUCTION: Since the 1980s, sex ratio at birth (male births per 100 female births has increased in many Asian countries as a result of selective abortions, but to date there has been no such evidence for Viet Nam. Our aim in this paper is to ascertain the situation with respect to sex ratio at birth in Viet Nam over the past five years. MATERIALS AND METHODS: Original data were obtained from sample population surveys in Viet Nam recording annual birth rates since 2000 of about 450,000 women, as well as from two successive birth surveys conducted for the first time in 2007 (1.1 million births. The annual population surveys include specific information on birth history and mothers' characteristics to be used for the analysis of trends and differentials in sex ratio at birth. RESULTS AND DISCUSSION: Birth history statistics indicate that the SRB in Viet Nam has recorded a steady growth since 2001. Starting from a level probably close to the biological standard of 105, the SRB reached 108 in 2005 and 112 in 2006, a value significantly above the normal level. An independent confirmation of these results comes from the surveys of births in health facilities which yielded a SRB of 110 in 2006-07. High SRB is linked to various factors such as access to modern health care, number of prenatal visits, level of higher education and employment status, young age, province of residence and prenatal sex determination. These results suggest that prenatal sex determination followed by selective abortion has recently become more common in Viet Nam. This recent trend is a consequence of various factors such as preference for sons, declining fertility, easy access to abortion, economic development as well as the increased availability of ultrasonography facilities.

Recent increase in sex ratio at birth in Viet Nam.

Science.gov (United States)

Guilmoto, Christophe Z; Hoàng, Xuyên; Van, Toan Ngo

2009-01-01

Since the 1980s, sex ratio at birth (male births per 100 female births) has increased in many Asian countries as a result of selective abortions, but to date there has been no such evidence for Viet Nam. Our aim in this paper is to ascertain the situation with respect to sex ratio at birth in Viet Nam over the past five years. Original data were obtained from sample population surveys in Viet Nam recording annual birth rates since 2000 of about 450,000 women, as well as from two successive birth surveys conducted for the first time in 2007 (1.1 million births). The annual population surveys include specific information on birth history and mothers' characteristics to be used for the analysis of trends and differentials in sex ratio at birth. Birth history statistics indicate that the SRB in Viet Nam has recorded a steady growth since 2001. Starting from a level probably close to the biological standard of 105, the SRB reached 108 in 2005 and 112 in 2006, a value significantly above the normal level. An independent confirmation of these results comes from the surveys of births in health facilities which yielded a SRB of 110 in 2006-07. High SRB is linked to various factors such as access to modern health care, number of prenatal visits, level of higher education and employment status, young age, province of residence and prenatal sex determination. These results suggest that prenatal sex determination followed by selective abortion has recently become more common in Viet Nam. This recent trend is a consequence of various factors such as preference for sons, declining fertility, easy access to abortion, economic development as well as the increased availability of ultrasonography facilities.

Habitat et environnement urbain au Viet-Nam: Hanoi et Hô Chi Minh ...

International Development Research Centre (IDRC) Digital Library (Canada)

With an annual income of approximately $200 US per capita, the Socialist Republic of Viet Nam is one of the world's poorest countries. It has been repetitively devastated by armed conflicts and frequent large-scale natural disasters for over 50 years. Viet Nam's population is estimated to approximately 70 million, 80% of ...

Tuberculosis case notification data in Viet Nam, 2007 to 2012.

Science.gov (United States)

Nhung, Nguyen Viet; Hoa, Nguyen Binh; Khanh, Pham Huyen; Hennig, Cornelia

2015-01-01

Tuberculosis (TB) remains a major cause of morbidity and mortality, and Viet Nam ranks 12 among the 22 high-TB burden countries. This study analyses surveillance data of the National Tuberculosis Control Programme in Viet Nam for the six-year period 2007 to 2012. During the study period, 598,877 TB cases (all forms) were notified, and 313,225 (52.3%) were new smear-positive cases. The case notification rate of new smear-positive cases was decreased, from 65 per 100,000 population in 2007 to 57 per 100,000 population in 2012; this decrease was observed for males and females in all age groups except males aged 0-14 and females aged 15-24 years. The male-to-female ratio of new smear-positive TB cases increased from 2.85 in 2007 to 3.02 in 2012. The average annual cure rate of new smear-positive cases was 90.3%. The high male-to-female ratio for new smear-positive TB cases in this notification data was lower than that from the 2007 TB prevalence survey in Viet Nam, suggesting a lower case detection for males. The decrease in new smear-positive case notification rates may reflect a decline in TB incidence in Viet Nam as several programmatic improvements have been made, although further research is required to increase case detection among young males and children.

Pesticide regulations and farm worker safety: the need to improve pesticide regulations in Viet Nam.

Science.gov (United States)

Phung, Dung Tri; Connell, Des; Miller, Greg; Rutherford, Shannon; Chu, Cordia

2012-06-01

Agricultural pesticide use in Viet Nam has more than tripled since 1990. However, pesticide legislation and regulations have not been developed in response to this large increase in usage, as a result of which pesticides pose a serious threat to human health and the environment. This paper identifies the need to improve pesticide regulations in Viet Nam through a comparative analysis of pesticide regulations in Viet Nam and the United States of America, where the rate of acute poisoning among agricultural workers is much lower than in Viet Nam and where information pertaining to pesticide regulations is made accessible to the public. The analysis identified several measures that would help to improve Viet Nam's pesticide regulations. These include enhancing pesticide legislation, clarifying the specific roles and active involvement of both the environmental and health sectors; performing a comprehensive risk-benefit evaluation of pesticide registration and management practices; improving regulations on pesticide suspension and cancellation, transport, storage and disposal; developing import and export policies and enhancing pesticide-related occupational safety programmes.

North American Mesoscale Forecast System (NAM) [12 km

Data.gov (United States)

National Oceanic and Atmospheric Administration, Department of Commerce — The North American Mesoscale Forecast System (NAM) is one of the major regional weather forecast models run by the National Centers for Environmental Prediction...

Viet Nam [Status and technology of polymer-containing fibrous materials in the Eastern Hemisphere

Energy Technology Data Exchange (ETDEWEB)

Le-Van-Thoi, [Viet Nam Atomic Energy Office, Saigon (Viet Nam)

1968-10-15

In South Viet Nam, forest covers about 30% of the land area or approximately 6 000 000 ha. Hardwoods comprise about 80% of the timber stock. The total growing stock is not known exactly. Forest inventory is difficult in Viet Nam since some areas are inaccessible in the virgin forest. Overcutting by the population for domestic uses should also be mentioned together with fire damage, destruction by the war, etc. Practically all species of fibrous wood which are common in South- East Asia grow in Viet Nam. Pine trees especially account for about 2% of the forest and bamboo for 1%, and rubber trees, kenaf and jute are abundant. Valuable fibrous materials other than wood are agricultural wastes such as rice straw and bagasse. Table I presents a list of the most common fibrous plants of Viet Nam; their importance, however, cannot be evaluated. In addition, restricted numbers of these plants are consumed by the population of the region where they grow wild. Exploitation is, in fact, purely artisanal and tends merely to meet local needs. Cotton plants (Gossipium herbaceum) grow mainly in Central Viet Nam; the cotton product is not of good quality since the fibres are not very long.

Home From the War: A Study of Psychiatric Problems in Viet Nam Returnees.

Science.gov (United States)

Strange, Robert E.; Brown, Dudley E., Jr.

1970-01-01

Fifty patients who developed psychiatric problems after return from tours of Viet Nam combat duty were compared with a group of patients who had not had such duty. The Viet Nam returnees reported more conflicts in intimate relationships and had a higher incidence of depression and somatization than did the noncombat group. A study was made of…

Phylogeography of recently emerged DENV-2 in southern Viet Nam.

Directory of Open Access Journals (Sweden)

Maia A Rabaa

2010-07-01

Full Text Available Revealing the dispersal of dengue viruses (DENV in time and space is central to understanding their epidemiology. However, the processes that shape DENV transmission patterns at the scale of local populations are not well understood, particularly the impact of such factors as human population movement and urbanization. Herein, we investigated trends in the spatial dynamics of DENV-2 transmission in the highly endemic setting of southern Viet Nam. Through a phylogeographic analysis of 168 full-length DENV-2 genome sequences obtained from hospitalized dengue cases from 10 provinces in southern Viet Nam, we reveal substantial genetic diversity in both urban and rural areas, with multiple lineages identified in individual provinces within a single season, and indicative of frequent viral migration among communities. Focusing on the recently introduced Asian I genotype, we observed particularly high rates of viral exchange between adjacent geographic areas, and between Ho Chi Minh City, the primary urban center of this region, and populations across southern Viet Nam. Within Ho Chi Minh City, patterns of DENV movement appear consistent with a gravity model of virus dispersal, with viruses traveling across a gradient of population density. Overall, our analysis suggests that Ho Chi Minh City may act as a source population for the dispersal of DENV across southern Viet Nam, and provides further evidence that urban areas of Southeast Asia play a primary role in DENV transmission. However, these data also indicate that more rural areas are also capable of maintaining virus populations and hence fueling DENV evolution over multiple seasons.

Phylogeography of recently emerged DENV-2 in southern Viet Nam.

Science.gov (United States)

Rabaa, Maia A; Ty Hang, Vu Thi; Wills, Bridget; Farrar, Jeremy; Simmons, Cameron P; Holmes, Edward C

2010-07-27

Revealing the dispersal of dengue viruses (DENV) in time and space is central to understanding their epidemiology. However, the processes that shape DENV transmission patterns at the scale of local populations are not well understood, particularly the impact of such factors as human population movement and urbanization. Herein, we investigated trends in the spatial dynamics of DENV-2 transmission in the highly endemic setting of southern Viet Nam. Through a phylogeographic analysis of 168 full-length DENV-2 genome sequences obtained from hospitalized dengue cases from 10 provinces in southern Viet Nam, we reveal substantial genetic diversity in both urban and rural areas, with multiple lineages identified in individual provinces within a single season, and indicative of frequent viral migration among communities. Focusing on the recently introduced Asian I genotype, we observed particularly high rates of viral exchange between adjacent geographic areas, and between Ho Chi Minh City, the primary urban center of this region, and populations across southern Viet Nam. Within Ho Chi Minh City, patterns of DENV movement appear consistent with a gravity model of virus dispersal, with viruses traveling across a gradient of population density. Overall, our analysis suggests that Ho Chi Minh City may act as a source population for the dispersal of DENV across southern Viet Nam, and provides further evidence that urban areas of Southeast Asia play a primary role in DENV transmission. However, these data also indicate that more rural areas are also capable of maintaining virus populations and hence fueling DENV evolution over multiple seasons.

Characteristics of tuberculosis patients at intake in Cambodia, two provinces in China, and Viet Nam

Directory of Open Access Journals (Sweden)

Lauritsen Jens M

2011-05-01

Full Text Available Abstract Background The tuberculosis register is a critical data source for the information system of national tuberculosis control programs. From the information in the tuberculosis case register, it is possible to extend the standard analysis of age and sex characteristics among sputum smear-positive cases to all tuberculosis case categories. National tuberculosis programs might utilize such information to identify problems related to referral and access to diagnosis and treatment. Objectives Based on the electronic database we created, our objectives were to provide a detailed description of age and sex characteristics of tuberculosis patients at registration and to provide a comparison of age-specific sex characteristics among incident and prevalent sputum smear-positive cases. Methods A representative sample of tuberculosis case registers from 1 January 2003 to 31 December 2005 was selected in Cambodia, two provinces in China and Viet Nam. Age and sex characteristics of cases in the three separate prevalence surveys in the three jurisdictions (Cambodia: year 2002; China: year 2000; and Viet Nam: year 2006-2007 were obtained for comparison. Results A total 37,635 patients had been registered during the period in the selected units in the three countries. Cases were more frequently male in all three countries with 53%, 71%, and 69% in Cambodia, China, and Viet Nam, respectively. The ratios of the female-to-male odds in the notification system to that in the prevalence survey in smear-positive cases in Cambodia, China and Viet Nam were 2.1, 0.9, and 1.8, respectively. Because of the small proportion of extrapulmonary tuberculosis registered in China, we limited the analysis on age and sex distribution for extrapulmonary cases to Cambodia and Viet Nam. The proportion with extrapulmonary tuberculosis among all cases was 18.5% in Cambodia and 15.7% in Viet Nam, decreasing in frequency with increasing age. Conclusions Characteristics of patients

Characteristics of tuberculosis patients at intake in Cambodia, two provinces in China, and Viet Nam.

Science.gov (United States)

Hoa, Nguyen B; Wei, Chen; Sokun, Chay; Lauritsen, Jens M; Rieder, Hans L

2011-05-23

The tuberculosis register is a critical data source for the information system of national tuberculosis control programs. From the information in the tuberculosis case register, it is possible to extend the standard analysis of age and sex characteristics among sputum smear-positive cases to all tuberculosis case categories. National tuberculosis programs might utilize such information to identify problems related to referral and access to diagnosis and treatment. Based on the electronic database we created, our objectives were to provide a detailed description of age and sex characteristics of tuberculosis patients at registration and to provide a comparison of age-specific sex characteristics among incident and prevalent sputum smear-positive cases. A representative sample of tuberculosis case registers from 1 January 2003 to 31 December 2005 was selected in Cambodia, two provinces in China and Viet Nam. Age and sex characteristics of cases in the three separate prevalence surveys in the three jurisdictions (Cambodia: year 2002; China: year 2000; and Viet Nam: year 2006-2007) were obtained for comparison. A total 37,635 patients had been registered during the period in the selected units in the three countries. Cases were more frequently male in all three countries with 53%, 71%, and 69% in Cambodia, China, and Viet Nam, respectively.The ratios of the female-to-male odds in the notification system to that in the prevalence survey in smear-positive cases in Cambodia, China and Viet Nam were 2.1, 0.9, and 1.8, respectively. Because of the small proportion of extrapulmonary tuberculosis registered in China, we limited the analysis on age and sex distribution for extrapulmonary cases to Cambodia and Viet Nam. The proportion with extrapulmonary tuberculosis among all cases was 18.5% in Cambodia and 15.7% in Viet Nam, decreasing in frequency with increasing age. Characteristics of patients greatly differed between countries and between patient categories. In Cambodia

Health Costs Attributable to Smoking in Viet Nam | IDRC ...

International Development Research Centre (IDRC) Digital Library (Canada)

Health Costs Attributable to Smoking in Viet Nam ... and the government has a particular interest in the economic costs associated with high tobacco consumption. ... IWRA/IDRC webinar on climate change and adaptive water management.

A rapid assessment and response approach for socially marketed nutrition commodities in Viet Nam.

Science.gov (United States)

Turk, Tahir; Quang, Nguyen Dinh; Nga, Tran Thuy; Phuong, Huynh; Tung, Le Van Anh; Trang, Vu Hoang

2017-01-01

The leading cause of death in children in developing countries is protein-energy malnutrition. In Viet Nam, 25.9% of children under 5 experience stunted growth and 6.6% are moderately wasted. Iron deficiency anaemia and vitamin A deficiency contribute to these and other malnutrition conditions. Given these factors, more evidence based approaches are required to improve understanding of current attitudes, opinions and behaviours of mothers with young children, in order to operationalise social marketing of nutrition commodities in Viet Nam. A literature review supported a rapid assessment and response method involving semi-structured interviews with 77 stakeholders and focus group discussions with 80 program beneficiaries from four geographic locations in the north and south of Viet Nam. Discussion agendas were developed to address key program issues with grounded theory utilized for data analysis. Data analysis highlighted challenges and opportunities within the six Ps of social marketing: Supply and demand side issues included: cost and the quality of products, the limited scale of interventions and promotional activities. Policy issues identified related to current policies that inhibited the broader promotion and distribution of micronutrient products, and opportunities for improved dialogue with policy partners. Partnerships further emphasized the need for public private partnerships to support the social change process. Implications for theory, policy, and practice indicates that rapid assessment and response is a cost-effective, pragmatic method of public health research, in resource constrained settings, to explore policies and behaviours amenable to change and build stakeholder engagement in the program.

My Folkloristic History of the Việt Nam War: A Non-communist Experience

Directory of Open Access Journals (Sweden)

Long S. Le

2013-01-01

Full Text Available Like many families who were on the “wrong” side of the Việt Nam war, my family history has effectively been “displaced” from official discourse in Việt Nam when the country was “reunified” in 1975, as well as in the discourse of public history in the U.S. which has overwhelmingly emphasized the “lessons” of the “American Experience” in Việt Nam. Using my family history as an index of historical processes, I hope to introduce windows on the continuities of what noncommunist Vietnamese do and think. My family folklore is utilized as a way to create opportunities for other non-communist Vietnamese here and elsewhere to connect, articulate, or remind them of a pattern from the past that can provide a contemporary coherence with an ethic workable for the future.

Two Integrator Loop Filters: Generation Using NAM Expansion and Review

Directory of Open Access Journals (Sweden)

Ahmed M. Soliman

2010-01-01

Full Text Available Systematic synthesis method to generate a family of two integrator loop filters based on nodal admittance matrix (NAM expansion is given. Eight equivalent circuits are obtained; six of them are new. Each of the generated circuits uses two grounded capacitors and employs two current conveyors (CCII or two inverting current conveyors (ICCII or a combination of both. The NAM expansion is also used to generate eight equivalent grounded passive elements two integrator loop filters using differential voltage current conveyor (DVCC; six of them are new. Changing the input port of excitation, two new families of eight unity gain lowpass filter circuits each using two CCII or ICCII or combination of both or two DVCC are obtained.

Positive and negative metacognitions about alcohol use among university students: Psychometric properties of the PAMS and NAMS French versions.

Science.gov (United States)

Gierski, Fabien; Spada, Marcantonio M; Fois, Eveline; Picard, Aurélie; Naassila, Mickaël; Van der Linden, Martial

2015-08-01

Metacognitions about the positive and negative effects of alcohol use have been associated with various patterns of drinking. The aim of the present study was to validate French versions of the Positive Alcohol Metacognitions Scale (PAMS) and the Negative Alcohol Metacognitions Scale (NAMS) developed by Spada and Wells (2008, Addict. Behav. 33, 515) and to investigate the relationship between metacognitions and patterns of alcohol use among university students. Responses of 1600 university students who participated in an internet survey-based study on alcohol use were submitted to confirmatory (N=800, mean age 20.40 years, 45.50% male) and exploratory (N=800, mean age 20.34 years, 45.38% male) factor analyses in two separate samples. Alcohol use, binge drinking and mood were also assessed. In line with the original versions of the scales, results provided support for a two-factor structure of the French PAMS and NAMS. Both scales revealed adequate internal reliability. Good temporal stability was found for the two factors of the NAMS, whereas one factor of the PAMS showed weakness across time. Predictive validity revealed that negative alcohol metacognitions about the uncontrollability of alcohol use were found to be consistently associated with alcohol use and binge drinking, whereas positive metacognitions about alcohol use were found to be differentially associated with alcohol use and binge drinking. The French versions of the PAMS and NAMS exhibited suitable psychometric properties. This study also emphasized the role of metacognitions about alcohol use in drinking behaviour among university students. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

Disease spectrum and management of children admitted with acute respiratory infection in Viet Nam.

Science.gov (United States)

Nguyen, T K P; Nguyen, D V; Truong, T N H; Tran, M D; Graham, S M; Marais, B J

2017-06-01

To assess the acute respiratory infection (ARI) disease spectrum, duration of hospitalisation and outcome in children hospitalised with an ARI in Viet Nam. We conducted a retrospective descriptive study of ARI admissions to primary (Hoa Vang District Hospital), secondary (Da Nang Hospital for Women and Children) and tertiary (National Hospital of Paediatrics in Ha Noi) level hospitals in Viet Nam over 12 months (01/09/2015 to 31/08/2016). Acute respiratory infections accounted for 27.9% (37 436/134 061) of all paediatric admissions; nearly half (47.6%) of all children admitted to Hoa Vang District Hospital. Most (64.6%) of children hospitalised with an ARI were Viet Nam, characterised by prolonged hospitalisation for relatively mild disease. There is huge potential to reduce unnecessary hospital admission and cost. © 2017 John Wiley & Sons Ltd.

Implementation of GINA guidelines in Ho Chi Minh City: a model for Viet Nam.

Science.gov (United States)

Tho, N V; Loan, H T H; Thao, N T P; Dung, N T T; Lan, L T T

2012-12-21

The Global Initiative for Asthma (GINA) guidelines have not been implemented effectively in primary care settings in Viet Nam. To estimate the proportion of patients with controlled asthma and the direct health care costs of managing asthma according to GINA guidelines at four out-patient clinics in Ho Chi Minh City (HCMC), Viet Nam. One hundred and six patients with asthma were treated and followed up according to GINA guidelines for 12 months. Clinical and pulmonary function responses and direct health care costs were evaluated every 3 months during the study. The proportion of patients with controlled asthma rose from 1.0% at the start of the study to 36.8% by the end of the study (P Viet Nam, improved asthma control with modest direct health care costs.

Oseltamivir resistance among influenza viruses: surveillance in northern Viet Nam, 2009-2012.

Science.gov (United States)

Hoang Vu, Mai-Phuong; Nguyen, Co Thach; Nguyen, Le Khanh Hang; Nguyen, Thi Kim Phuong; Le, Quynh Mai

2013-01-01

Antiviral resistance has been reported in seasonal influenza A viruses and avian influenza A(H5N1) viruses in Viet Nam, raising concerns about the efficacy of treatment. We analysed specimens from two sources during the period 2009-2012: influenza-positive samples from influenza-like illness patients at sentinel clinics in northern Viet Nam and isolates from patients with confirmed A(H5N1) infections. Pyrosequencing was used to detect mutations: H275Y [for A(H1N1) and A(H5N1)], E119V [for A(H3N2)] and I117V [for A(H5N1)]. A neuraminidase inhibition assay was used to determine the Inhibitory Concentration 50 (IC₅₀) values for all influenza A and B isolates. There were 341 influenza A positive samples identified; influenza A(H1N1)pdm09 was identified most frequently (n = 215). In 2009, oseltamivir resistance was observed in 100% (19 of 19) of seasonal A(H1N1) isolates and 1.4% (3/215) of A(H1N1)pdm09 isolates. This H275Y mutation was not found in influenza subtypes A(H5N1) or A(H3N2) isolates. In Viet Nam, seasonal and A(H5N1) influenza vaccines are not currently available; thus, effective treatment is required. The presence of oseltamivir-resistant viruses is therefore a concern. Active surveillance for oseltamivir resistance among influenza viruses circulating in Viet Nam should be continued.

Analysing Key Debates in Education and Sustainable Development in Relation to ESD Practice in Viet Nam

Science.gov (United States)

Balls, Emily

2016-01-01

This article is based on qualitative field research carried out in Ha Noi, Viet Nam, in 2013 for an MA dissertation in Education and International Development at the UCL Institute of Education. It analyses interpretations of education for sustainable development (ESD) in Viet Nam, relating these to key debates around instrumental and democratic…

Habitat et environnement urbain au Viêt-nam

International Development Research Centre (IDRC) Digital Library (Canada)

Avant 1985, la construction et la gestion du logement au Viêt-nam étaient en ...... du contrôle administratif et n'ont pas été en mesure d'inciter le développement ...... et les syndicats, il est toutefois encore trop tôt pour juger de leur performance.

A situational review of infant and young child feeding practices and interventions in Viet Nam.

Science.gov (United States)

Nguyen, Phuong Hong; Menon, Purnima; Ruel, Mariel; Hajeebhoy, Nemat

2011-01-01

Sub-optimal infant and young child feeding (IYCF) practices are likely a significant contributor to high undernutrition rates in Viet Nam. To date, however, there has been no comprehensive review of IYCF practices in Viet Nam. The objectives of this paper were to review: 1) patterns/trends in IYCF in Viet Nam; 2) the barriers and facilitators to IYCF practices; and 3) interventions and policies and their effectiveness. Methods used include reviewing and analyzing existing data, summarizing and organizing the evidence into broad themes based on a pre-defined conceptual framework. Findings show that the proportion of children ever breastfed is almost universal and the median duration of breastfeeding is 13-18 months. However, exclusive breastfeeding for the first six months is low (8-17%) and appears to be declining over time. Information on complementary feeding is limited, but two key challenges are: early introduction, and low nutrient quality of complementary foods. Facilitators of optimal IYCF were support from 1) government progressive policies, 2) non-profit organizations and 3) family members. Barriers to optimal IYCF included 1) the lack of enforcement of, and compliance with the code of marketing breast milk substitutes, 2) inadequate knowledge among health care providers; and 3) maternal poor knowledge. These findings indicate that the evidence base on complementary feeding is weak in Viet Nam and needs to be strengthened. The review also reinforces that program and policy actions to improve IYCF in Viet Nam must target multiple stakeholders at different levels: the family, the health system and the private sector.

Stimulating the development of national Streptococcus suis guidelines in Viet Nam through a strategic research partnership.

Science.gov (United States)

Horby, Peter; Wertheim, Heiman; Ha, Nguyen Hong; Trung, Nguyen Vu; Trinh, Dao Tuyet; Taylor, Walter; Ha, Nguyen Minh; Lien, Trinh Thi Minh; Farrar, Jeremy; Van Kinh, Nguyen

2010-06-01

Streptococcus suis is a common cause of adult bacterial meningitis in Viet Nam, and possibly other parts of Asia, yet this disabling infection has been largely neglected. Prevention, diagnosis and treatment are relatively straightforward and affordable but, in early 2007, no national diagnostic, case management or prevention guidelines existed in Viet Nam. Enhanced detection of S. suis infections was established in 2007 as part of a collaborative research programme between the National Hospital for Tropical Diseases, a key national hospital with very close links to the Ministry of Health, and a research group affiliated with Oxford University based in Viet Nam. The results were reported directly to policy-makers at the Ministry of Health. Viet Nam is a low-income country with a health-care system that has seen considerable improvements and increased autonomy. However, parts of the system remain fairly centralized the Ministry of Health. Following the improved detection and reporting of S. suis cases, the Ministry of Health issued guidance to all hospitals in Viet Nam on the clinical and laboratory diagnosis, treatment and prevention of S. suis. A public health laboratory diagnostic service was established at the National Institute of Hygiene and Epidemiology and training courses were conducted for clinicians and microbiologists. Ministry of Health guidance on surveillance and control of communicable diseases was updated to include a section on S. suis. Research collaborations can efficiently inform and influence national responses if they are well positioned to reach policy-makers.

IAEA Mission Concludes Peer Review of Viet Nam's Radiation and Nuclear Regulatory Framework

International Nuclear Information System (INIS)

2014-01-01

Senior international nuclear safety and radiation protection experts today concluded a 10-day International Atomic Energy Agency (IAEA) mission to review how Viet Nam's regulatory framework for nuclear and radiation safety has incorporated recommendations and suggestions from an earlier review, conducted in 2009. The Integrated Regulatory Review Service (IRRS) follow-up mission, requested by the Viet Nam Agency for Radiation and Nuclear Safety (VARANS), also reviewed the development of the regulatory safety infrastructure to support Viet Nam's nuclear power programme. The eight-member team comprised senior regulatory experts from Canada, France, Pakistan, Slovenia, United Arab Emirates and the United States of America, as well as three IAEA staff members. The IRRS team said in its preliminary assessment that Viet Nam had made progress since 2009, but that some key recommendations still needed to be addressed. Particular strengths identified by the team included: The commitment of VARANS staff to develop legislation and regulations in the field of nuclear and radiation safety; VARANS' efforts to implement practices that are in line with IAEA Safety Standards and internationally recognized good practices; A willingness to receive feedback regarding the efforts to establish and implement a regulation programme; and Progress made in developing the regulatory framework to support the introduction of nuclear power. The team identified the following areas as high-priority steps to further strengthen radiation and nuclear safety in Viet Nam: The effective independence of the regulatory decision-making process needs to be urgently addressed; Additional resources are needed to regulate existing radiation facilities and activities, as well as the country's research reactor; Efforts to increase the capacity of VARANS to regulate the developing nuclear power programme should continue; The draft Master Plan for the Development of Nuclear Power Infrastructure should be finalized

Improving natural resource management in Viet Nam's Hong Ha ...

International Development Research Centre (IDRC) Digital Library (Canada)

2011-07-15

Jul 15, 2011 ... Improving natural resource management in Viet Nam's Hong Ha commune ... In this work, the research team helped local farmers improve their land ... with a home garden economy, limit forest destruction, diversify crop production, ... low female participation rates in decision making; limited education; rapid ...

A multicentre molecular analysis of hepatitis B and blood-borne virus coinfections in Viet Nam.

Science.gov (United States)

Dunford, Linda; Carr, Michael J; Dean, Jonathan; Nguyen, Linh Thuy; Ta Thi, Thu Hong; Nguyen, Binh Thanh; Connell, Jeff; Coughlan, Suzie; Nguyen, Hien Tran; Hall, William W; Thi, Lan Anh Nguyen

2012-01-01

Hepatitis B (HBV) infection is endemic in Viet Nam, with up to 8.4 million individuals estimated to be chronically infected. We describe results of a large, multicentre seroepidemiological and molecular study of the prevalence of HBV infection and blood-borne viral coinfections in Viet Nam. Individuals with varying risk factors for infection (n = 8654) were recruited from five centres; Ha Noi, Hai Phong, Da Nang, Khanh Hoa and Can Tho. A mean prevalence rate of 10.7% was observed and levels of HBsAg were significantly higher in injecting drug users (IDUs) (17.4%, n = 174/1000) and dialysis patients (14.3%, n = 82/575) than in lower-risk groups (9.4%; pViet Nam and also highlights the significant levels of blood-borne virus coinfections, which have important implications for hepatitis-related morbidity and development of effective management strategies.

Viet Nam Economic Research Network (VERN) - Phase II | CRDI ...

International Development Research Centre (IDRC) Digital Library (Canada)

VERN I (101273) constituted the first network for young economic researchers in Viet Nam, where previously there had been no modality for cooperation or peer review. Guided by the philosophy of "understanding and managing globalization" that underpinned the earlier project, VERN II proposes to expand the network, ...

Globalization and the Governance of Education in Viet Nam

Science.gov (United States)

London, Jonathan D.

2010-01-01

In a globalizing world, local and global governance arrangements are increasingly interdependent, which produces harmonization in some instances and new tensions and contradictions in others. Analysis shows that successive waves of globalization have affected the governance of education in Viet Nam differently. It shows that the globalization of…

Le pluralisme médicamenteux face à l’épidémie de VIH/sida au Viêt Nam Drug Pluralism Confronted by HIV/AIDS Epidemic in Viêt Nam

Directory of Open Access Journals (Sweden)

Marie-Ève Blanc

2012-10-01

Full Text Available Cet article traite de la place du pluralisme médicamenteux au Viêt Nam dans le contexte de l’épidémie de VIH/sida et de la mise en place d’une nouvelle politique du médicament qui mène à la régulation du médicament traditionnel. Un des principaux problèmes dans la prise en charge du VIH/sida au Viêt Nam fut l’absence de médicaments appropriés, efficaces et accessibles. Contrairement à la Chine, la médecine traditionnelle au Viêt Nam ne s’est pas adaptée, ni n’a réussi à développer durablement de produits spécifiques. Pourtant, l’OMS favorise et incite les thérapeutes traditionnels à participer et à proposer des solutions et pas seulement dans le cadre de soins complémentaires ou palliatifs. On a pu parfois même observer des attitudes plutôt répressives de la part des autorités vietnamiennes à l’égard d’un médicament traditionnel qui n’était pas passé par l’evidence based medicine. En revanche, contrairement à la Chine, le Viêt Nam s’est orienté vers une production locale de médicaments génériques pour répondre aux besoins locaux et baisser le coût de la prise en charge du VIH. À l’aide d’une analyse de contenu de la presse vietnamienne sur le sujet nous tenterons de comprendre les enjeux politiques, économiques et culturels qui se cachent derrière le faible développement de médicaments traditionnels dans le cadre de la prise en charge du VIH/sida. Nous montrerons que l’occidentalisation pendant la période coloniale, l’ouverture du pays depuis le début des années 1990, la globalisation (vue ici comme la multiplication des échanges avec les pays occidentaux et l’intégration du Viêt Nam au reste du monde et à l’ASEAN et la chaîne de production du médicament pharmaceutique ont modifié les pratiques de pluralisme médicamenteux ainsi que la politique nationale en matière de santé, avec des implications à plus ou moins long terme sur les pratiques

Delivery cost of human papillomavirus vaccination of young adolescent girls in Peru, Uganda and Viet Nam.

Science.gov (United States)

Levin, Carol E; Van Minh, Hoang; Odaga, John; Rout, Swampa Sarit; Ngoc, Diep Nguyen Thi; Menezes, Lysander; Araujo, Maria Ana Mendoza; LaMontagne, D Scott

2013-08-01

To estimate the incremental delivery cost of human papillomavirus (HPV) vaccination of young adolescent girls in Peru, Uganda and Viet Nam. Data were collected from a sample of facilities that participated in five demonstration projects for hpv vaccine delivery: school-based delivery was used in Peru, Uganda and Viet Nam; health-centre-based delivery was also used in Viet Nam; and integrated delivery, which involved existing health services, was also used in Uganda. Microcosting methods were used to guide data collection on the use of resources (i.e. staff, supplies and equipment) and data were obtained from government, demonstration project and health centre administrative records. Delivery costs were expressed in 2009 United States dollars (US$). Exclusively project-related expenses and the cost of the vaccine were excluded. The economic delivery cost per vaccine dose ranged from US$ 1.44 for integrated outreach in Uganda to US$ 3.88 for school-based delivery in Peru. In Viet Nam, the lowest cost per dose was US$ 1.92 for health-centre-based delivery. Cost profiles revealed that, in general, the largest contributing factors were project start-up costs and recurrent personnel costs. The delivery cost of HPV vaccine was higher than published costs for traditional vaccines recommended by the Expanded Programme on Immunization (EPI). The cost of delivering HPV vaccine to young adolescent girls in Peru, Uganda and Viet Nam was higher than that for vaccines currently in the EPI schedule. The cost per vaccine dose was lower when delivery was integrated into existing health services.

Circulation of influenza B lineages in northern Viet Nam, 2007-2014.

Science.gov (United States)

Le, Thi Thanh; Pham, Thu Hang; Pham, Thi Hien; Nguyen, Le Khanh Hang; Nguyen, Co Thach; Hoang, Vu Mai Phuong; Tran, Thu Huong; Nguyen, Vu Son; Ngo, Huong Giang; Le, Quynh Mai

2015-01-01

Influenza B viruses circulate throughout Viet Nam, and their activities vary by region. There have been two antigenically distinct lineages of influenza B viruses co-circulating in the past 20 years; however, only one lineage is selected as a component of contemporary trivalent seasonal influenza vaccines. To improve the understanding of circulating influenza B lineages and influenza vaccine mismatches, we report the virus lineages circulating in northern Viet Nam over an eight-year period (2007-2014). Lineages of 331 influenza B viruses were characterized by haemagglutination inhibition assay against standard reference ferret (Yamagata) and sheep (Victoria) antisera. Sequence analysis of the haemagglutinin gene was performed in 64 selected influenza B isolates. The proportion of influenza B lineages changed by year. The Yamagata lineage predominated in 2007, 2008 and 2012; the Victoria lineage predominated in 2009-2014 except 2012. The two lineages showed continuous evolution over time. The Northern Hemisphere's influenza vaccine components were mismatched with the predominant circulating viruses in 2007, 2009 and 2014. The seasonality of influenza B activity is more variable in tropical and subtropical regions than in temperate zones. Our data showed a common co-circulation of both influenza B lineages in northern Viet Nam, and it was difficult to predict which one was the predominant lineage. Quadrivalent influenza vaccines containing both lineages may improve the effectiveness of influenza vaccine programmes in the future.

The fourth national anti-tuberculosis drug resistance survey in Viet Nam.

Science.gov (United States)

Nhung, N V; Hoa, N B; Sy, D N; Hennig, C M; Dean, A S

2015-06-01

Viet Nam's Fourth National Anti-Tuberculosis Drug Resistance Survey was conducted in 2011. To determine the prevalence of resistance to the four main first-line anti-tuberculosis drugs in Viet Nam. Eighty clusters were selected using a probability proportion to size approach. Drug susceptibility testing (DST) against the four main first-line anti-tuberculosis drugs was performed. A total of 1629 smear-positive tuberculosis (TB) patients were eligible for culture. Of these, DST results were available for 1312 patients, including 1105 new TB cases, 195 previously treated TB cases and 12 cases with an unknown treatment history. The proportion of cases with resistance to any drug was 32.7% (95%CI 29.1-36.5) among new cases and 54.2% (95%CI 44.3-63.7) among previously treated cases. The proportion of multidrug-resistant TB (MDR-TB) cases was 4.0% (95%CI 2.5-5.4) in new cases and 23.3 (95%CI 16.7-29.9) in previously treated cases. The fourth drug resistance survey in Viet Nam found that the proportion of MDR-TB among new and previously treated cases was not significantly different from that in the 2005 survey. The National TB Programme should prioritise the detection and treatment of MDR-TB to reduce transmission of MDR-TB in the community.

River Basin Water Assessment and Balance in fast developing areas in Viet Nam

Science.gov (United States)

Le, Van Chin; Ranzi, Roberto

2010-05-01

Uneven precipitation in space and time together with mismanagement and lack of knowledge about quantity and quality of water resources, have caused water shortages for water supply to large cities and irrigation areas in many regions of Viet Nam in the dry season. The rainy season (from June to October) counts for 80% of the total annual rainfall, while the water volume of dry season (from November to May of the following year) accounts for 20% only. Lack of sufficient water volumes occurs in some areas where the pressure of a fast increasing population (1.3% per year on average in the last decade in Viet Nam), intensive agricultural and industrial uses is one of the major problems facing sustainable development. For those areas an accurate water assessment and balance at the riverbasin scale is needed to manage the exploitation and appropriate use of water resources and plan future development. The paper describes the preliminary phase of the pilot development of the river basin water balance for the Day River Basin in the Red River delta in Viet Nam. The Day river basin includes a 7,897 km² area in the south-western part of the Red River in Viet Nam. The total population in the Day river basin exceeds 8 millions inhabitants, including the Hanoi capital, Nam Dinh and other large towns. Agricultural land covered 390,294 ha in 2000 and this area is going to be increased by 14,000 ha in 2010 due to land reclamation and expansion toward the sea. Agricultural uses exploit about 90% of surface water resources in the Day river basin but have to compete with industrial and civil needs in the recent years. At the background of the brief characterization of the Day River Basin, we concentrate on the application of a water balance model integrated by an assessment of water quality after consumptive uses for civil, agricultural and industrial needs to assist water management in the basin. In addition, future development scenarios are taken into account, considering less

Antibiotic use and resistance in emerging economies: a situation analysis for Viet Nam.

Science.gov (United States)

Nguyen, Kinh Van; Thi Do, Nga Thuy; Chandna, Arjun; Nguyen, Trung Vu; Pham, Ca Van; Doan, Phuong Mai; Nguyen, An Quoc; Thi Nguyen, Chuc Kim; Larsson, Mattias; Escalante, Socorro; Olowokure, Babatunde; Laxminarayan, Ramanan; Gelband, Hellen; Horby, Peter; Thi Ngo, Ha Bich; Hoang, Mai Thanh; Farrar, Jeremy; Hien, Tran Tinh; Wertheim, Heiman F L

2013-12-10

Antimicrobial resistance is a major contemporary public health threat. Strategies to contain antimicrobial resistance have been comprehensively set forth, however in developing countries where the need for effective antimicrobials is greatest implementation has proved problematic. A better understanding of patterns and determinants of antibiotic use and resistance in emerging economies may permit more appropriately targeted interventions.Viet Nam, with a large population, high burden of infectious disease and relatively unrestricted access to medication, is an excellent case study of the difficulties faced by emerging economies in controlling antimicrobial resistance. Our working group conducted a situation analysis of the current patterns and determinants of antibiotic use and resistance in Viet Nam. International publications and local reports published between 1-1-1990 and 31-8-2012 were reviewed. All stakeholders analyzed the findings at a policy workshop and feasible recommendations were suggested to improve antibiotic use in Viet Nam.Here we report the results of our situation analysis focusing on: the healthcare system, drug regulation and supply; antibiotic resistance and infection control; and agricultural antibiotic use. Market reforms have improved healthcare access in Viet Nam and contributed to better health outcomes. However, increased accessibility has been accompanied by injudicious antibiotic use in hospitals and the community, with predictable escalation in bacterial resistance. Prescribing practices are poor and self-medication is common - often being the most affordable way to access healthcare. Many policies exist to regulate antibiotic use but enforcement is insufficient or lacking.Pneumococcal penicillin-resistance rates are the highest in Asia and carbapenem-resistant bacteria (notably NDM-1) have recently emerged. Hospital acquired infections, predominantly with multi-drug resistant Gram-negative organisms, place additional strain on

Towards a lifelong learning society through reading promotion: Opportunities and challenges for libraries and community learning centres in Viet Nam

Science.gov (United States)

Hossain, Zakir

2016-04-01

The government of Viet Nam has made a commitment to build a Lifelong Learning Society by 2020. A range of related initiatives have been launched, including the Southeast Asian Ministers of Education Organization Centre for Lifelong Learning (SEAMEO CELLL) and "Book Day" - a day aimed at encouraging reading and raising awareness of its importance for the development of knowledge and skills. Viet Nam also aims to implement lifelong learning (LLL) activities in libraries, museums, cultural centres and clubs. The government of Viet Nam currently operates more than 11,900 Community Learning Centres (CLCs) and is in the process of both renovating and innovating public libraries and museums throughout the country. In addition to the work undertaken by the Viet Nam government, a number of enterprises have been initiated by non-governmental organisations and non-profit organisations to promote literacy and lifelong learning. This paper investigates some government initiatives focused on libraries and CLCs and their impact on reading promotion. Proposing a way forward, the paper confirms that Viet Nam's libraries and CLCs play an essential role in promoting reading and building a LLL Society.

Completeness and consistency in recording information in the tuberculosis case register, Cambodia, China and Viet Nam.

Science.gov (United States)

Hoa, N B; Wei, C; Sokun, C; Lauritsen, J M; Rieder, H L

2010-10-01

Tuberculosis (TB) case registers in Cambodia, two provinces in China and in Viet Nam. To determine completeness and consistency of information for quarterly reports on case finding and treatment outcome. A representative sample of TB case registers was selected in Cambodia, in two provinces in China and in Viet Nam. Quarterly reports were reproduced from double-entered, validated data to determine completeness and consistency. The dataset comprised 37,635 patient records in 2 calendar years. Only 0.2%, 3.6% and 1.1% of cases, respectively, in Cambodia, the two China provinces, and Viet Nam did not allow classification for the quarterly report on case finding. If the treatment outcome was reported as cured, it was correct in 99.9%, 85.7%, and 98.5% of the respective three jurisdictions: errors were mostly due to misclassification of completion as cure. Under-reporting of failures was more frequent than over-reporting in Cambodia and Viet Nam, while in the two provinces in China 84% of reported failures did not actually meet the bacteriological criterion. This evaluation demonstrates that recording essential information is exemplary in all three countries. It will be essential to carefully supervise the ability of staff to correctly define TB treatment outcome results in all three countries.

Innovative data tools: a suite for managing peer outreach to key affected populations in Viet Nam.

Science.gov (United States)

Nga, Nguyen Thien; Jacka, David; Van Hai, Nguyen; Trinh, Nguyen Kieu; Boisen, Neil; Neukom, Josselyn

2012-07-01

The paper tools used to monitor outreach work in all major cities in Viet Nam had substantial writing requirements for each contact with difficulty maintaining confidentiality. This paper describes the development of a Unique Identifier Code (UIC), a field data collection notebook (databook) and a computer data entry system in Viet Nam. The databook can document 40 individual clients and has space for commodity distribution, group contacts and needles/syringe collection for each month. Field implementation trials of the UIC and databook have been undertaken by more than 160 peer outreach workers to document their work with people who inject drugs (PWID) and sex workers (SW). Following an expanded trial in Hai Phong province, there have been requests for national circulation of the databook to be used by peer educators documenting outreach to PWID, SW and men who have sex with men. The standardized UIC and databook, in a variety of locally adapted formats, have now been introduced in more than 40 of the 63 provinces in Viet Nam. This development in Viet Nam is, to our knowledge, the first example of the combination of a confidential UIC and an innovative, simple pocket-sized paper instrument with associated customized data-entry software for documenting outreach.

The promises and perils of hospital autonomy: reform by decree in Viet Nam.

Science.gov (United States)

London, Jonathan D

2013-11-01

This article investigates impacts of hospital autonomization in Viet Nam employing a "decision-space" framework that examines how hospitals have used their increased discretion and to what effect. Analysis suggests autonomization is associated with increased revenue, increasing staff pay, and greater investment in infrastructure and equipment. But autonomization is also associated with more costly and intensive treatment methods of uncertain contribution to the Vietnamese government's stated goal of quality healthcare for all. Impacts of autonomization in district hospitals are less striking. Despite certain limitations, the analysis generates key insights into early stages of hospital autonomization in Viet Nam. Copyright © 2013 The Author. Published by Elsevier Ltd.. All rights reserved.

Evaporation variability of Nam Co Lake in the Tibetan Plateau and its role in recent rapid lake expansion

Science.gov (United States)

Ma, Ning; Szilagyi, Jozsef; Niu, Guo-Yue; Zhang, Yinsheng; Zhang, Teng; Wang, Binbin; Wu, Yanhong

2016-06-01

Previous studies have shown that the majority of the lakes in the Tibetan Plateau (TP) started to expand rapidly since the late 1990s. However, the causes are still not well known. For Nam Co, being a closed lake with no outflow, evaporation (EL) over the lake surface is the only way water may leave the lake. Therefore, quantifying EL is key for investigating the mechanism of lake expansion in the TP. EL can be quantified by Penman- and/or bulk-transfer-type models, requiring only net radiation, temperature, humidity and wind speed for inputs. However, interpolation of wind speed data may be laden with great uncertainty due to extremely sparse ground meteorological observations, the highly heterogeneous landscape and lake-land breeze effects. Here, evaporation of Nam Co Lake was investigated within the 1979-2012 period at a monthly time-scale using the complementary relationship lake evaporation (CRLE) model which does not require wind speed data. Validations by in-situ observations of E601B pan evaporation rates at the shore of Nam Co Lake as well as measured EL over an adjacent small lake using eddy covariance technique suggest that CRLE is capable of simulating EL well since it implicitly considers wind effects on evaporation via its vapor transfer coefficient. The multi-year average of annual evaporation of Nam Co Lake is 635 mm. From 1979 to 2012, annual evaporation of Nam Co Lake expressed a very slight decreasing trend. However, a more significant decrease in EL occurred during 1998-2008 at a rate of -12 mm yr-1. Based on water-level readings, this significant decrease in lake evaporation was found to be responsible for approximately 4% of the reported rapid water level increase and areal expansion of Nam Co Lake during the same period.

Seismic Interpretation of the Nam Con Son Basin and its Implication for the Tectonic Evolution

Directory of Open Access Journals (Sweden)

Nguyen Quang Tuan

2016-06-01

Full Text Available DOI:10.17014/ijog.3.2.127-137The Nam Con Son Basin covering an area of circa 110,000 km2 is characterized by complex tectonic settings of the basin which has not fully been understood. Multiple faults allowed favourable migration passageways for hydrocarbons to go in and out of traps. Despite a large amount of newly acquired seismic and well data there is no significant update on the tectonic evolution and history of the basin development. In this study, the vast amount of seismic and well data were integrated and reinterpreted to define the key structural events in the Nam Con Son Basin. The results show that the basin has undergone two extentional phases. The first N - S extensional phase terminated at around 30 M.a. forming E - W trending grabens which are complicated by multiple half grabens filled by Lower Oligocene sediments. These grabens were reactivated during the second NW - SE extension (Middle Miocene, that resulted from the progressive propagation of NE-SW listric fault from the middle part of the grabens to the margins, and the large scale building up of roll-over structure. Further to the SW, the faults of the second extentional phase turn to NNE-SSW and ultimately N - S in the SW edge of the basin. Most of the fault systems were inactive by Upper Miocene except for the N - S fault system which is still active until recent time.

Deforestation in Viet Nam | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Deforestation in Viet Nam reports on a innovative and timely study by a team of Vietnamese and Canadian researchers. It presents a labourious historical analysis of the smallest changes affecting soil use, forest cover, population, and political and socioeconomic characteristics. The book concludes with suggestions for ...

Enterovirus D68 in Viet Nam (2009-2015 [version 1; referees: 2 approved, 1 approved with reservations

Directory of Open Access Journals (Sweden)

Nguyen Thi Han Ny

2017-06-01

Full Text Available Background: Since 1962, enterovirus D68 (EV-D68 has been implicated in multiple outbreaks and sporadic cases of respiratory infection worldwide, but especially in the USA and Europe with an increasing frequency between 2010 and 2014. We describe the detection, associated clinical features and molecular characterization of EV-D68 in central and southern Viet Nam between 2009 and 2015. Methods: Enterovirus/rhinovirus PCR positive respiratory or CSF samples taken from children and adults with respiratory/central nervous system infections in Viet Nam were tested by an EV-D68 specific PCR. The included samples were derived from 3 different observational studies conducted at referral hospitals across central and southern Viet Nam between 2009 and 2015. Whole-genome sequencing was carried out using a MiSeq based approach. Phylogenetic reconstruction and estimation of evolutionary rate and recombination were carried out in BEAST and Recombination Detection Program, respectively. Results: EV-D68 was detected in 21/625 (3.4% enterovirus/rhinovirus PCR positive respiratory samples but in none of the 15 CSF. All the EV-D68 patients were young children (age range: 11.8 – 24.5 months and had moderate respiratory infections. Phylogenetic analysis suggested that the Vietnamese sequences clustered with those from Asian countries, of which 9 fell in the B1 clade, and the remaining sequence was identified within the A2 clade. One intra sub-clade recombination event was detected, representing the second reported recombination within EV-D68. The evolutionary rate of EV-D68 was estimated to be 5.12E-3 substitutions/site/year. Phylogenetic analysis indicated that the virus was imported into Viet Nam in 2008. Conclusions: We have demonstrated for the first time EV-D68 has been circulating at low levels in Viet Nam since 2008, associated with moderate acute respiratory infection in children. EV-D68 in Viet Nam is most closely related to Asian viruses, and clusters

Ecological Modernisation Theory and Industrialising Economies : The Case of Viet Nam

NARCIS (Netherlands)

Frijns, J.; Phuong Thuy Phung,; Mol, A.P.J.

2000-01-01

As Ecological Modernisation Theory has been developed against the background of European industrialised societies, the value and applicability of Ecological Modernisation Theory for developing or industrialising economies is often questioned. This article explores this controversy by taking Viet Nam

Maternal health care utilization in Viet Nam: increasing ethnic inequity.

Science.gov (United States)

Målqvist, Mats; Lincetto, Ornella; Du, Nguyen Huy; Burgess, Craig; Hoa, Dinh Thi Phuong

2013-04-01

To investigate changes that took place between 2006 and 2010 in the inequity gap for antenatal care attendance and delivery at health facilities among women in Viet Nam. Demographic, socioeconomic and obstetric data for women aged 15-49 years were extracted from Viet Nam's Multiple Indicator Cluster Survey for 2006 (MICS3) and 2010-2011 (MICS4). Multivariate logistic regression was performed to determine if antenatal care attendance and place of delivery were significantly associated with maternal education, maternal ethnicity (Kinh/Hoa versus other), household wealth and place of residence (urban versus rural). These independent variables correspond to the analytical framework of the Commission on Social Determinants of Health. Large discrepancies between urban and rural populations were found in both MICS3 and MICS4. Although antenatal care attendance and health facility delivery rates improved substantially between surveys (from 86.3 to 92.1% and from 76.2 to 89.7%, respectively), inequities increased, especially along ethnic lines. The risk of not giving birth in a health facility increased significantly among ethnic minority women living in rural areas. In 2006 this risk was nearly five times higher than among women of Kinh/Hoa (majority) ethnicity (odds ratio, OR: 4.67; 95% confidence interval, CI: 2.94-7.43); in 2010-2011 it had become nearly 20 times higher (OR: 18.8; 95% CI: 8.96-39.2). Inequity in maternal health care utilization has increased progressively in Viet Nam, primarily along ethnic lines, and vulnerable groups in the country are at risk of being left behind. Health-care decision-makers should target these groups through affirmative action and culturally sensitive interventions.

Criteria for prioritization of HIV programs in Viet Nam: a discrete choice experiment.

Science.gov (United States)

Safarnejad, Ali; Pavlova, Milena; Son, Vo Hai; Phuong, Huynh Lan; Groot, Wim

2017-11-13

With the decline in funding for Viet Nam's response to the HIV epidemic, there is a need for evidence on the criteria to guide the prioritization of HIV programs. There is a gap in the research on the relative importance of multiple criteria for prioritizing a package of interventions. This study elicits preferences and the trade-offs made between different HIV programs by relevant stakeholders and decision-makers in Viet Nam. It also pays attention to how differences in social and professional characteristics of stakeholders and their agency affiliations shape preferences for HIV program criteria in Viet Nam. This study uses self-explicated ranking and discrete choice experiments to determine the relative importance of five criteria - effectiveness, feasibility, cost-effectiveness, rate of investment and prevention/treatment investment ratio - to stakeholders when they evaluate and select hypothetical HIV programs. The study includes 69 participants from government, civil society, and international development partners. Results of the discrete choice experiment show that overall the feasibility criterion is ranked highest in importance to the participants when choosing a hypothetical HIV program, followed by sustainability, treatment to prevention spending ratio, and effectiveness. The participant's work in management, programming, or decision-making has a significant effect on the importance of some criteria to the participant. In the self-explicated ranking effectiveness is the most important criterion and the cost-effectiveness criterion ranks low in importance across all groups. This study has shown that the preferred HIV program in Viet Nam is feasible, front-loaded for sustainability, has a higher proportion of investment on prevention, saves more lives and prevents more infections. Similarities in government and civil society rankings of criteria can create common grounds for future policy dialogues between stakeholders. Innovative models of planning should

Some Aspects of the Teaching of English in Viet Nam.

Science.gov (United States)

Le Van Diem

In regard to the teaching of English, which is replacing French as a foreign language, Viet Nam presents some unique aspects and some individual problems. More secondary school students are selecting English as their foreign language choice; English departments in the universities are expanding rapidly; the teacher shortage is increasing. One…

Drill bit seismic, vertical seismic profiling, and seismic depth imaging to aid drilling decisions in the Tho Tinh structure, Nam Con Son basin, Vietnam

Energy Technology Data Exchange (ETDEWEB)

Borland, W; Hayashida, N; Kusaka, H; Leaney, W; Nakanishi, S

1996-10-01

This paper reviews the problem of overpressure, a common reason for acquiring look-ahead VSPs, and the seismic trace inversion problem, a fundamental issue in look-ahead prediction. The essential components of intermediate VSPs were examined from acquisition through processing to inversion, and recently acquired real data were provided, which were indicative of the advances being made toward developing an exclusive high resolution VSP service. A simple interpretation method and an end product of predicted mud weight versus depth were also presented, which were obtained from the inverted acoustic impedance and empirical relations. Of paramount importance in predicting the depth to a target was the velocity function used below the intermediate TD. The use of empirical or assumed density functions was an obvious weak link in the procedure. The advent of real-time time-depth measurements from drill bit seismic allowed a continuously updated predicted target depth below the present bit depth. 8 refs., 7 figs.

Climate change and development responses on agriculture in Quang Nam Province Vietnam

DEFF Research Database (Denmark)

Schroll, Henning; Andersen, Jan; Lund, Søren

2011-01-01

to document the influence of climate change on the agriculture of Quang Nam. Administratively, agriculture in Quang Nam includes the three sectors: farming, forestry and aquaculture. From interviews we found that many Vietnamese authorities and farmers were convinced that today climate changes impact farming......, forestry and aquaculture and consequently different kinds of adaptations have been introduced. We wanted to study the development in agriculture in order to scrutinize if climate events had major impacts on productivity of the three sectors. An overview of agricultural changes was provided through...... statistics and interviews and important climate impacts and adaptations were identified and assessed. An energy flow method was used to describe the agricultural situation. During the last decade the study showed that farmers in the agricultural field had increased the productivity and they performed strong...

The Scientific and Technical Revolution in the Socialist Republic of Viet Nam.

Science.gov (United States)

Vien, Nguyen Khac

1979-01-01

Discussed are the reasons for the Socialist Republic of Viet Nam's scientific backwardness. A development project which will enable this country to become a modern, economically self-sufficient country by the year 2000 is outlined. (BT)

Time to unsuccessful tuberculosis treatment outcome, Cambodia, China, and Viet Nam

DEFF Research Database (Denmark)

Hoa, N B; Sokun, C; Wei, C

2012-01-01

OBJECTIVE: To determine the frequency and characteristics of patients with unsuccessful tuberculosis (TB) treatment. METHODS: Random selection of TB case registers among all treatment units in Cambodia, two provinces in China, and Viet Nam. The data of two calendar years were analyzed to assess u...

Osmanlı Devletinin Son Yıllarında Ağnam Vergisine Yapılan Zamlar Rise In Ağnam (Sheep Tax In The Recent Years Of Ottoman State

Directory of Open Access Journals (Sweden)

Ünal TAŞKIN

2013-07-01

Full Text Available People generally known as rayah in Ottoman State had some responsibilities to state. Among these responsibilities there were tax figures to be paid about agricultural and husbandry facilities. Each rayah doing husbandry facilities made payments in certain rates according to animal breed fed. Known as the tax of sheep and goat in the classical time of state, sheep tax gained a more general meaning and was subject to new regulations. It was initiated to be collected with a method called mukataa and expressing a certain amount determined in advance since the XVII. century of Ottoman State. Called as sheep tax mukataa, this income became one the most important figure of central treasury. Since the XIX. by abandoning the collection in kind method additional taxes with various names were also abolished.The price determined as the amount of tax was too much for some regions of the state because of regional differences in sheep prices. Because of this it was initiated to determine how much income was gained from the milk and wool of sheep and goat according to each region with the new regulation since the second part of the XIX. century. Determined by local administrations seperately, the tax figure of these amounts were determined in central office.As the rise in the taxes caused a negative effect on public, they were read justed towards the end of XIX. century. Reasons such as the current social situation of state, the worry of fund raising and political events caused changes in the encashment of taxes called as ağnam group. In ourwork the eight fold rise in ağnam tax which is accepted as one of the most important sources for recovering budget deficit of Ottoman State is goingto be studied. Osmanlı Devleti’nde reaya genel adıyla bilinen halkın, devletekarşı birtakım mükellefiyetleri vardı. Bu mükellefiyetler içerisinde,tarım ve hayvancılık faaliyetlerinden kaynaklı, ödenmesi gereken vergikalemleri mevcuttu. Hayvanc

Psychological and social factors associated with late pregnancy iron deficiency anaemia in rural Viet Nam: a population-based prospective study.

Science.gov (United States)

Tran, Thach Duc; Biggs, Beverley-Ann; Tran, Tuan; Casey, Gerard J; Hanieh, Sarah; Simpson, Julie Anne; Dwyer, Terence; Fisher, Jane

2013-01-01

The aim of this study was to examine the relationships between psychological and social factors and late pregnancy IDA among pregnant women in rural Viet Nam. Pregnant women from 50 randomly-selected communes within Ha Nam province were recruited and assessed at 12 - 20 weeks gestation (Wave 1, W1). They were followed up in the last trimester (Wave 2, W2). IDA was defined as Haemoglobin Viet Nam. The link between them suggests that while direct recommendations to use iron supplements are important, the social factors associated with common mental disorders should be addressed in antenatal care in order to improve the health of pregnant women and their infants.

The formulation and implementation of a national helmet law: a case study from Viet Nam.

Science.gov (United States)

Passmore, Jonathon W; Nguyen, Lan Huong; Nguyen, Nam Phuong; Olivé, Jean-Marc

2010-10-01

Road traffic injuries are a leading cause of death and disability in Viet Nam. In 2008, official data reported 11 243 deaths and 7771 serious injuries on the roads, of which an estimated 60% of fatalities occur in motorcycle riders and passengers. In recognition of this problem, Viet Nam has had partial motorcycle helmet legislation since 1995. However, for a variety of reasons, implementation and enforcement have been limited. On 15 December 2007, Viet Nam's first comprehensive mandatory helmet law came into effect, covering all riders and passengers on all roads nationwide. Penalties increased ten-fold and cohorts of police were mobilized for enforcement. The Viet Nam national helmet legislation was developed and implemented by the National Traffic Safety Committee. Despite past barriers to enforcement, increased policing in 2008 led to 680 000 infringements being issued for non-helmet wearing. While changes in helmet wearing were not nationally observed, significant increases were documented in selected provinces in the first six months of the law's introduction. In Da Nang, helmet wearing increased from 27 to 99%. In the first three months after the law took effect, surveillance data from 20 urban and rural hospitals, found the risk of road traffic head injuries and deaths decreased by 16% and 18% respectively. Political leadership, intensive advanced public education and stringent enforcement have contributed to the successful implementation of the new law. Through continual monitoring of the legislation, loopholes detrimental to the effectiveness of the law have been identified and addressed.

Tax Rates Effects on the Risk Level of Listed Viet Nam Wholesale ...

African Journals Online (AJOL)

user

The emerging stock market in Viet Nam has been developed since 2006 and was affected ... positive relationship with the increasing levels of tax rate. Finally, this ... Hypothesis 1: because tax may strongly affect business returns, changing tax.

Inclusion in Viet Nam: More than a Decade of Implementation.

Science.gov (United States)

Villa, Richard A.; Tac, Le Van; Muc, Pham Minh; Ryan, Susan; Thuy, Nguyen Thi Minh; Weill, Cindy; Thousand, Jacqueline S.

2003-01-01

This article traces the evolution of special education policies and services and the introduction of inclusive education as a service delivery model in Viet Nam. The impact of a series of inclusion projects and resultant goals of the Ministry of Education and Training to expand inclusive education are described. (Contains 8 references.) (Author/CR)

Financial burden of household out-of pocket health expenditure in Viet Nam: findings from the National Living Standard Survey 2002-2010.

Science.gov (United States)

Van Minh, Hoang; Kim Phuong, Nguyen Thi; Saksena, Priyanka; James, Chris D; Xu, Ke

2013-11-01

In Viet Nam, household direct out-of-pocket (OOP) health expenditure as a share of the total health expenditure has been always high, ranging from 50% to 70%. The high share of OOP expenditure has been linked to different inequity problems such as catastrophic health expenditure (households must reduce their expenditure on other necessities) and impoverishment. This paper aims to examine catastrophic and poverty impacts of household out-of-pocket health expenditure in Viet Nam over time and identify socio-economic indicators associated with them. Data used in this research were obtained from a nationally representative household survey, Viet Nam Living Standard Survey 2002, 2004, 2006, 2008 and 2010. The findings revealed that there were problems in health care financing in Viet Nam - many households encountered catastrophic health expenditure and/or were pushed into poverty due to health care payments. The issues were pervasive over time. Catastrophic expenditure and impoverishment problems were more common among the households who had more elderly people and those located in rural areas. Importantly, the financial protection aspect of the national health insurance schemes was still modest. Given these findings, more attention is needed on developing methods of financial protection in Viet Nam. Copyright © 2012 Elsevier Ltd. All rights reserved.

Circulation of influenza B lineages in northern Viet Nam, 2007–2014

Science.gov (United States)

Le, Thi Thanh; Pham, Thu Hang; Pham, Thi Hien; Nguyen, Le Khanh Hang; Hoang, Vu Mai Phuong; Tran, Thu Huong; Nguyen, Vu Son; Ngo, Huong Giang

2015-01-01

Introduction Influenza B viruses circulate throughout Viet Nam, and their activities vary by region. There have been two antigenically distinct lineages of influenza B viruses co-circulating in the past 20 years; however, only one lineage is selected as a component of contemporary trivalent seasonal influenza vaccines. To improve the understanding of circulating influenza B lineages and influenza vaccine mismatches, we report the virus lineages circulating in northern Viet Nam over an eight-year period (2007–2014). Methods Lineages of 331 influenza B viruses were characterized by haemagglutination inhibition assay against standard reference ferret (Yamagata) and sheep (Victoria) antisera. Sequence analysis of the haemagglutinin gene was performed in 64 selected influenza B isolates. Results The proportion of influenza B lineages changed by year. The Yamagata lineage predominated in 2007, 2008 and 2012; the Victoria lineage predominated in 2009–2014 except 2012. The two lineages showed continuous evolution over time. The Northern Hemisphere’s influenza vaccine components were mismatched with the predominant circulating viruses in 2007, 2009 and 2014. Discussion The seasonality of influenza B activity is more variable in tropical and subtropical regions than in temperate zones. Our data showed a common co-circulation of both influenza B lineages in northern Viet Nam, and it was difficult to predict which one was the predominant lineage. Quadrivalent influenza vaccines containing both lineages may improve the effectiveness of influenza vaccine programmes in the future. PMID:26798557

Supply- and Demand-Side Factors Influencing Utilization of Infant and Young Child Feeding Counselling Services in Viet Nam.

Science.gov (United States)

Nguyen, Phuong H; Kim, Sunny S; Nguyen, Tuan T; Tran, Lan M; Hajeebhoy, Nemat; Frongillo, Edward A; Ruel, Marie T; Rawat, Rahul; Menon, Purnima

2016-01-01

Adequate utilization of services is critical to maximize the impact of counselling on infant and young child feeding (IYCF), but little is known about factors affecting utilization. Our study examined supply- and demand-side factors associated with the utilization of IYCF counselling services in Viet Nam. We used survey data from mothers with children Viet Nam, and may be relevant for increasing and sustaining use of nutrition services in similar contexts.

Viet Nam at the Crossroads: The Role of Science and Technology ...

International Development Research Centre (IDRC) Digital Library (Canada)

In response, IDRC and CIDA assembled a team of experts into a mission with the following objectives: Assess the impact of current Vietnamese science and technology policies on the economic and social development of Viet Nam;. Compare the Vietnamese experience with regard to science and technology policies with ...

Surface ozone at Nam Co in the inland Tibetan Plateau: variation, synthesis comparison and regional representativeness

Directory of Open Access Journals (Sweden)

X. Yin

2017-09-01

Full Text Available Ozone is an important pollutant and greenhouse gas, and tropospheric ozone variations are generally associated with both natural and anthropogenic processes. As one of the most pristine and inaccessible regions in the world, the Tibetan Plateau has been considered as an ideal region for studying processes of the background atmosphere. Due to the vast area of the Tibetan Plateau, sites in the southern, northern and central regions exhibit different patterns of variation in surface ozone. Here, we present continuous measurements of surface ozone mixing ratios at Nam Co Station over a period of  ∼ 5 years (January 2011 to October 2015, which is a background site in the inland Tibetan Plateau. An average surface ozone mixing ratio of 47.6 ± 11.6 ppb (mean ± standard deviation was recorded, and a large annual cycle was observed with maximum ozone mixing ratios in the spring and minimum ratios during the winter. The diurnal cycle is characterized by a minimum in the early morning and a maximum in the late afternoon. Nam Co Station represents a background region where surface ozone receives negligible local anthropogenic emissions inputs, and the anthropogenic contribution from South Asia in spring and China in summer may affect Nam Co Station occasionally. Surface ozone at Nam Co Station is mainly dominated by natural processes involving photochemical reactions, vertical mixing and downward transport of stratospheric air mass. Model results indicate that the study site is affected differently by the surrounding areas in different seasons: air masses from the southern Tibetan Plateau contribute to the high ozone levels in the spring, and enhanced ozone levels in the summer are associated with air masses from the northern Tibetan Plateau. By comparing measurements at Nam Co Station with those from other sites on the Tibetan Plateau, we aim to expand the understanding of ozone cycles and transport processes over the Tibetan Plateau

Surface ozone at Nam Co in the inland Tibetan Plateau: variation, synthesis comparison and regional representativeness

Science.gov (United States)

Yin, Xiufeng; Kang, Shichang; de Foy, Benjamin; Cong, Zhiyuan; Luo, Jiali; Zhang, Lang; Ma, Yaoming; Zhang, Guoshuai; Rupakheti, Dipesh; Zhang, Qianggong

2017-09-01

Ozone is an important pollutant and greenhouse gas, and tropospheric ozone variations are generally associated with both natural and anthropogenic processes. As one of the most pristine and inaccessible regions in the world, the Tibetan Plateau has been considered as an ideal region for studying processes of the background atmosphere. Due to the vast area of the Tibetan Plateau, sites in the southern, northern and central regions exhibit different patterns of variation in surface ozone. Here, we present continuous measurements of surface ozone mixing ratios at Nam Co Station over a period of ˜ 5 years (January 2011 to October 2015), which is a background site in the inland Tibetan Plateau. An average surface ozone mixing ratio of 47.6 ± 11.6 ppb (mean ± standard deviation) was recorded, and a large annual cycle was observed with maximum ozone mixing ratios in the spring and minimum ratios during the winter. The diurnal cycle is characterized by a minimum in the early morning and a maximum in the late afternoon. Nam Co Station represents a background region where surface ozone receives negligible local anthropogenic emissions inputs, and the anthropogenic contribution from South Asia in spring and China in summer may affect Nam Co Station occasionally. Surface ozone at Nam Co Station is mainly dominated by natural processes involving photochemical reactions, vertical mixing and downward transport of stratospheric air mass. Model results indicate that the study site is affected differently by the surrounding areas in different seasons: air masses from the southern Tibetan Plateau contribute to the high ozone levels in the spring, and enhanced ozone levels in the summer are associated with air masses from the northern Tibetan Plateau. By comparing measurements at Nam Co Station with those from other sites on the Tibetan Plateau, we aim to expand the understanding of ozone cycles and transport processes over the Tibetan Plateau. This work may provide a

Childhood tuberculosis in northern Viet Nam: a review of 103 cases.

Science.gov (United States)

Blount, Robert J; Tran, Bao; Jarlsberg, Leah G; Phan, Ha; Thanh Hoang, Van; Nguyen, Nhung Viet; Lewinsohn, Deborah A; Nahid, Payam

2014-01-01

Childhood tuberculosis causes significant morbidity and mortality in Southeast Asia, yet little is known about the epidemiology and clinical characteristics of this disease in Viet Nam. To determine the demographics, clinical presentations, radiographic and microbiologic findings, treatment regimens, and outcomes of children admitted with tuberculosis (TB) to a national referral hospital in Viet Nam. We conducted a retrospective case series study of children ≤ 15 years old with bacteriologically confirmed or clinically diagnosed TB admitted to a national referral hospital in Ha Noi, Viet Nam from January through December 2007. One hundred three children were identified: median age 5 years (IQR 2-10), 44% female, 99% Kinh ethnicity, 27% residing in Ha Noi, 88% with BCG vaccination, 27% with known TB contact, and 38% malnourished. Intrathoracic TB was present in 62%, extrathoracic in 52%, both intra and extrathoracic in 19%, and undetermined site in 5%. The most common extrathoracic manifestation was peripheral lymphadenitis, and children under 5 were more likely to have miliary TB or both intra and extrathoracic TB. Fever and failure to thrive were common presenting symptoms among all participants (65% and 56%, respectively), 66% of those with intrathoracic TB presented with cough, and 92% of those with TB meningitis presented with severe neurologic impairment. Acid-fast bacilli smears and mycobacterial cultures were positive in 18% and 21% of children tested, and histopathology was positive in 88% of those biopsied. There were no adverse drug reactions necessitating change in therapy, and no inpatient mortality. Extrathoracic TB was common, treatment well tolerated and clinical outcomes excellent. Culture confirmation rates were low and emphasize the need for improved diagnostics.

Water Isotope framework for lake water balance monitoring and modelling in the Nam Co Basin, Tibetan Plateau

Directory of Open Access Journals (Sweden)

Shichang Kang

2017-08-01

New hydrological insights: A water isotope framework for the Nam Co basin, including the Local Meteoric Water Line, limiting isotopic composition of evaporation and two hypothetical evaporation trajectories, is established. We further applied the isotope mass balance model to estimate the overall isotopic composition of input water to the Nam Co, the evaporation over inputs ratios (E/I for three consecutive years, and the water yields (Wy, depth equivalent runoff at a basin scale. Our results clearly suggest a positive water budget (i.e., E/I < 1, providing another line of evidence that the subsurface leakage from Nam Co is likely. The discrepancy between isotope-based water yields estimations and field-based runoff observations suggest that, compared to the well-studied Nyainqentanglha Mountains and southwestern mountains, the ridge-and-valley landscape in the western highlands and northwestern hogbacks are possibly low yields area, which should draw more research attentions in future hydrological investigations.

Phylodynamics of Enterovirus A71-Associated Hand, Foot, and Mouth Disease in Viet Nam.

Science.gov (United States)

Geoghegan, Jemma L; Tan, Le Van; Kühnert, Denise; Halpin, Rebecca A; Lin, Xudong; Simenauer, Ari; Akopov, Asmik; Das, Suman R; Stockwell, Timothy B; Shrivastava, Susmita; Ngoc, Nghiem My; Uyen, Le Thi Tam; Tuyen, Nguyen Thi Kim; Thanh, Tran Tan; Hang, Vu Thi Ty; Qui, Phan Tu; Hung, Nguyen Thanh; Khanh, Truong Huu; Thinh, Le Quoc; Nhan, Le Nguyen Thanh; Van, Hoang Minh Tu; Viet, Do Chau; Tuan, Ha Manh; Viet, Ho Lu; Hien, Tran Tinh; Chau, Nguyen Van Vinh; Thwaites, Guy; Grenfell, Bryan T; Stadler, Tanja; Wentworth, David E; Holmes, Edward C; Van Doorn, H Rogier

2015-09-01

Enterovirus A71 (EV-A71) is a major cause of hand, foot, and mouth disease (HFMD) and is particularly prevalent in parts of Southeast Asia, affecting thousands of children and infants each year. Revealing the evolutionary and epidemiological dynamics of EV-A71 through time and space is central to understanding its outbreak potential. We generated the full genome sequences of 200 EV-A71 strains sampled from various locations in Viet Nam between 2011 and 2013 and used these sequence data to determine the evolutionary history and phylodynamics of EV-A71 in Viet Nam, providing estimates of the effective reproduction number (Re) of the infection through time. In addition, we described the phylogeography of EV-A71 throughout Southeast Asia, documenting patterns of viral gene flow. Accordingly, our analysis reveals that a rapid genogroup switch from C4 to B5 likely took place during 2012 in Viet Nam. We show that the Re of subgenogroup C4 decreased during the time frame of sampling, whereas that of B5 increased and remained >1 at the end of 2013, corresponding to a rise in B5 prevalence. Our study reveals that the subgenogroup B5 virus that emerged into Viet Nam is closely related to variants that were responsible for large epidemics in Malaysia and Taiwan and therefore extends our knowledge regarding its associated area of endemicity. Subgenogroup B5 evidently has the potential to cause more widespread outbreaks across Southeast Asia. EV-A71 is one of many viruses that cause HFMD, a common syndrome that largely affects infants and children. HFMD usually causes only mild illness with no long-term consequences. Occasionally, however, severe infection may arise, especially in very young children, causing neurological complications and even death. EV-A71 is highly contagious and is associated with the most severe HFMD cases, with large and frequent epidemics of the virus recorded worldwide. Although major advances have been made in the development of a potential EV-A71

Prevalence of latent tuberculous infection among adults in the general population of Ca Mau, Viet Nam.

Science.gov (United States)

Marks, G B; Nhung, N V; Nguyen, T A; Hoa, N B; Khoa, T H; Son, N V; Phuong, N T B; Tin, D M; Ho, J; Fox, G J

2018-03-01

The study was conducted in a randomly selected sample of persons aged 15 years living in Ca Mau Province, southern Viet Nam. To estimate the prevalence of latent tuberculous infection (LTBI) in the general adult population of this province of Viet Nam. The secondary objective was to examine age and sex differences in prevalence. A cross-sectional survey was conducted in a cluster-random sample of the population. Clusters were subcommunes. The presence of LTBI was assessed using the QuantiFERON®-TB Gold In-Tube test system. QuantiFERON tests were performed among 1319 persons aged 15 years (77.7% of those selected). The overall prevalence of positive tests was 36.8% (95%CI 33.4-40.3). The prevalence of a positive test was lower in females than in males (31.0% vs. 44.7%, OR 0.57, 95%CI 0.45-0.72, P Viet Nam have evidence of LTBI. Although LTBI prevalence is higher in males, the sex difference is not as great as that for TB notification rates.

Cooperative learning vs confucian heritage culture's collectivism. The analysis in Viet Nam

NARCIS (Netherlands)

Nguyen, Phuong-Mai; Terlouw, C.; Pilot, A.

2005-01-01

Confucian Heritage Cultures (CHC) such as Viet Nam, China, Korea, Japan, Hong Kong and Singapore are proven to share characteristics of Collectivist society. Researchers agree that this collectivist mentality supports cooperation, that CHC’s learners/workers best perform in groups. Not satisfied

The effects of placing an operational research fellow within the Viet Nam National Tuberculosis Programme.

Science.gov (United States)

Hoa, N B; Nhung, N V; Kumar, A M V; Harries, A D

2016-12-21

In April 2009, an operational research fellow was placed within the Viet Nam National Tuberculosis Control Programme (NTP). Over the 6 years from 2010 to 2015, the OR fellow co-authored 21 tuberculosis research papers (as principal author in 15 [71%]). This constituted 23% of the 91 tuberculosis papers published in Viet Nam during this period. Of the 21 published papers, 16 (76%) contributed to changes in policy ( n = 8) and practice ( n = 8), and these in turn improved programme performance. Many papers also contributed important evidence for better programme planning. Highly motivated OR fellows embedded within NTPs can facilitate high-quality research and research uptake.

Acemetacin cocrystal structures by powder X-ray diffraction

Science.gov (United States)

Bolla, Geetha

2017-01-01

Cocrystals of acemetacin drug (ACM) with nicotinamide (NAM), p-aminobenzoic acid (PABA), valerolactam (VLM) and 2-pyridone (2HP) were prepared by melt crystallization and their X-ray crystal structures determined by high-resolution powder X-ray diffraction. The powerful technique of structure determination from powder data (SDPD) provided details of molecular packing and hydrogen bonding in pharmaceutical cocrystals of acemetacin. ACM–NAM occurs in anhydrate and hydrate forms, whereas the other structures crystallized in a single crystalline form. The carboxylic acid group of ACM forms theacid–amide dimer three-point synthon R 3 2(9)R 2 2(8)R 3 2(9) with three different syn amides (VLM, 2HP and caprolactam). The conformations of the ACM molecule observed in the crystal structures differ mainly in the mutual orientation of chlorobenzene fragment and the neighboring methyl group, being anti (type I) or syn (type II). ACM hydrate, ACM—NAM, ACM–NAM-hydrate and the piperazine salt of ACM exhibit the type I conformation, whereas ACM polymorphs and other cocrystals adopt the ACM type II conformation. Hydrogen-bond interactions in all the crystal structures were quantified by calculating their molecular electrostatic potential (MEP) surfaces. Hirshfeld surface analysis of the cocrystal surfaces shows that about 50% of the contribution is due to a combination of strong and weak O⋯H, N⋯H, Cl⋯H and C⋯H interactions. The physicochemical properties of these cocrystals are under study. PMID:28512568

Acemetacin cocrystal structures by powder X-ray diffraction

Directory of Open Access Journals (Sweden)

Geetha Bolla

2017-05-01

Full Text Available Cocrystals of acemetacin drug (ACM with nicotinamide (NAM, p-aminobenzoic acid (PABA, valerolactam (VLM and 2-pyridone (2HP were prepared by melt crystallization and their X-ray crystal structures determined by high-resolution powder X-ray diffraction. The powerful technique of structure determination from powder data (SDPD provided details of molecular packing and hydrogen bonding in pharmaceutical cocrystals of acemetacin. ACM–NAM occurs in anhydrate and hydrate forms, whereas the other structures crystallized in a single crystalline form. The carboxylic acid group of ACM forms theacid–amide dimer three-point synthon R32(9R22(8R32(9 with three different syn amides (VLM, 2HP and caprolactam. The conformations of the ACM molecule observed in the crystal structures differ mainly in the mutual orientation of chlorobenzene fragment and the neighboring methyl group, being anti (type I or syn (type II. ACM hydrate, ACM—NAM, ACM–NAM-hydrate and the piperazine salt of ACM exhibit the type I conformation, whereas ACM polymorphs and other cocrystals adopt the ACM type II conformation. Hydrogen-bond interactions in all the crystal structures were quantified by calculating their molecular electrostatic potential (MEP surfaces. Hirshfeld surface analysis of the cocrystal surfaces shows that about 50% of the contribution is due to a combination of strong and weak O...H, N...H, Cl...H and C...H interactions. The physicochemical properties of these cocrystals are under study.

Touchstone for Japan's Export of nuclear power plant system. Vinh Hai unit 1 and 2 project in the Ninh Thuan province in Viet Nam

International Nuclear Information System (INIS)

Mitsumata, Hiroki; Takekuro, Ichiro; Kaneko, Kumao; Suzuki, Hideaki; Saito, Shinzo

2011-01-01

'Japan-Viet Nam Joint Statement on the Strategic Partnership for Peace and Prosperity in Asia' issued after the meeting between Japan-Viet Nam Prime Ministers on October 31, affirmed that the Vietnamese Government had decided to choose Japan as the cooperation partner for building Vinh Hai Unit 1 and 2 Project in the Ninh Thuan Province, southern Viet Nam, which showed substantially an order of Japan was arranged informally. 'International Nuclear Energy Development of Japan Co., Ltd. (JINED)' set up by industry and government, would negotiate to decide fundamental parameters such as type and power of nuclear power plants with the start of operation scheduled in 2021. This special issue consisted of six articles on significance of the project of Japan's first export, feasibility studies and future perspective and regional effects with introduction of nuclear power station in Viet Nam. (T. Tanaka)

Foot-and-mouth disease virus typing from foot-and-mouth outbreaks in the central provinces of Viet Nam

International Nuclear Information System (INIS)

Nguyen Luong Hien

2000-01-01

A total of 167 tissue samples were collected from Foot-and-mouth disease (FMD) infected animals from 57 FMD outbreaks to detect the sero-type of the FMD virus by the ELISA technique. The ELISA kit has been prepared and standardised by the World Reference Laboratory (WRL), UK and supplied under a Research Contract as part of an FAO/IAEA Co-ordinated Research Project. Eight tissue samples from cattle and one tissue sample from pig were sent to WRL for further study on the sero-type and to characterize the FMD viruses present in Viet Nam. The study was carried out from March 1996 to May 1998 in the central region of Viet Nam and the FMD type O virus was detected in these outbreaks only. The FMD type O virus from cattle and the FMD type O virus from pig are two distinct FMD type O viruses in Viet Nam. (author)

Clinical and Molecular Epidemiology of Human Parainfluenza Viruses 1-4 in Children from Viet Nam.

Science.gov (United States)

Linster, Martin; Do, Lien Anh Ha; Minh, Ngo Ngoc Quang; Chen, Yihui; Zhe, Zhu; Tuan, Tran Anh; Tuan, Ha Manh; Su, Yvonne C F; van Doorn, H Rogier; Moorthy, Mahesh; Smith, Gavin J D

2018-05-01

HPIVs are serologically and genetically grouped into four species that account for up to 10% of all hospitalizations due to acute respiratory infection in children under the age of five. Genetic and epidemiological data for the four HPIVs derived from two pediatric cohorts in Viet Nam are presented. Respiratory samples were screened for HPIV1-4 by real-time PCR. Demographic and clinical data of patients infected with different HPIV were compared. We used a hemi-nested PCR approach to generate viral genome sequences from HPIV-positive samples and conducted a comprehensive phylogenetic analysis. In total, 170 samples tested positive for HPIV. HPIV3 was most commonly detected in our cohort and 80 co-detections of HPIV with other respiratory viruses were found. Phylogenetic analyses suggest local endemic circulation as well as punctuated introductions of new HPIV lineages. Viral gene flow analysis revealed that Viet Nam is a net importer of viral genetic diversity. Epidemiological analyses imply similar disease severity for all HPIV species. HPIV sequences from Viet Nam formed local clusters and were interspersed with sequences from diverse geographic regions. Combined, this new knowledge will help to investigate global HPIV circulation patterns in more detail and ultimately define more suitable vaccine strains.

Le Recul de la Forêt au Viet Nam

International Development Research Centre (IDRC) Digital Library (Canada)

Le fait d'ignorer la réalité pragmatique dans un souci d'opportunisme politique ne ... Si le texte de l'étude que voici a été rédigé en solo, les choses ont été fort différentes sur ..... Parmi les ressources requises par le système mondial — mis en place par les .... Les guerres dont le Viet Nam a été le théâtre au cours du dernier ...

Identifying factors for job motivation of rural health workers in North Viet Nam

NARCIS (Netherlands)

Dieleman, Marjolein; Cuong, Pham Viet; Anh, Le Vu; Martineau, Tim

2003-01-01

BACKGROUND: In Viet Nam, most of the public health staff (84%) currently works in rural areas, where 80% of the people live. To provide good quality health care services, it is important to develop strategies influencing staff motivation for better performance. METHOD: An exploratory qualitative

Distance Education Policy and Public Awareness in Cambodia, Laos, and Viet Nam

Science.gov (United States)

Vuth, Doung; Than, Chhuon Chan; Phanousith, Somphone; Phissamay, Phonpasit; Tai, Tran Thi

2007-01-01

The current project brings together academic and governmental specialists from Cambodia, Laos, and Viet Nam (CLV), in a collaborative study of the prospects for distance education (DE) in those countries. The study's overall objectives are to: (1) survey and take stock of existing educational scenarios and problems in CLV; (2) document the…

Player or referee? Aid effectiveness and the governance of health policy development: Lessons from Viet Nam.

Science.gov (United States)

Dodd, Rebecca; Olivé, Jean-Marc

2011-01-01

Viet Nam is one of the brightest stars in the constellation of developing countries. Its remarkable achievements in reducing poverty and improving health and education outcomes are well known, and as a result it has enjoyed generous aid programmes. Viet Nam also has a reputation for taking a strong lead in disciplining its donors and pushing for more efficient and effective forms of aid delivery, both at home and internationally. This article discusses how efforts to improve the effectiveness of aid intersect with policy-making processes in the health sector. It presents a quantitative review of health aid flows in Viet Nam and a qualitative analysis of the aid environment using event analysis, participant observation and key informant interviews. The analysis reveals a complex and dynamic web of incentives influencing the implementation of the aid effectiveness agenda in the health sector. There are contradictory forces within the Ministry of Health, within government as a whole, within the donor community and between donors and government. Analytical frameworks drawn from the study of policy networks and governance can help explain these tensions. They suggest that governance of health aid in Viet Nam is characterised by multiple, overlapping 'policy networks' which cut across the traditional donor-government divide. The principles of aid effectiveness make sense for some of these communities, but for others they are irrational and may lead to a loss of influence and resources. However, sustained engagement combined with the building of strategic coalitions can overcome individual and institutional incentives. This article suggests that aid reform efforts should be understood not as a technocratic agenda but as a political process with all the associated tensions, perverse incentives and challenges. Partners thus need to recognise - and find new ways of making sense of - the complexity of forces affecting aid delivery.

A new nidovirus (NamDinh virus NDiV): Its ultrastructural characterization in the C6/36 mosquito cell line

Energy Technology Data Exchange (ETDEWEB)

Thuy, Nguyen Thanh, E-mail: ngtthuy02@yahoo.com [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Huy, Tran Quang, E-mail: huytq@nihe.org.vn [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Nga, Phan Thi [National Institute of Hygiene and Epidemiology, 1 Yersin Street, Hai Ba Trung District, Hanoi (Viet Nam); Morita, Kouichi [Department of Virology, Institute of Tropical Medicine, Global COE Program, Nagasaki University, Nagasaki (Japan); Dunia, Irene; Benedetti, Lucio [Institut Jacques Monod, UMR7592 Université Paris Diderot/CNRS, Paris (France)

2013-09-15

We describe the ultrastructure of the NamDinh virus (NDiV), a new member of the order Nidovirales grown in the C6/36 mosquito cell line. Uninfected and NDiV-infected cells were investigated by electron microscopy 24–48 h after infection. The results show that the viral nucleocapsid-like particles form clusters concentrated in the vacuoles, the endoplasmic reticulum, and are scattered in the cytoplasm. Mature virions of NDiV were released as budding particles on the cell surface where viral components appear to lie beneath and along the plasma membrane. Free homogeneous virus particles were obtained by ultracentrifugation on sucrose gradients of culture fluids. The size of the round-shaped particles with a complete internal structure was 80 nm in diameter. This is the first study to provide information on the morphogenesis and ultrastructure of the first insect nidovirus NDiV, a missing evolutionary link in the emergence of the viruses with the largest RNA genomes. - Highlights: • NamDinh virus (NDiV), a new member of the order Nidovirales was tested in cultured cell line. • The morphogenesis and ultrastructure of NDiV were investigated by electron microscopy. • The viral nucleocapsid-like particles clustered and scattered in the cytoplasm. • NDiVs were released as budding particles on the cell surface. • The size of the viral particles with a complete internal structure was 80 nm in diameter.

Adequacy of anti-tuberculosis drug prescriptions in Viet Nam

DEFF Research Database (Denmark)

Hoa, N B; Lauritsen, J M; Rieder, H L

2012-01-01

SETTING: National Tuberculosis Program, Viet Nam, 2008. OBJECTIVES: To determine drug prescription adherence to national guidelines, to examine factors associated with an erroneous dosage of rifampin (RMP) and to evaluate the impact of an insufficient RMP dosage on treatment outcome. METHODS......: A representative sample of 30 treatment units was randomly selected. All patient treatment cards enrolled in these units were obtained, and data were double-entered and validated before calculating the adequacy of the individual drug prescriptions. RESULTS: Of 3412 tuberculosis treatment cards, 3225 (94.5%) had...

Co-existence of Paragonimus harinasutai and Paragonimus bangkokensis metacercariae in fresh water crab hosts in central Viet Nam with special emphasis on their close phylogenetic relationship.

Science.gov (United States)

Doanh, Pham Ngoc; Hien, Hoang Van; Nonaka, Nariaki; Horii, Yoichiro; Nawa, Yukifumi

2012-09-01

During our epidemiological surveys for Paragonimus species in central Viet Nam, we found four morphologically different Paragonimus metacercariae in mountainous crabs. They were identified as metacercariae of Paragonimus westermani, P. bangkokensis, P. proliferus, and P. harinasutai in the order of their prevalence in crab hosts. This is the first discovery of P. harinasutai in Viet Nam, co-inhabiting with P. bangkokensis and other species. Metacercariae of P. harinasutai were given orally to a cat to obtain adult worms. Then, ITS2 and CO1 sequences of metacercariae and adults of P. harinasutai, and metacercariae of P. bangkokensis collected from the same place were determined for analyses of phylogenetic relationships to other P. harinasutai and P. bangkokensis populations as well as related species. The results of molecular analyses showed that P. harinasutai from Quang Binh province of central Viet Nam was almost completely identical with those from Vientiane, Lao PDR; P. bangkokensis from Quang Binh, Viet Nam was also almost completely identical with those from Lao PDR and from Quang Ninh province, Viet Nam. Except for one P. harinasutai isolate from China, all populations of P. harinasutai and P. bangkokensis from Thailand, Lao and Viet Nam make a single clade in both ITS2 and CO1 trees. In ITS2 sequences, AT deletion and ATC insertion were observed in some isolates of both species, indicating recent gene flow between P. harinasutai and P. bangkokensis. Moreover, because of their extremely high genetic similarities and their co-inhabitation in the same crab hosts found in Thailand, Lao PDR and Viet Nam, they should be considered as the sister species at the early stage of divergence. In addition, P. microrchis previously described from Yunnan, China should be placed as the synonym of P. harinasutai, because of their morphological and molecular similarities. Copyright © 2012 Elsevier Ireland Ltd. All rights reserved.

Validation and norming of the Intelligibility in Context Scale in Northern Viet Nam.

Science.gov (United States)

Phạm, Ben; McLeod, Sharynne; Harrison, Linda J

2017-01-01

Vietnamese is one of the 20 most commonly spoken languages in the world; however, there are no standardised tools to assess Vietnamese children's speech. This study aimed to validate and norm the Vietnamese version of the Intelligibility in Context Scale (ICS-VN). Data were collected from parents of 181 children (aged 2;0-5;11) living in Ha Noi, Northern Viet Nam. The mean ICS-VN score was 4.43 (out of a maximum of 5), indicating that children were 'usually' to 'always' intelligible; however, item-level scores demonstrated significant differences between communication partners. Children with parental concerns about speech and language had significantly lower mean scores than children without parental concerns. Scores also differed by children's age, parents' occupation and mothers' education level but not by sex of child or fathers' education level. The ICS-VN had good psychometric properties indicating it to be a valid tool for use with Vietnamese-speaking children in Northern Viet Nam.

A contextual ICA stakeholder model approach for the Namibian spatial data infrastructure (NamSDI)

CSIR Research Space (South Africa)

Sinvula, KM

2013-08-01

Full Text Available In 2011, the Namibian parliament presented and promulgated the Namibian Spatial Data Infrastructure (NamSDI) with the aim of promoting the sharing and improved access and use of geospatial data and services across Namibia. Notable SDI models...

Social networks, geographic proximity, and firm performance in Viet Nam

OpenAIRE

Howard, Emma

2017-01-01

This paper uses panel data to assess the relative importance of social networks and geographic proximity to micro, small, and medium enterprises in Viet Nam. The results suggest that a larger social network, and hiring employees mainly through social networks, are both correlated with higher value added per worker. The number of government officials and civil servants in a firm's network emerges as particularly important. When the quality of contacts is controlled for, firms with tighter soci...

Common perinatal mental disorders in northern Viet Nam: community prevalence and health care use

Science.gov (United States)

Tran, Thach; La, Buoi thi; Kriitmaa, Kelsi; Rosenthal, Doreen; Tran, Tuan

2010-01-01

Abstract Objective To establish the prevalence of common perinatal mental disorders their determinants, and their association with preventive health care use among women in one rural and one urban province in northern Viet Nam. Methods We conducted a cross-sectional survey of cohorts of pregnant women and mothers of infants recruited systematically in 10 randomly-selected communes. The women participated in psychiatrist-administered structured clinical interviews and separate structured interviews to assess sociodemographic factors, reproductive health, the intimate partner relationship, family violence and the use of preventive and psychiatric health care. Associations between these variables and perinatal mental disorders were explored through univariate analyses and multivariable logistic regression. Findings Among women eligible for the study (392), 364 (93%) were recruited. Of these, 29.9% (95% confidence interval, CI: 25.20–34.70) were diagnosed with a common perinatal mental disorder (CPMD). The frequency of such disorders during pregnancy and in the postpartum period was the same. Their prevalence was higher among women in rural provinces (odds ratio, OR: 2.17; 95% CI: 1.19–3.93); exposed to intimate partner violence (OR: 2.11; 95% CI: 1.12–3.96); fearful of other family members (OR: 3.36; 95% CI: 1.05–10.71) or exposed to coincidental life adversity (OR: 4.40; 95% CI: 2.44–7.93). Fewer women with a CPMD used iron supplements than women without a CPMD, but the results were not statistically significant (P = 0.05). None of the women studied had ever received mental health care. Conclusion Perinatal depression and anxiety are prevalent in women in northern Viet Nam. These conditions are predominantly determined by social factors, including rural residence, poverty and exposure to family violence. At present the needs of women with common perinatal mental disorders are unrecognized and not attended to and their participation in essential

Symptoms and risk factors for stroke in a community-based observational sample in Viet Nam.

Science.gov (United States)

Fitzpatrick, Annette L; Ngo, Quang Van; Ly, Kiet A; Ton, Thanh G N; Longstreth, W T; Vo, Tung T; Heitzinger, Kristen; Pham, Chien H; Tirschwell, David L

2012-09-01

Viet Nam is experiencing a health transition from infectious to chronic disease. Data on cardiovascular diseases, including strokes, are limited. Data were randomly collected from six communities in Da Nang, Viet Nam, on participant demographics, medical history, blood pressure, anthropometrics and health behavior using World Health Organization (WHO) guidelines. Stroke symptoms were collected by self-report with the standardized Questionnaire for Verifying Stroke Free Status. Multivariate logistic regression was used to identify factors associated with the presence of stroke symptoms. One thousand six hundred and twenty one adults were examined with a mean age of 52.0 years (± 12.5 years), of which 56.1% were women. 27.3% of the participants were found to have hypertension, 26.2% used tobacco, and 16.1% were overweight. More than two-thirds of the participants with hypertension were unaware of their condition. Almost one fourth of the participants were identified by the questionnaire as previously experiencing at least one stroke symptom. Age, rural residence, and education were associated with the presence of stroke symptoms. Models adjusted for demographics found hypertension, high cholesterol, reported severe chest pain, former smoking, and being overweight to be associated with a higher prevalence of stroke symptoms. The high frequency of stroke symptoms in Da Nang calls for further evaluation and interventions to reduce hypertension and other risk factors for chronic disease in Viet Nam and other health transition countries.

Decreasing In-home Smoking of Adults-Results from a School-based Intervention Program in Viet Nam.

Science.gov (United States)

Huong, Le Thi Thanh; Long, Tran Khanh; Anh, Le Vu; Cook, Margaret; Capra, Mike

2016-01-01

It is indicated that children are involuntarily exposed to secondhand smoke from adults, mainly at their home environment. This study aimed at describing the effectiveness of the school-based intervention to decrease the in-home smoking situation of adults so as to decrease children's exposure to secondhand smoke at home during the year 2011-2012 in a rural district in Hanoi, Viet Nam. This school-based intervention program (intervention and control group) involved 804 children aged 8 to 11 years from August 2011 to May 2012 in a rural district of Hanoi, Viet Nam. Children were taught in class about the harmful effects of secondhand smoke and about how to negotiate with fathers not to smoke in-home. Then children applied what they learnt, including staying away from secondhand smoke and persuading fathers not to smoke in-home in order to decrease children's exposure to secondhand smoke. Chi square test, t-test and multinominal logistic regression were applied in data analysis. The results showed that children's reported their father's in-home smoking decreased from 83.0% pre-intervention to 59.8% post-intervention ( p Viet Nam to increase children's awareness on the adverse health effects of secondhand smoke and to help them to be able to avoid their exposure to secondhand smoke at their home environment.

Using lot quality-assurance sampling and area sampling to identify priority areas for trachoma control: Viet Nam.

Science.gov (United States)

Myatt, Mark; Mai, Nguyen Phuong; Quynh, Nguyen Quang; Nga, Nguyen Huy; Tai, Ha Huy; Long, Nguyen Hung; Minh, Tran Hung; Limburg, Hans

2005-10-01

To report on the use of lot quality-assurance sampling (LQAS) surveys undertaken within an area-sampling framework to identify priority areas for intervention with trachoma control activities in Viet Nam. The LQAS survey method for the rapid assessment of the prevalence of active trachoma was adapted for use in Viet Nam with the aim of classifying individual communes by the prevalence of active trachoma among children in primary school. School-based sampling was used; school sites to be sampled were selected using an area-sampling approach. A total of 719 communes in 41 districts in 18 provinces were surveyed. Survey staff found the LQAS survey method both simple and rapid to use after initial problems with area-sampling methods were identified and remedied. The method yielded a finer spatial resolution of prevalence than had been previously achieved in Viet Nam using semiquantitative rapid assessment surveys and multistage cluster-sampled surveys. When used with area-sampling techniques, the LQAS survey method has the potential to form the basis of survey instruments that can be used to efficiently target resources for interventions against active trachoma. With additional work, such methods could provide a generally applicable tool for effective programme planning and for the certification of the elimination of trachoma as a blinding disease.

Les impacts de la guerre du Việt Nam sur les forêts d’A Lưới

OpenAIRE

Robert-Charmeteau, Amélie

2015-01-01

Au cours de la guerre du Việt Nam, l’actuel district d’A Lưới (province de Thừa Thiên Huế, Việt Nam central), traversé par la piste Hồ Chí Minh, subit de nombreux épandages d’herbicides et pilonnages. Les forêts sont une cible privilégiée. Mais les conséquences de ces pratiques militaires sur les sylvosystèmes sont sujettes à controverses. Pour identifier objectivement le poids de la guerre sur les dynamiques paysagères, l’étude se fonde sur une analyse diachronique régressive des paysages et...

Worlds Apart: Nam Le’s The Boat and Ali Alizadeh’s Transactions

Directory of Open Access Journals (Sweden)

Lachlan Brown

2015-05-01

Full Text Available This paper reads Ali Alizadeh’s transnational book of short stories (Transactions, 2013 as a curious and pointed response to the kind of literary internationalism seen in Nam Le’s The Boat (2008. Le’s work was first published in the same year as Alizadeh’s The New Angel (which was set during the Iranian revolution. There is a sense in which the spectacular success of Le’s book ‘overshadowed’ the publicity for Alizadeh’s novel in the year of its arrival. But Le’s also work contains a story about an American woman visiting Tehran, and his mimicry perhaps signifies a more problematic representational point of comparison. With this in mind, this paper examines Alizadeh’s Transactions exploring the ways in which Alizadeh’s brutally connected global vision is coded through certain aesthetic choices (including structural, tonal and descriptive that offer something very different to the artisanal and paratactic sensibility of The Boat.

The text of the Agreement of 1 July 1983 concerning the Agency's assistance to Viet Nam for the transfer of enriched uranium for a research reactor

International Nuclear Information System (INIS)

1983-12-01

The full text of the Supply and Project Agreement of 1 July 1983 between the Agency and the Government of the Socialist Republic of Viet Nam concerning the Agency's assistance for the transfer of moderately enriched uranium from the USSR for a research reactor in Viet Nam is presented

Role of alcohol in hospitalized road trauma in Viet nam.

Science.gov (United States)

Nguyen, Nam Phuong; Passmore, Jonathon; Tran, Lan Thi Ngoc; Luong, Anh Mai

2013-01-01

To assess the blood alcohol concentration (BAC; dependent variable) of patients with road traffic injuries (RTIs) presenting at 3 provincial and central hospitals in the Socialist Republic of Viet Nam by age, sex, and road user type (independent variables). This survey formed part of the Viet Nam Road Traffic Injury Prevention Project, funded by Bloomberg Philanthropies. RTIs are a leading cause of death and disability in Viet Nam, with 14,690 deaths and 143,940 injuries reported by the Ministry of Health (MOH) in 2010. Research estimates suggest that motorcycle riders and passengers account for 60 percent of fatalities. Alcohol has long been suspected of being a leading cause of road traffic collisions and injuries. However, until now data on this relationship have been limited. A descriptive cross-sectional study measuring BAC in all consenting patients with RTIs presenting at 3 provincial or central hospitals between July 2009 and September 2010. All results were anonymous and summary information on key variables was sent to MOH and the World Health Organization (WHO) on a monthly basis. Of the 36,418 patients with RTIs presenting to these 3 hospitals between July 2009 and September 2010, BAC analysis was completed on 14,990 patients (41.2%), representing all patients with RTIs 15 years of age and above who consented to anonymous testing. BAC results ranged from 0 to 0.589 g/dL blood, with a mean of 0.0441 g/dL being the average concentration among all tested patients. Of all patients tested, 56.8 percent had no detectable alcohol in their system. Motorcycle riders were most commonly represented in the tested sample (70.7%), with 27.8 percent having a BAC above the legal limit (0.05 g/dL). Car or other vehicle drivers represented 2.7 percent of the sample, with 63.4 percent tested having a BAC above 0 g/dL, the legal limit for these road users. The results of this preliminary study indicate that 29.1 percent of all car drivers and motorcycle riders presenting at

High-risk and multiple human papillomavirus infections among married women in Can Tho, Viet Nam.

Science.gov (United States)

Vu, Lan Thi Hoang

2012-07-01

The two currently licensed human papillomavirus (HPV) vaccines are highly efficacious in preventing cervical pre-cancers related to HPV 6, 11, 16 and 18. Before implementing a large-scale HPV vaccine campaign in Viet Nam, information about the prevalence of infection with the HPV vaccine types is required. This study was done in Can Tho, the province with the highest prevalence of cervical cancer in the south of Viet Nam, to explore the distribution of other high-risk types of HPV among married women in this province. The study employed a cross-sectional design with multistage sampling. A total of 1000 participants were randomly selected, interviewed and given gynaecological examinations. HPV infection status and HPV genotyping test were completed for all participants. A broad spectrum of HPV types was reported in this study. The prevalence of cases infected with HPV 16 and/or 18 was 7%; the prevalence of cases infected with other high-risk HPV types was 6%. The highest prevalence for single and multiple infections, as well as for high-risk infections, was reported for the youngest age group (less than 30 years). While it is relevant to implement an HPV vaccine campaign in Viet Nam due to the high prevalence of infection with HPV 16 and/or 18, it is important to note that one can be infected with multiple types of HPV. Vaccination does not protect against all types of high-risk HPV. Future vaccine campaigns should openly disclose this information to women receiving vaccines.

Improving the diagnosis of pulmonary tuberculosis in HIV-infected individuals in Ho Chi Minh City, Viet Nam.

Science.gov (United States)

Nguyen, D T M; Hung, N Q; Giang, L T; Dung, N H; Lan, N T N; Lan, N N; Yen, N T B; Bang, N D; Ngoc, D V; Trinh, L T T; Beasley, R P; Ford, C E; Hwang, L-Y; Graviss, E A

2011-11-01

District 6, An Hoa Clinic in Ho Chi Minh City (HCMC), Viet Nam. To evaluate the performance of various algorithms in tuberculosis (TB) screening and diagnosis in a human immunodeficiency virus (HIV) infected population in HCMC, Viet Nam. A cross-sectional study of 397 consecutive HIV-infected patients seeking care at the An Hoa Clinic from August 2009 to June 2010. Data on participant demographics, clinical status, chest radiography (CXR) and laboratory results were collected. A multiple logistic regression model was developed to assess the association of covariates and pulmonary TB (PTB). The prevalence of sputum culture-confirmed PTB, acid-fast bacilli (AFB) positive TB, and multidrugresistant TB among the 397 HIV-infected patients was respectively 7%, 2%, and 0.3%. Adjusted odds ratios for low CD4+ cell count, positive sputum smear, and CXR to positive sputum culture were respectively 3.17, 32.04 and 4.28. Clinical findings alone had poor sensitivity, but combining CD4+ cell count, AFB sputum smear and CXR had a more accurate diagnostic performance. Results suggest that symptom screening had poor clinical performance, and support the routine use of sputum culture to improve the detection of TB disease in HIV-infected individuals in Viet Nam. However, when routine sputum culture is not available, an algorithm combining CD4+ cell count, AFB sputum smear and CXR is recommended for diagnosing PTB.

New Triangular and Rectangular NAM Representation Algorithm for Color Images%一种新的TRNAM彩色图像表示算法

Institute of Scientific and Technical Information of China (English)

郑运平

2011-01-01

The Non-symmetry and Anti-packing Model (NAM) is suitable for representations of image pattern, audio pattern, video pattern, and text pattern, and it is a general pattern representation model. Inspired by the idea of representing the pixels by the Gray code, a new triangular and rectangular NAM representation algorithm for color images, which is called the NTRNAM algorithm, is proposed. The principium and the description of the NTRNAM algorithm are presented and the storage structure, the total data a-mount, and the time and space complexities of the proposed algorithm are analyzed. The theoretical and experimental results show that the NTRNAM algorithm can greatly reduce the number of subpatterns and simultaneously save the storage room, and therefore it is an effective algorithm for color image representation.%非对称逆布局模型(NAM)适用于图像模式、语音模式、文本模式、视频模式的表示,是一个通用型的模式表示模型.借助于格雷码表示图像像素的思想,提出了一种新的三角形和矩形NAM彩色图像表示算法(简称NTRNAM算法).给出了算法的原理及形式化描述,并对其存储结构、总数据量和时空复杂性进行了分析.理论分析和实验结果表明:NTRNAM算法能够显著降低子模式数和存储空间,是一种有效的彩色图像表示算法.

Impacts on Breastfeeding Practices of At-Scale Strategies That Combine Intensive Interpersonal Counseling, Mass Media, and Community Mobilization: Results of Cluster-Randomized Program Evaluations in Bangladesh and Viet Nam.

Science.gov (United States)

Menon, Purnima; Nguyen, Phuong Hong; Saha, Kuntal Kumar; Khaled, Adiba; Kennedy, Andrew; Tran, Lan Mai; Sanghvi, Tina; Hajeebhoy, Nemat; Baker, Jean; Alayon, Silvia; Afsana, Kaosar; Haque, Raisul; Frongillo, Edward A; Ruel, Marie T; Rawat, Rahul

2016-10-01

Despite recommendations supporting optimal breastfeeding, the number of women practicing exclusive breastfeeding (EBF) remains low, and few interventions have demonstrated implementation and impact at scale. Alive & Thrive was implemented over a period of 6 y (2009-2014) and aimed to improve breastfeeding practices through intensified interpersonal counseling (IPC), mass media (MM), and community mobilization (CM) intervention components delivered at scale in the context of policy advocacy (PA) in Bangladesh and Viet Nam. In Bangladesh, IPC was delivered through a large non-governmental health program; in Viet Nam, it was integrated into government health facilities. This study evaluated the population-level impact of intensified IPC, MM, CM, and PA (intensive) compared to standard nutrition counseling and less intensive MM, CM, and PA (non-intensive) on breastfeeding practices in these two countries. A cluster-randomized evaluation design was employed in each country. For the evaluation sample, 20 sub-districts in Bangladesh and 40 communes in Viet Nam were randomized to either the intensive or the non-intensive group. Cross-sectional surveys (n ~ 500 children 0-5.9 mo old per group per country) were implemented at baseline (June 7-August 29, 2010, in Viet Nam; April 28-June 26, 2010, in Bangladesh) and endline (June 16-August 30, 2014, in Viet Nam; April 20-June 23, 2014, in Bangladesh). Difference-in-differences estimates (DDEs) of impact were calculated, adjusting for clustering. In Bangladesh, improvements were significantly greater in the intensive compared to the non-intensive group for the proportion of women who reported practicing EBF in the previous 24 h (DDE 36.2 percentage points [pp], 95% CI 21.0-51.5, p Viet Nam, EBF increases were greater in the intensive group (27.9 pp, 95% CI 17.7-38.1, p Viet Nam than standard counseling with less intensive MM, CM, and PA. To our knowledge, this study is the first to document implementation and impacts of

Swedish Spring Wheat Varieties with the Rare High Grain Protein Allele of NAM-B1 Differ in Leaf Senescence and Grain Mineral Content

Science.gov (United States)

Asplund, Linnéa; Bergkvist, Göran; Leino, Matti W.; Westerbergh, Anna; Weih, Martin

2013-01-01

Some Swedish spring wheat varieties have recently been shown to carry a rare wildtype (wt) allele of the gene NAM-B1, known to affect leaf senescence and nutrient retranslocation to the grain. The wt allele is believed to increase grain protein concentration and has attracted interest from breeders since it could contribute to higher grain quality and more nitrogen-efficient varieties. This study investigated whether Swedish varieties with the wt allele differ from varieties with one of the more common, non-functional alleles in order to examine the effect of the gene in a wide genetic background, and possibly explain why the allele has been retained in Swedish varieties. Forty varieties of spring wheat differing in NAM-B1 allele type were cultivated under controlled conditions. Senescence was monitored and grains were harvested and analyzed for mineral nutrient concentration. Varieties with the wt allele reached anthesis earlier and completed senescence faster than varieties with the non-functional allele. The wt varieties also had more ears, lighter grains and higher yields of P and K. Contrary to previous information on effects of the wt allele, our wt varieties did not have increased grain N concentration or grain N yield. In addition, temporal studies showed that straw length has decreased but grain N yield has remained unaffected over a century of Swedish spring wheat breeding. The faster development of wt varieties supports the hypothesis of NAM-B1 being preserved in Fennoscandia, with its short growing season, because of accelerated development conferred by the NAM-B1 wt allele. Although the possible effects of other gene actions were impossible to distinguish, the genetic resource of Fennoscandian spring wheats with the wt NAM-B1 allele is interesting to investigate further for breeding purposes. PMID:23555754

The association of estimated salt intake with blood pressure in a Viet Nam national survey.

Directory of Open Access Journals (Sweden)

Paul N Jensen

Full Text Available To evaluate the association of salt consumption with blood pressure in Viet Nam, a developing country with a high level of salt consumption.Analysis of a nationally representative sample of Vietnamese adults 25-65 years of age who were surveyed using the World Health Organization STEPwise approach to Surveillance protocol. Participants who reported acute illness, pregnancy, or current use of antihypertensive medications were excluded. Daily salt consumption was estimated from fasting mid-morning spot urine samples. Associations of salt consumption with systolic blood pressure and prevalent hypertension were assessed using adjusted linear and generalized linear models. Interaction terms were tested to assess differences by age, smoking, alcohol consumption, and rural/urban status.The analysis included 2,333 participants (mean age: 37 years, 46% male, 33% urban. The average estimated salt consumption was 10g/day. No associations of salt consumption with blood pressure or prevalent hypertension were observed at a national scale in men or women. The associations did not differ in subgroups defined by age, smoking, or alcohol consumption; however, associations differed between urban and rural participants (p-value for interaction of urban/rural status with salt consumption, p = 0.02, suggesting that higher salt consumption may be associated with higher systolic blood pressure in urban residents but lower systolic blood pressure in rural residents.Although there was no evidence of an association at a national level, associations of salt consumption with blood pressure differed between urban and rural residents in Viet Nam. The reasons for this differential association are not clear, and given the large rate of rural to urban migration experienced in Viet Nam, this topic warrants further investigation.

The association of estimated salt intake with blood pressure in a Viet Nam national survey.

Science.gov (United States)

Jensen, Paul N; Bao, Tran Quoc; Huong, Tran Thi Thanh; Heckbert, Susan R; Fitzpatrick, Annette L; LoGerfo, James P; Ngoc, Truong Le Van; Mokdad, Ali H

2018-01-01

To evaluate the association of salt consumption with blood pressure in Viet Nam, a developing country with a high level of salt consumption. Analysis of a nationally representative sample of Vietnamese adults 25-65 years of age who were surveyed using the World Health Organization STEPwise approach to Surveillance protocol. Participants who reported acute illness, pregnancy, or current use of antihypertensive medications were excluded. Daily salt consumption was estimated from fasting mid-morning spot urine samples. Associations of salt consumption with systolic blood pressure and prevalent hypertension were assessed using adjusted linear and generalized linear models. Interaction terms were tested to assess differences by age, smoking, alcohol consumption, and rural/urban status. The analysis included 2,333 participants (mean age: 37 years, 46% male, 33% urban). The average estimated salt consumption was 10g/day. No associations of salt consumption with blood pressure or prevalent hypertension were observed at a national scale in men or women. The associations did not differ in subgroups defined by age, smoking, or alcohol consumption; however, associations differed between urban and rural participants (p-value for interaction of urban/rural status with salt consumption, p = 0.02), suggesting that higher salt consumption may be associated with higher systolic blood pressure in urban residents but lower systolic blood pressure in rural residents. Although there was no evidence of an association at a national level, associations of salt consumption with blood pressure differed between urban and rural residents in Viet Nam. The reasons for this differential association are not clear, and given the large rate of rural to urban migration experienced in Viet Nam, this topic warrants further investigation.

Consequences of gestational diabetes in an urban hospital in Viet Nam: a prospective cohort study.

Science.gov (United States)

Hirst, Jane E; Tran, Thach S; Do, My An T; Morris, Jonathan M; Jeffery, Heather E

2012-01-01

Gestational diabetes mellitus (GDM) is increasing and is a risk for type 2 diabetes. Evidence supporting screening comes mostly from high-income countries. We aimed to determine prevalence and outcomes in urban Viet Nam. We compared the proposed International Association of the Diabetes and Pregnancy Study Groups (IADPSG) criterion, requiring one positive value on the 75-g glucose tolerance test, to the 2010 American Diabetes Association (ADA) criterion, requiring two positive values. We conducted a prospective cohort study in Ho Chi Minh City, Viet Nam. Study participants were 2,772 women undergoing routine prenatal care who underwent a 75-g glucose tolerance test and interview around 28 (range 24-32) wk. GDM diagnosed by the ADA criterion was treated by local protocol. Women with GDM by the IADPSG criterion but not the ADA criterion were termed "borderline" and received standard care. 2,702 women (97.5% of cohort) were followed until discharge after delivery. GDM was diagnosed in 164 participants (6.1%) by the ADA criterion, 550 (20.3%) by the IADPSG criterion. Mean body mass index was 20.45 kg/m(2) in women with out GDM, 21.10 in women with borderline GDM, and 21.81 in women with GDM, pViet Nam. Women with GDM by the IADPSG criterion were at risk of preterm delivery and neonatal hypoglycaemia, although this criterion resulted in 20% of pregnant women being positive for GDM. The ability to cope with such a large number of cases and prevent associated adverse outcomes needs to be demonstrated before recommending widespread screening. Please see later in the article for the Editors' Summary.

'Never testing for HIV' among men who have sex with men in Viet Nam: results from an Internet-based cross-sectional survey.

Science.gov (United States)

García, Macarena Cecilia; Duong, Quyen Le; Mercer, Licelot Eralte; Meyer, Samantha Beth; Ward, Paul Russell

2013-12-28

Men who have sex with men in Viet Nam have been under-studied as a high-risk group for HIV infection, and this population's percentage and determinants of HIV testing have not been comprehensively investigated. A national Internet-based survey of self-reported sexual and health seeking behaviours was conducted between August and October 2011 with 2077 Vietnamese men who had sex with men in the last twelve months to identify the frequency of 'never testing for HIV' among Internet-using MSM living in Viet Nam, as well as the factors associated with this HIV-related high-rish behavior. Logistic regression analyses were conducted to assess the demographic characteristics and behaviours predicting never testing for HIV. A total of 76.5% of men who have sex with men who were surveyed reported never having been voluntarily tested for HIV. Predictors of never being tested included having a monthly income less than VND 5 Million, being a student, using the Internet less than 15 hour per week, and not participating in a behavioural HIV intervention. Never testing for HIV is common among Internet-using men who have sex with men in Viet Nam. Given the dangerously high prevalence of this high-risk behaviour, our findings underscore the urgent need for segmented and targeted HIV prevention, care and treatment strategies, focusing on drastically reducing the number of men who have sex with men never testing for HIV in Viet Nam.

Criteria for prioritization of HIV programs in Viet Nam: a discrete choice experiment

Directory of Open Access Journals (Sweden)

Ali Safarnejad

2017-11-01

Full Text Available Abstract Background With the decline in funding for Viet Nam’s response to the HIV epidemic, there is a need for evidence on the criteria to guide the prioritization of HIV programs. There is a gap in the research on the relative importance of multiple criteria for prioritizing a package of interventions. This study elicits preferences and the trade-offs made between different HIV programs by relevant stakeholders and decision-makers in Viet Nam. It also pays attention to how differences in social and professional characteristics of stakeholders and their agency affiliations shape preferences for HIV program criteria in Viet Nam. Methods This study uses self-explicated ranking and discrete choice experiments to determine the relative importance of five criteria - effectiveness, feasibility, cost-effectiveness, rate of investment and prevention/treatment investment ratio - to stakeholders when they evaluate and select hypothetical HIV programs. The study includes 69 participants from government, civil society, and international development partners. Results Results of the discrete choice experiment show that overall the feasibility criterion is ranked highest in importance to the participants when choosing a hypothetical HIV program, followed by sustainability, treatment to prevention spending ratio, and effectiveness. The participant’s work in management, programming, or decision-making has a significant effect on the importance of some criteria to the participant. In the self-explicated ranking effectiveness is the most important criterion and the cost-effectiveness criterion ranks low in importance across all groups. Conclusions This study has shown that the preferred HIV program in Viet Nam is feasible, front-loaded for sustainability, has a higher proportion of investment on prevention, saves more lives and prevents more infections. Similarities in government and civil society rankings of criteria can create common grounds for future

The Use of Microorganism for Biological Control of Anthracnose in Nam Dok Mai Mango for Export

International Nuclear Information System (INIS)

Piadiang, Nattaya

2006-09-01

Antagonist were tested inhibition of mycelial growth of Collectorichum gloeosporioides, a causal agent of anthracnose on potato dextrose agar (PDA) revealed that 46 isolated that 46 isolate inhibited the growth of mycelia by 40.01-60.00 5. The selected four isolates inhibit the growth of fungal nycelia by 47.01-50.00 % including YFm1, YFm2, Y18 and AC2-1 were test for the potential reduce anthracnose lesion development on detected Nam Dok Mai mango by application of antagonistic microorganism before inoculation of C. gloeosporioides. This result slow that four isolate antagonistic reduced sized of lesion on Nam Dok Mai mango by 89.23, 75.38, 58.46 and 33.85 %, respectively as compare the control. Five isolate of antagonist including YFm1, YFm2, Y18, CLY35 and CLY23 could inhibited the growth of mycelia on PDA by 44.01-50.00 % were test the potential reduce anthracnose lesion development on detected Nam Dok Mai mango by application of antagonistic microorganism after inoculation of C. gloeosporioides. It was found that this application could not inhibit anthracnose on fruit mango as compare to the control. YFm1 were test for the potential inhibition anthracnose disease under field condition. It was found that YFm1 could control of C. gloeosporioides within 7 and 14 day after spraying antagonistic suspension. The efficiency test of YFm1 for anthracnose controlling on mango was followed by export treatment Azoxystrobin, ET-fon and showed 55.55%, 77.77 % and 88.88 % anthracnose infection and/or spoilage respectively

Land use changes assessment using spatial data: Case study in Cong river basin - Thai Nguyen City - Viet Nam

Science.gov (United States)

Nguyen, Hieu

Land use changes are being interested in most countries, especially in developing countries. Because land use changes always impacts on sustainable development not only in a region or a country but also in whole the world. Viet Nam is a developing country, in the last 10 years, land uses have rapidly changed in most provinces. Many of agriculture areas, forest areas have changed for various purposes as urban sprawl, establishing new industrial parks, public areas, mining and other land uses relate to human activities or economic function associated with a specific piece of land. Beside efficiencies of economic and society, then environment issues have been threatening serious pollution, are from land use changes. Remote sensing images application on studying land use changes, has been done in many countries around the world, and has brought high efficiencies. However, this application is still very new and limited in Viet Nam due to lacking of materials, tools, experts of remote sensing. This study used spatial data as Landsat TM images, SPOT5 images and land use planning maps to rapidly assess on happenings of land uses in the period 2000 -2010 in Cong river basin (Thai Nguyen City, Viet Nam), and to forecast the changes of land uses in the period 2010 - 2020. The results had a good accuracy and to be important references for authorities, policy makers in local land use.

Drug-drug cocrystals of antituberculous 4-aminosalicylic acid: Screening, crystal structures, thermochemical and solubility studies.

Science.gov (United States)

Drozd, Ksenia V; Manin, Alex N; Churakov, Andrei V; Perlovich, German L

2017-03-01

Experimental multistage cocrystal screening of the antituberculous drug 4-aminosalicylic acid (PASA) has been conducted with a number of coformers (pyrazinamide (PYR), nicotinamide (NAM), isonicotinamide (iNAM), isoniazid (INH), caffeine (CAF) and theophylline (TPH)). The crystal structures of 4-aminosalicylic acid cocrystals with isonicotinamide ([PASA+iNAM] (2:1)) and methanol solvate with caffeine ([PASA+CAF+MeOH] (1:1:1)) have been determined by single X-ray diffraction experiments. For the first time for PASA cocrystals it has been found that the structural unit of the [PASA+iNAM] cocrystal (2:1) is formed by 2 types of heterosynthons: acid-pyridine and acid-amide. The desolvation study of the [PASA+CAF+MeOH] cocrystal solvate (1:1:1) has been conducted. The correlation models linking the melting points of the cocrystals with the melting points of the coformers used in this paper have been developed. The thermochemical and solubility properties for all the obtained cocrystals have been studied. Cocrystallization has been shown to lead not only to PASA solubility improving but also to its higher stability against the chemical decomposition. Copyright © 2016 Elsevier B.V. All rights reserved.

VU6010608, a Novel mGlu7 NAM from a Series of N-(2-(1H-1,2,4-Triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamides.

Science.gov (United States)

Reed, Carson W; McGowan, Kevin M; Spearing, Paul K; Stansley, Branden J; Roenfanz, Hanna F; Engers, Darren W; Rodriguez, Alice L; Engelberg, Eileen M; Luscombe, Vincent B; Loch, Matthew T; Remke, Daniel H; Rook, Jerri M; Blobaum, Anna L; Conn, P Jeffrey; Niswender, Colleen M; Lindsley, Craig W

2017-12-14

Herein, we report the structure-activity relationships within a series of mGlu 7 NAMs based on an N -(2-(1 H -1,2,4-triazol-1-yl)-5-(trifluoromethoxy)phenyl)benzamide core with excellent CNS penetration ( K p 1.9-5.8 and K p,uu 0.4-1.4). Analogues in this series displayed steep SAR. Of these, VU6010608 ( 11a ) emerged with robust efficacy in blocking high frequency stimulated long-term potentiation in electrophysiology studies.

Floristic inventory of vascular plant in Nam Ha National Biodiversity Conservation Area, Lao People's Democratic Republic

Directory of Open Access Journals (Sweden)

Jeong Ho Park

2018-06-01

Full Text Available The floristic inventory of vascular plants in Nam Ha National Biodiversity Conservation Area was conducted to understand the plant diversity in the northern area of Lao People's Democratic Republic. From the joint field surveys between Korean and Laos experts conducted during 2015–2017, it was found that there are 64 families, 145 genera, and 189 species distributed in the Nam Ba National Biodiversity Conservation Area, and a total of 56 families, 117 genera, and 148 species which comprise more than 78% of the total species were identified as endemic plants to the Lao People's Democratic Republic. Considering the usage of the plants, there are 91 species of medicinal plants, 33 species of ornamental plants, eight species of edible plants, and 16 species of economic plants. In addition, it was found out that Dalbergia balansae and Cinnamomum macrocarpum are categorized as vulnerable in the International Union for Conservation of Nature (IUCN Red list, and 13 more species are categorized as the least concern.

‘Never testing for HIV’ among Men who have Sex with Men in Viet Nam: results from an internet-based cross-sectional survey

Science.gov (United States)

2013-01-01

Background Men who have sex with men in Viet Nam have been under-studied as a high-risk group for HIV infection, and this population’s percentage and determinants of HIV testing have not been comprehensively investigated. Methods A national Internet-based survey of self-reported sexual and health seeking behaviours was conducted between August and October 2011 with 2077 Vietnamese men who had sex with men in the last twelve months to identify the frequency of ‘never testing for HIV’ among Internet-using MSM living in Viet Nam, as well as the factors associated with this HIV-related high-rish behavior. Logistic regression analyses were conducted to assess the demographic characteristics and behaviours predicting never testing for HIV. Results A total of 76.5% of men who have sex with men who were surveyed reported never having been voluntarily tested for HIV. Predictors of never being tested included having a monthly income less than VND 5 Million, being a student, using the Internet less than 15 hour per week, and not participating in a behavioural HIV intervention. Conclusions Never testing for HIV is common among Internet-using men who have sex with men in Viet Nam. Given the dangerously high prevalence of this high-risk behaviour, our findings underscore the urgent need for segmented and targeted HIV prevention, care and treatment strategies, focusing on drastically reducing the number of men who have sex with men never testing for HIV in Viet Nam. PMID:24373483

Factors associated with breastfeeding intent among mothers of newborn babies in Da Nang, Viet Nam.

Science.gov (United States)

Nguyen, Phuong Thi Kim; Tran, Hoang Thi; Thai, Thuy Thi Thanh; Foster, Kirsty; Roberts, Christine L; Marais, Ben J

2018-01-01

Breastfeeding is recognized as the single most cost-effective intervention to reduce child morbidity and mortality. However, few studies have explored perceived barriers to breastfeeding and factors associated with breastfeeding intent among mothers of newborn babies in Viet Nam. We conducted a study to assess breastfeeding initiation rates, intent to breastfeed exclusively for 6 months or more and perceived barriers to breastfeed among mothers of newborn babies in Da Nang, Viet Nam. We conducted a cross-sectional questionnaire survey of mothers in the postnatal wards of Da Nang Hospital for Women and Children in central Viet Nam from 10 February 2017 to 24 February 2017, following implementation of the World Health Organization (WHO) Essential Newborn Care (ENC) package. Of 286 mothers surveyed, 259 (90.6%) initiated breastfeeding; 203/258 (78.7%) within 1 hour (h) of birth. Most (207, 72.4%) mothers indicated intent to breastfeed exclusively for 6 months or more, but this was lower among mothers of preterm babies (82.2% versus 20.0%, p  < 0.001) and those without post-secondary school education (74.8% versus 55.6%, p  = 0.02). Amongst mothers struggling to establish breastfeeding, 18/27 (66.7%) had a Cesarean section. Planned non-exclusive breastfeeding was mostly (39, 60.9%) motivated by mothers' concern that their milk supply would be insufficient for their baby's growth requirements. Most mothers had good knowledge about the benefits of breastfeeding and indicated strong decision autonomy. We documented high rates of early breastfeeding establishment and intent to breastfeed exclusively for 6 months or more. This probably reflects high levels of maternal education and successful implementation of the WHO ENC package. Mothers of premature babies may benefit from additional support.

Detection of potentially novel paramyxovirus and coronavirus viral RNA in bats and rats in the Mekong Delta region of southern Viet Nam.

Science.gov (United States)

Berto, A; Anh, P H; Carrique-Mas, J J; Simmonds, P; Van Cuong, N; Tue, N T; Van Dung, N; Woolhouse, M E; Smith, I; Marsh, G A; Bryant, J E; Thwaites, G E; Baker, S; Rabaa, M A

2018-02-01

Bats and rodents are being increasingly recognized as reservoirs of emerging zoonotic viruses. Various studies have investigated bat viruses in tropical regions, but to date there are no data regarding viruses with zoonotic potential that circulate in bat and rat populations in Viet Nam. To address this paucity of data, we sampled three bat farms and three wet markets trading in rat meat in the Mekong Delta region of southern Viet Nam. Faecal and urine samples were screened for the presence of RNA from paramyxoviruses, coronaviruses and filoviruses. Paramyxovirus RNA was detected in 4 of 248 (1%) and 11 of 222 (4.9%) bat faecal and urine samples, respectively. Coronavirus RNA was detected in 55 of 248 (22%) of bat faecal samples; filovirus RNA was not detected in any of the bat samples. Further, coronavirus RNA was detected in 12 of 270 (4.4%) of rat faecal samples; all samples tested negative for paramyxovirus. Phylogenetic analysis revealed that the bat paramyxoviruses and bat and rat coronaviruses were related to viruses circulating in bat and rodent populations globally, but showed no cross-species mixing of viruses between bat and rat populations within Viet Nam. Our study shows that potentially novel variants of paramyxoviruses and coronaviruses commonly circulate in bat and rat populations in Viet Nam. Further characterization of the viruses and additional human and animal surveillance is required to evaluate the likelihood of viral spillover and to assess whether these viruses pose a risk to human health. © 2017 The Authors. Zoonoses and Public Health Published by Blackwell Verlag GmbH.

Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei) and leaf rust (Puccinia hordei) in barley using nested association mapping (NAM).

Science.gov (United States)

Vatter, Thomas; Maurer, Andreas; Perovic, Dragan; Kopahnke, Doris; Pillen, Klaus; Ordon, Frank

2018-01-01

The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM) was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars.

Iodine status in late pregnancy and psychosocial determinants of iodized salt use in rural northern Viet Nam

Science.gov (United States)

Tran, Thach; Biggs, Beverley; Tran, Tuan; Dwyer, Terry; Casey, Gerard; Tho, Dang Hai; Hetzel, Basil

2011-01-01

Abstract Objective To establish iodine status among pregnant women in rural northern Viet Nam and explore psychosocial predictors of the use of iodized salt in their households. Methods This prospective study included pregnant women registered in health stations in randomly-selected communes in Ha Nam province. At recruitment ( 28 weeks of gestation) a urine specimen was collected to measure urinary iodine concentration (UIC) and iodized salt use was assessed. Predictors were explored through univariable analyses and multivariable linear and logistic regression. Findings The 413 pregnant women who provided data for this study had a median UIC of 70 µg/l; nearly 83% had a UIC lower than the 150 µg/l recommended by the World Health Organization; only 73.6% reported using iodized salt in any form in their households. Iodized salt use was lower among nulliparous women (odds ratio, OR: 0.56; 95% confidence interval, CI: 0.32–0.96); less educated women (OR: 0.34; 95% CI: 0.16–0.71); factory workers or small-scale traders (OR: 0.52; 95% CI: 0.31–0.86), government workers (OR: 0.35; 95% CI: 0.13–0.89) and women with common mental disorders at recruitment (OR: 0.61; 95% CI: 0.38–0.98). Conclusion The decline in the use of iodized salt in Viet Nam since the National Iodine Deficiency Disorders Control Programme was suspended in 2005 has placed pregnant women and their infants in rural areas at risk of iodine deficiency disorders. PMID:22084527

Seasonal variability of faecal indicator bacteria numbers and die-off rates in the Red River basin, North Viet Nam

Science.gov (United States)

Nguyen, Huong Thi Mai; Le, Quynh Thi Phuong; Garnier, J.; Janeau, J.-L.; Rochelle-Newall, E.

2016-02-01

The Red River is the second largest river in Viet Nam and constitutes the main water source for a large percentage of the population of North Viet Nam. Here we present the results of an annual survey of Escherichia coli (EC) and Total Coliforms (TC) in the Red River basin, North Viet Nam. The objective of this work was to obtain information on faecal indicator bacteria (FIB) numbers over an annual cycle and, secondly, to determine the die-off rates of these bacterial indicators. Monthly observations at 10 stations from July 2013-June 2014 showed that TC and EC reached as high as 39100 cfu (colony forming units) 100 ml-1 and 15300 colonies 100 ml-1, respectively. We observed a significant seasonal difference for TC (p < 0.05) with numbers being higher during the wet season. In contrast, no significant seasonal difference was found for EC. The FIB die-off rates ranged from 0.01 d-1 to a maximum of 1.13 d-1 for EC and from 0.17 d-1 to 1.33 d-1 for TC. Die-off rates were significantly higher for free bacteria than for total (free + particle attached) bacteria, suggesting that particle attachment provided a certain level of protection to FIB in this system.

Completeness and reliability of mortality data in Viet Nam: Implications for the national routine health management information system.

Science.gov (United States)

Hong, Tran Thi; Phuong Hoa, Nguyen; Walker, Sue M; Hill, Peter S; Rao, Chalapati

2018-01-01

Mortality statistics form a crucial component of national Health Management Information Systems (HMIS). However, there are limitations in the availability and quality of mortality data at national level in Viet Nam. This study assessed the completeness of recorded deaths and the reliability of recorded causes of death (COD) in the A6 death registers in the national routine HMIS in Viet Nam. 1477 identified deaths in 2014 were reviewed in two provinces. A capture-recapture method was applied to assess the completeness of the A6 death registers. 1365 household verbal autopsy (VA) interviews were successfully conducted, and these were reviewed by physicians who assigned multiple and underlying cause of death (UCOD). These UCODs from VA were then compared with the CODs recorded in the A6 death registers, using kappa scores to assess the reliability of the A6 death register diagnoses. The overall completeness of the A6 death registers in the two provinces was 89.3% (95%CI: 87.8-90.8). No COD recorded in the A6 death registers demonstrated good reliability. There is very low reliability in recording of cardiovascular deaths (kappa for stroke = 0.47 and kappa for ischaemic heart diseases = 0.42) and diabetes (kappa = 0.33). The reporting of deaths due to road traffic accidents, HIV and some cancers are at a moderate level of reliability with kappa scores ranging between 0.57-0.69 (pViet Nam.

Drinking & driving in Viet Nam: prevalence, knowledge, attitudes, and practices in two provinces.

Science.gov (United States)

Bachani, Abdulgafoor M; Jessani, Nasreen S; Pham, V Cuong; Quang, La Ngoc; Nguyen, Phuong N; Passmore, Jonathon; Hyder, Adnan A

2013-12-01

Viet Nam is experiencing a shift in its burden of disease profile with injuries becoming more prominent. A history of high alcohol involvement in road traffic crashes despite stringent laws led to increased enforcement by police, enhanced public education messaging and targeted social marketing campaigns in Ha Nam and Ninh Binh provinces in Viet Nam. This study aims to illustrate the changes in prevalence (November 2010 to December 2011) and knowledge, attitudes and practices (KAP) around alcohol use and drink-driving for the year 2011. Breath Alcohol Concentration (BrAC) was collected through police enforcement checkpoints in the two provinces. The proportion of drivers with BrAC above the legal limit was plotted over time for both provinces. The trend in prevalence of drink-driving over time was further assessed using Poisson regression models. Prevailing KAPs were determined through surveying randomly selected road users over the age of 17 years at gas stations at quarterly intervals. Cross tabulations of key variables as well Chi-Square statistic were used to assess associations. A total of 8,404 drivers were tested for BrAC levels of which less than 0.25% were female. Of 1,639 drivers displaying BrAC levels in excess of the legal limit, 87.3% were car drivers, 7.9% motorcyclists and 86% were between the ages of 25 and 44 years. KAP surveys captured 1,661 drivers over the study period. The prevalence of self-reported drink-driving increased 6 percentage points among respondents aged 27-36. Between 44% (January 2011) and 49% (December 2011) of respondents indicated awareness of a drinking and driving Blood Alcohol Concentration (BAC) or BrAC limit and only 25% of all study participants recalled being penalized for a traffic violation - none of which were for drink-driving. While there has been some reduction in drink-driving prevalence, inadequate or incorrect knowledge on drink-driving legislation appears to be an impediment to greater gains. Increased

The World Report on Disability in relation to the development of speech-language pathology in Viet Nam.

Science.gov (United States)

Atherton, Marie; Dung, Nguyễn Thị Ngọc; Nhân, Võ Hoàng

2013-02-01

Wylie, McAllister, Davidson, and Marshall (2013) argue that recommendations made within the World Report on Disability provide an opportunity for speech-language pathologists to consider new ways of developing services for people with communication and swallowing disorders. They propose that current approaches to the delivery of speech-language pathology services are largely embedded within the medical model of impairment, thereby limiting the ability of services to meet the needs of people in a holistic manner. In this paper, the criticality of selecting an appropriate service delivery model is discussed within the context of a recently established post-graduate speech therapy education programme in Viet Nam. Driving forces for the implementation of the program will be explored, as will the factors that determined the choice of service delivery. Opportunities and challenges to the long-term viability of the program and the program's potential to meet the needs of persons with communication and swallowing disorders in Viet Nam will be considered.

Multiple and concurrent sexual partnerships among men who have sex with men in Viet Nam: results from a National Internet-based Cross-sectional Survey.

Science.gov (United States)

García, M C; Duong, Q L; Meyer, S B; Ward, P R

2016-03-01

Men who have sex with men (MSM) are one of the largest HIV risk groups in Viet Nam and have been understudied. Sexual concurrency and multiple sex partnerships may contribute to high HIV incidence among MSM in Viet Nam. Limited information is available on concurrency and multiple sexual partnerships among MSM in Viet Nam or on the extent to which this population engages in concurrent and multiple unprotected anal intercourse. Data are from a self-administered Internet-based survey of Vietnamese MSM aged 18 years or older, having sex with male partner(s) in the last 12 months and recruited from social networking MSM-specific websites in Viet Nam. Multiple partnerships and concurrency were measured using the UNAIDS-recommended sexual partner matrix, a key component in the questionnaire. Concurrent and multiple sexual partnerships were analyzed at the individual level. Logistic regression analyses were conducted to assess the demographic characteristics and behaviors associated with multiple sexual partnerships. A total of 1695 MSM reported on multiple sexual partnerships; 69.5% indicated multiple sexual partnerships in the last 6 months. A total of 257 MSM reported on concurrent sexual partnerships, with 51.0% reporting penetrative sex with concurrent partners in the last 6 months. Respondents were more likely to engage in multiple sexual partnerships if they were no longer a student, consumed alcohol before and/or during sex, used the Internet to meet casual sex partners and had never participated in a behavioral HIV intervention. Multiple sexual partnerships in the previous 6 months were common among MSM surveyed, as was sexual concurrency. High levels of multiple and concurrent sexual partnerships may be catalyzing the transmission of HIV among MSM in Viet Nam. Given the high prevalence of this high-risk sexual behavior, our findings underscore the urgent need for targeted prevention efforts, focusing on the reduction of multiple and concurrent sexual partners

Impact of Adverse Events Following Immunization in Viet Nam in 2013 on chronic hepatitis B infection.

Science.gov (United States)

Li, Xi; Wiesen, Eric; Diorditsa, Sergey; Toda, Kohei; Duong, Thi Hong; Nguyen, Lien Huong; Nguyen, Van Cuong; Nguyen, Tran Hien

2016-02-03

Adverse Events Following Immunization in Viet Nam in 2013 led to substantial reductions in hepatitis B vaccination coverage (both the birth dose and the three-dose series). In order to estimate the impact of the reduction in vaccination coverage on hepatitis B transmission and future mortality, a widely-used mathematical model was applied to the data from Viet Nam. Using the model, we estimated the number of chronic infections and deaths that are expected to occur in the birth cohort in 2013 and the number of excessive infections and deaths attributable to the drop in immunization coverage in 2013. An excess of 90,137 chronic infections and 17,456 future deaths were estimated to occur in the 2013 birth cohort due to the drop in vaccination coverage. This analysis highlights the importance of maintaining high vaccination coverage and swiftly responding to reported Adverse Events Following Immunization in order to regain consumer confidence in the hepatitis B vaccine. Copyright © 2015 World Health Organization; licensee Elsevier. Published by Elsevier Ltd.. All rights reserved.

Private standards and labour productivity in the food sector in Viet Nam

DEFF Research Database (Denmark)

Trifkovic, Neda

standards affect labour productivity of small and medium firms from the food sector in Viet Nam. The results based on a 3-year panel show that the application of private standards improves labour productivity. These gains primarily occur to firms operating above a threshold labour-intensity level. Firms......A rising number of firms from developing countries have adopted voluntary private standards in the last decade. This has become an area of active research, especially in terms of the impact of private standards on trade, organizational performance, and employee outcomes. This paper analyses how...

Seroprevalence survey of avian influenza A(H5N1) among live poultry market workers in northern Viet Nam, 2011.

Science.gov (United States)

Dung, Tham Chi; Dinh, Pham Ngoc; Nam, Vu Sinh; Tan, Luong Minh; Hang, Nguyen Le Khanh; Thanh, Le Thi; Mai, Le Quynh

2014-01-01

Highly pathogenic avian influenza A(H5N1) is endemic in poultry in Viet Nam. The country has experienced the third highest number of human infections with influenza A(H5N1) in the world. A study in Hanoi in 2001, before the epizootic that was identified in 2003, found influenza A(H5N1) specific antibodies in 4% of poultry market workers (PMWs). We conducted a seroprevalence survey to determine the seroprevalence of antibodies to influenza A(H5N1) among PMWs in Hanoi, Thaibinh and Thanhhoa provinces. We selected PMWs from five markets, interviewed them and collected blood samples. These were then tested using a horse haemagglutination inhibition assay and a microneutralization assay with all three clades of influenza A(H5N1) viruses that have circulated in Viet Nam since 2004. The overall seroprevalence was 6.1% (95% confidence interval: 4.6-8.3). The highest proportion (7.2%) was found in PMWs in Hanoi, and the majority of seropositive subjects (70.3%) were slaughterers or sellers of poultry. The continued circulation and evolution of influenza A(H5N1) requires comprehensive surveillance of both human and animal sites throughout the country with follow-up studies on PMWs to estimate the risk of avian-human transmission of influenza A(H5N1) in Viet Nam.

Management and treatment outcomes of patients enrolled in MDR-TB treatment in Viet Nam.

Science.gov (United States)

Phuong, N T M; Nhung, N V; Hoa, N B; Thuy, H T; Takarinda, K C; Tayler-Smith, K; Harries, A D

2016-03-21

The programmatic management of drug-resistant tuberculosis (TB) in Viet Nam has been rapidly scaled up since 2009. To document the annual numbers of patients enrolled for multidrug-resistant tuberculosis (MDR-TB) treatment during 2010-2014 and to determine characteristics and treatment outcomes of patients initiating treatment during 2010-2012. A retrospective cohort study using national reports and data from the national electronic data system for drug-resistant TB. The number of patients enrolled annually for MDR-TB treatment increased from 97 in 2010 to 1522 in 2014. The majority of patients were middle-aged men who had pulmonary disease and had failed a retreatment regimen; 77% had received ⩾2 courses of TB treatment. Favourable outcomes (cured and treatment completed) were attained in 73% of patients. Unfavourable outcomes included loss to follow-up (12.5%), death (8%) and failure (6.3%). Having had ⩾2 previous treatment courses and being human immunodeficiency virus-positive were associated with unfavourable outcomes. Increasing numbers of patients are being treated for MDR-TB each year with good treatment outcomes under national programme management in Viet Nam. However, there is a need to increase case detection-currently at 30% of the estimated 5100 MDR-TB cases per year, reduce adverse outcomes and improve monitoring and evaluation.

Collaborative activities and treatment outcomes in patients with HIV-associated tuberculosis in Viet Nam.

Science.gov (United States)

Huyen, T T T; Nhung, N V; Shewade, H D; Hoa, N B; Harries, A D

2016-03-21

The National Tuberculosis (TB) Programme in Viet Nam and Ho Chi Minh City (HCMC). To determine 1) at national level between 2011 and 2013, the relationship between human immunodeficiency virus (HIV) testing, uptake of TB-HIV interventions and adverse treatment outcomes among TB-HIV patients; and 2) in HCMC in 2013, patient characteristics associated with adverse outcomes. An ecological study reviewing aggregate nationwide data and a retrospective cohort review in HCMC. Nationwide, from 2011 to 2013, HIV testing increased in TB patients from 58% to 68% and antiretroviral therapy (ART) increased in TB-HIV patients from 54% to 63%. Adverse treatment outcomes in TB-HIV patients increased from 24% to 27%, largely due to transfer out (5-9% increase) and death. The Northern and Highland regions showed poor uptake of TB-HIV interventions. In HCMC, 303 (27%) of 1110 TB-HIV patients had adverse outcomes, with higher risks observed in those with previously treated TB, those diagnosed as HIV-positive before TB onset and those never placed on cotrimoxazole or ART. Despite improving HIV testing rates and TB-HIV interventions, adverse outcomes in TB-HIV patients remain at about 26%. Characteristics predicting higher risk of adverse outcomes must be addressed if Viet Nam wishes to end the TB epidemic by 2030.

A world-class target for ICDP drilling at Lake Nam Co, Tibetan Plateau, China: progresses and perspectives

Science.gov (United States)

Zhu, L.; Wang, J.; Daut, G.; Spiess, V.; Haberzettl, T.; Schulze, N.; Ju, J.; Lü, X.; Bergmann, F.; Haberkern, J.; Schwalb, A.; Mäusbacher, R.

2017-12-01

Lake Nam Co (ca. 2000 km2, 4718 m a.s.l., maximum depth: 100 m) is located at the interaction zone of the Westerlies and the Indian monsoon on the central Tibetan Plateau. It was part of a mega-lake during Marine Isotope Stage (MIS) 3 before the Last Glacial Maximum. A long term sedimentary record from Nam Co could therefore provide an excellent paleo-environmental sequence for regional and global comparative studies. This will to deepen our understanding of large scale atmospheric circulation shifts and the environmental links between the Tibetan Plateau at low latitudes and the North Atlantic region at high latitudes. A Nam Co deep drilling will fill the gap in two large scale ICDP/IODP drilling transects (N-S: Lake Baikal, Lake Qinghai, Bay of Bengal; W-E: Lake Van, Lake Issyk-Kul, South China Sea, Lake Towuti), which will show the great significance of monsoon dynamics on a long-term scale. Multidisciplinary researches have been conducted since 2005 by a Sino-German cooperative team. The progresses during the last decade are: 1) Detailed bathymetric surveying, including a shallow sediment profiler investigation (Innomar SES 2000 light, ca. 30 m sediment penetration); 2) Paleo-environmental reconstructions covering the past 24 ka; 3) Modern sediment distribution covering the entire lake; 4) Monitoring including water temperature profiles, sediment traps, seasonal airborne pollen collection; 5) Deep seismic survey penetrating up to 800 meters of lake sediments. Based on sediment rates from reference core NC08/01, seismic results show that an age of 500 ka may be reached at 500 m, and >1 Ma at the observed base. Faulting can be clearly detected in the seismic profiles, especially from MIS 5 to early Holocene, and shows the characteristics of normal faults or strike-slip faults. Both rotation of the layers and the close spacing, along with negative and positive offsets of the faults make a transtensional origin of the basin likely. An ICDP workshop proposal was

Examining the Seven-Flag "Chieu Hoi" Pass: A Primary Document from the American War in Viet Nam

Science.gov (United States)

Engelmann, Ted

2006-01-01

During the Viet Nam war, U.S. military helicopters dropped "Chieu Hoi" (safe conduct) passes over suspected enemy locations to encourage enemy soldiers to surrender. This article presents a classroom activity that encourages students to examine a "Chieu Hoi" pass as a primary historical document, identify its various elements,…

The Elimination of Illiteracy and the Use of Complementary Education in the Socialist Republic of Viet Nam.

Science.gov (United States)

United Nations Educational, Scientific, and Cultural Organization, Bangkok (Thailand). Regional Office for Education in Asia and Oceania.

To counteract the legacy of 80 years of colonial rule in North Viet Nam, President Ho Chi Minh outlined government objectives in the Declaration of Independence in 1945. Major objectives included combatting ignorance and illiteracy. To work toward these objectives, the government established a Department of Popular Education and encouraged…

Detection of NAM-A1 Natural Variants in Bread Wheat Reveals Differences in Haplotype Distribution between a Worldwide Core Collection and European Elite Germplasm

Directory of Open Access Journals (Sweden)

Fabien Cormier

2015-04-01

Full Text Available In wheat, remobilization of nitrogen absorbed before anthesis and regulation of monocarpic senescence is a major issue in breeding for nutrient use efficiency. We identified natural variants of NAM-A1, a gene having the same role as its well-characterized homoeolog NAM-B1, a NAC transcription factor associated with senescence kinetics and nutrient remobilization to the grain. Differences in haplotype frequencies between a worldwide core collection and a panel of European elite varieties were assessed and discussed. Moreover, hypotheses for the loss of function of the most common haplotype in elite European germplasm are discussed.

Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei) and leaf rust (Puccinia hordei) in barley using nested association mapping (NAM)

Science.gov (United States)

Vatter, Thomas; Maurer, Andreas; Perovic, Dragan; Kopahnke, Doris; Pillen, Klaus

2018-01-01

The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM) was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars. PMID:29370232

Identification of QTL conferring resistance to stripe rust (Puccinia striiformis f. sp. hordei and leaf rust (Puccinia hordei in barley using nested association mapping (NAM.

Directory of Open Access Journals (Sweden)

Thomas Vatter

Full Text Available The biotrophic rust fungi Puccinia hordei and Puccinia striiformis are important barley pathogens with the potential to cause high yield losses through an epidemic spread. The identification of QTL conferring resistance to these pathogens is the basis for targeted breeding approaches aiming to improve stripe rust and leaf rust resistance of modern cultivars. Exploiting the allelic richness of wild barley accessions proved to be a valuable tool to broaden the genetic base of resistance of barley cultivars. In this study, SNP-based nested association mapping (NAM was performed to map stripe rust and leaf rust resistance QTL in the barley NAM population HEB-25, comprising 1,420 lines derived from BC1S3 generation. By scoring the percentage of infected leaf area, followed by calculation of the area under the disease progress curve and the average ordinate during a two-year field trial, a large variability of resistance across and within HEB-25 families was observed. NAM based on 5,715 informative SNPs resulted in the identification of twelve and eleven robust QTL for resistance against stripe rust and leaf rust, respectively. Out of these, eight QTL for stripe rust and two QTL for leaf rust are considered novel showing no overlap with previously reported resistance QTL. Overall, resistance to both pathogens in HEB-25 is most likely due to the accumulation of numerous small effect loci. In addition, the NAM results indicate that the 25 wild donor QTL alleles present in HEB-25 strongly differ in regard to their individual effect on rust resistance. In future, the NAM concept will allow to select and combine individual wild barley alleles from different HEB parents to increase rust resistance in barley. The HEB-25 results will support to unravel the genetic basis of rust resistance in barley, and to improve resistance against stripe rust and leaf rust of modern barley cultivars.

Accreditation of Viet Nam's Higher Education: Achievements and Challenges after a Dozen Years of Development

Science.gov (United States)

Nguyen, Huu Cuong; Evers, Colin; Marshall, Stephen

2017-01-01

Purpose: The purpose of this paper is to investigate the development of Viet Nam's approach to higher education quality assurance during the past dozen years since its establishment, focusing on the achievements and challenges. Design/methodology/approach: This is a desktop analysis study. The paper analyses the policies and practices related to…

No evidence for ideological asymmetry in dissonance avoidance : Unsuccessful close and conceptual replications of Nam, Jost, and van Bavel

NARCIS (Netherlands)

Collins, Timothy P.; Crawford, Jarret T.; Brandt, M.J.

2013-01-01

Nam, Jost, and van Bavel (2013) found that conservatives were more likely than liberals to avoid dissonance-arousing situations (viz., writing counter-attitudinal essays in a high-choice situation). A close replication of this original research was unsuccessful, as both liberals and conservatives

Allergen sensitisation among chronic respiratory diseases in urban and rural areas of the south of Viet Nam.

Science.gov (United States)

Chu, H T; Godin, I; Phuong, N T; Nguyen, L H; Hiep, T T M; Michel, O

2018-02-01

To evaluate the prevalence of and risk factors for allergen sensitisation among patients with chronic respiratory disease (CRD) in southern Viet Nam. An environmental questionnaire and skin prick tests for airborne and food allergens were administered to patients with CRD, defined as individuals with respiratory symptoms and lung function defects. Of 610 CRD patients, 56% had chronic obstructive pulmonary disease and 31% were asthma patients; 80% were males. The most frequent sensitisers were dust mites (Dermatophagoides farinae 22%, Blomia tropicalis 19%, D. pteronyssinus 18%) and cockroach droppings (13%). Among study participants, 37% were from rural settings and 36% from urban areas, whereas 27% had migrated from rural to urban areas. Compared with people from rural areas, being born in an urban area was a risk factor for sensitisation to mites (OR 1.56, 95%CI 1.11-2.20, P Viet Nam. Compared with the urban population, being native to a rural area was protective against mite sensitisation, but this effect ceased to be significant after migration from rural to urban areas.

Seroprevalence survey of avian influenza A(H5N1 among live poultry market workers in northern Viet Nam, 2011

Directory of Open Access Journals (Sweden)

Tham Chi Dung

2014-11-01

Full Text Available Objective: Highly pathogenic avian influenza A(H5N1 is endemic in poultry in Viet Nam. The country has experienced the third highest number of human infections with influenza A(H5N1 in the world. A study in Hanoi in 2001, before the epizootic that was identified in 2003, found influenza A(H5N1 specific antibodies in 4% of poultry market workers (PMWs. We conducted a seroprevalence survey to determine the seroprevalence of antibodies to influenza A(H5N1 among PMWs in Hanoi, Thaibinh and Thanhhoa provinces. Methods: We selected PMWs from five markets, interviewed them and collected blood samples. These were then tested using a horse haemagglutination inhibition assay and a microneutralization assay with all three clades of influenza A(H5N1 viruses that have circulated in Viet Nam since 2004. Results: The overall seroprevalence was 6.1% (95% confidence interval: 4.6–8.3. The highest proportion (7.2% was found in PMWs in Hanoi, and the majority of seropositive subjects (70.3% were slaughterers or sellers of poultry. Discussion: The continued circulation and evolution of influenza A(H5N1 requires comprehensive surveillance of both human and animal sites throughout the country with follow-up studies on PMWs to estimate the risk of avian–human transmission of influenza A(H5N1 in Viet Nam.

Violation of Bans on Tobacco Advertising and Promotion at Points of Sale in Viet Nam: Trend from 2009 - 2015.

Science.gov (United States)

Huong, Le Thi Thanh; Long, Tran Khanh; Son, Phung Xuan; Huyen, Do Phuc; Linh, Phan Thuy; Bich, Nguyen Ngoc; Lam, Nguyen Xuan; Anh, Le Vu; Tuyet-Hanh, Tran Thi

2016-01-01

Comprehensive bans on tobacco advertising and promotion were introduced through tobacco control legislation in Viet Nam, but it has been established that violations of the bans are very common. This study was conducted to explore the trend in violations of bans on tobacco advertising and promotion at points of sale in Viet Nam in the past six years and to explore any differences in the violation situations before and after the Law on Tobacco Control came into effect on 1st May 2013. Quantitative data were collected through observation of violations of the bans on tobacco advertising and promotion at points of sale in 10 provinces throughout Viet Nam in four survey rounds (2009, 2010, 2011, and 2015). Variation in violation prevalence over time was examined by chi-square test using a Bonferini method. Binary logistic regression was employed to identify the factors that may have influences on different types of violation. A level of significance of padvertising increased while violations on promotion ban and on displaying tobacco decreased through time. Some factors associated with the tobacco advertising and promotion bans included surveyed years, types of points of sale, regions and areas where the points of sale were located. The enforcement of the bans did not improve even after the issuance and the enactment of the Law on Tobacco Control. This suggests that the monitoring and enforcement of bans on tobacco advertising and promotion at points of sale should be strengthened. Penalties should be strictly applied for violators as indicated in the current tobacco control legislation.

Determination of boron and lithium in diverse biological matrices using neutron activation-mass spectrometry (NA-MS)

International Nuclear Information System (INIS)

Iyengar, G.V.; Downing, R.G.; Clarke, W.B.

1990-01-01

Essential features of the neutron activation-mass Spectrometry (NA-MS) technique are described. Applicability of this technique for the simultaneous determination of boron and lithium is demonstrated for a diverse group of biomaterials. NA-MS is a nondestructive analytical technique, and dynamic in nature since its coverage extends to a broad range of concentration levels. Contamination after the irradiation step, extraneous by natural lithium or boron is inconsequential, since only the activation products are the analyted assayed. Coupling the nuclear activation phenomenon which generates 4 He and 3 He (from 10 B and 6 Li, respectively), with the high precision potential of mass spectrometry forms the bases of this technique. Under ideal conditions the detection limit is extendable to pg g -1 concentration ranges and therefore, it is extremely well suited to investigate the natural concentration levels of boron and lithium in biomaterials. The potential of this method for the determination of lithium in biomedical trace element research is of special significance since determination of sub-ppb levels of lithium by other analytical techniques faces serious analytical difficulties mainly due to contamination control and in some cases to insufficiently low detection limits. (orig.)

Early marriage and intimate partner violence among adolescents and young adults in Viet Nam.

Science.gov (United States)

Hong Le, Minh Thi; Tran, Thach Duc; Nguyen, Huong Thanh; Fisher, Jane

2014-03-01

Research about the association between early marriage and intimate partner violence (IPV) in low-income countries has yielded conflicting evidence. The aim of this study was to describe the prevalence of and associations between early marriage, and IPV among adolescents and young adults in Viet Nam. Secondary analysis of data from the national Survey Assessment of Viet Namese Youth-Round II (SAVY-II) conducted in 2009-2010, which assessed a representative cohort of people aged 14 to 25 years recruited via a systematic household survey was undertaken. Prevalence was established using descriptive statistics. The association between early marriage and IPV was examined using multiple logistic regressions, adjusting for potential risk factors. Of 10,044 participants, 1,701 had ever married and were included in analyses. Early marriage (before age 18), and experiences of verbal, physical, or sexual IPV were more common among females than males. More young married men than women reported experiences of controlling behaviors by their partners. Early marriage, being illiterate, and exposure to sexual abuse were associated with experience of IPV among young females, but not among young males. Poverty and exposure to family violence was associated with IPV in both sexes. Addressing early marriage, low educational opportunities for girls, childhood sexual abuse, family violence, and poverty should be considered in strategies to reduce IPV in Viet Nam.

Manual on sample-based data collection for fisheries assessment : Examples from Viet Nam

DEFF Research Database (Denmark)

Sparre, Per Johan

with through both detailed discussion and by using simple examples. These examples are mostly based on situations in tropical fisheries and, in particular, experience has been drawn from developing a data collection programme in Viet Nam. The main questions addressed in the manual are which fisheries data...... to collect, where and when to collect them. Only data collected from commercial marine capture fisheries are considered (data from freshwater fisheries, cultured fish and experimental fisheries are excluded). The methodologies used are mainly appropriate for a tropical developing country with many small...

Harm reduction and “Clean” community: can Viet Nam have both?

Directory of Open Access Journals (Sweden)

Khuat Thu

2012-07-01

Full Text Available Abstract The findings of our research show that while police play multiple roles in the fight against drug-related crime, they often perceived their tasks – especially preventing and controlling drug use on the one hand, and supporting harm reduction on the other – as contradictory, and this creates tensions in their work and relations with their communities. Although they are leaders and implementers of harm reduction, not all police know about it, and some remain skeptical or perceive it as contradictory to their main task of fighting drugs. Methadone treatment is seen by some as in competition with their main task of coordinating conventional drug treatment in the rehabilitation center. The history of drug use and the evolution of discourses on drug use in Viet Nam have created these conflicting pressures on police, and thus created contradictory expectations and led to different views and attitudes of police regarding various harm reduction measures. This might aid understanding why, despite the comprehensive and progressive policies on HIV/AIDS and harm reduction in Viet Nam, it is not easy for police to actively and effectively support and be involved in harm reduction at the ground level. To promote the wider acceptance of harm reduction the concept of community safety must be expanded to include community health; harm reduction must be integrated into the “new society” movement; and laws and policies need further revision to reduce contradiction between current drug laws and HIV laws. Harm reduction guidelines for police and other actors need to be disseminated and supported, embodying better ways of working between sectors, and all sectors in the partnership require support for building capacity to contribute to the overall goal.

Validation of clinical case definition of acute intussusception in infants in Viet Nam and Australia.

OpenAIRE

Bines, JE; Liem, NT; Justice, F; Son, TN; Carlin, JB; de Campo, M; Jamsen, K; Mulholland, K; Barnett, P; Barnes, GL

2006-01-01

OBJECTIVE: To test the sensitivity and specificity of a clinical case definition of acute intussusception in infants to assist health-care workers in settings where diagnostic facilities are not available. METHODS: Prospective studies were conducted at a major paediatric hospital in Viet Nam (the National Hospital of Pediatrics, Hanoi) from November 2002 to December 2003 and in Australia (the Royal Children's Hospital, Melbourne) from March 2002 to March 2004 using a clinical case definition ...

Improving hospital death certification in Viet Nam: results of a pilot study implementing an adapted WHO hospital death report form in two national hospitals.

Science.gov (United States)

Walton, Merrilyn; Harrison, Reema; Chevalier, Anna; Esguerra, Esmond; Van Duong, Dang; Chinh, Nguyen Duc; Giang, Huong

2016-01-01

Viet Nam does not have a system for the national collection of death data that meets international requirements for mortality reporting. It is identified as a 'no-report' country by the WHO. Verbal autopsy reports are used in the community but exclude deaths in hospitals. This project was undertaken in Bach Mai National General Hospital and Viet Duc Surgical and Trauma Hospital in Viet Nam from 1 March 2013 to 31 March 2015. In phase 1, a modified hospital death report form, consistent with the International Statistical Classification of Diseases and Related Health Problems, 10th Revision, was developed. Small group training in use of the report form was delivered to 427 doctors. In phase two, death data were collected, collated and analysed. In phase three, a random sample (7%) of all report forms was checked for accuracy and completeness against medical records. During the 23 months of the study, 3956 deaths were recorded. Across both hospitals, 222 distinct causes of deaths were recorded. Traumatic cerebral oedema was the immediate cause of death (15% of cases, 575/3956 patients), followed by septic shock (13%, 528/3956), brain compression (11%, 416/3956), intracerebral haemorrhage (8%, 336/3956) and pneumonia (5%, 186/3956); 67% (2639/3956) of patients were discharged home to die and 33% (1314/3956) of deaths were due to a road traffic accident, or injury at home or at work. This study confirms the viability of implementing a death report form system compliant with international standards in hospitals in Viet Nam and provides the foundation for introducing a national death report form scheme. These data are critical to comprehensive knowledge of causes of death in Viet Nam. Death data about patients discharged home to die is presented for the first time, with implications for countries where this is a cultural preference.

A multicentre molecular analysis of hepatitis B and blood-borne virus coinfections in Viet Nam.

Directory of Open Access Journals (Sweden)

Linda Dunford

Full Text Available Hepatitis B (HBV infection is endemic in Viet Nam, with up to 8.4 million individuals estimated to be chronically infected. We describe results of a large, multicentre seroepidemiological and molecular study of the prevalence of HBV infection and blood-borne viral coinfections in Viet Nam. Individuals with varying risk factors for infection (n = 8654 were recruited from five centres; Ha Noi, Hai Phong, Da Nang, Khanh Hoa and Can Tho. A mean prevalence rate of 10.7% was observed and levels of HBsAg were significantly higher in injecting drug users (IDUs (17.4%, n = 174/1000 and dialysis patients (14.3%, n = 82/575 than in lower-risk groups (9.4%; p<0.001. Coinfection with HIV was seen in 28% of HBV-infected IDUs (n = 49/174 and 15.2% of commercial sex workers (CSWs; n = 15/99. HCV infection was present in 89.8% of the HBV-HIV coinfected IDUs (n = 44/49 and 40% of HBV-HIV coinfected CSWs (n = 16/40. Anti-HDV was detected in 10.7% (n = 34/318 of HBsAg positive individuals. Phylogenetic analysis of HBV S gene (n = 187 showed a predominance of genotype B4 (82.6%; genotypes C1 (14.6%, B2 (2.7% and C5 (0.5% were also identified. The precore mutation G1896A was identified in 35% of all specimens, and was more frequently observed in genotype B (41% than genotype C (3%; p<0.0001. In the immunodominant 'a' region of the surface gene, point mutations were identified in 31% (n = 58/187 of sequences, and 2.2% (n = 4/187 and 5.3% (n = 10/187 specimens contained the major vaccine escape mutations G145A/R and P120L/Q/S/T, respectively. 368 HBsAg positive individuals were genotyped for the IL28B SNP rs12979860 and no significant association between the IL28B SNP and clearance of HBsAg, HBV viral load or HBeAg was observed. This study confirms the high prevalence of HBV infection in Viet Nam and also highlights the significant levels of blood-borne virus coinfections, which have important implications for hepatitis-related morbidity and development of effective

A Self-Sustained Education System for a Developing Country: The Case of the Socialist Republic of Viet Nam.

Science.gov (United States)

Tran, Dien Ngoc

Viet Nam's average annual population growth rate is 2.6%, which accounts for a large youth population: 37.7% of the total population is under age 15, compared with an average of 20% in developed or newly industrialized countries. A free basic education for all children is almost impossible to provide. With consideration of the Vietnamese people's…

Prevalence of and risk factors for violent disciplinary practices at home in Viet Nam.

Science.gov (United States)

Cappa, Claudia; Dam, Hang

2014-02-01

Data on parenting practices and the use of violence in child rearing remain scarce worldwide, hindering prevention efforts. This study examines disciplinary methods used on children at home in Viet Nam. It is based on data collected from 2010 to 2011 through the fourth round of the Multiple Indicator Cluster Survey (MICS4)-a household survey program supported by the United Nations Children's Fund (UNICEF) that focuses on women and children in low- and middle-income countries. Respondents in the survey were asked 11 questions relating to disciplinary measures used in the preceding month on one randomly selected child (2-14 years old) in each household. A final question about attitudes probed adults' views on the need for physical punishment in child rearing. Univariate and multivariate analyses were conducted to estimate the prevalence of violent and nonviolent forms of discipline, and to identify risk factors associated with violent punishment. Results showed that three in four children in Viet Nam are disciplined through violent means. The exposure of Vietnamese children to violent forms of discipline was significantly associated with varied characteristics of both children and their caregivers. Moreover, the use of violent disciplinary practices on children was strongly associated with positive attitudes toward corporal punishment. Risk factors for violent child discipline identified in this study can inform future interventions to promote positive practices and to protect Vietnamese children against violence in the home.

Effects of Social Class and School Conditions on Educational Enrollment and Achievement of Boys and Girls in Rural Viet Nam

Science.gov (United States)

Nguyen, Phuong L.

2006-01-01

This study examines the effects of parental SES, school quality, and community factors on children's enrollment and achievement in rural areas in Viet Nam, using logistic regression and ordered logistic regression. Multivariate analysis reveals significant differences in educational enrollment and outcomes by level of household expenditures and…

The Agency's technical co-operation programme with Viet Nam 1983-1993 country programme summaries

International Nuclear Information System (INIS)

1993-01-01

This report contains a review of the Agency's technical co-operation activities in Viet Nam carried out during 1983-1993. In terms of coverage and analytical depth, country programmes summaries stand somewhere midway between in-depth country programme evaluations and individual project evaluations. They attempt to provide a comprehensive, descriptive picture of the Agency's co-operation with a Member State in a manner that will be particularly useful for programming decisions. The attempt is very much to describe - largely through statistical data - not to provide independent analysis and evaluation

Epidemiology, Seasonality, and Predictors of Outcome of AIDS-Associated Penicillium marneffei Infection in Ho Chi Minh City, Viet Nam

Science.gov (United States)

Wolbers, Marcel; Quang, Vo Minh; Chinh, Nguyen Tran; Huong Lan, Nguyen Phu; Lam, Pham Si; Kozal, Michael J.; Shikuma, Cecilia M.; Day, Jeremy N.; Farrar, Jeremy

2011-01-01

Background. Penicillium marneffei is an important human immunodeficiency virus (HIV)–associated opportunistic pathogen in Southeast Asia. The epidemiology and the predictors of penicilliosis outcome are poorly understood. Methods. We performed a retrospective study of culture-confirmed incident penicilliosis admissions during 1996–2009 at the Hospital for Tropical Diseases in Ho Chi Minh City, Viet Nam. Seasonality of penicilliosis was assessed using cosinor models. Logistic regression was used to assess predictors of death or worsening disease based on 10 predefined covariates, and Cox regression was performed to model time-to-antifungal initiation. Results. A total of 795 patients were identified; hospital charts were obtainable for 513 patients (65%). Cases increased exponentially and peaked in 2007 (156 cases), mirroring the trends in AIDS admissions during the study period. A highly significant seasonality for penicilliosis (P Viet nam. The number of cases increases during rainy months. Injection drug use, shorter history, absence of fever or skin lesions, respiratory difficulty, higher lymphocyte count, and lower platelet count predict poor in-hospital outcome. PMID:21427403

On stable ground: Tackling soil erosion with nuclear techniques in Viet Nam

International Nuclear Information System (INIS)

Gaspar, Miklos

2015-01-01

Dao Thanh Canh never studied physics or chemistry in school, but he understands a thing or two about nuclear isotopes. Until a couple of years ago, much of his five acre farm on the hills of central Viet Nam was gradually sliding away. Thanks to nuclear techniques used in determining the exact cause and source of soil erosion, his land is now stable, and his coffee plantation profitable. “We were very worried as uncertainty loomed,” he said. “A few centimetres of the soil disappeared every year when we had big hail storms.” Thanh Canh is not alone. Soil degradation affects 1.9 billion hectares of land worldwide, close to two thirds of global soil resources.

Decreasing In-home Smoking of Adults—Results from a School-based Intervention Program in Viet Nam

Directory of Open Access Journals (Sweden)

Le Thi Thanh Huong

2016-10-01

Full Text Available It is indicated that children are involuntarily exposed to secondhand smoke from adults, mainly at their home environment. This study aimed at describing the effectiveness of the school-based intervention to decrease the in-home smoking situation of adults so as to decrease children’s exposure to secondhand smoke at home during the year 2011–2012 in a rural district in Hanoi, Viet Nam. This school-based intervention program (intervention and control group involved 804 children aged 8 to 11 years from August 2011 to May 2012 in a rural district of Hanoi, Viet Nam. Children were taught in class about the harmful effects of secondhand smoke and about how to negotiate with fathers not to smoke in-home. Then children applied what they learnt, including staying away from secondhand smoke and persuading fathers not to smoke in-home in order to decrease children’s exposure to secondhand smoke. Chi square test, t-test and multinominal logistic regression were applied in data analysis. The results showed that children’s reported their father’s in-home smoking decreased from 83.0% pre-intervention to 59.8% post-intervention (p < 0.001 in the intervention school while no change happened in the control school. The study found that the better changed smoking location of adult smokers as reported by children associated with the school who received intervention activities (adjusted OR = 2.04; 95% CI: 1.28–3.24. Poorer changed attitudes towards secondhand smoke of children associated with a lower percentage of better change in smoking location of their fathers/other adult smokers (aOR = 0.51, 95% CI: 0.28–0.96. Children’s poorer changed knowledge towards secondhand smoke also associated with poorer changed smoking location of adult smokers (aOR = 2.88, 95% CI: 1.07–7.76. It is recommended by this study that similar school based intervention approaches should be applied in primary schools in Viet Nam to increase children’s awareness on the

Risk Factors for Chronic Disease in Viet Nam: A Review of the Literature

Science.gov (United States)

Rao, Chalapati; Nhung, Nguyen Thi Trang; Marks, Geoffrey; Hoa, Nguyen Phuong

2013-01-01

Introduction Chronic diseases account for most of the disease burden in low- and middle-income countries, particularly those in Asia. We reviewed literature on chronic disease risk factors in Viet Nam to identify patterns and data gaps. Methods All population-based studies published from 2000 to 2012 that reported chronic disease risk factors were considered. We used standard chronic disease terminology to search PubMed and assessed titles, abstracts, and articles for eligibility for inclusion. We summarized relevant study information in tables listing available studies, risk factors measured, and the prevalence of these risk factors. Results We identified 23 studies conducted before 2010. The most common age range studied was 25 to 64 years. Sample sizes varied, and sample frames were national in 5 studies. A combination of behavioral, physical, and biological risk factors was studied. Being overweight or obese was the most common risk factor studied (n = 14), followed by high blood pressure (n = 11) and tobacco use (n = 10). Tobacco and alcohol use were high among men, and tobacco use may be increasing among Vietnamese women. High blood pressure is common; however, people’s knowledge that they have high blood pressure may be low. A high proportion of diets do not meet international criteria for fruit and vegetable consumption. Prevalence of overweight and obesity is increasing. None of the studies evaluated measured dietary patterns or total caloric intake, and only 1 study measured dietary salt intake. Conclusion Risk factors for chronic diseases are common in Viet Nam; however, more recent and context-specific information is required for planning and monitoring interventions to reduce risk factors and chronic disease in this country. PMID:23306076

First record of a cave species of Euscorpiops Vachon from Viet Nam (Scorpiones, Euscorpiidae, Scorpiopinae).

Science.gov (United States)

Lourenço, Wilson R; Pham, Dinh-Sac

2013-07-01

Euscorpiops cavernicola sp. n., belonging to the family Euscorpiidae Laurie, is described on the basis of two male and two female specimens collected in the Hua Ma cave located in the Quang Khe commune, Ba Be district of Bac Kan province in Viet Nam. The new species presents most features exhibited by scorpions within the genus Euscorpiops, however it may represent the first discovered Scorpiopinae species exhibiting certain adaptations to cave life. Copyright © 2013 Académie des sciences. Published by Elsevier SAS. All rights reserved.

Towards a Lifelong Learning Society through Reading Promotion: Opportunities and Challenges for Libraries and Community Learning Centres in Viet Nam

Science.gov (United States)

Hossain, Zakir

2016-01-01

The government of Viet Nam has made a commitment to build a Lifelong Learning Society by 2020. A range of related initiatives have been launched, including the Southeast Asian Ministers of Education Organization Centre for Lifelong Learning (SEAMEO CELLL) and "Book Day"--a day aimed at encouraging reading and raising awareness of its…

Sensitivity, completeness and agreement of the tuberculosis electronic system in Ho Chi Minh City, Viet Nam.

Science.gov (United States)

Thai, L H; Nhat, L M; Shah, N; Lyss, S; Ackers, M

2017-12-21

Setting: Since 2011, tuberculosis (TB) clinics in Ho Chi Minh City (HCMC), Viet Nam, have been entering data from a paper-based TB treatment register into an electronic database known as VITIMES (Viet Nam TB Information Management Electronic System), which is currently used in parallel with the paper system. Objective: To evaluate the sensitivity, completeness and agreement of data in VITIMES with that of paper-based registers among TB patients co-infected with the human immunodeficiency virus (HIV) being treated for TB in HCMC. Design: This was a retrospective data review of all TB-HIV patients receiving anti-tuberculosis treatment in each of the 24 district TB clinics in HCMC in 2013. Data were abstracted from the paper-based TB treatment registers at district level and extracted electronically at the provincial level. Records were matched based on name, age and address. The sensitivity, completeness and agreement of the electronic data were compared with data from the paper system. Results: The findings showed that the electronic system had high sensitivity (99.2%), high completeness (87-99%) and high agreement (κ 0.78-0.97) for all variables. Conclusion: The results of this study suggest that data are being correctly entered into VITIMES and that patient data can be directly entered into VITIMES instead of having a parallel, paper-based system.

Can health systems be enhanced for optimal health services through disease-specific programs? Results of field studies in Viet Nam and Cambodia.

Science.gov (United States)

Egami, Y; Fujita, N; Akashi, H; Matsumoto, Y; Ohara, H; Takeuchi, M

2012-02-01

Developing better health systems is the key to delivering optimal health services, although more evidence of effective strategies to do so is needed. Field surveys were conducted in Viet Nam and Cambodia to identify best practices in addressing health system bottlenecks to scale up disease control programs. The two countries were compared over time using a framework for analysis developed by the authors. In Viet Nam, a health system was in place for decades at the central to municipal levels, although it was fragile until the 1990s, when the government started taking measures. In Cambodia, the previous health system had been destroyed during previous internal conflict. In the post-conflict period, the health system was rebuilt with support for programs followed by centralization of health services. In different settings, different measures were taken to deal with similar bottlenecks. In Cambodia, vertical programs were dominant, so the government sought to centralize drug management to deal with shortages of essential drugs, while Viet Nam sought to mobilize resources to ensure drug distribution at all levels. This study shows there is no single successful approach to health systems, and a systemic approach needs to be taken because elimination of one bottleneck may reveal another. Efforts to enhance disease-specific programs may not always contribute to overall enhancement of the health system, and the best possible approach may not be the same in different countries. Further study is needed to explore common issues and principles for effective strategies to enhance health systems in different contexts.

Patterns of the utilization of prenatal diagnosis services among pregnant women, their satisfaction and its associated factors in Viet Nam.

Science.gov (United States)

Doan, Duong Thi Thuy; Nguyen, Huong Thi Thu; Bui, Ha Thi Thu

2017-02-01

This study aimed at understanding the patterns of the utilization of prenatal diagnostic (PND) services among pregnant women, their satisfaction and its associated factors at three regional prenatal diagnostic centres in Viet Nam. A cross-sectional design was used, with a consecutive sampling method to recruit pregnant women who used PND services at the three biggest regional PND services centres in Viet Nam between January and June, 2014. A total of 298 participants, about 100 participants per centre were interviewed and included in data analysis. Descriptive analyses and logistic regression methods were applied to identify association between satisfaction of women and their socio-economic characteristics. 80% of pregnant women received counselling on PND services, whilst 90% received ultrasonography services; 65.4% were satisfied with the PND services they used. Pregnant women, who were in a lower income group and received counselling but did not receive ultrasonography, were more likely to have higher satisfaction levels of PND services. A process to ensure that every pregnant woman receives sufficient PND counselling before and after receiving PND testing must be given careful and thorough consideration.

The Disruptive Effect of Lysozyme on the Bacterial Cell Wall Explored by an "In-Silico" Structural Outlook

Science.gov (United States)

Primo, Emiliano D.; Otero, Lisandro H.; Ruiz, Francisco; Klinke, Sebastián; Giordano, Walter

2018-01-01

The bacterial cell wall, a structural unit of peptidoglycan polymer comprised of glycan strands consisting of a repeating disaccharide motif [N-acetylglucosamine (NAG) and N-acetylmuramylpentapeptide (NAM pentapeptide)], encases bacteria and provides structural integrity and protection. Lysozymes are enzymes that break down the bacterial cell wall…

Prevalence and risk factors for tuberculosis infection among hospital workers in Hanoi, Viet Nam.

Science.gov (United States)

Lien, Luu Thi; Hang, Nguyen Thi Le; Kobayashi, Nobuyuki; Yanai, Hideki; Toyota, Emiko; Sakurada, Shinsaku; Thuong, Pham Huu; Cuong, Vu Cao; Nanri, Akiko; Mizoue, Tetsuya; Matsushita, Ikumi; Harada, Nobuyuki; Higuchi, Kazue; Tuan, Le Anh; Keicho, Naoto

2009-08-27

Transmission of tuberculosis (TB) to health care workers (HCWs) is a global issue. Although effective infection control measures are expected to reduce nosocomial TB, HCWs' infection has not been assessed enough in TB high burden countries. We conducted a cross-sectional study to determine the prevalence of TB infection and its risk factors among HCWs in Hanoi, Viet Nam. A total of 300 HCWs including all staff members in a municipal TB referral hospital received an interferon-gamma release assay (IGRA), QuantiFERON-TB Gold In-Tube(TM), followed by one- and two-step tuberculin skin test (TST) and a questionnaire-based interview. Agreement between the tests was evaluated by kappa statistics. Risk factors for TB infection were analyzed using a logistic regression model. Among the participants aged from 20 to 58 years (median = 40), prevalence of TB infection estimated by IGRA, one- and two-step TST was 47.3%, 61.1% and 66.3% respectively. Although the levels of overall agreement between IGRA and TST were moderate, the degree of agreement was low in the group with BCG history (kappa = 0.29). Working in TB hospital was associated with twofold increase in odds of TB infection estimated by IGRA. Increased age, low educational level and the high body mass index also demonstrated high odds ratios of IGRA positivity. Prevalence of TB infection estimated by either IGRA or TST is high among HCWs in the hospital environment for TB care in Viet Nam and an infection control program should be reinforced. In communities with heterogeneous history of BCG vaccination, IGRA seems to estimate TB infection more accurately than any other criteria using TST.

Isolation and Selection of Microalgal Strains from Natural Water Sources in Viet Nam with Potential for Edible Oil Production.

Science.gov (United States)

Thao, Tran Yen; Linh, Dinh Thi Nhat; Si, Vo Chi; Carter, Taylor W; Hill, Russell T

2017-06-23

Industrial vegetable oil production in Viet Nam depends on oil seeds and crude plant oils that are currently more than 90% imported. As the first step in investigating the feasibility of using microalgae to provide Viet Nam with a domestic source of oil for food and edible oil industries, fifty lipid-producing microalgae were isolated and characterized. The microalgae were isolated from water sources ranging from freshwater to brackish and marine waters from a wide geographic distribution in Viet Nam. Initial analyses showed that 20 of the 50 strains had good growth rates, produced high biomass and had high lipid content, ranging up to 50% of dry weight biomass. 18S rRNA gene sequence analyses of the 50 strains showed a great diversity in this assemblage of microalgae, comprising at least 38 species and representatives of 25 genera : Chlamydomonas , Poterioochromonas , Scenedesmus , Desmodesmus , Chlorella , Bracteacoccus , Monoraphidium , Selenastrum , Acutodesmus , Mychonastes , Ankistrodesmus , Kirchneriella , Raphidocelis , Dictyosphaerium , Coelastrella , Schizochlamydella , Oocystidium , Nannochloris , Auxenochlorella , Chlorosarcinopsis , Stichococcus , Picochlorum , Prasinoderma , Chlorococcum , and Marvania. Some of the species are closely related to well-known lipid producers such as Chlorella sorokiniana , but some other strains are not closely related to the strains found in public sequence databases and likely represent new species. Analysis of oil quality showed that fatty acid profiles of the microalgal strains were very diverse and strain-dependent. Fatty acids in the microalgal oils comprised saturated fatty acids (SFAs), poly-unsaturated fatty acids (PUFAs), and mono-unsaturated fatty acids (MUFAs). The main SFA was palmitic acid. MUFAs and PUFAs were dominated by oleic acid, and linoleic and linolenic acids, respectively. Some strains were especially rich in the essential fatty acid α-linolenic acid (ALA), which comprised more than 20% of the

Art as a Political Act: Expression of Cultural Identity, Self-Identity, and Gender by Suk Nam Yun and Yong Soon Min

Science.gov (United States)

Caruso, Hwa Young Choi

2005-01-01

This cross-cultural study explored the lives of two contemporary Korean/Korean American women artists--Suk Nam Yun and Yong Soon Min--who live in Seoul, South Korea, and Los Angeles, California. The author's research focused on the artists' identity formation, artistic expression, professional achievements, and the role of art as a political act.…

Trends in Second-Hand Tobacco Smoke Exposure Levels at Home among Viet Nam School Children Aged 13-15 and Associated Factors.

Science.gov (United States)

Lam, Nguyen Tuan; Nga, Pham Thi Quynh; Minh, Hoang Van; Giang, Kim Bao; Hai, Phan Thi; Huyen, Doan Thu; Linh, Nguyen Thuy; Van, Duong Khanh; Khue, Luong Ngoc

2016-01-01

Second-hand tobacco smoke (SHS) exposure at home, especially among children, is a serious issue in Viet Nam. During the past decade, much effort has been taken for tobacco control in the country, including various prgorammes aiming to reduce SHS exposure among adults and children. This article analysed trends and factors associated with SHS exposure at home among school children aged 13-15 in Viet Nam, using the Global Youth Tobacco Surveys conducted in 2007 and 2014. Descriptive and inferential statistical methods with logistic regression were applied. Overall, there was a significant reduction in the level of exposure, from 58.5% (95%CI: 57.6-59.3) in 2007 to 47.1% (95%CI: 45.4-48.8) in 2014. Of the associated factors, having one or both parents smoking was significantly associated with the highest odds of SHS exposure at home (OR=5.0; 95%CI: 4.2-6.1). Conversely, having a mother with a college or higher education level was found to be a protective factor (OR=0.5; 95%CI: 0.3-0.8).

Gauging the Acceptability of HIV Vaccines: An Exploratory Study Examining Knowledge, Attitudes, and Beliefs among Injecting Drug Users in Viet Nam

Science.gov (United States)

Nguyen, France

2007-01-01

In contrast to other countries in Southeast Asia, the HIV/ AIDS epidemic is in the initial stages in Viet Nam, although the rates have increased notably since 1997. This study examined attitudes towards the use of an HIV vaccine (when one becomes available) as a means for preventing the disease. Since injecting drug users are the great majority of…

Prevalence and risk factors for tuberculosis infection among hospital workers in Hanoi, Viet Nam.

Directory of Open Access Journals (Sweden)

Luu Thi Lien

Full Text Available BACKGROUND: Transmission of tuberculosis (TB to health care workers (HCWs is a global issue. Although effective infection control measures are expected to reduce nosocomial TB, HCWs' infection has not been assessed enough in TB high burden countries. We conducted a cross-sectional study to determine the prevalence of TB infection and its risk factors among HCWs in Hanoi, Viet Nam. METHODOLOGY/PRINCIPAL FINDINGS: A total of 300 HCWs including all staff members in a municipal TB referral hospital received an interferon-gamma release assay (IGRA, QuantiFERON-TB Gold In-Tube(TM, followed by one- and two-step tuberculin skin test (TST and a questionnaire-based interview. Agreement between the tests was evaluated by kappa statistics. Risk factors for TB infection were analyzed using a logistic regression model. Among the participants aged from 20 to 58 years (median = 40, prevalence of TB infection estimated by IGRA, one- and two-step TST was 47.3%, 61.1% and 66.3% respectively. Although the levels of overall agreement between IGRA and TST were moderate, the degree of agreement was low in the group with BCG history (kappa = 0.29. Working in TB hospital was associated with twofold increase in odds of TB infection estimated by IGRA. Increased age, low educational level and the high body mass index also demonstrated high odds ratios of IGRA positivity. CONCLUSIONS/SIGNIFICANCE: Prevalence of TB infection estimated by either IGRA or TST is high among HCWs in the hospital environment for TB care in Viet Nam and an infection control program should be reinforced. In communities with heterogeneous history of BCG vaccination, IGRA seems to estimate TB infection more accurately than any other criteria using TST.

The online measured black carbon aerosol and source orientations in the Nam Co region, Tibet.

Science.gov (United States)

Zhang, Xin; Ming, Jing; Li, Zhongqin; Wang, Feiteng; Zhang, Guoshuai

2017-11-01

Equivalent black carbon (eBC) mass concentrations were measured by an aethalometer (AE-31) in the Nam Co, central Tibet from 2010 to 2014. Different from previous filter-sampling studies (Ming et al., J Environ Sci 22(11):1748-1756, 2010; Zhao et al., Environ Sci Pollut Res 20:5827-5838, 2013), the first high-resolution online eBC measurement conducted in central Tibet is reported here, allowing to discuss the diurnal variations as well as seasonal variabilities of eBC. Average daily eBC concentration was 74 ± 50 ng/m 3 , reflecting a global background level. Meteorological conditions influenced eBC concentrations largely at seasonal scale, which are higher in February-May but lower in June-January. The highest eBC concentrations (greater than 210 ng/m 3 ) were more associated with the W and WSW winds smaller than 6 m/s. The diurnal variations of eBC showed plateaus from 10:00 to 15:00 with seasonal variations, associated with local anthropogenic activities, such as indigenous Tibetan burning animal waste and tourism traffic. The PBLHs showed a co-variance with eBC concentrations, implicating close sources. The aerosol optical depths derived from the MODIS data over the Nam Co Observatory Station (NCOS)-included sub-area (30° N-40° N, 90° E-100° E) showed significant relationship with eBC concentrations. This suggests that nearby or short-distance sources other than long-distance transported pollutants could be important contributors to eBC concentrations at the NCOS, different from the conclusions suggested by previous studies.

Evaluation of the integrated clinic model for HIV/AIDS services in Ho Chi Minh City, Viet Nam, 2013-2014.

Science.gov (United States)

Hung, V; Nguyen, S T; Tieu, V T T; Nguyen, T T T; Duong, T H; Lyss, S; Oeltmann, J E

2016-12-21

Setting: Ho Chi Minh City (HCMC), Viet Nam. Objective: To evaluate a new integrated service model for human immunodeficiency virus/acquired immune-deficiency syndrome (HIV/AIDS) care. Design: In HCMC, co-located services, including voluntary HIV counseling and testing (VCT), HIV treatment at out-patient clinics (OPC), and methadone maintenance therapy (MMT) for persons who inject drugs, have operated under different administrative structures. In the context of decreasing international financial support, integration of these services into one administrative structure with reduced staff occurred in seven districts in HCMC between October 2013 and June 2014. We used a pre-post study design to compare service-related outcomes from routinely collected data at health facilities 6 months before and 6 months after integration. Results: The proportion of HIV-infected persons linked from VCT to OPCs was unchanged or increased following integration. A higher percentage of patients eligible for antiretroviral therapy (ART) were started on ART. The proportion of ART patients lost to follow-up remained unchanged. The proportions of MMT patients who tested positive for heroin or other substances decreased or were unchanged. Conclusions: VCT, OPC and MMT service delivery quality remained the same or improved during the 6 months following the integration. Expansion of the integrated model should be considered for HIV-related services.

Impact of mandatory motorcycle helmet wearing legislation on head injuries in Viet Nam: results of a preliminary analysis.

Science.gov (United States)

Passmore, Jonathon; Tu, Nguyen Thi Hong; Luong, Mai Anh; Chinh, Nguyen Duc; Nam, Nguyen Phuong

2010-04-01

To compare estimated prevalence of head injuries among road traffic injury patients admitted to hospitals, before and after the introduction of a mandatory helmet law in the Socialist Republic of Viet Nam. Before and after study of all road traffic injury patients with head injuries admitted to 20 provincial and central hospitals 3 months before and after the new law came into effect on 15 December 2007. Relative risk was computed and comparison made for the periods of 3 months before and after the new law. The study found a 16 percent reduction in the risk of road traffic head injuries (4683 to 3522; relative risk [RR] 0.84; 95% confidence interval [CI] 0.81-0.87) and an 18 percent reduction in the risk of road traffic death (deaths in hospital plus injured patients discharged to die at home; 566 to 417; RR 0.82; 95% CI 0.73-0.93). Over the first 3 months of the comprehensive mandatory helmet legislation there has been a significant reduction in the risk of road traffic head injuries among patients admitted to 20 hospitals. The Viet Nam Government's decision to require all motorcycle riders and passengers to wear helmets is suspected of leading to positive road safety benefits and should be seen as a policy example for other low- and middle-income countries with a high utilization of motorcycles for transport.

South China sea off Viet Nam to see more exploration

International Nuclear Information System (INIS)

Anon.

1992-01-01

British and Japanese operators are posed for exploration campaigns off southern Viet Nam. This paper reports that a 50-50 partnership of Lasmo International Ltd., London, and C. Itoh Exploration Co. of Japan signed a heads of agreement covering Block 04-2, and AEDC Vietnam Oil Development Co. and Teikoku Oil Co. acquired Block 05-3 under a production sharing contract. AEDC is a unit of AOC Energy Development Co., a subsidiary of Arabian Oil Co. (AOC) of Japan. Both tracts are in the Con Son basin in the South China Sea. Site is 15 km north of 500 million bbl Dai Hung (Big Bear) oil field for which state owned Petrovietnam is evaluating bids to place on production. A unit of the Royal Dutch/shell Group acquired a west offset, Block 10, early this year. The Lasmo-C. Itoh acreage is among five blocks offered in Vietnam's second round of offshore licensing. All are in the area that once was reserved entirely for Vietsovpetro, a partnership of Petrovietnam and the former Soviet Union

Aetiologies of central nervous system infection in Viet Nam: a prospective provincial hospital-based descriptive surveillance study.

Directory of Open Access Journals (Sweden)

Nghia Ho Dang Trung

Full Text Available Infectious diseases of the central nervous system (CNS remain common and life-threatening, especially in developing countries. Knowledge of the aetiological agents responsible for these infections is essential to guide empiric therapy and develop a rational public health policy. To date most data has come from patients admitted to tertiary referral hospitals in Asia and there is limited aetiological data at the provincial hospital level where most patients are seen.We conducted a prospective Provincial Hospital-based descriptive surveillance study in adults and children at thirteen hospitals in central and southern Viet Nam between August 2007-April 2010. The pathogens of CNS infection were confirmed in CSF and blood samples by using classical microbiology, molecular diagnostics and serology.We recruited 1241 patients with clinically suspected infection of the CNS. An aetiological agent was identified in 640/1241 (52% of the patients. The most common pathogens were Streptococcus suis serotype 2 in patients older than 14 years of age (147/617, 24% and Japanese encephalitis virus in patients less than 14 years old (142/624, 23%. Mycobacterium tuberculosis was confirmed in 34/617 (6% adult patients and 11/624 (2% paediatric patients. The acute case fatality rate (CFR during hospital admission was 73/617 (12% in adults and to 42/624 (7% in children.Zoonotic bacterial and viral pathogens are the most common causes of CNS infection in adults and children in Viet Nam.

Brief behavioural surveys in routine HIV sentinel surveillance: a new tool for monitoring the HIV epidemic in Viet Nam.

Science.gov (United States)

Thanh, Duong Cong; Hien, Nguyen Tran; Tuan, Nguyen Anh; Ha, Hoang Thi Thanh; Thang, Pham Hong; Ha, Nguyen Thi Thanh; Tuan, Le Anh; Quang, Tran Dai; Tram, Tran Hong; Le Hai, Nguyen; Huong, Phan Thi Thu; Son, Vo Hai; Duc, Bui Hoang; Nga, Nguyen Thien; Jacka, David; Sabin, Keith

2015-01-01

In this report we describe a new approach in HIV sentinel surveillance that was piloted in Viet Nam in 2009 and is currently being rolled out in all provinces. It comprises a brief behavioural questionnaire added to the HIV sentinel surveillance surveys conducted routinely among people who inject drugs, female sex workers and men who have sex with men. Timely reporting of data from this system has resulted in improvements to HIV prevention efforts for most at-risk populations.

Adequacy of anti-tuberculosis drug prescriptions in Viet Nam.

Science.gov (United States)

Hoa, N B; Lauritsen, J M; Rieder, H L

2012-03-21

National Tuberculosis Program, Viet Nam, 2008. To determine drug prescription adherence to national guidelines, to examine factors associated with an erroneous dosage of rifampin (RMP) and to evaluate the impact of an insufficient RMP dosage on treatment outcome. A representative sample of 30 treatment units was randomly selected. All patient treatment cards enrolled in these units were obtained, and data were double-entered and validated before calculating the adequacy of the individual drug prescriptions. Of 3412 tuberculosis treatment cards, 3225 (94.5%) had information on treatment regimen and the patient's weight. Treatment was successful in 89.4%. Prescriptions of tablets/vials conforming to recommendations were found for respectively 91.2%, 89.9%, 92.3% and 94.6% of the patients for RMP/isoniazid, pyrazinamide, ethambutol and streptomycin. Patients in the 25-39 kg weight bracket received insufficient dosages. This was almost entirely attributable to patients at the end of the weight bracket. Nevertheless, no significant association was found between treatment failure and death, body weight and insufficient RMP dosage. Adherence to national recommendations was high. RMP was given in insufficient dosage for patients at the end of a weight range bracket, but the under-dosage was small and did not measurably affect treatment outcome.

Enterovirus serotypes in patients with central nervous system and respiratory infections in Viet Nam 1997-2010.

Science.gov (United States)

B'Krong, Nguyen Thi Thuy Chinh; Minh, Ngo Ngoc Quang; Qui, Phan Tu; Chau, Tran Thi Hong; Nghia, Ho Dang Trung; Do, Lien Anh Ha; Nhung, Nguyen Ngoc; Van Vinh Chau, Nguyen; Thwaites, Guy; Van Tan, Le; van Doorn, H Rogier; Thanh, Tran Tan

2018-04-12

Enteroviruses are the most common causative agents of human illness. Enteroviruses have been associated with regional and global epidemics, recently, including with severe disease (Enterovirus A71 and D68), and are of interest as emerging viruses. Here, we typed Enterovirus A-D (EV) from central nervous system (CNS) and respiratory infections in Viet Nam. Data and specimens from prospective observational clinical studies conducted between 1997 and 2010 were used. Species and serotypes were determined using type-specific RT-PCR and viral protein 1 or 4 (VP1, VP4) sequencing. Samples from patients with CNS infection (51 children - 10 CSF and 41 respiratory/rectal swabs) and 28 adults (28 CSF) and respiratory infection (124 children - 124 respiratory swabs) were analysed. Twenty-six different serotypes of the four Enterovirus species (A-D) were identified, including EV-A71 and EV-D68. Enterovirus B was associated with viral meningitis in children and adults. Hand, foot and mouth disease associated Enteroviruses A (EV-A71 and Coxsackievirus [CV] A10) were detected in children with encephalitis. Diverse serotypes of all four Enterovirus species were found in respiratory samples, including 2 polio-vaccine viruses, but also 8 CV-A24 and 8 EV-D68. With the exception of EV-D68, the relevance of these viruses in respiratory infection remains unknown. We describe the diverse spectrum of enteroviruses from patients with CNS and respiratory infections in Viet Nam between 1997 and 2010. These data confirm the global circulation of Enterovirus genera and their associations and are important for clinical diagnostics, patient management, and outbreak response.

Brief behavioural surveys in routine HIV sentinel surveillance: a new tool for monitoring the HIV epidemic in Viet Nam

Directory of Open Access Journals (Sweden)

Duong Cong Thanh

2015-01-01

Full Text Available In this report we describe a new approach in HIV sentinel surveillance that was piloted in Viet Nam in 2009 and is currently being rolled out in all provinces. It comprises a brief behavioural questionnaire added to the HIV sentinel surveillance surveys conducted routinely among people who inject drugs, female sex workers and men who have sex with men. Timely reporting of data from this system has resulted in improvements to HIV prevention efforts for most at-risk populations.

Comparative study of nasoalveolar molding methods: nasal elevator plus DynaCleft® versus NAM-Grayson in patients with complete unilateral cleft lip and palate.

Science.gov (United States)

Monasterio, Luis; Ford, Alison; Gutiérrez, Carolina; Tastets, María Eugenia; García, Jacqueline

2013-09-01

Objective : To compare nasoalveolar molding (NAM) effect employing a nasal elevator plus DynaCleft® and NAM-Grayson system in patients with complete unilateral cleft lip and palate. Method : Prospective study in two groups. Group A included 20 consecutive patients treated with DynaCleft® and a nasal elevator before lip surgery. Group B included 20 patients treated with NAM-Grayson system. Maxillary casts and standard view photographs were done before and after treatment. Columella deviation angle, soft tissue distance of the cleft, intercommisural distance, and nostril height and width were traced and measured on the printed photos; a ratio was obtained and compared before and after treatment. Cleft width, anterior width, and anteroposterior distances were measured on the maxillary cast. Results : Group A began treatment at an average age of 14.3 days and group B at an average age of 16.9 days; no complications were observed. For group A, the initial average alveolar cleft within the cast was 10.7 mm, and after treatment it was 6.6 mm. For group B, pretreatment width was 11.2 mm, and after treatment it was 5.9 mm. No differences were found on the anterior and posterior width, and A-P distance of both groups. The initial mean columellar angle in group A was 38.1°, and after treatment it was 61.5°; for group B the initial mean columellar angle was 33.6°, and after treatment it was 59.5°. Results of Mann-Whitney U and Student's t tests showed no differences (P > .05). Width and height dimensions of the nostril showed minor differences. Conclusions : Both methods significantly reduced the cleft width and improved the nasal asymmetry. Our findings show that both methods produced similar results.

The Effect of Intermittent Antenatal Iron Supplementation on Maternal and Infant Outcomes in Rural Viet Nam: A Cluster Randomised Trial

Science.gov (United States)

Hanieh, Sarah; Ha, Tran T.; Simpson, Julie A.; Casey, Gerard J.; Khuong, Nguyen C.; Thoang, Dang D.; Thuy, Tran T.; Pasricha, Sant-Rayn; Tran, Thach D.; Tuan, Tran; Dwyer, Terence; Fisher, Jane; Biggs, Beverley-Ann

2013-01-01

Background Anemia affects over 500 million women, and in pregnancy is associated with impaired maternal and infant outcomes. Intermittent antenatal iron supplementation is an attractive alternative to daily dosing; however, the impact of this strategy on infant outcomes remains unclear. We compared the effect of intermittent antenatal iron supplementation with daily iron supplementation on maternal and infant outcomes in rural Viet Nam. Methods and Findings This cluster randomised trial was conducted in Ha Nam province, Viet Nam. 1,258 pregnant women (<16 wk gestation) in 104 communes were assigned to daily iron–folic acid (IFA), twice weekly IFA, or twice weekly multiple micronutrient (MMN) supplementation. Primary outcome was birth weight. Mean birth weight was 3,148 g (standard deviation 416). There was no difference in the birth weights of infants of women receiving twice weekly IFA compared to daily IFA (mean difference [MD] 28 g; 95% CI −22 to 78), or twice weekly MMN compared to daily IFA (MD −36.8 g; 95% CI −82 to 8.2). At 32 wk gestation, maternal ferritin was lower in women receiving twice weekly IFA compared to daily IFA (geometric mean ratio 0.73; 95% CI 0.67 to 0.80), and in women receiving twice weekly MMN compared to daily IFA (geometric mean ratio 0.62; 95% CI 0.57 to 0.68), but there was no difference in hemoglobin levels. Infants of mothers who received twice weekly IFA had higher cognitive scores at 6 mo of age compared to those who received daily IFA (MD 1.89; 95% CI 0.23 to 3.56). Conclusions Twice weekly antenatal IFA or MMN did not produce a clinically important difference in birth weight, when compared to daily IFA supplementation. The significant improvement in infant cognitive outcomes at 6 mo of age following twice weekly antenatal IFA requires further exploration, and provides additional support for the use of intermittent, rather than daily, antenatal IFA in populations with low rates of iron deficiency. Trial registration

Patterns and risk factors of inconsistent condom use among men who have sex with men in Viet Nam: Results from an Internet-based cross-sectional survey.

Science.gov (United States)

García, Macarena C; Duong, Quyen L; Mercer, Licelot C Eralte; Meyer, Samantha B; Koppenhaver, Todd; Ward, Paul R

2014-01-01

Survey data from men who have sex with men (MSM) in Asian cities indicate drastic increases in HIV prevalence. It is unknown which factors are most important in driving these epidemics. The objective of this study was to identify patterns of condom use among MSM Internet users living in Viet Nam, as well as risk factors associated with inconsistent condom use and non-condom use. A national Internet-based survey of sexual behaviours was administered in 2011. Results showed that 44.9% of MSM reported not using a condom during their last anal sex encounter with a male partner. MSM were less likely to report condom use during anal sex with long-term partners than with casual partners. Twenty-three and a half per cent of MSM surveyed had ever taken an HIV test and received the results. Study findings highlight the urgent need for targeted strategies focused on increasing the rate of consistent condom use during anal sex with male partners among MSM in Viet Nam.

Diversity and uses of Zingiberaceae in Nam Nao National Park, Chaiyaphum and Phetchabun provinces, Thailand, with a new record for Thailand

Directory of Open Access Journals (Sweden)

Surapon Saensouk

2016-11-01

Full Text Available Three tribes, 12 genera and 38 species of the ginger family (Zingiberaceae along five routes in Nam Nao National Park were surveyed between January 2012 and December 2013 to determine their diversity, ecological data, phenology, uses and conservation status. The highest diversity was found in the tribe Zingibereae (6 genera and 21 species, of which the genera Curcuma and Zingiber comprised the highest number species (eight species each. A species key was constructed based on morphology. The ginger family was found in four forest-types—deciduous dipterocarp forest, mixed deciduous forest, dry evergreen forest and pine forest. The most flowering bloom of the ginger family in Nam Nao National Park was during March to August and the most fruiting bloom was during June to September. The popular uses of Zingiberaceae were as a food, spice, in medicine, as ornamentation and in rituals. Eight species have been evaluated as of least concern and are presented in the IUCN Red List, while two rare species were reported in Thailand Red Data: Plants, while six rare Zingiberaceae species were identified based on the evaluation criteria of Saensouk (2011. Four species were endemic to Thailand. Moreover, Etlingera yunnanensis (T. L. Wu & S. J. Chen R. M. Smith was a new record for Thailand.

Structural modification of mordenite zeolite with Fe For the photo-degradation of EDTA

International Nuclear Information System (INIS)

Emara, Mostafa M.; Tourky, Amal S.M.; El-Moselhy, Medhat M.

2009-01-01

Fe 2+ was incorporated inside mordenite through ion exchange technique in aqueous solution. The amount of Fe loading was 25-100 wt %, using FeSO 4 .7H 2 O as precursor and Na-mordenite starting material Na-M. The Fe incorporated (Fe-M) thus prepared was characterized by XRD, FTIR and N 2 adsorption measurements. It was found that Fe mordenite retained the same structure as that for Na-mordenite which may indicate that Fe well dispersed into mordenite channels. BET indicated that Fe-M samples possessed higher surface area compared to the parent Na-M. Photocatalytic degradation of EDTA was carried out in presence of the prepared Fe-M catalysts. Effects of catalyst concentration and temperature were also studied. Thermodynamic parameters calculated for 50% Fe-M showed the highest catalytic activity toward EDTA degradation.

Structural modification of mordenite zeolite with Fe For the photo-degradation of EDTA

Energy Technology Data Exchange (ETDEWEB)

Emara, Mostafa M. [Chemistry Department, Faculty of Science (boys), Al-Azha University, Nasr city 11884, Cairo (Egypt); Tourky, Amal S.M. [Chemistry Department, Faculty of Science (Girls), Al-Azhar University, Nasr city, Cairo (Egypt); El-Moselhy, Medhat M., E-mail: medhatmohamed@yahoo.com [Chemistry Department, Faculty of Science (boys), Al-Azha University, Nasr city 11884, Cairo (Egypt)

2009-07-15

Fe{sup 2+} was incorporated inside mordenite through ion exchange technique in aqueous solution. The amount of Fe loading was 25-100 wt %, using FeSO{sub 4}.7H{sub 2}O as precursor and Na-mordenite starting material Na-M. The Fe incorporated (Fe-M) thus prepared was characterized by XRD, FTIR and N{sub 2} adsorption measurements. It was found that Fe mordenite retained the same structure as that for Na-mordenite which may indicate that Fe well dispersed into mordenite channels. BET indicated that Fe-M samples possessed higher surface area compared to the parent Na-M. Photocatalytic degradation of EDTA was carried out in presence of the prepared Fe-M catalysts. Effects of catalyst concentration and temperature were also studied. Thermodynamic parameters calculated for 50% Fe-M showed the highest catalytic activity toward EDTA degradation.

Using exceedance probabilities to detect anomalies in routinely recorded animal health data, with particular reference to foot-and-mouth disease in Viet Nam.

Science.gov (United States)

Richards, K K; Hazelton, M L; Stevenson, M A; Lockhart, C Y; Pinto, J; Nguyen, L

2014-10-01

The widespread availability of computer hardware and software for recording and storing disease event information means that, in theory, we have the necessary information to carry out detailed analyses of factors influencing the spatial distribution of disease in animal populations. However, the reliability of such analyses depends on data quality, with anomalous records having the potential to introduce significant bias and lead to inappropriate decision making. In this paper we promote the use of exceedance probabilities as a tool for detecting anomalies when applying hierarchical spatio-temporal models to animal health data. We illustrate this methodology through a case study data on outbreaks of foot-and-mouth disease (FMD) in Viet Nam for the period 2006-2008. A flexible binomial logistic regression was employed to model the number of FMD infected communes within each province of the country. Standard analyses of the residuals from this model failed to identify problems, but exceedance probabilities identified provinces in which the number of reported FMD outbreaks was unexpectedly low. This finding is interesting given that these provinces are on major cattle movement pathways through Viet Nam. Copyright © 2014 Elsevier Ltd. All rights reserved.

Senescence-associated barley NAC (NAM, ATAF1,2, CUC) transcription factor interacts with radical-induced cell death 1 through a disordered regulatory domain

DEFF Research Database (Denmark)

Kjaersgaard, Trine; Jensen, Michael K; Christiansen, Michael W

2011-01-01

as a transcriptional activator suggesting that an involvement of HvNAC013 and HvNAC005 in senescence will be different. HvNAC013 interacted with barley radical-induced cell death 1 (RCD1) via the very C-terminal part of its TRD, outside of the region containing the LP motif. No significant secondary structure...... (NAM, ATAF1,2, CUC) TF family are up-regulated during senescence in barley (Hordeum vulgare). Both HvNAC005 and HvNAC013 bound the conserved NAC DNA target sequence. Computational and biophysical analyses showed that both proteins are intrinsically disordered in their large C-terminal domains, which...... was induced in the HvNAC013 TRD upon interaction with RCD1. RCD1 also interacted with regions dominated by intrinsic disorder in TFs of the MYB and basic helix-loop-helix families. We propose that RCD1 is a regulatory protein capable of interacting with many different TFs by exploiting their intrinsic...

La Misión Salesiana "La Candelaria" y los cambios en la dieta de los selk'nam

Directory of Open Access Journals (Sweden)

Casali, Romina

2007-01-01

Full Text Available Esta comunicación tiene como objetivo dar a conocer los primeros resultados acerca del análisis de la dieta de los aborígenes Selk’nam que habitaron en la Misión Salesiana ‘La Candelaria’, Río Grande (Tierra del Fuego durante su funcionamiento (1893-1931. Nuestros anteriores estudios señalaron a la tuberculosis como causa de muerte excluyente dentro de la Misión. Por tanto, asumimos la relevancia de evaluar y generar información comparativa, acerca de aspectos de la vida cotidiana, en este caso los cambios dietarios, y su incidencia en la salud de los Selk’nam. Se trata de un abordaje interdisciplinario, en función de la conexión de distintos tipos de evidencia y de una visión totalizadora del proceso de desaparición étnica (intervención de múltiples factores con grado variable de sustento en el contacto interétnico, lo mismo que con un comportamiento sinérgico. Se revistan fuentes etnográficas, etnohistóricas y primarias (registros internos de la Misión. Se entrelazan los datos obtenidos, atendiendo a variables cuanti y cualitativas, lo mismo que a las referencias al ámbito de la Misión, como al exterior. Se formaliza una lectura historiográ- fica, antropológica y biológica. Se vislumbra un claro contraste en el tipo de dieta pre y pos contacto interétnico, lo mismo que una discordancia entre los ámbitos “naturales” y la Misión.

Prevalence of resistance to second-line tuberculosis drug among multidrug-resistant tuberculosis patients in Viet Nam, 2011.

Science.gov (United States)

Nguyen, Hoa Binh; Nguyen, Nhung Viet; Tran, Huong Thi Giang; Nguyen, Hai Viet; Bui, Quyen Thi Tu

2016-01-01

Extensively drug-resistant tuberculosis (XDR-TB) represents an emerging public health problem worldwide. According to the World Health Organization, an estimated 9.7% of multidrug-resistant TB (MDR-TB) cases are defined as XDR-TB globally. The objective of this study was to determine the prevalence of drug resistance to second-line TB drugs among MDR-TB cases detected in the Fourth National Anti-Tuberculosis Drug Resistance Survey in Viet Nam. Eighty clusters of TB cases were selected using a probability-proportion-to-size approach. To identify MDR-TB cases, drug susceptibility testing (DST) was performed for the four major first-line TB drugs. DST of second-line drugs (ofloxacin, amikacin, kanamycin, capreomycin) was performed on isolates from MDR-TB cases to identify pre-XDR and XDR cases. A total of 1629 smear-positive TB cases were eligible for culture and DST. Of those, DST results for first-line drugs were available for 1312 cases, and 91 (6.9%) had MDR-TB. Second-line DST results were available for 84 of these cases. Of those, 15 cases (17.9%) had ofloxacin resistance and 6.0% were resistant to kanamycin and capreomycin. Five MDR-TB cases (6.0%) met the criteria of XDR-TB. This survey provides the first estimates of the proportion of XDR-TB among MDR-TB cases in Viet Nam and provides important information for local policies regarding second-line DST. Local policies and programmes that are geared towards TB prevention, early diagnosis and treatment with effective regimens are of high importance.

Shared epitopes of glycoprotein A and protein 4.1 defined by antibody NaM10-3C10.

Science.gov (United States)

Rasamoelisolo, M; Czerwinski, M; Willem, C; Blanchard, D

1998-06-01

We have produced the murine monoclonal antibody (MAb) NaM70-3C10 (IgM) from splenocytes of mice immunized with human red blood cells (RBCs). The MAb agglutinated untreated as well as trypsin, chymotrypsin, neuraminidase, or ficin-treated RBCs from controls. In contrast, control RBCs treated with papaine or bromelaine were not agglutinated. On immunoblots, the MAb bound to glycophorin A (GPA) and to a 80 kDa protein identified as protein 4.1. Analysis by agglutination of variant RBCs carrying hybrid glycophorins made of the N-terminus (amino acids 1-58) of GPA and of the C-terminus (amino acids 27-72) of glycophorin B (GPB) and competition-inhibition test using purified GPA and a synthetic peptide corresponding to the amino acid sequence 48-58 of GPA demonstrated that the epitope is located within residues 48-58 of GPA. Epitope analysis with immobilized peptides showed that the MAb recognizes the sequence 53Pro-Pro-Glu-Glu-GIu58 of GPA. A homologous sequence is also present within amino acids 395 to 405 of protein 4.1. Finally, the MAb bound to 16 kDa chymotryptic peptide of protein 4.1, which carries the above amino acid sequence. In conclusion, it may be assumed that NaM70-3C10 specifically recognizes a common epitope on the extracellular domain of GPA and on the intracellular protein 4.1; this specificity explains the persistence of the 80 kDa band on blots when RBCs are treated with papain.

Developing management packages for acid sulphate soils based on farmer and expert knowledge : field study in the Mekong Delta, Viet Nam

OpenAIRE

Quang Tri, Le

1996-01-01

Effective interaction of farmers' expertise and expert knowledge has been a special point of attention for this study. The objectives of the study were to describe the process of interaction between farmers and experts in improving the use of acid sulphate soils and to point out difficulties encountered. Actual conditions for four major areas were described including variabilities. Four representative areas: Tan Thanh, Tri Ton, Phung Hiep, and Hong Dan in the Mekong Delta, Viet Nam...

Risk factors for the presence of Aedes aegypti and Aedes albopictus in domestic water-holding containers in areas impacted by the Nam Theun 2 hydroelectric project, Laos

NARCIS (Netherlands)

Hiscox, A.F.; Kaye, A.; Vongphayloth, K.; Banks, I.; Piffer, M.; Khammanithong, P.; Sananikhom, P.; Kaul, S.; Hill, N.; Lindsay, S.W.; Brey, P.T.

2013-01-01

We assessed risk factors for vectors of dengue and chikungunya viruses near a new hydroelectric project, Nam Theun 2, in Laos. Immature stages of Aedes aegypti were found only in sites within 40 km of the urban provincial capital, but Aedes albopictus was found throughout. Aedes aegypti pupae were

A Flood Risk Assessment of Quang Nam, Vietnam Using Spatial Multicriteria Decision Analysis

Directory of Open Access Journals (Sweden)

Chinh Luu

2018-04-01

Full Text Available Vietnam is highly vulnerable to flood and storm impacts. Holistic flood risk assessment maps that adequately consider flood risk factors of hazard, exposure, and vulnerability are not available. These are vital for flood risk preparedness and disaster mitigation measures at the local scale. Unfortunately, there is a lack of knowledge about spatial multicriteria decision analysis and flood risk analysis more broadly in Vietnam. In response to this need, we identify and quantify flood risk components in Quang Nam province through spatial multicriteria decision analysis. The study presents a new approach to local flood risk assessment mapping, which combines historical flood marks with exposure and vulnerability data. The flood risk map output could assist and empower decision-makers in undertaking flood risk management activities in the province. Our study demonstrates a methodology to build flood risk assessment maps using flood mark, exposure and vulnerability data, which could be applied in other provinces in Vietnam.

Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons

International Nuclear Information System (INIS)

2012-01-01

The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met [fr

Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons

International Nuclear Information System (INIS)

2012-01-01

The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met [es

Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons

International Nuclear Information System (INIS)

2012-01-01

The text of the Protocol Additional to the Agreement between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Board of Governors approved the Additional Protocol on 6 March 2007. It was signed on 10 August 2007 in Vienna, Austria. Pursuant to Article 17 of the Additional Protocol, the Protocol entered into force on 17 September 2012, the date on which the Agency received from the Socialist Republic of Viet Nam written notification that Vietnam's statutory and constitutional requirements for entry into force had been met

A model immunization programme to control Japanese encephalitis in Viet Nam.

Science.gov (United States)

Yen, Nguyen Thu; Liu, Wei; Hanh, Hoang Duc; Chang, Na Yoon; Duong, Tran Nhu; Gibbons, Robert V; Marks, Florian; Thu, Nghiem Anh; Hong, Nguyen Minh; Park, Jin Kyung; Tuan, Pham Anh; Nisalak, Ananda; Clemens, John D; Xu, Zhi-Yi

2015-03-01

In Viet Nam, an inactivated, mouse brain-derived vaccine for Japanese encephalitis (JE) has been given exclusively to ≤ 5 years old children in 3 paediatric doses since 1997. However, JE incidence remained high, especially among children aged 5-9 years. We conducted a model JE immunization programme to assess the feasibility and impact of JE vaccine administered to 1-9 year(s) children in 3 standard-dose regimen: paediatric doses for children aged <3 years and adult doses for those aged ≥ 3 years. Of the targeted children, 96.2% were immunized with ≥ 2 doses of the vaccine. Compared to the national immunization programme, JE incidence rate declined sharply in districts with the model programme (11.32 to 0.87 per 100,000 in pre-versus post-vaccination period). The rate of reduction was most significant in the 5-9 years age-group. We recommend a policy change to include 5-9 years old children in the catch-up immunization campaign and administer a 4th dose to those aged 5-9 years, who had received 3 doses of the vaccine during the first 2-3 years of life.

The context of HIV risk behaviours among HIV-positive injection drug users in Viet Nam: Moving toward effective harm reduction

Directory of Open Access Journals (Sweden)

Thanh Duong

2009-04-01

Full Text Available Abstract Background Injection drug users represent the largest proportion of all HIV reported cases in Viet Nam. This study aimed to explore the perceptions of risk and risk behaviours among HIV-positive injection drug users, and their experiences related to safe injection and safe sex practices. Methods This study used multiple qualitative methods in data collection including in-depth interviews, focus group discussions and participant observation with HIV-positive injection drug users. Results The informants described a change in the sharing practices among injection drug users towards more precautions and what was considered 'low risk sharing', like sharing among seroconcordant partners and borrowing rather than lending. However risky practices like re-use of injection equipment and 'syringe pulling' i.e. the use of left-over drugs in particular, were frequently described and observed. Needle and syringe distribution programmes were in place but carrying needles and syringes and particularly drugs could result in being arrested and fined. Fear of rejection and of loss of intimacy made disclosure difficult and was perceived as a major obstacle for condom use among recently diagnosed HIV infected individuals. Conclusion HIV-positive injection drug users continue to practice HIV risk behaviours. The anti-drug law and the police crack-down policy appeared as critical factors hampering ongoing prevention efforts with needle and syringe distribution programmes in Viet Nam. Drastic policy measures are needed to reduce the very high HIV prevalence among injection drug users.

La sexualidad en adolescentes de la secundaria básica "Viet Nam" Sexuality of adolescent students in "Viet Nam" junior high school

Directory of Open Access Journals (Sweden)

Elisa Puentes Rizo

2012-12-01

Full Text Available Introducción: en la actualidad existe en los adolescentes una temprana iniciación de las relaciones sexuales y cambios en la actitud social hacia la sexualidad. Objetivo: identificar las particularidades y conocimientos sobre sexualidad en adolescentes. Métodos: se realizó una investigación descriptiva y transversal en adolescentes entre los 12 y 15 años, de la secundaria básica "Viet Nam" del municipio Arroyo Naranjo, durante los años 2009-2010. El universo estuvo constituido por 296 estudiantes y la muestra por 150, seleccionados mediante sorteo hasta completar 50 estudiantes de cada año. La información se obtuvo de una encuesta validada por el Ministerio de Educación. Todos los seleccionados expresaron su consentimiento para participar en la investigación. Resultados: predominó el sexo masculino y los adolescentes de 15 años. El inicio de las relaciones sexuales fue a los 14 años en los muchachos y a los 15 en las muchachas; 72 (56,69 % adolescentes utilizaron el condón en su "primera vez". Las principales vías de obtención de información fueron los padres, profesores y la información televisiva. Hubo mayor conocimiento sobre VIH-sida, gonorrea y sífilis y menor sobre, herpes simple y clamidia. El condón resultó ser el método anticonceptivo más conocido. Conclusiones: hay un inicio precoz en las relaciones sexuales y poco conocimiento acerca de los métodos anticonceptivos biológicos o naturales, lo que pudiera estar indicando la importancia que tiene la familia, sobre todo los padres, los profesores y médicos de familia, en incrementar y mantener la labor educativa con los jóvenes en relación con la sexualidad.Introduction: there exists an early onset of sexual relations in adolescents at present, together with changes in the social attitude towards sexuality. Objective: to identify the particularities of and the knowledge on sexuality in adolescents. Methods: a cross-sectional and descriptive research study was

Liver disease in Viet Nam: screening, surveillance, management and education: a 5-year plan and call to action.

Science.gov (United States)

Gish, Robert G; Bui, Tam D; Nguyen, Chuc T K; Nguyen, Duc T; Tran, Huy V; Tran, Diem M T; Trinh, Huy N

2012-02-01

Despite a high prevalence of liver disease in Viet Nam, there has been no nationwide approach to the disease and no systematic screening of at-risk individuals. Risk factors include chronic hepatitis B (estimated prevalence of 12%), chronic hepatitis C (at least 2% prevalence), and heavy consumption of alcohol among men. This combination of factors has resulted in liver cancer being the most common cause of cancer death in Viet Nam. There is a general lack of understanding by both the general public and health-care providers about the major risk to health that liver disease represents. We report here the initial steps taken as part of a comprehensive approach to liver disease that will ultimately include nationwide education for health-care providers, health educators, and the public; expansion of nationwide screening for hepatitis B and C followed by hepatitis B virus vaccination or treatment of chronic hepatitis B and/or hepatitis C; education about alcoholic liver disease; long-term surveillance for liver cancer; reduction of infection transmission related to medical, commercial, and personal re-use of contaminated needles, syringes, sharp instruments, razors, and inadequately sterilized medical equipment; and ongoing collection and analysis of data about the prevalence of all forms of liver disease and the results of the expanded screening, vaccination, and treatment programs. We report the beginning results of our pilot hepatitis B screening program. We believe that this comprehensive nationwide approach could substantially reduce the morbidity and mortality from liver disease and greatly lessen the burden in terms of both lives lost and health-care costs. © 2011 Journal of Gastroenterology and Hepatology Foundation and Blackwell Publishing Asia Pty Ltd.

Two new species of the genus Pararrhynchium de Saussure (Hymenoptera: Vespidae: Eumeninae) from northern Vietnam.

Science.gov (United States)

Nguyen, Lien Thi Phuong

2015-06-22

Two new species of the genus Pararrhynchium are described and figured: P. striatum sp. nov. (northern Vietnam: Hoa Binh, Ha Tinh and Thai Nguyen) and P. concavum sp. nov. (northern Vietnam: Cao Bang). A key to all known species of the genus is provided.

Based on the Materials of IV Scientific Session of the Institute of Gastroenterology of the NAMS of Ukraine «New Technologies in Theoretical and Clinical Gastroenterology»

Directory of Open Access Journals (Sweden)

I.Yu. Skyrda

2016-09-01

Scientific supervisor of the conference — Yuri M. Stepanov, doctor of Sciences, Professor, honored doctor of Ukraine, Director of SI "Institute gastroenterology of NAMS of Ukraine", head of the Department of gastroenterology and therapy SI "Dnepropetrovsk medical Academy", the Chairman of the Union "Association for the study and treatment of diseases of the digestive system in Ukraine".

Atmospheric nitrogen deposition budget in a subtropical hydroelectric reservoir (Nam Theun II case study, Lao PDR)

Science.gov (United States)

Adon, Marcellin; Galy-Lacaux, Corinne; Serça, Dominique; Guerin, Frederic; Guedant, Pierre; Vonghamsao, Axay; Rode, Wanidaporn

2016-04-01

With 490 km² at full level of operation, Nam Theun 2 (NT2) is one of the largest hydro-reservoir in South East Asia. NT2 is a trans-basin hydropower project that diverts water from the Nam Theun river (a Mekong tributary) to the Xe Ban Fai river (another Mekong tributary). Atmospheric deposition is an important source of nitrogen (N), and it has been shown that excessive fluxes of N from the atmosphere has resulted in eutrophication of many coastal waters. A large fraction of atmospheric N input is in the form of inorganic N. This study presents an estimation of the atmospheric inorganic nitrogen budget into the NT2 hydroelectric reservoir based on a two-year monitoring (July 2010 to July 2012) including gas concentrations and precipitation. Dry deposition fluxes are calculated from monthly mean surface measurements of NH3, HNO3 and NO2 concentrations (passive samplers) together with simulated deposition velocities, and wet deposition fluxes from NH4+ and NO3- concentrations in single event rain samples (automated rain sampler). Annual rainfall amount was 2500 and 3160 mm for the two years. The average nitrogen deposition flux is estimated at 1.13 kgN.ha-1.yr-1 from dry processes and 5.52 kgN.ha-1.yr-1 from wet ones, i.e., an average annual total nitrogen flux of 6.6 kgN.ha-1.yr-1 deposited into the NT2 reservoir. The wet deposition contributes to 83% of the total N deposition. The nitrogen deposition budget has been also calculated over the rain tropical forest surrounding the reservoir. Due to higher dry deposition velocities above forested ecosystems, gaseous dry deposition flux is estimated at 4.0 kgN.ha-1.yr-1 leading to a total nitrogen deposition about 9.5 kgN.ha-1.yr-1. This result will be compared to nitrogen deposition in the African equatorial forested ecosystems in the framework of the IDAF program (IGAC-DEBITS-AFrica).

Abundance and prevalence of Aedes aegypti immatures and relationships with household water storage in rural areas in southern Viet Nam.

Science.gov (United States)

Nguyen, Le Anh P; Clements, Archie C A; Jeffery, Jason A L; Yen, Nguyen Thi; Nam, Vu Sinh; Vaughan, Gregory; Shinkfield, Ramon; Kutcher, Simon C; Gatton, Michelle L; Kay, Brian H; Ryan, Peter A

2011-06-01

Since 2000, the Government of Viet Nam has committed to provide rural communities with increased access to safe water through a variety of household water supply schemes (wells, ferrocement tanks and jars) and piped water schemes. One possible, unintended consequence of these schemes is the concomitant increase in water containers that may serve as habitats for dengue mosquito immatures, principally Aedes aegypti. To assess these possible impacts we undertook detailed household surveys of Ae. aegypti immatures, water storage containers and various socioeconomic factors in three rural communes in southern Viet Nam. Positive relationships between the numbers of household water storage containers and the prevalence and abundance of Ae. aegypti immatures were found. Overall, water storage containers accounted for 92-97% and 93-96% of the standing crops of III/IV instars and pupae, respectively. Interestingly, households with higher socioeconomic levels had significantly higher numbers of water storage containers and therefore greater risk of Ae. aegypti infestation. Even after provision of piped water to houses, householders continued to store water in containers and there was no observed decrease in water storage container abundance in these houses, compared to those that relied entirely on stored water. These findings highlight the householders' concerns about the limited availability of water and their strong behavoural patterns associated with storage of water. We conclude that household water storage container availability is a major risk factor for infestation with Ae. aegypti immatures, and that recent investment in rural water supply infrastructure are unlikely to mitigate this risk, at least in the short term.

Where "Sign Language Studies" Has Led Us in Forty Years: Opening High School and University Education for Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation

Science.gov (United States)

Woodward, James; Hoa, Nguyen Thi

2012-01-01

This paper discusses how the Nippon Foundation-funded project "Opening University Education to Deaf People in Viet Nam through Sign Language Analysis, Teaching, and Interpretation," also known as the Dong Nai Deaf Education Project, has been implemented through sign language studies from 2000 through 2012. This project has provided deaf…

The Text of the Agreement between Viet-Nam and the Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons

Energy Technology Data Exchange (ETDEWEB)

NONE

1975-01-24

The text of the Agreement between the Republic of Viet-Nam and the Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement entered into force on 9 January 1974, pursuant to Article 25.

The Text of the Agreement between Viet-Nam and the Agency for the Application of Safeguards in Connection with the Treaty on the Non-Proliferation of Nuclear Weapons

International Nuclear Information System (INIS)

1975-01-01

The text of the Agreement between the Republic of Viet-Nam and the Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons is reproduced in this document for the information of all Members. The Agreement entered into force on 9 January 1974, pursuant to Article 25.

Study design and the estimation of the size of key populations at risk of HIV: lessons from Viet Nam.

Science.gov (United States)

Safarnejad, Ali; Groot, Wim; Pavlova, Milena

2018-01-30

Estimation of the size of populations at risk of HIV is a key activity in the surveillance of the HIV epidemic. The existing framework for considering future research needs may provide decision-makers with a basis for a fair process of deciding on the methods of the estimation of the size of key populations at risk of HIV. This study explores the extent to which stakeholders involved with population size estimation agree with this framework, and thus, the study updates the framework. We conducted 16 in-depth interviews with key informants from city and provincial governments, NGOs, research institutes, and the community of people at risk of HIV. Transcripts were analyzed and reviewed for significant statements pertaining to criteria. Variations and agreement around criteria were analyzed, and emerging criteria were validated against the existing framework. Eleven themes emerged which are relevant to the estimation of the size of populations at risk of HIV in Viet Nam. Findings on missing criteria, inclusive participation, community perspectives and conflicting weight and direction of criteria provide insights for an improved framework for the prioritization of population size estimation methods. The findings suggest that the exclusion of community members from decision-making on population size estimation methods in Viet Nam may affect the validity, use, and efficiency of the evidence generated. However, a wider group of decision-makers, including community members among others, may introduce diverse definitions, weight and direction of criteria. Although findings here may not apply to every country with a transitioning economy or to every emerging epidemic, the principles of fair decision-making, value of community participation in decision-making and the expected challenges faced, merit consideration in every situation.

Episiotomy rate in Vietnamese-born women in Australia: support for a change in obstetric practice in Viet Nam.

Science.gov (United States)

Trinh, Anh T; Khambalia, Amina; Ampt, Amanda; Morris, Jonathan M; Roberts, Christine L

2013-05-01

To describe the use of episiotomy among Vietnamese-born women in Australia, including risk factors for, and pregnancy outcomes associated with, episiotomy. This population-based, retrospective cohort study included data on 598 305 singleton, term (i.e. ≥ 37 weeks' gestation) and vertex-presenting vaginal births between 2001 and 2010. Data were obtained from linked, validated, population-level birth and hospitalization data sets. Contingency tables and multivariate analysis were used to compare risk factors and pregnancy outcomes in women who did or did not have an episiotomy. The episiotomy rate in 12 208 Vietnamese-born women was 29.9%, compared with 15.1% in Australian-born women. Among Vietnamese-born women, those who had an episiotomy were significantly more likely than those who did not to be primiparous, give birth in a private hospital, have induced labour or undergo instrumental delivery. In these women, having an episiotomy was associated with postpartum haemorrhage (adjusted odds ratio, aOR: 1.26; 95% confidence interval, CI: 1.08-1.46) and postnatal hospitalization for more than 4 days (aOR: 1.14; 95% CI: 1.00-1.29). Among multiparous women only, episiotomy was positively associated with a third- or fourth-degree perineal tear (aOR: 2.00; 95% CI: 1.31-3.06); in contrast, among primiparous women the association was negative (aOR: 0.47; 95% CI: 0.37-0.60). Episiotomy was performed in far fewer Vietnamese-born women giving birth in Australia than in Viet Nam, where more than 85% undergo the procedure, and was not associated with adverse outcomes. A lower episiotomy rate should be achievable in Viet Nam.

EIA models and capacity building in Viet Nam: an analysis of development aid programs

International Nuclear Information System (INIS)

Doberstein, Brent

2004-01-01

There has been a decided lack of empirical research examining development aid agencies as 'agents of change' in environmental impact assessment (EIA) systems in developing countries, particularly research examining the model of environmental planning practice promoted by aid agencies as part of capacity building. This paper briefly traces a conceptual framework of EIA, then introduces the concept of 'EIA capacity building'. Using Viet Nam as a case study, the paper then outlines the empirical results of the research, focusing on the extent to which aid agency capacity-building programs promoted a Technical vs. Planning Model of EIA and on the coherence of capacity-building efforts across all aid programs. A discussion follows, where research results are interpreted within the Vietnamese context, and implications of research results are identified for three main groups of actors. The paper concludes by calling for development aid agencies to reconceptualise EIA capacity building as an opportunity to transform developing countries' development planning processes

Feasibility study of VLH hydro turbine installation at Nam Pung hydropower plant, Thailand

Directory of Open Access Journals (Sweden)

Weerapon Nuantong

2016-10-01

Full Text Available The aim of this research was to study the feasibility of installing a Very Low Head (VLH hydro turbine at downstream of the Nam Pung hydropower plant by increasing the potential of renewable energy sources for the Electricity Generating Authority of Thailand (EGAT. Due to the constraints of the local site, the water head level was limited to less than 2 meters and the flow rate to below 5 m3/ s. The hydro turbine selected was an axial flow turbine with performance of 86.4%. The outcome of the power output was 84.61 kW. Investment analysis was subsequently applied to estimate feasibility of the project using engineering economics. The analyses of results have shown that the project is worthwhile in terms of an investment decision. The payback period of actual price was 0.83 and 0.88 years and general price case of 3.68 and 4.04 years, along with an interest rate of 6.75% and 12.625% respectively. Projected project lifespan is 25 years.

Los misioneros salesianos y la polémica sobre la extinción de los Selk’nam de Tierra del Fuego

Directory of Open Access Journals (Sweden)

María Andrea Nicoletti

2006-12-01

Full Text Available El proceso de extinción de los selk’nam generó una polémica dentro de la congregación de los salesianos alrededor de las causas que suscitaron su desaparición. Por medio de la reducción «Nuestra Señora de la Candelaria» llevada a cabo por monseñor Fagnano en 1893, se puso en marcha un plan de evangelización y «civilización» de los selk’nam. Estos aborígenes buscaban refugio en la reducción ante la persecución y asesinato perpetrados por los estancieros fueguinos. Las acechanzas, el contagio de enfermedades a las que los aborígenes no eran inmunes y el impacto cultural que provocó el sistema de reducciones, contribuyeron a su extinción. Los misioneros salesianos, protagonistas del proceso reduccional, analizaron las causas de la extinción poniendo el acento fundamentalmente en las matanzas de los estancieros y la violencia aplicada por las autoridades estatales, aun admitiendo las ocasionadas por el cambio cultural. La siguiente generación de salesianos, desde el estudio de las fuentes y la construcción de su propia historia, desplazó la causa violenta hacia motivos fisiológicos y culturales, con el fin de no poner en tela de juicio el rol que las familias de estancieros Braun Menéndez y Menéndez Behety, colaboradoras con la obra salesiana, tuvieron en este nefasto proceso.

Study of the natural radiation background affected on the human body in some areas of Viet Nam

International Nuclear Information System (INIS)

Ngo Van Thanh

2008-01-01

The author had studied the natural radiation background in 68 districts belong 40 provinces and cities of Vietnam from 2002 to 2005. The estimated results clearly show that the average external irradiation dose levels and the average annual external radiation equivalent dose affected on the human body are 0.181± 0.0189 μSv/h and 1599 ± 171.8 μSv/year respectively, both are in normal limit; the highest levels are in Lai Chau district (Lai Chau province); the lowest levels are in Buon Ma Thuot city (DakLak province), Phuoc Son district (Quang Nam province), Tan An district (Long An province). The radon concentration in the human being and the average annual internal inhalation irradiation equivalent dose affected on the human beings are 26.9 ± 15.89 Bq/m 3 and 392.88 ± 231.99 μSv/year respectively; the maximums are in Nha Trang city (Khanh Hoa province), Bac Binh district (Binh Phuoc province); the minimums are in Vung Tau city (Ba Ria- Vung Tau province), Tan An district (Long An province), Rach Gia district (Kien Giang province). The terrestrial radionuclide concentrations in the cereals, foodstuffs (rice, meat, vegetables), water, earth and the average annual internal irradiation equivalent dose are 829.2 ± 38.06 Bq/kg and 229.3 ± 67.70 μSv/year respectively; the highest levels are in Phong Tho district (Lai Chau province), Dien Bien city; the lowest levels are in Dong Xoai district (Binh Phuoc province), Tan An district (Long An province). The average total annual natural radiation background effective equivalent dose level affected on the human body is 2206.9 ± 529.30 μSv/year; the highest levels are in Lai Chau district (Lai Chau province); the lowest levels are in Tan An district (Long An province). The 14 maps of Natural Radiation Background in several localized regions belong 40 provinces and cities of Viet Nam had been set up. These results can reserve for serviceman and public health in the both wartime and peacetime. (author)

The text of the Agreement of 12 June 1981 between Viet Nam and the Agency relating to the application of safeguards in connection with the supply of nuclear fuel for the Da Lat research reactor

International Nuclear Information System (INIS)

1982-02-01

The full text of the agreement between Viet Nam and the International Atomic Energy Agency relating to the application of safeguards in connection with the supply of nuclear fuel for the DA LAT Research Reactor is presented

The disruptive effect of lysozyme on the bacterial cell wall explored by an in-silico structural outlook.

Science.gov (United States)

Primo, Emiliano D; Otero, Lisandro H; Ruiz, Francisco; Klinke, Sebastián; Giordano, Walter

2018-01-01

The bacterial cell wall, a structural unit of peptidoglycan polymer comprised of glycan strands consisting of a repeating disaccharide motif [N-acetylglucosamine (NAG) and N-acetylmuramylpentapeptide (NAM pentapeptide)], encases bacteria and provides structural integrity and protection. Lysozymes are enzymes that break down the bacterial cell wall and disrupt the bacterial life cycle by cleaving the linkage between the NAG and NAM carbohydrates. Lab exercises focused on the effects of lysozyme on the bacterial cell wall are frequently incorporated in biochemistry classes designed for undergraduate students in diverse fields as biology, microbiology, chemistry, agronomy, medicine, and veterinary medicine. Such exercises typically do not include structural data. We describe here a sequence of computer tasks designed to illustrate and reinforce both physiological and structural concepts involved in lysozyme effects on the bacterial cell-wall structure. This lab class usually lasts 3.5 hours. First, the instructor presents introductory concepts of the bacterial cell wall and the effect of lysozyme on its structure. Then, students are taught to use computer modeling to visualize the three-dimensional structure of a lysozyme in complex with bacterial cell-wall fragments. Finally, the lysozyme inhibitory effect on a bacterial culture is optionally proposed as a simple microbiological assay. The computer lab exercises described here give students a realistic understanding of the disruptive effect of lysozymes on the bacterial cell wall, a crucial component in bacterial survival. © 2017 by The International Union of Biochemistry and Molecular Biology, 46(1):83-90, 2018. © 2017 The International Union of Biochemistry and Molecular Biology.

Supervisors and accomplices: extra-marital sex among migrant construction workers in Ha Noi, Viet Nam.

Science.gov (United States)

Thuy, Bui Thi Thanh; Kretchmar, Joshua

2008-06-01

This study examines the influence of social networks on the sexual relations of migrant construction workers in Ha Noi, Viet Nam. Research included observation and interviews with members of two different groups of workers. The first group, together with their employer (cai), came from the same village; the second group came from different villages. Of interest in the present study was how social relationships among workers and their employers influence extra-marital sexual activity. In the group where workers and their cai came from the same village of origin, fear of acquiring a bad reputation made these workers reluctant to seek sex services, since accounts of their behaviour were transmitted quickly home. In contrast, workers from the group who came from different villages often went out together to purchase sex. The absence of direct links to their villages of origin made it easier for these latter workers to conceal their activity. The implication of these findings for sexual safety and risk are discussed.

Unpredictable Agency: An Analysis of Youth and Educational Practices in Times of Political and Economic Precarity in Contemporary Đà Nẵng City, Việt Nam

OpenAIRE

Duong, Phuoc M

2017-01-01

This dissertation investigates how educational agency performed by young adults in Việt Nam is utilized to build and sustain the socialist nation-building project. Drawing on a framework of governmentality, I analyze the rationale of governance and agency through Việt Nam’s experiment with differing political economies to contribute to anthropological debates on how the shift from collective action for the greater common good to liberal individualism by young adults, sustain or compromise the...

Phenylacetic acid co-crystals with acridine, caffeine, isonicotinamide and nicotinamide: Crystal structures, thermal analysis, FTIR spectroscopy and Hirshfeld surface analysis

Science.gov (United States)

Amombo Noa, Francoise M.; Jacobs, Ayesha

2017-07-01

Co-crystals of phenylacetic acid (PAA) with acridine (ACR), caffeine (CAF), isonicotinamide (INM) and nicotinamide (NAM) have been successfully prepared and characterised by single crystal X-ray diffraction, FTIR spectroscopy, thermal analysis and Hirshfeld surface analysis. The ACR, INM and NAM co-crystals with PAA exhibit the carboxylic acid-pyridine heterosynthon. Furthermore the amide-amide supramolecular homosynthon is observed in the PAA co-crystals with INM and NAM as well as Nsbnd H⋯O interactions between the acid and the respective base. The CAF co-crystal exhibits hydrogen bonding between the imidazole nitrogen and the COOH group of the PAA. The compounds demonstrate different stoichiometries; for PAA·ACR and PAA·INM a 1:1 ratio is displayed, a 2:1 in 2PAA·CAF and a 2:2 in the case of 2PAA·2NAM.

Ground subsidence as a result of natural gas exploitation. NAM-fields in Groningen, Friesland and North-Drente. State-of-the-art report 2010 and prognosis up to the year 2070

International Nuclear Information System (INIS)

2010-09-01

Based on present knowledge of and insights a prognosis is given of ground subsidence as a result of natural gas exploration in the title provinces in the Netherlands. The prognosis will be repeated every five years according to an agreement between the province Groningen and the NAM (Dutch Petroleum Company). This is the third prognosis. [nl

Cigarette Smoking among Adolescents aged 13-15 in Viet Nam and Correlates of Current Cigarette Smoking: Results from GYTS 2014 Data.

Science.gov (United States)

Huong, Le Thi; Vu, Nga Thi Thu; Dung, Nguyen Ngoc; Xuan, Le Thi Thanh; Giang, Kim Bao; Hai, Phan Thi; Huyen, Doan Thu; Khue, Luong Ngoc; Lam, Nguyen Tuan; Minh, Hoang Van; Nga, Pham Thi Quynh

2016-01-01

The aim of this paper is to report the rate of current and ever cigarette smoking and explore correlates of current cigarette smoking among adolescents aged 13-15 in Viet Nam. This analysis was derived from GYTS survey, which comprised of 3,430 adolescents aged 13-15, conducted in 2014 in 13 cities and provinces of Viet Nam. We calculated the weighted rates of current and ever cigarette smoking and reported patterns of smoking behavior. We also performed logistic regression to explore correlates of current cigarette smoking behavior. The weighted rate of ever cigarette smoking was 9.5% (95% confidence interval (CI): 8.5 %-10.5%), in which the weighted rate among males (15.4%; 95% CI: 13.6%-17.0%) was higher than that among females (4.2%; 95% CI: 3.3%-5.1%). The weighted rate of current cigarette smoking was relatively low at 2.5% (95%CI: 2.0%- 3.0%) with higher weighted rate among males (4.9%; 95% CI: 3.8%-5.9%) compared to the corresponding figure among females (0.2%; 95% CI: 0.0 %-0.5%). Current cigarette smoking was significantly higher among males than females, in students aged 15 versus 13 years old, and in students who had several or all close friends smoking and students with daily observation of smoking at school. For greater smoking reduction outcomes, we recommend that tobacco interventions for adolescents should consider targeting more male students at older ages, establish stricter adherence to school-based banning of cigarette smoking, engage both smoking and nonsmoking adolescents and empower adolescents to resist peer smoking influence as well as changing their norms or beliefs towards smoking benefits.

Genotypic differences in phosphorus use efficiency and yield of wetland rice of southern Viet Nam

International Nuclear Information System (INIS)

Bui Thi Hong Thanh; Le Dac Lieu; Luong Thu Tra; Mai Thanh Son; Nguyen Dang Nghia; Do Trung Binh

1996-01-01

This study was conducted during 1992 to 1994 with the objective of assessing genotypic differences in phosphorus use efficiency of wetland rice (Oriza sativa L.) and to select genotypes which grow well on soils low in available P or requiring only small amounts of added phosphorus fertilizer. In the first experiment, 24 genotypes of rice were screened under field conditions at low P (0 P added) and high P (90 kg P 2 O 5 /ha) on a gray soil of South Viet Nam. Significant genotypic differences were found in straw and grain yield, total P uptake, plant height and phosphorus use efficiency. Grain yield was highly correlated with phosphorus use efficiency. The effect of P supply was generally small. On average P supply decreased straw yield and increased grain yield. In the second experiment, four genotypes selected from the first experiment were grown under greenhouse conditions for four weeks supplied with 0, 30 and 90 ppm. Dry weight of shoots did not respond to P fertilization, but dry weight of roots increased with increasing P supply. The two efficient genotypes, G6 and G22, showed a higher root/shoot ratio than the two inefficient genotypes, G11 and G19. This indicates a higher potential for P acquisition of G6 and G22. In the third experiment, the same contrasting genotypes, and G18 with intermediate efficiency, were grown under field conditions at 0, 30, 60, 90 and 120 kg P 2 O 5 /ha. Of the two inefficient genotypes, G11 gave the highest grain yield at 60 and G19 at 90 kg P 2 O 5 /ha; G18 gave a clear response up to 60 kg P 2 O 5 /ha. Based on the information obtained in this study we conclude that G6 and G22 are efficiently and well adapted rice genotypes to gray soils of South Viet Nam, low in available P. At low P supply G6 may be slightly better than G22. Further, the 15 N tracer study showed that for G6, a small P supply (30 kg P 2 O 5 /ha) can increase the % N recover from urea applied at 120 kg N/ha. (author). 12 refs, 6 figs, 3 tabs

Genotypic differences in phosphorus use efficiency and yield of wetland rice of southern Viet Nam

Energy Technology Data Exchange (ETDEWEB)

Hong Thanh, Bui Thi; Lieu, Le Dac; Tra, Luong Thu; Son, Mai Thanh [Center of Nuclear Techniques, Ho Chi Minh City (Viet Nam); Nghia, Nguyen Dang; Binh, Do Trung [Agricultural Science Inst., Ho Chi Minh City (Viet Nam)

1996-07-01

This study was conducted during 1992 to 1994 with the objective of assessing genotypic differences in phosphorus use efficiency of wetland rice (Oriza sativa L.) and to select genotypes which grow well on soils low in available P or requiring only small amounts of added phosphorus fertilizer. In the first experiment, 24 genotypes of rice were screened under field conditions at low P (0 P added) and high P (90 kg P{sub 2}O{sub 5}/ha) on a gray soil of South Viet Nam. Significant genotypic differences were found in straw and grain yield, total P uptake, plant height and phosphorus use efficiency. Grain yield was highly correlated with phosphorus use efficiency. The effect of P supply was generally small. On average P supply decreased straw yield and increased grain yield. In the second experiment, four genotypes selected from the first experiment were grown under greenhouse conditions for four weeks supplied with 0, 30 and 90 ppm. Dry weight of shoots did not respond to P fertilization, but dry weight of roots increased with increasing P supply. The two efficient genotypes, G6 and G22, showed a higher root/shoot ratio than the two inefficient genotypes, G11 and G19. This indicates a higher potential for P acquisition of G6 and G22. In the third experiment, the same contrasting genotypes, and G18 with intermediate efficiency, were grown under field conditions at 0, 30, 60, 90 and 120 kg P{sub 2}O{sub 5}/ha. Of the two inefficient genotypes, G11 gave the highest grain yield at 60 and G19 at 90 kg P{sub 2}O{sub 5}/ha; G18 gave a clear response up to 60 kg P{sub 2}O{sub 5}/ha. Based on the information obtained in this study we conclude that G6 and G22 are efficiently and well adapted rice genotypes to gray soils of South Viet Nam, low in available P. At low P supply G6 may be slightly better than G22. Further, the {sup 15}N tracer study showed that for G6, a small P supply (30 kg P{sub 2}O{sub 5}/ha) can increase the % N recover from urea applied at 120 kg N/ha.

Ground subsidence as a result of natural gas exploitation. NAM-fields in Groningen, Friesland and North-Drente. State-of-the-art report 2005 and prognosis up to the year 2050. Summary

International Nuclear Information System (INIS)

2005-12-01

Based on present knowledge of and insights a prognosis is given of ground subsidence as a result of natural gas exploration in the title provinces in the Netherlands. The prognosis will be repeated every five years according to an agreement between the province Groningen and the NAM (Dutch Petroleum Company). This is the second prognosis [nl

Investigation Of The Natural Radioactivity In The Phuoc Dinh Area Located In The Thuan Nam District, Ninh Thuan Province

International Nuclear Information System (INIS)

Ba Van Khoi; Vo Xuan An

2011-01-01

It is very important that the natural radioactivity in the Phuoc Dinh area located in the Thuan Nam district, Ninh Thuan province has to be investigated. Because Phuoc Dinh is an area anticipated for constructing The 1 st Ninh Thuan Nuclear Power Plant, the data of the natural radioactivity determined before installing and operating this Nuclear Power Plant are to evaluate the dangerous ecologic effects of this industry. The soil samples were collected in the radius of 0.5, 0.6 and 0.7 km from the fence of this Nuclear Power Plant. The results of the natural radioactivity were measured on the low background spectrometry using the high purity germanium (HPGe) detector at the Center for Nuclear Techniques Ho Chi Minh City. (author)

French Policies towards the Chinese in Vietnam Les politiques françaises envers les Chinois du Viêt Nam : études des migrations et des réponses du colonisateur

Directory of Open Access Journals (Sweden)

Ramses Amer

2010-07-01

Full Text Available This study examines the patterns of Chinese migration to and from Vietnam as well as the demographic changes relating to the Chinese residing in the country. It also outlines how the French authorities responded to the arrival of the Chinese and how they treated them. The focus is on the period of French control over the whole of Vietnam from 1883 to 1954. The French authorities did pay considerable attention to the Chinese migration to Vietnam. The policies of the French aimed at keeping a close surveillance on the Chinese. To administer the Chinese communities the French opted to maintain the system of indirect control introduced by the Vietnamese Emperors. During the period of French rule the Chinese population grew considerably. Chinese migration to and from Vietnam was influenced by the political evolution in China and by repercussions of international economic developments. Thus, the French authorities could influence the migrants when they arrived or departed, but the decision to migrate was primarily due to other factors.Cette étude examine les modèles de la migration chinoise à destination et en provenance du Viêt Nam de même que les changements démographiques concernant les Chinois résidant dans le pays. Elle précise également les réponses des autorités françaises à l’arrivée des Chinois et le traitement qui leur était réservé. Elle traite tout spécialement la période du contrôle français sur le Viêt Nam de 1883 à 1954. Car les autorités françaises ont porté un intérêt considérable à la migration des Chinois au Viêt Nam. La politique française consistait à surveiller de près les Chinois. Pour l’administration des communautés chinoises les Français ont choisi de conserver le système de contrôle indirect mis en place par les empereurs vietnamiens. La population chinoise connut une croissance considérable pendant la période française. La migration vers et depuis le Viêt Nam était influenc

Growth and Structural Transformation in Viet Nam during the 2000s

DEFF Research Database (Denmark)

Thu Hoai, Dang Thi; Tarp, Finn; van Seventer, Dirk

the period 2000–12, while moving from primary production (agriculture) towards more value adding manufacturing activities. This transformation has been broad-based and in large measure driven by external demand. We conclude that it will be challenging to sustain growth without bold moves in technological......We study structural transformation and change in the Vietnamese economy using two Social Accounting Matrices (SAMs), one for the year 2000 and a recently compiled SAM for the year 2012. This period is of particular interest as it features an important shift in terms of more economic integration...

Forty women parliamentarians gather to reaffirm commitment to the ICPD, Ho Chi Minh City, Viet Nam.

Science.gov (United States)

1995-01-01

Over 40 delegates attended the Indo-China Female Parliamentarians Conference on the Status of Women and Reproductive Health held in Viet Nam in June 1995. The conference was organized by the Vietnamese Association of Parliamentarians on Population and Development. Participants noted that, in Indochina, the participation of women in local politics has been blocked by the absence of laws and policies on gender equality. Recommended, to remedy this situation, were the following measures: 1) implementation of programs on women's status outlined at the 1994 International Conference on Population and Development; 2) allocation of sufficient resources for programs in the areas of maternal-child health, family planning, and acquired immunodeficiency syndrome (AIDS) prevention; 3) enactment of laws banning child prostitution and violence against women; 4) promotion of changes in men's sexual behaviors that spread AIDS; 5) encouragement of women to increase their knowledge of and participation in political action; and 6) appeals to international agencies and nongovernmental organizations to develop programs for Indochinese women.

GIS and local knowledge in disaster management: a case study of flood risk mapping in Viet Nam.

Science.gov (United States)

Tran, Phong; Shaw, Rajib; Chantry, Guillaume; Norton, John

2009-03-01

Linking community knowledge with modern techniques to record and analyse risk related data is one way of engaging and mobilising community capacity. This paper discusses the use of the Geographic Information System (GIS) at the local level and the need for integrating modern technology and indigenous knowledge into disaster management. It suggests a way to mobilise available human and technical resources in order to strengthen a good partnership between local communities and local and national institutions. The paper also analyses the current vulnerability of two communes by correlating hazard risk and loss/damage caused by disasters and the contribution that domestic risk maps in the community can make to reduce this risk. The disadvantages, advantages and lessons learned from the GIS flood risk mapping project are presented through the case study of the Quang Tho Commune in Thua Thien Hue province, central Viet Nam.

Exploration drilling and ecology. A contribution to the MER (Environmental Effect Report) of the NAM (Netherlands Petroleum Company) for the benefit of exploration drilling for natural gas in the Waddenzee and the North Sea coastal area

International Nuclear Information System (INIS)

Dankers, N.; Wintermans, G.J.M.

1996-01-01

Within the framework of the title drilling activities the NAM carries out a MER. Several research institutes were asked to contribute to the MER. The authors' institute was asked to describe the ecology of the exploration areas in the Wadden Sea, as well as the possible effects of the exploration drilling on the ecology. In this report only the impact for the Wadden Sea is dealt with. In chapter 1 the ecology of the Wadden Sea is discussed in detail for the subjects primary production (photosynthesis), secondary production (consumption of vegetable organic materials), birds, seals, and societal functions. In chapter 2 specific aspects of specific sites are outlined. In chapter 3 an overview (the so-called factor train) is given of the activities around the exploration drilling of the NAM in the Wadden Sea and the disturbances that can be the result of those activities. In chapter 4 the possible effects of exploration drilling on birds and seals are discussed for each drilling site

Fool’s Gold: Understanding Social, Economic and Environmental Impacts from Gold Mining in Quang Nam Province, Vietnam

Directory of Open Access Journals (Sweden)

Nhi Nguyen

2018-04-01

Full Text Available Extractive industries are often claimed to contribute to both poverty reduction and economic growth. Yet, there is also a body of research that suggests natural resource dependence can result in limited development, environmental degradation and social upheaval. This paper examines differences in the socioeconomic and environmental state of mining and non-mining communities in rural Vietnam in order to understand the extent to which mining contributes to livelihood development and socioeconomic well-being. In particular, we examine the role that “corporate social responsibility” (CSR plays in supporting community development in Phuoc Son and Phu Ninh districts, Quang Nam province. Content analysis of newspapers, government documents and mining company reports provided a contextual overview of mining operations and community relations in each study area. Semi-structured interviews were used to collect information from local and regional stakeholders to further understand perceived impacts of mining operations on local communities. Our study finds that in comparison to non-mining communities, communities with active mines demonstrated increased job development, decreased poverty rates, enhanced infrastructure and social development along with increased incidences of CSR initiatives. However, a number of adverse effects from mining activities were reported including environmental degradation (e.g., deforestation, water pollution, etc. increased criminal activity and drug addiction. Dependence on mine-related employment in local communities becomes acutely apparent when temporary mine closures result in widespread unemployment. Local governments may be the greatest beneficiaries of mining with increased tax revenues and enhanced management potential of leased land. Non-mining communities without direct benefits from mining activities maintained economic diversity and were therefore more resilient to economic shocks such as nearby mine closures.

The northern annular mode in summer and its relation to solar activity variations in the GISS ModelE

Science.gov (United States)

Lee, Jae N.; Hameed, Sultan; Shindell, Drew T.

2008-03-01

The northern annular mode (NAM) has been successfully used in several studies to understand the variability of the winter atmosphere and its modulation by solar activity. The variability of summer circulation can also be described by the leading empirical orthogonal function (EOF) of geopotential heights. We compare the annular modes of the summer geopotential heights in the northern hemisphere stratosphere and troposphere in the Goddard Institute for Space Studies (GISS) ModelE with those in the National Centers for Environmental Prediction/National Center for Atmospheric Research (NCEP/NCAR) reanalysis. In the stratosphere, the summer NAM obtained from NCEP/NCAR reanalysis as well as from the ModelE simulations has the same sign throughout the northern hemisphere, but shows greater variability at low latitudes. The patterns in both analyses are consistent with the interpretation that low NAM conditions represent an enhancement of the seasonal difference between the summer and the annual averages of geopotential height, temperature and velocity distributions, while the reverse holds for high NAM conditions. Composite analysis of high and low NAM cases in both model and observation suggests that the summer stratosphere is more "summer-like" when the solar activity is near a maximum. This means that the zonal easterly wind flow is stronger and the temperature is higher than normal. Thus increased irradiance favors a low summer NAM. A quantitative comparison of the anti-correlation between the NAM and the solar forcing is presented in the model and in the observation, both of which show lower/higher NAM index in solar maximum/minimum conditions. The temperature fluctuations in simulated solar minimum conditions are greater than in solar maximum throughout the summer stratosphere. The summer NAM in the troposphere obtained from NCEP/NCAR reanalysis has a dipolar zonal structure with maximum variability over the Asian monsoon region. The corresponding EOF in ModelE has

Veselības aprūpes iemaņas pusaudžiem bērnu namā

OpenAIRE

Zūpe, Daira

2008-01-01

Pētniecības darbā „Veselības aprūpes iemaņas pusaudžiem bērnu namā” autore Daira Zūpe izpēta un analizē vienu no bērnu namu aktuālajām problēmām veselības profilakses veicināšanā – veselības aprūpes iemaņu attīstīšanu. Pētījumā uzmanība pievērsta māsas lomai bērnu nama pusaudžu veselības aprūpes procesā, kur akcentēta veselības aprūpes pamatiemaņu nozīme veselības vecināšanā - fiziskās aktivitātes, ēšanas paradumi, kaitīgie ieradumi un higiēnas iemaņas. Pētniecības darba zinātniskā vadītā...

Three new species of earthworms in the Amynthas (Clitellata: Megascolecidae from Nam Xam National Protected Area, Laos

Directory of Open Access Journals (Sweden)

Yong Hong

2017-09-01

Full Text Available Earthworm specimens collected from the Nam Xam National Protected Area, Laos, belong to three new species of megascolecid earthworms: Amynthas xamtaiensis sp. nov., Amynthas vanhyai sp. nov., and Amynthas multipapillatus sp. nov. The authors provide a new record for Amynthas gracilis (Kinberg, 1867. All three new species key to the gracilis (hawayanus group in Sims and Easton (1972, defined by having three pairs of spermathecal pores in 5/6–7/8. A. xamtaiensis sp. nov. has male pores superficial in thickened areas, containing two genital papillae medial to the male pores. A. vanhyai sp. nov. has male pores equatorial oval pads at sixth setal lines, and shallowly pinnate intestinal ceca having 6–10 lobes on each edge. A. multipapillatus sp. nov. has male pores on small longitudinal shallow invaginations at lateral margins of the ventrum, and more than 100 small genital papillae covering the ventral surface from 16/17 to 17/18.

Factors affecting ultraviolet irradiation/hydrogen peroxide (UV/H2O2) degradation of mixed N-nitrosamines in water

International Nuclear Information System (INIS)

Zhou, Chao; Gao, Naiyun; Deng, Yang; Chu, Wenhai; Rong, Wenlei; Zhou, Shengdong

2012-01-01

Highlights: ► NAms with three-induced toxicity, as emerging DBPs, has caused a great public attention. ► No paper regards UV/H 2 O 2 oxidation of mixed NAms in an aquatic environment. ► The treatment effect is typically affected by a few factors in water. ► NPIP and NDPhA are the most readily and difficult to be degraded due to unique structure. ► All the NAms degradation exhibited a pseudo-first-order kinetics pattern. - Abstract: Disinfection by-products (DBPs) are a great challenge to our drinking water security. Particularly, nitrosamines (NAms), as emerging DBPs, are potently carcinogenic, mutagenic, and teratogenic, and have increasingly attained public attention. This study was to evaluate the performance of the NAms degradation by the ultraviolet (UV) irradiation (253.7 nm) in the presence of hydrogen peroxide (H 2 O 2 ). In the UV/H 2 O 2 system, hydroxyl radicals (OH·), a type of nonselective and powerful oxidant, was produced to attack the molecules of NAms. Factors affecting the treatment efficiency, including the H 2 O 2 dosage, initial NAms concentration, UV irradiation intensity, initial solution pH, and inorganic anions present in water, were evaluated. All the NAms degradation exhibited a pseudo-first-order kinetics pattern. Within 60 min, 0.1 mg/L of any NAms could be almost decomposed except NDPhA that required 120 min for complete removal, at 25 μmol/L H 2 O 2 and at initial pH 7. Results demonstrate that the UV/H 2 O 2 treatment is a viable option to control NAms in water.

Father's involvement and its effect on early breastfeeding practices in Viet Nam.

Science.gov (United States)

Bich, Tran Huu; Hoa, Dinh Thi Phuong; Ha, Nguyen Thanh; Vui, Le Thi; Nghia, Dang Thi; Målqvist, Mats

2016-10-01

Fathers have an important but often neglected role in the promotion of healthy breastfeeding practices in developing countries. A community-based education intervention was designed to mobilize fathers' support for early breastfeeding. This study aimed to evaluate an education intervention targeting fathers to increase the proportion of early breastfeeding initiation and to reduce prelacteal feeding. Quasi-experimental study design was used to compare intervention and control areas located in two non-adjacent rural districts that shared similar demographic and health service characteristics in northern Viet Nam. Fathers and expectant fathers with pregnant wives from 7 to 30 weeks gestational age were recruited. Fathers in the intervention area received breastfeeding education materials, counselling services at a commune health centre and household visits. They were also invited to participate in a breastfeeding promotion social event. After intervention, early breastfeeding initiation rate was 81.2% in the intervention area and 39.6% in the control area (P < 0.001). Babies in the intervention area were more likely to be breastfed within the first hour after birth [odds ratio (OR) 7.64, 95% confidence interval (CI) 4.81-12.12] and not to receive any prelacteal feeding (OR 4.43, 95% CI 2.88-6.82) compared with those in the control area. Fathers may positively influence the breastfeeding practices of mothers, and as a resource for early childcare, they can be mobilized in programmes aimed at improving the early initiation of breastfeeding. © 2015 John Wiley & Sons Ltd.

Study On The Choice Of Leaching System For Thanh My, Quang Nam Province Uranium Ores Treatment

International Nuclear Information System (INIS)

Than Van Lien; Nguyen Dinh Van; Tran The Dinh

2011-01-01

In order to implement the plan of peaceful uses of atomic energy, the Radioactive and Rare Earth Geology Division have been carried out the uranium ores exploitation project in Thanh My area of Quang Nam province since 2010. The treatment uranium ores samples is one of works of this project. In order to preparing for uranium ores samples treatment, the Institute for Technology of Radioactive and Rare Elements have been studied and have chosen the heap leaching method for Thanh My uranium ore treatment. The ore, which contained less than 0.07% U, was crushed to -1 cm before being placed in the heap. The acid consumption for this heap leach operation was approximately ranged 40 kg - 45 kg of H 2 SO 4 per tonne of ore, and oxidant 4 kg of MnO 2 per tonne of ore. The entire treatment cycle required 20-25 days, the recovery exceeded 80%, the leached tails contained less than 0.01% U. The experimental results were comparable with those obtained in the field scale heap leaching in the world. (author)

The Volatility of Market Risk In Viet Nam Listed Public Utilities Company Groups during and after the Financial Crisis 2007-2009

Directory of Open Access Journals (Sweden)

Dinh Tran Ngoc Huy

2014-03-01

Full Text Available This study estimates market risk of total 45 listed companies in Viet Nam public utilities, natural gas and oil industry during the financial crisis period 2007-2009. Firstly, we found out in the research sample that there are 82% of firms, of total listed firms, with beta values lower than ( 1, meaning having stock returns fluctuating more than the market benchmark. Thirdly, among three (3 groups, the systemic risk in the electric power industry is the smallest, shown by estimated values of equity and asset beta mean, and asset beta variance in this industry is also the smallest. Finally, this paper generates some analytical outcomes that enable companies and government to have more evidence in establishing their policies in investments and in governance

The mangrove's contribution to people: Interdisciplinary pilot study of the Can Gio Mangrove Biosphere Reserve in Viet Nam

Science.gov (United States)

Cormier-Salem, Marie-Christine; Van Trai, Nguyen; Burgos, Ariadna; Durand, Jean-Dominique; Bettarel, Yvan; Klein, Judith; Duc Huy, Hoang; Panfili, Jacques

2017-10-01

The main objective of this pilot study, conducted in June 2015 in the Can Gio Mangrove Biosphere Reserve (Can Gio MBR, Viet Nam), was to develop an interdisciplinary approach to assess some key services provided by reforested mangroves subject to external pressures and varying management policies. We focused on the abundance of viruses, bacteria, endo- and epi- and macrofauna and the diversity of crabs in the mangrove and the exploitation of its resources. The main social finding was that the local inhabitants are aware of the levels of protection of the different zones within the Can Gio MBR and respect them. The core and the buffer zones seem to present a similar ecological status. Genotyping showed a low level of crab diversity although there were many different morphotypes. In the future, we need to understand the stakeholders' general perception of the biodiversity and environment changes by developing an integrated, multi-scale approach.

Risk Behaviors for HIV and HCV Infection Among People Who Inject Drugs in Hai Phong, Viet Nam, 2014.

Science.gov (United States)

Duong, Huong Thi; Jarlais, Don Des; Khuat, Oanh Hai Thi; Arasteh, Kamyar; Feelemyer, Jonathan; Khue, Pham Minh; Giang, Hoang Thi; Laureillard, Didier; Hai, Vinh Vu; Vallo, Roselyne; Michel, Laurent; Moles, Jean Pierre; Nagot, Nicolas

2017-06-13

We examined the potential for HIV and hepatitis C (HCV) transmission across persons who inject drugs (PWID), men-who-have-sex-with-men (MSM) and female commercial sex workers (CSW) PWID and the potential for sexual transmission of HIV from PWID to the general population in Hai Phong, Viet Nam. Using respondent driven and convenience sampling we recruited 603 participants in 2014. All participants used heroin; 24% used non-injected methamphetamine. HIV prevalence was 25%; HCV prevalence was 67%. HIV infection was associated with HCV prevalence and both infections were associated with length of injecting career. Reported injecting risk behaviors were low; unsafe sexual behavior was high among MSM-PWID and CSW-PWID. There is strong possibility of sexual transmission to primary partners facilitated by methamphetamine use. We would suggest future HIV prevention programs utilize multiple interventions including "treatment as prevention" to potential sexual transmission of HIV among MSM and CSW-PWID and from PWID to the general population.

Des habitations à bon marché au Việt Nam. La question du logement social en situation coloniale Public Housing Projects in Việt Nam: the Problem of Habitation in a Colonial Situation

Directory of Open Access Journals (Sweden)

Caroline Herbelin

2009-10-01

Full Text Available La crise du logement dans les grandes villes du Việt Nam est récurrente pendant toute la colonisation. Elle touche les Européens, mais surtout les populations locales qui vivent en majorité dans des habitats précaires. A partir des années 1920, face à l’ampleur de la situation, le gouvernement général décide d’adapter dans la colonie les récentes lois françaises en faveur du logement social. Si quelques prototypes d’habitations à bon marché vont être mis en place par la municipalité de Hanoi dans les années 1930, ce n’est que dans les années 1950, pour répondre à la crise sociale que les politiques de logement vont commencer à être significatives. Entre inertie et projets enthousiastes, les politiques de logement révèlent les contradictions du système colonial face à un problème aussi crucial que complexe, mettant en jeu différents acteurs à différents niveaux : le gouvernement général d’Indochine, la résidence supérieure du Tonkin, les municipalités, les associations privées et dans une moindre mesure les sociétés de construction. Du point de vue architectural, les projets mis en place sont des créations hybrides qui montrent une volonté manifeste de s’adapter au style de vie vietnamien.During the colonial period, the main cities of Việt Nam periodically experienced social housing crises. While Europeans did not remain immune from the consequences of a lack of adequate housing, local populations, who constituted the majority in these makeshift constructs, were most deeply affected. Beginning in the 1920s, faced with the urgency of this problem, the general government sought to adapt contemporaneous French laws in favor of social housing to the local colonial situation. Even though some prototypes of affordable housing were constructed by the Hanoi municipality in the 1930s, it was only in the 1950s that government efforts began to have a significant impact. The politics of housing, and

Home-Based Care and Perceived Quality of Life Among People Living with HIV in Ho Chi Minh City, Viet Nam.

Science.gov (United States)

Bui, Quyen Thi Tu; Brickley, Deborah Bain; Tieu, Van Thi Thu; Hills, Nancy K

2018-03-31

We conducted a cross-sectional study to examine the perceptions of quality of life among people living with HIV who received home-based care services administered through outpatient clinics in Ho Chi Minh City, Viet Nam. Data were collected from a sample of 180 consecutively selected participants (86 cases, 94 controls) at four outpatient clinics, all of whom were on antiretroviral therapy. Quality of life was evaluated using the WHOQOL-BREF instrument. In adjusted analysis, those who received home-based care services had a quality of life score 4.08 points higher (on a scale of 100) than those who did not receive home-based care services (CI 95%, 2.32-5.85; p < 0.001). The findings suggest that home-based care is associated with higher self-perceptions of quality of life among people living with HIV.

Nuclear analyses in biology and medical science. Measuring on nucleii in stead of atoms

International Nuclear Information System (INIS)

De Goeij, J.J.M.

1996-01-01

A brief overview is given of the use of nuclear analyses in life sciences. Features of nuclear analytical methods (NAMs) are grouped into four categories: physical basis, isotopic analyses rather than elemental analyses, no interference of electronic and molecular structure, and penetrating character of nuclear radiation. Obstacles in applying NAMs in the life sciences are outlined. 1 tab

Application of groundwater sustainability indicators to the Upper Pliocene aquifer in Ho Chi Minh city, Viet Nam

Science.gov (United States)

Ngo, T. M.; Lee, J.; Lee, H.; Woo, N. C.

2013-12-01

Groundwater plays an importance role for domestic, industrial, and agricultural uses in Ho Chi Minh city, Viet Nam. This study is objected to evaluate the sustainability of groundwater by using groundwater sustainability indicators (GWSIs) defined by UNESCO/IAEA/IAH Working Group on Groundwater Indicators at aquifer scale (the Upper Pliocene aquifer). There are four main indicators selected and one new indicator designed for the particular characteristic of Ho Chi Minh city which is under influence of by saline-water intrusion. The results indicated groundwater of the Upper Pliocene aquifer, the main groundwater supply source, is generally in the unsustainable state. The abstraction of groundwater, which was much greater than its capability, is probably causing the serious state of annual groundwater depletion and saline-water intrusion. The GWSIs, which expressed in such a simple way but scientifically-based and policy-relevant, proved its usefulness in evaluating the sustainability of groundwater at the aquifer scale in Ho Chi Minh city, and subsequently should be incorporated in water resource management practices.

A study of the Chinese organic-inorganic hybrid sealing material used in 'Huaguang No.1' ancient wooden ship

Energy Technology Data Exchange (ETDEWEB)

Fang, Shiqiang [Department of Chemistry, Zhejiang University, Hangzhou 310027 (China); College of Chemical Engineering and Materials Science, Zhejiang University of Technology, Hangzhou 310014 (China); Zhang, Hui [Department of Cultural Heritage and Museology, Zhejiang University, Hangzhou 310028 (China); Zhang, Bingjian, E-mail: zhangbiji@zju.edu.cn [Department of Chemistry, Zhejiang University, Hangzhou 310027 (China); Department of Cultural Heritage and Museology, Zhejiang University, Hangzhou 310028 (China); Wei, Guofeng [Department of Chemistry, Zhejiang University, Hangzhou 310027 (China); Li, Guoqing [Museum of Overseas Communication History Quanzhou, Fujian 362000 (China); Zhou, Yang [China National Silk Museum, Hangzhou 310002 (China)

2013-01-10

Highlights: Black-Right-Pointing-Pointer The composition of ancient sealing material was analyzed. Black-Right-Pointing-Pointer The excellent performance of this sealing material comes from the compact structure. Black-Right-Pointing-Pointer This structure is established through coordination and oxidative polymerization. Black-Right-Pointing-Pointer Conservation of ancient relies to a knowledge on their materials and crafts. - Abstracts: Chu-nam putty is a special organic-inorganic hybrid material invented by ancient Chinese people. It was prepared by mixing tung-oil, lime and oakum (plant fibers like jute, ramie and so on) with excellent sealing performance. The invention and application of Chu-nam putty in wooden ship lead to improvement in sailing technology and ship safety issue. In this paper, the analytical results of a piece of chu-nam putty which was discovered in 'Huaguang No.1' ancient ship are presented. The results show that the components of chu-nam putty are calcite, carboxylate and unsaturated esters by means of FT-IR, XRD and TGA/DSC. And the FT-IR and cross-section microscopic analysis confirm that the oakum was from jute. Comparing with the modeling putty samples it is found that the outstanding sealing performance of chu-nam putty comes from the coordination reaction of Ca{sup 2+} from the Ca(OH){sub 2} and the oxidation aggregation reaction of C=C double bonds in unsaturated fatty acid.

A study of the Chinese organic–inorganic hybrid sealing material used in “Huaguang No.1” ancient wooden ship

International Nuclear Information System (INIS)

Fang, Shiqiang; Zhang, Hui; Zhang, Bingjian; Wei, Guofeng; Li, Guoqing; Zhou, Yang

2013-01-01

Highlights: ► The composition of ancient sealing material was analyzed. ► The excellent performance of this sealing material comes from the compact structure. ► This structure is established through coordination and oxidative polymerization. ► Conservation of ancient relies to a knowledge on their materials and crafts. - Abstracts: Chu-nam putty is a special organic–inorganic hybrid material invented by ancient Chinese people. It was prepared by mixing tung-oil, lime and oakum (plant fibers like jute, ramie and so on) with excellent sealing performance. The invention and application of Chu-nam putty in wooden ship lead to improvement in sailing technology and ship safety issue. In this paper, the analytical results of a piece of chu-nam putty which was discovered in “Huaguang No.1” ancient ship are presented. The results show that the components of chu-nam putty are calcite, carboxylate and unsaturated esters by means of FT-IR, XRD and TGA/DSC. And the FT-IR and cross-section microscopic analysis confirm that the oakum was from jute. Comparing with the modeling putty samples it is found that the outstanding sealing performance of chu-nam putty comes from the coordination reaction of Ca 2+ from the Ca(OH) 2 and the oxidation aggregation reaction of C=C double bonds in unsaturated fatty acid.

The Seroprevalence and Seroincidence of Enterovirus71 Infection in Infants and Children in Ho Chi Minh City, Viet Nam

Science.gov (United States)

Tran, Chau Bich Nguyen; Nguyen, Hieu Trong; Phan, Ha Thanh Thi; Tran, Ngoc Van; Wills, Bridget; Farrar, Jeremy; Santangelo, Joseph D.; Simmons, Cameron P.

2011-01-01

Enterovirus 71 (EV71)-associated hand, foot and mouth disease has emerged as a serious public health problem in South East Asia over the last decade. To better understand the prevalence of EV71 infection, we determined EV71 seroprevalence and seroincidence amongst healthy infants and children in Ho Chi Minh City, Viet Nam. In a cohort of 200 newborns, 55% of cord blood samples contained EV71 neutralizing antibodies and these decayed to undetectable levels by 6 months of age in 98% of infants. The EV71 neutralizing antibody seroconversion rate was 5.6% in the first year and 14% in the second year of life. In children 5–15 yrs of age, seroprevalence of EV71 neutralizing antibodies was 84% and in cord blood it was 55%. Taken together, these data suggest EV71 force of infection is high and highlights the need for more research into its epidemiology and pathogenesis in high disease burden countries. PMID:21765891

Nicotinamide: a vitamin able to shift macrophage differentiation toward macrophages with restricted inflammatory features.

Science.gov (United States)

Weiss, Ronald; Schilling, Erik; Grahnert, Anja; Kölling, Valeen; Dorow, Juliane; Ceglarek, Uta; Sack, Ulrich; Hauschildt, Sunna

2015-11-01

The differentiation of human monocytes into macrophages is influenced by environmental signals. Here we asked in how far nicotinamide (NAM), a vitamin B3 derivative known to play a major role in nicotinamide adenine dinucleotide (NAD)-mediated signaling events, is able to modulate monocyte differentiation into macrophages developed in the presence of granulocyte macrophage colony-stimulating factor (GM-MØ) or macrophage colony-stimulating factor (M-MØ). We found that GM-MØ undergo biochemical, morphological and functional modifications in response to NAM, whereas M-MØ were hardly affected. GM-MØ exposed to NAM acquired an M-MØ-like structure while the LPS-induced production of pro-inflammatory cytokines and COX-derived eicosanoids were down-regulated. In contrast, NAM had no effect on the production of IL-10 or the cytochrome P450-derived eicosanoids. Administration of NAM enhanced intracellular NAD concentrations; however, it did not prevent the LPS-mediated drain on NAD pools. In search of intracellular molecular targets of NAM known to be involved in LPS-induced cytokine and eicosanoid synthesis, we found NF-κB activity to be diminished. In conclusion, our data show that vitamin B3, when present during the differentiation of monocytes into GM-MØ, interferes with biochemical pathways resulting in strongly reduced pro-inflammatory features. © The Author(s) 2015.

Removal of emulsified and dissolved traces of organic compounds from industrial wastewaters using nature and synthesized (Na A and Nam) zeolites

International Nuclear Information System (INIS)

Modirshahla, N.; Tabatabaii, S.

2004-01-01

The main object of this study was to compare the natural and synthetic (Na A and Nam) zeolites as absorbents in removing emulsified and dissolved traces of organic compounds, which appear in the wastewater of power plants, refinery and petrochemical complexes. The specific objections of the work was: a) to select the best species that have the highest amount of absorption; b) to measure the rate of absorption of traces organic compounds and emulsions on the natural and synthesized zeolites; c) to establish the absorption isotherms for the organics and emulsions with selected samples; d) to select readily available regenerants, and e ) to examine the ph dependence of the process and to establish a simple and practical method to detect and to measure the pollution after the treatment process. The BOD and COD of the treated and feed waters were compared

Do canopy disturbances drive forest plantations into more natural conditions? — A case study from Can Gio Biosphere Reserve, Viet Nam

Science.gov (United States)

Vogt, Juliane; Kautz, Markus; Fontalvo Herazo, Martha Liliana; Triet, Tran; Walther, Denny; Saint-Paul, Ulrich; Diele, Karen; Berger, Uta

2013-11-01

Large areas of mangrove forests were devastated in South Viet Nam during the second Indochina war. After its end in 1975, extensive reforestation with monocultures took place. Can Gio, one of the biggest replanted sites with about 20,000 ha of mangroves mainly Rhizophora apiculata, was declared a biosphere reserve by the UNESCO in 2000. Although this status now enables progressive forest dynamics, there are still drawbacks resulting from the unnatural character of the plantations. For example, the homogeneous size and age structure as well as the regular arrangement of the planted trees make larger forest stands more vulnerable to synchronized collapsing which can be triggered by stronger winds and storms. A transformation into a more natural forest characterized by a heterogeneous age and size structure and a mixed species composition is of urgent need to avoid a synchronized dieback. In this study we test the capability of natural canopy disturbances (e.g. lightning strikes) to facilitate this transformation.Canopy gaps created by lightning strikes were detected and quantified by remote sensing techniques. SPOT satellite images from the years 2003, 2005 and 2007 provided information about the spatial distribution, size, shape, and formation frequency of the gaps. Lightning strike gaps were identified based on their shape and size. They form small openings (mean: 0.025 ha) and their yearly probability of occurrence was determined to be approximately 0.012 per hectare. Selected gaps were surveyed in the field in 2008 to complement the remote sensing data and to provide information upon forest structure and regeneration.Simulation experiments were carried out with the individual-based KiWi mangrove model for quantifying the influence of different lightning regimes on the vertical and horizontal structure of the R. apiculata plantation. In addition, we conducted simulations with a natural and thus randomly generated forest to compare the structure of the two

Vibration of an Offshore Structure Having the Form of a Hollow Column Partially Filled with Multiple Fluids and Immersed in Water

OpenAIRE

Lin, Hsien-Yuan; Lee, Jeng-Nan; Sung, Wen-Hao

2012-01-01

This paper employs the numerical assembly method (NAM) to determine the exact frequency-response amplitudes of an offshore structure such as piles or towers having the form of a hollow column filled with multiple fluids, immersed in water, carrying an eccentric tip mass supported by a translational spring and/or a rotational spring, and subjected to a harmonic force. The hollow column is modeled as a Bernoulli-Euler cantilever beam fixed at the bottom. For the case of zero harmonic force, the...

Review of monograph of Doctor of Medicine, Professor Prokopov V.O. «Drinking water of Ukraine: medical-ecologic and sanitary-hygiene aspects» edited by Doctor of Medicine, Academician of NAMS of Ukraine A.M. Serdiuk. – K.: Academic Press «Medicine», 2016.

OpenAIRE

Shevchenko, O. A.

2017-01-01

Review of monograph of Doctor ofMedicine, Professor Prokopov V.O. «Drinking water ofUkraine: medical-ecologic and sanitary-hygiene aspects»edited by Doctor of Medicine, Academician of NAMS ofUkraine A.M. Serdiuk. – K.: Academic Press «Medicine»,2016. – 400 p.

Preparation of high quality zirconium oxychloride from zircon of Vietnam

International Nuclear Information System (INIS)

Ngo Van Tuyen; Vu Thanh Quang; Trinh Giang Huong; Vuong Huu Anh

2007-01-01

This paper introduces a sodium hydroxide decomposition method for zirconium oxychloride production from zircon sand of Vietnam such as Ha Tinh, Hue, Binh Thuan seaside. Techniques for separation of impurities in ZOC final product such as SiO 2 , Fe 2 O 3 , TiO 2 , rare earths, uranium, and thorium have also been introduced. Content of uranium and thorium in the final product of ZOC is less than 1 ppm. (author)

Breeding for high N2 fixation in groundnut and soybean in Viet Nam

International Nuclear Information System (INIS)

Nguyen Xuan Hong

1998-01-01

Groundnut (Arachis hypogaea L.) and soybean (Glycine max (L.) Mer.) are grown mainly on two types of soil in Viet Nam: coastal-sandy and upland-degraded soils. These soils are deficient in N, and considering that fertilizer N is not only costly to farmers but also a threat to the environment, it is important to maximize productivity by exploiting the ability of these legumes to fix N 2 symbiotically in their root nodules. We initiated programmes of breeding and selection to combine high N 2 fixation and high grain-yielding capacity. In the spring of 1992, breeding lines of groundnut and soybean were tested under greenhouse conditions for varietal differences in the capacity to fix N 2 using the acetylene reduction assay and the 15 N-dilution technique, with upland rice as reference plants. Varietal differences were found in nitrogenase activity, and percent N derived from fixation (%Ndfa) ranged from 11 to 63% for groundnut and from 9 to 79% for soybean. Field experiments in the autumn-winter season of 1992 again revealed significant varietal differences; %Ndfa ranged from 36 to 56% for groundnut and from 28 to 58% for soybean. Gamma-irradiated seeds of soybean were propagated in bulk from M 1 to M 4 . Five high-yielding mutant lines of both species were selected from the M 5 populations, and N 2 fixation was estimated using the 15 N-dilution technique. The average values for %Ndfa of the mutants were 55 and 57%, significant improvements over the parent-cultivar values of 25 and 29% for soybean and groundnut, respectively

Evaluation of mobile digital light-emitting diode fluorescence microscopy in Hanoi, Viet Nam.

Science.gov (United States)

Chaisson, L H; Reber, C; Phan, H; Switz, N; Nilsson, L M; Myers, F; Nhung, N V; Luu, L; Pham, T; Vu, C; Nguyen, H; Nguyen, A; Dinh, T; Nahid, P; Fletcher, D A; Cattamanchi, A

2015-09-01

Hanoi Lung Hospital, Hanoi, Viet Nam. To compare the accuracy of CellScopeTB, a manually operated mobile digital fluorescence microscope, with conventional microscopy techniques. Patients referred for sputum smear microscopy to the Hanoi Lung Hospital from May to September 2013 were included. Ziehl-Neelsen (ZN) smear microscopy, conventional light-emitting diode (LED) fluorescence microscopy (FM), CellScopeTB-based LED FM and Xpert(®) MTB/RIF were performed on sputum samples. The sensitivity and specificity of microscopy techniques were determined in reference to Xpert results, and differences were compared using McNemar's paired test of proportions. Of 326 patients enrolled, 93 (28.5%) were Xpert-positive for TB. The sensitivity of ZN microscopy, conventional LED FM, and CellScopeTB-based LED FM was respectively 37.6% (95%CI 27.8-48.3), 41.9% (95%CI 31.8-52.6), and 35.5% (95%CI 25.8-46.1). The sensitivity of CellScopeTB was similar to that of conventional LED FM (difference -6.5%, 95%CI -18.2 to 5.3, P = 0.33) and ZN microscopy (difference -2.2%, 95%CI -9.2 to 4.9, P = 0.73). The specificity was >99% for all three techniques. CellScopeTB performed similarly to conventional microscopy techniques in the hands of experienced TB microscopists. However, the sensitivity of all sputum microscopy techniques was low. Options enabled by digital microscopy, such as automated imaging with real-time computerized analysis, should be explored to increase sensitivity.

Discovery of the fossiliferous Cu Brei Formation (Lower Devonian) in the Kon Tum Block (South Viet Nam)

Science.gov (United States)

Thanh, Tong-Dzuy; Duyen, Than Duc; Hung, Nguyen Huu; My, Bui Phu

2007-01-01

Lower Devonian corals and stromatoporoids have recently been discovered in limestones among low grade metamorphic rocks on the western margin of the Kon Tum Block (South Viet Nam). This unit has been identified as the Cu Brei Formation. Coral and stromatoporoid species have been described including Squameofavosites aff. spongiosus, Parallelostroma cf. multicolumnum, Amphipora cf. rasilis, A. cf. raritalis, Simplexodictyon cf. artyschtense, Stromatopora cf. boriarchinovi and Stromatopora sp. indet. The Cu Brei Formation is exposed in a small area 6 km in length and 3 km wide at the foot of Cu Brei Mountain (Sa Thay District, Kon Tum Province). As this formation is in marine shelf facies it is probable that further exposures of Lower Devonian sediments may be discovered in the Kon Tum Block. This discovery raises the question of the tectonic history of the metamorphic Kon Tum Block. It is possible that the block was not an area of positive uplift from the beginning of Paleozoic as has been supposed, but was submerged in a marine environment, at least on its outer margins, in the Devonian, and possibly even earlier, in Early Paleozoic.

Bērnu ar uzvedības traucējumiem problēmu risinājums bērnu namā

OpenAIRE

Degterjova, Ella

2012-01-01

Izvēlētā diplomdarba tēma ir „Bērnu ar uzvedības traucējumiem problēmu risinājums bērnu namā”. Izvirzītais diplomdarba mērķis ir pētīt uzvedības traucējumu problēmu risināšanas veidus ilgstošās sociālās aprūpes un sociālās rehabilitācijas institūcijās dzīvojošiem bērniem ar uzvedības traucējumiem. Diplomdarbs sastāv no četrām darba nodaļām. Pirmajā nodaļā ir teorētiski analizēti bērnu uzvedības traucējumu veidi un bērnu uzvedības traucējumu jēdziens. Otrajā nodaļā autore analizē bērnu uz...

Physical and chemical properties of Nam Prig Noom, a Thai green-chili paste, following ultra-high pressure and thermal processes

Science.gov (United States)

Apichartsrangkoon, Arunee; Srisajjalertwaja, Siriwan; Chaikham, Pittaya; Hirun, Sathira

2013-03-01

A study of processing green-chili pastes (Nam Prig Noom) by pressurization (100-600 MPa/30-50°C/20 min), pasteurization (90°C/3-5 min) or sterilization (121°C/4 min), subsequently, their physical, biochemical and microbiological qualities as well as the sensory acceptance were assessed. It was found that pressure at low levels (100-300 MPa) could improve activities of enzyme peroxidase (POD), polyphenoloxidase (PPO) and lypoxygenase (LOX) in the chili paste by more than 100%, while pressures above 500 or 300 MPa combined with heat would significantly inactivate these enzyme activities. Both color parameters and enzyme activities illustrated that though some enzymatic browning occurred with the pressurized products indicated by b* (yellowish) parameter, the magnitude of these browning was still milder than those thermally treated products indicated by-a* (greenness) and L (lightness) parameters, presumably as a consequence of the Maillard reaction. Moreover, the sensory scores were found in accordance with color parameters, firmness and capsaicin contents.

Adapting the Melon Production Model to Climate Change in Giao Thuy district, Nam Dinh Province, Vietnam

Directory of Open Access Journals (Sweden)

Ngo, AT.

2016-01-01

Full Text Available Embedded in a package of climate change adaptation, researchers and farmers tested the melon hybrid variety, Kim Hoang Hau (KHH, for yield and disease resistance during the spring-summer season from March to June 2015 in Giao Thuy district, Nam Dinh province. The results were analysed and subsequently discussed with local farmers in focused groups. Analysis showed that the KHH was suitable to local soil conditions. The farmers preferred this new variety over the local melon, because not only did KHH give higher yield and pest resistance, it also showed less vulnerability to climatic stressors. Farmers decided to grow KHH based on the prevailing good market price at that time. However, farmers only shifted away from the old melon when they could anticipate the possibility of selling the new product. Those who did not continue with the KHH had difficulty in actively accessing the market for this new product. This study suggests that the market information does not solely drive the process of the adaptation itself, but it also provides relevant stimuli to farmers enabling them to successfully shift to new crop varieties. This study also implies that such process-based understanding is crucial in formulating strategies that increase the farmer's capacity to adapt to climate change.

DYNAMIQUES PAYSAGÈRES ET GUERRE DANS LA PROVINCE DE THUA THIÊN HUÊ (VIÊT NAM CENTRAL), 1954-2007 - Entre défoliation, déforestation et reconquêtes végétales

OpenAIRE

Robert, Amélie

2011-01-01

The Viêt Nam war put the forest at the heart of military stakes. The controversies over the environmental consequences of herbicide spraying inspire the hypothesis that the impacts of this practice are differential according to landscape units, worsened by the human disturbances prior to and after the war. Coming under biogeography, the geohistorical analysis compares sources, that are often divergent, and favors primary ones to reconstruct, at key dates, the landscapes of a province at the h...

Nicotinamide impairs entry into and exit from meiosis I in mouse oocytes.

Science.gov (United States)

Riepsamen, Angelique; Wu, Lindsay; Lau, Laurin; Listijono, Dave; Ledger, William; Sinclair, David; Homer, Hayden

2015-01-01

Following exit from meiosis I, mammalian oocytes immediately enter meiosis II without an intervening interphase, accompanied by rapid reassembly of a bipolar spindle that maintains condensed chromosomes in a metaphase configuration (metaphase II arrest). Here we study the effect of nicotinamide (NAM), a non-competitive pan-sirtuin inhibitor, during meiotic maturation in mouse oocytes. Sirtuins are a family of seven NAD+-dependent deacetylases (Sirt1-7), which are involved in multiple cellular processes and are emerging as important regulators in oocytes and embryos. We found that NAM significantly delayed entry into meiosis I associated with delayed accumulation of the Cdk1 co-activator, cyclin B1. GVBD was also inhibited by the Sirt2-specific inhibitor, AGK2, and in a very similar pattern to NAM, supporting the notion that as in somatic cells, NAM inhibits sirtuins in oocytes. NAM did not affect subsequent spindle assembly, chromosome alignment or the timing of first polar body extrusion (PBE). Unexpectedly, however, in the majority of oocytes with a polar body, chromatin was decondensed and a nuclear structure was present. An identical phenotype was observed when flavopiridol was used to induce Cdk1 inactivation during late meiosis I prior to PBE, but not if Cdk1 was inactivated after PBE when metaphase II arrest was already established, altogether indicating that NAM impaired establishment rather than maintenance of metaphase II arrest. During meiosis I exit in NAM-treated medium, we found that cyclin B1 levels were lower and inhibitory Cdk1 phosphorylation was increased compared with controls. Although activation of the anaphase-promoting complex-Cdc20 (APC-Cdc20) occurred on-time in NAM-treated oocytes, Cdc20 levels were higher in very late meiosis I, pointing to exaggerated APC-Cdc20-mediated proteolysis as a reason for lower cyclin B1 levels. Collectively, therefore, our data indicate that by disrupting Cdk1 regulation, NAM impairs entry into meiosis I and

Respiratory virus laboratory pandemic planning and surveillance in central Viet Nam, 2008-2010.

Science.gov (United States)

Tran, Thomas; Chien, Bui Trong; Papadakis, Georgina; Druce, Julian; Birch, Chris; Chibo, Doris; An, Truong Phuoc; Trang, Le Thi Kim; Trieu, Nguyen Bao; Thuy, Doan Thi Thanh; Catton, Mike; Mai, Trinh Xuan

2012-07-01

Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1) pandemic in 2009. Polymerase chain reaction (PCR) procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken. Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week) presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists. Of 2144 surveillance samples tested, 1235 (57.6%) were positive for at least one virus. The most common were influenza A strains (17.9%), with pandemic influenza A(H1N1) 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%), enterovirus (8.9%), influenza B (8.3%), adenovirus (5.3%), parainfluenza (4.7%), respiratory syncytial virus (RSV) (3.9%), human coronavirus (3.0%) and human metapneumovirus (0.3%). The detection rate was greatest in the 0-5 year age group. Viral co-infections were identified in 148 (6.9%) cases. The outbreak in 2009 of the influenza A(H1N1) pandemic strain provided a practical test of the laboratory's pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections.

Some properties of tetravalent actinide phosphates of M1M42(PO4)3 type and peculiarities of their structure

International Nuclear Information System (INIS)

Burnaeva, A.A.; Volkov, Yu.F.; Kryukova, A.I.; Skiba, O.V.; Spiryakov, V.I.; Korshunov, I.A.; Samojlova, T.K.

1987-01-01

Generalizing analysis of data on crystallographic and IR spectral properties of double phosphates of actinide and alkali elements of M (1) M 2 (4) (PO 4 ) 3 type is conducted. It is shown, that Li - , Na - , K - , Rb - , CsTh 2 (PO 4 ) 3 , Li - , Na - , KU 2 (PO 4 ) 3 , NaNp 2 (PO 4 ) 3 compounds crystallize in a monoclinic type structure and form an isostructural phosphate series. It is ascertained, that in rubidium-uranium, uranium-cesium systems double salt formation is not observed. Plutonium-sodium phosphate has a rhombic-type structure, which points out to the existence of a morphotropic transition in NaM 2 4 (PO 4 ) 3 phosphate series at the Np-Pu boundary. Some regularities of structure and effect of M 1 and M 4 nature on the double phosphate structure are revealed

Development of Phaeocystis globosa blooms in the upwelling waters of the South Central coast of Viet Nam

Science.gov (United States)

Hai, Doan-Nhu; Lam, Nguyen-Ngoc; Dippner, Joachim W.

2010-11-01

Blooms of haptophyte algae in the south central coastal waters of Viet Nam often occur in association with upwelling phenomenon during the southwest (SW) monsoon. Depending on the magnitude of the blooms, damage to aquaculture farms may occur. Based on two years of data on biology, oceanography, and marine chemistry, the present study suggests a conceptual model of the growth of the haptophyte Phaeocystis globosa. At the beginning of the bloom, low temperature and abundant nutrient supply, especially nitrate from rain and upwelling, favour bloom development. Diatoms utilize available nitrate and phosphate; subsequently, higher ammonium concentration allows P. globosa to grow faster than the diatoms. At the end of the Phaeocystis bloom, free cells may become available as food for a heterotrophic dinoflagellate species, Noctiluca scintillans. During and after the phytoplankton bloom, remineralization by bacteria reduces dissolved oxygen to a very low concentration at depth, and favors growth of nitrate-reducing bacteria.A Lagrangian Harmful Algal Bloom (HAB) model, driven by a circulation model of the area, realistically simulates the transport of microalgae in surface waters during strong and weak SW monsoon periods, suggesting that it may be a good tool for early warning of HABs in Vietnamese coastal waters.

Growth and population dynamics during early stages of the mangrove Kandelia candel in Halong Bay, North Viet Nam

Science.gov (United States)

Thi Ha, Hoang; Duarte, Carlos M.; Tri, Nguyen Hoang; Terrados, Jorge; Borum, Jens

2003-11-01

Quantifying the dynamics of the early stages in the life cycle of mangroves is essential to predict the distribution, species composition and structure of mangrove forests, and their maintenance and recovery from perturbations. The growth and population dynamics of two stands of the mangrove Kandelia candel in Halong Bay (Viet Nam) were examined for 1 year. Growth was highly seasonal, with high growth rates and fast internode formation in the summer, dropping to extremely low growth during January-February, the coldest and driest months in the year. In addition, growth and internode formation rates showed important inter-annual variability during the last decade. The complete reproductive period required 7-8 months. Flower initiation was maximal in June and peak propagule maturity occurred in December-January. Only one mature propagule developed for every 67 and 127 inflorescence buds formed at Site 1 and Site 2, respectively. Kandelia candel propagules begun to sink 10 days after being released, and after 18 days all propagules had negative buoyancy. The propagules developed roots within 19-68 days, depending on whether they were held on the water or sediment, and were capable of long range dispersal, for 15-20% of them dispersed more than 100 m within 1 day. The median age of K. candel plants ranged between 8.7 and 5.6 years, with a density of 1900 and 470 plants ha -1, in Sites 1 and 2. Plant mortality was high, with 64 and 74% of the plants surviving after a year at Sites 1 and 2. Life expectancy (i.e. median age-at-death) of only 2.2 and 2.7 years at Sites 1 and 2, respectively, indicates that mortality of young K. candel plants was specially high. Recruitment occurred in early spring, and did not suffice to balance the mortality within the annual period examined. These results suggest that the K. candel stands in Halong Bay might be maintained by a few years of high recruitment which would compensate for generally high mortality rates.

Validation of clinical case definition of acute intussusception in infants in Viet Nam and Australia.

Science.gov (United States)

Bines, Julie E; Liem, Nguyen Thanh; Justice, Frances; Son, Tran Ngoc; Carlin, John B; de Campo, Margaret; Jamsen, Kris; Mulholland, Kim; Barnett, Peter; Barnes, Graeme L

2006-07-01

To test the sensitivity and specificity of a clinical case definition of acute intussusception in infants to assist health-care workers in settings where diagnostic facilities are not available. Prospective studies were conducted at a major paediatric hospital in Viet Nam (the National Hospital of Pediatrics, Hanoi) from November 2002 to December 2003 and in Australia (the Royal Children's Hospital, Melbourne) from March 2002 to March 2004 using a clinical case definition of intussusception. Diagnosis of intussusception was confirmed by air enema or surgery and validated in a subset of participants by an independent clinician who was blinded to the participant's status. Sensitivity of the definition was evaluated in 584 infants agedclinical features consistent with intussusception but for whom another diagnosis was established (234 infants in Hanoi; 404 in Melbourne). In both locations the definition used was sensitive (96% sensitivity in Hanoi; 98% in Melbourne) and specific (95% specificity in Hanoi; 87% in Melbourne) for intussusception among infants with sufficient data to allow classification (449/533 in Hanoi; 50/51 in Melbourne). Reanalysis of patients with missing data suggests that modifying minor criteria would increase the applicability of the definition while maintaining good sensitivity (96-97%) and specificity (83-89%). The clinical case definition was sensitive and specific for the diagnosis of acute intussusception in infants in both a developing country and a developed country but minor modifications would enable it to be used more widely.

Agreement of 2 October 1989 between the Socialist Republic of Viet Nam and the International Atomic Energy Agency for the application of safeguards in connection with the Treaty on the Non-Proliferation of Nuclear Weapons

International Nuclear Information System (INIS)

1990-03-01

The document contains two parts. The first part stipulates the agreement of Viet Nam to accept safeguards on all source or special fissionable material in all peaceful nuclear activities within its territory, under its jurisdiction or carried out under its control anywhere, for the exclusive purpose of verifying that such material is not diverted to nuclear weapons or other nuclear explosive devices. The second part specifies the procedures to be applied in the implementation of the safeguards provisions of Part I

Genome-wide analysis and identification of stress-responsive genes of the NAM-ATAF1,2-CUC2 transcription factor family in apple.

Science.gov (United States)

Su, Hongyan; Zhang, Shizhong; Yuan, Xiaowei; Chen, Changtian; Wang, Xiao-Fei; Hao, Yu-Jin

2013-10-01

NAC (NAM, ATAF1,2, and CUC2) proteins constitute one of the largest families of plant-specific transcription factors. To date, little is known about the NAC genes in the apple (Malus domestica). In this study, a total of 180 NAC genes were identified in the apple genome and were phylogenetically clustered into six groups (I-VI) with the NAC genes from Arabidopsis and rice. The predicted apple NAC genes were distributed across all of 17 chromosomes at various densities. Additionally, the gene structure and motif compositions of the apple NAC genes were analyzed. Moreover, the expression of 29 selected apple NAC genes was analyzed in different tissues and under different abiotic stress conditions. All of the selected genes, with the exception of four genes, were expressed in at least one of the tissues tested, which indicates that the NAC genes are involved in various aspects of the physiological and developmental processes of the apple. Encouragingly, 17 of the selected genes were found to respond to one or more of the abiotic stress treatments, and these 17 genes included not only the expected 7 genes that were clustered with the well-known stress-related marker genes in group IV but also 10 genes located in other subgroups, none of which contains members that have been reported to be stress-related. To the best of our knowledge, this report describes the first genome-wide analysis of the apple NAC gene family, and the results should provide valuable information for understanding the classification and putative functions of this family. Copyright © 2013 Elsevier Masson SAS. All rights reserved.

Respiratory virus laboratory pandemic planning an surveillance in central Viet Nam, 2008-2010

Directory of Open Access Journals (Sweden)

Trinh Xuan Mai

2012-07-01

Full Text Available Introduction: Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1 pandemic in 2009. Polymerase chain reaction (PCR procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken.Methods: Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists.Results: Of 2144 surveillance samples tested, 1235 (57.6% were positive for at least one virus. The most common were influenza A strains (17.9%, with pandemic influenza A(H1N1 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%, enterovirus (8.9%, influenza B (8.3%, adenovirus (5.3%, parainfluenza (4.7%, respiratory syncytial virus (RSV (3.9%, human coronavirus (3.0% and human metapneumovirus (0.3%. The detection rate was greatest in the 0–5 year age group. Viral co-infections were identified in 148 (6.9% cases.Discussion: The outbreak in 2009 of the influenza A(H1N1 pandemic strain provided a practical test of the laboratory’s pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections.

Anti- and pro-lipase activity of selected medicinal, herbal and aquatic plants, and structure elucidation of an anti-lipase compound.

Science.gov (United States)

Ado, Muhammad Abubakar; Abas, Faridah; Mohammed, Abdulkarim Sabo; Ghazali, Hasanah M

2013-11-26

Plants that help in slowing down the digestion of triacylglycerols (TAGs) in the pancreas and small intestine of humans play an important role in the reduction of obesity. On the other hand, there may be plants or plant parts that stimulate intestinal lipolytic activity, thus contributing to greater TAG assimilation. The aim of this study was to evaluate the aqueous methanolic extracts of ninety eight (98) medicinal, herbal and aquatic plant materials from Malaysia for their effect on porcine pancreatic lipase (PPL) activity and to identify the structure of an anti-lipase compound from one of the sources. The degree of inhibition was also quantified as relative to orlistat activity against PPL (orlistat equivalents). Results revealed that while 19.4% of the extracts were found to have anti-lipase activity ≥80%, 12% were actually found to promote PPL activity. Twenty two percent (22.4%) exhibited moderate inhibition (41%-80%) and 2% were neutral toward PPL activity. The ripe fruit of Averrhoa carambola and the leaves of Archidendron jiringa (Jack) I.C Nielsen L. (jering), Cynometra cauliflora (nam-nam) and Aleurites moluccana (L.) Willd (candle nut/buah keras) had the highest (100%) anti-lipase activity and are equivalent to 0.11 µg orlistat/mL. Plants that stimulated lipase activity included Pimpinella anisum L. (aniseed/jintan manis), activating the enzyme by 186.5%. Kaempferol 3-O-rhamnoside was isolated from the ethyl acetate fraction of C. cauliflora leaves and found to be an active lipase inhibitor. The structure was elucidated using 1H-NMR, 13C-NMR and 2D-NMR analyses.

Carbon dioxide emissions from the flat bottom and shallow Nam Theun 2 Reservoir: drawdown area as a neglected pathway to the atmosphere

Science.gov (United States)

Deshmukh, Chandrashekhar; Guérin, Frédéric; Vongkhamsao, Axay; Pighini, Sylvie; Oudone, Phetdala; Sopraseuth, Saysoulinthone; Godon, Arnaud; Rode, Wanidaporn; Guédant, Pierre; Oliva, Priscia; Audry, Stéphane; Zouiten, Cyril; Galy-Lacaux, Corinne; Robain, Henri; Ribolzi, Olivier; Kansal, Arun; Chanudet, Vincent; Descloux, Stéphane; Serça, Dominique

2018-03-01

Freshwater reservoirs are a significant source of CO2 to the atmosphere. CO2 is known to be emitted at the reservoir surface by diffusion at the air-water interface and downstream of dams or powerhouses by degassing and along the river course. In this study, we quantified total CO2 emissions from the Nam Theun 2 Reservoir (Lao PDR) in the Mekong River watershed. The study started in May 2009, less than a year after flooding and just a few months after the maximum level was first reached and lasted until the end of 2013. We tested the hypothesis that soils from the drawdown area would be a significant contributor to the total CO2 emissions.Total inorganic carbon, dissolved and particulate organic carbon and CO2 concentrations were measured in 4 pristine rivers of the Nam Theun watershed, at 9 stations in the reservoir (vertical profiles) and at 16 stations downstream of the monomictic reservoir on a weekly to monthly basis. CO2 bubbling was estimated during five field campaigns between 2009 and 2011 and on a weekly monitoring, covering water depths ranging from 0.4 to 16 m and various types of flooded ecosystems in 2012 and 2013. Three field campaigns in 2010, 2011 and 2013 were dedicated to the soils description in 21 plots and the quantification of soil CO2 emissions from the drawdown area. On this basis, we calculated total CO2 emissions from the reservoir and carbon inputs from the tributaries. We confirm the importance of the flooded stock of organic matter as a source of carbon (C) fuelling emissions. We show that the drawdown area contributes, depending on the year, from 40 to 75 % of total annual gross emissions in this flat and shallow reservoir. Since the CO2 emissions from the drawdown zone are almost constant throughout the years, the large interannual variations result from the significant decrease in diffusive fluxes and downstream emissions between 2010 and 2013. This overlooked pathway in terms of gross emissions would require an in-depth evaluation

Carbon dioxide emissions from the flat bottom and shallow Nam Theun 2 Reservoir: drawdown area as a neglected pathway to the atmosphere

Directory of Open Access Journals (Sweden)

C. Deshmukh

2018-03-01

Full Text Available Freshwater reservoirs are a significant source of CO2 to the atmosphere. CO2 is known to be emitted at the reservoir surface by diffusion at the air–water interface and downstream of dams or powerhouses by degassing and along the river course. In this study, we quantified total CO2 emissions from the Nam Theun 2 Reservoir (Lao PDR in the Mekong River watershed. The study started in May 2009, less than a year after flooding and just a few months after the maximum level was first reached and lasted until the end of 2013. We tested the hypothesis that soils from the drawdown area would be a significant contributor to the total CO2 emissions.Total inorganic carbon, dissolved and particulate organic carbon and CO2 concentrations were measured in 4 pristine rivers of the Nam Theun watershed, at 9 stations in the reservoir (vertical profiles and at 16 stations downstream of the monomictic reservoir on a weekly to monthly basis. CO2 bubbling was estimated during five field campaigns between 2009 and 2011 and on a weekly monitoring, covering water depths ranging from 0.4 to 16 m and various types of flooded ecosystems in 2012 and 2013. Three field campaigns in 2010, 2011 and 2013 were dedicated to the soils description in 21 plots and the quantification of soil CO2 emissions from the drawdown area. On this basis, we calculated total CO2 emissions from the reservoir and carbon inputs from the tributaries. We confirm the importance of the flooded stock of organic matter as a source of carbon (C fuelling emissions. We show that the drawdown area contributes, depending on the year, from 40 to 75 % of total annual gross emissions in this flat and shallow reservoir. Since the CO2 emissions from the drawdown zone are almost constant throughout the years, the large interannual variations result from the significant decrease in diffusive fluxes and downstream emissions between 2010 and 2013. This overlooked pathway in terms of gross emissions would require

Collaborative GIS for flood susceptibility mapping: An example from Mekong river basin of Viet Nam

Science.gov (United States)

Thanh, B.

2016-12-01

Flooding is one of the most dangerous natural disasters in Vietnam. Floods have caused serious damages to people and made adverse impact on social economic development across the country, especially in lower river basin where there is high risk of flooding as consequences of the climate change and social activities. This paper presents a collaborative platform of a combination of an interactive web-GIS framework and a multi-criteria evaluation (MCE) tool. MCE is carried out in server side through web interface, in which parameters used for evaluation are groups into three major categories, including (1) climatic factor: precipitation, typhoon frequency, temperature, humidity (2) physiographic data: DEM, topographic wetness index, NDVI, stream power index, soil texture, distance to river (3) social factor: NDBI, land use pattern. Web-based GIS is based on open-source technology that includes an information page, a page for MCE tool that users can interactively alter parameters in flood susceptible mapping, and a discussion page. The system is designed for local participation in prediction of the flood risk magnitude under impacts of natural processes and human intervention. The proposed flood susceptibility assessment prototype was implemented in the Mekong river basin, Viet Nam. Index images were calculated using Landsat data, and other were collected from authorized agencies. This study shows the potential to combine web-GIS and spatial analysis tool to flood hazard risk assessment. The combination can be a supportive solution that potentially assists the interaction between stakeholders in information exchange and in disaster management, thus provides for better analysis, control and decision-making.

Community-based intervention for depression management at the primary care level in Ha Nam Province, Vietnam: a cluster-randomised controlled trial.

Science.gov (United States)

Niemi, Maria; Kiel, Simone; Allebeck, Peter; Hoan, Le Thi

2016-05-01

To evaluate the effectiveness of an intervention including psychoeducation and yoga for depression management at the primary healthcare level in one district in the Hà Nam province, Vietnam. The Patient Health Questionnaire-9 (PHQ-9) was used for depression screening and follow-up. Screened patients were further diagnosed with the Mini-International Neuropsychiatric Diagnostic Interview, by a trained general doctor. A linear regression model, adjusted for age, gender and baseline PHQ-9 score was used to assess whether the intervention leads to decreased depression severity compared to standard care in the control communes. Both groups had similar PHQ-9 scores at baseline. The intervention group had on average significantly lower PHQ-9 scores after the intervention than the control group. Almost half of the patients in the intervention group recovered from depression, whereas nobody did in the control group. The results indicate that the intervention can be more effective than standard care in treating depression. The mean change of the PHQ-9 score after the intervention is deemed to be of clinical relevance. © 2016 John Wiley & Sons Ltd.

Effect of heat treatment and shelf life on chilling injury of mango cv. Nam Dok Mai

Directory of Open Access Journals (Sweden)

Apiradee Muangdech

2017-10-01

Full Text Available This study was aimed to investigate the effect of heat treatment and shelf life on chilling injury of mango cv.Nam Dok Mai.The heat treatment of mango pulp during storage were determined by hot air oven set at 34 and 38°C for three intervals, as 24, 48, and 72 hours, then they were subsequently stored at 5°C for 10, 20, and 30 days to determine the appropriate shelf life. The findings showed that the symptom of mango fruit after chilling injury appeared within the 30th day of storage at 5°C. Several symptoms of mango fruit after chilling injury treatment were observed, i.e., pitting, browning on the skin, water soaking, and rapid rotting of the fruits that resulted in shorter shelf life. It was found that chilling injury mangoes had lower level of total soluble solid, higher disease incidence, and lower quality of fruit when compared with normal ripe-mango fruits at 25°C. Mango fruits treated at 34°C for either 24 or 48 hours, and at 38°C for 24 hours prior to cold storage at 5°C for 10 and 20 days showed a significant reduction in the chilling injury (CI index when compared to that of non-heated fruits. On the other hand, the heat treatment did not affect fruit weight loss, firmness, color changes, and water soaking at 5°C.

John Cage y su influencia en la obra del video artista Nam June Paik

Directory of Open Access Journals (Sweden)

Sarriugarte Gómez, Íñigo

2009-12-01

Full Text Available In 1958, the Korean artist Nam June Paik (*1932; †2006 meets in Germany John Cage (*1912; †1992, avant-garde musician, who was deeply interested in the Zen Buddhism. The meeting with Cage was vital, because the North American composer will convince him to orient his career towards the artistic avant-garde, giving up his facet like classic pianist. The philosophy of Cage is refl ected in compositions like “4’ 33’’, from 1952, where the spectator doesn’t listen the sound of the piano, because this isn’t played, but he listens a silence that is interrupted by the environmental sound. There are several versions of this piece, marking the silences by means of processes at random with the “I Ching”. In this sense, the silence used by John Cage is related to the vacuity of the Zen Buddhism. Also, Paik makes use of silence in numerous works, like “1963 TV Clock”, where 24 colour television sets are manipulated, feeling at the same time the silence, interrupted again by the own momentary circumstances of the spectator. This same infl uence of the Zen Buddhism in the music of Cage is observed when argues that the music composed of melodies has the same value than the sound understood by us like noises. This aspect, among others, infl uenced to Paik, whose video images are defi ned like attributes of traditional works that don’t impress to the audience, but they suggest variable conditions. Some of his works related to Cage’s philosophy have been “Hommage à John Cage” from 1959; “Study for pianoforte” from 1960; and “Global Grove” from 1973, where Paik uses as a collage the images of his avant-garde collaborators John Cage, Allen Ginsberg and Merce Cunningham.

En 1958, el artista coreano Nam June Paik (*1932; †2006 conoce en Alemania a John Cage (*1912; †1992, músico vanguardista, quien estaba profundamente interesado en el budismo zen. Su encuentro con Cage fue vital, ya que el compositor

Modeling Recognition Memory Using the Similarity Structure of Natural Input

Science.gov (United States)

Lacroix, Joyca P. W.; Murre, Jaap M. J.; Postma, Eric O.; van den Herik, H. Jaap

2006-01-01

The natural input memory (NAM) model is a new model for recognition memory that operates on natural visual input. A biologically informed perceptual preprocessing method takes local samples (eye fixations) from a natural image and translates these into a feature-vector representation. During recognition, the model compares incoming preprocessed…

Combat Maintenance Concepts and Repair Techniques for Helicopter Airframe Structures

Science.gov (United States)

1981-01-01

probably more vulnerable to frontal and top hits than were aircraft operating in Viet Nam . And aircraft in terrain-following and nap-of-the-earth (NÖE...Addition of substantial weight and/or aerodynamic protrusions to the aircraft. 5. Neglect of finishing work ( cosmetic appearance). 6. Restrictions on

Presurgical nasoalveolar molding therapy in cleft lip and palate individuals: Case series and review

Directory of Open Access Journals (Sweden)

Narayan H Gandedkar

2015-01-01

Full Text Available The nasoalveolar molding (NAM therapy is advocated to reduce the severity of alveolar cleft and nasal deformity. NAM therapy has demonstrated to be an effective method for reducing cleft and improve nose anatomy. This paper presents a case report of three cleft lip and palate individuals treated with NAM therapy. Furthermore, the paper highlights the advantages of NAM therapy along with an enumeration of literature suggesting in favor of NAM therapy and otherwise. Regardless of controversies and divergent views involved with NAM therapy, the immediate success of NAM therapy facilitating primary lip repair surgery cannot be under-emphasized.

Estuarine Turbidity Maxima and Variations of Aggregate Parameters in the Cam-Nam Trieu Estuary, North Vietnam, in Early Wet Season

Directory of Open Access Journals (Sweden)

Vu Duy Vinh

2018-01-01

Full Text Available This study aims at exploring the characteristic parameters of the Estuarine Turbidity Maxima (ETM and at investigating their tidal variations within the Cam-Nam Trieu estuary (North Vietnam during the early wet season. Six longitudinal river transects were performed at spring tide. Two types of ETM were observed: an upper well mixed ETM with high Suspended Particulate Matter (SPM concentrations up to the surface at low salinity (0.11 to <1 psu, and a lower ETM confined in a bottom layer over stratified waters at salinities between ~1 psu and 15 psu. Their length depended on the longitudinal salinity gradient and was highest at low tide than at high tide. D50 of the flocs varied between 35 and 90 μm, their excess of density between 60 and 300 kg m−3 and their settling velocity ranged from 0.07 to 0.55 mm s−1 with values between 0.12 and 0.40 mm s−1 in the core of ETMs. The average fractal dimension of flocs was estimated to vary between 1.93 (at high tide to 2.04 (at low tide.

Collision-induced basalt eruptions at Pleiku and Buôn Mê Thuột, south-central Viet Nam

Science.gov (United States)

Hoàng, Nguyễn; Flower, Martin F. J.; Chí, Cung Thu'ọ'ng; Xuân, Phạm Tích; Quý, Hoàng Văn; Sơn, Trần Thanh

2013-09-01

Neogene-Quaternary basalts occur as dispersed volcanic clusters in the vicinity of the Tethyan tectonic belt, possibly representing 'far-field' effects of the Early Tertiary collisions of Gondwana fragments with the southern margin of Eurasia. In Indochina, such a 'Diffuse Igneous Province' post-dates the 45-42 Ma 'hard' India-Asia collision and southeastward, collision induced (c. 30-17 Ma.), extrusion of Indochina. Extrusion was accommodated by left-lateral strike-slip shearing on the Ailao Shan-Red River Fault, coeval with seafloor spreading in the East Viet Nam (South China) Sea. The Indochina basalts mostly comprise shield-building tholeiites capped by small-volume undersaturated types, the latter often bearing mantle xenoliths and 'exotic' xenocrysts such as sapphire, zircon. They appeared at c. 17 Ma, more-or-less coinciding with the cessation of both continental extrusion and seafloor spreading. At this point extensional stress appears to have shifted westwards to continental Indochina, with magmatic activity appearing, characteristically, at 'pull-apart' basins. However, the relationship of mantle melting beneath this region to its geodynamic setting is controversial, being variously attributed to mantle plumes, extreme lithospheric stretching, and lateral asthenospheric displacement. There is little or no definitive evidence for regional mantle upwelling while lithosphere stretching alone appears to be insufficient to allow for melting, Here, we present geochemical and Sr, Nd, and Pb isotopic (and paleomagnetic data), for cored sections from the Pleiku and Buon Mê Thuột plateaus in south-central Viet Nam, representative in most respects of the Indochina province as a whole. In the Pleiku shield olivine tholeiite flows are intercalated with quartz tholeiites while, in contrast, alkali basalts predominate over olivine tholeiite in the Buon Mê Thuột (BMT) shield. The first of these features (in Pleiku) probably reflects crustal wall-rock reaction while

High-resolution OSL chronology of a sediment core from Lake Nam Co on the southern Tibetan Plateau: Comparison with radiocarbon dating

Science.gov (United States)

Long, Hao; Shen, Ji; Haberzettl, Torsten; Fuchs, Markus; Frechen, Manfred; Wang, Junbo

2013-04-01

Numerous studies on lake sediment cores from the Tibetan Plateau aimed to reconstruct spatial and temporal changes of the late Glacial and Holocene monsoon variations, which are characterized by fluctuations in precipitation and expansion of monsoonal air masses across the Plateau. Accurate and reliable dating of lacustrine deposits is of crucial importance in both the reconstruction of palaeolake and palaeoclimate evolution and the understanding of the mechanisms for climate changes, especially abrupt changes of regional-hemispheric hydrological circulation. Radiocarbon dating is the most commonly used method for establishing chronologies of lake sediments. However, 14C dating of such sediments could be problematic due to the lack of organic matter or a reservoir effect, which appears common in radiocarbon dating of lacustrine sediments from the Tibetan Plateau. In this study, ca. 10.5 m long core (NC core) was retrieved from the water depth of 93 m at Nam Co Lake, which is the second largest saline lake in China, located on the southern Tibetan Plateau. For this core, high-resolution samples (23 samples) were obtained for optically stimulated luminescence (OSL) dating. Quartz of fine-grain (4-11 μm) fraction were extracted from this samples for OSL dating, which is compared with the 14C chronology of NC core based on accelerator mass spectrometry (AMS) dating of bulk organic matter of 22 samples. The sample from the top of NC core was dated to approximate zero age, indicating the sediments bleached well before deposition. Luminescence behaviors of the study samples further confirmed the robustness of OSL ages. Comparison between OSL and 14C ages suggested that: (1) two kinds of ages are in agreement within error from top to 1.8 m, (2) from 1.8 m to the base of NC core, the 14C ages show a general trend to ca. 4 ka higher ages than the OSL ages. Although 14C dating overestimate the ages from 1.8 m to base, they still show the general trend in sedimentation rate

Respiratory virus laboratory pandemic planning and surveillance in central Viet Nam, 2008–2010

Science.gov (United States)

Chien, Bui Trong; Papadakis, Georgina; Druce, Julian; Birch, Chris; Chibo, Doris; An, Truong Phuoc; Trang, Le Thi Kim; Trieu, Nguyen Bao; Thuy, Doan Thi Thanh; Catton, Mike; Mai, Trinh Xuan

2012-01-01

Introduction Laboratory capacity is needed in central Viet Nam to provide early warning to public health authorities of respiratory outbreaks of importance to human health, for example the outbreak of influenza A(H1N1) pandemic in 2009. Polymerase chain reaction (PCR) procedures established as part of a capacity-building process were used to conduct prospective respiratory surveillance in a region where few previous studies have been undertaken. Methods Between October 2008 and September 2010, nose and throat swabs from adults and children (approximately 20 per week) presenting with an acute respiratory illness to the Ninh Hoa General Hospital were collected. Same-day PCR testing and result reporting for 13 respiratory viruses were carried out by locally trained scientists. Results Of 2144 surveillance samples tested, 1235 (57.6%) were positive for at least one virus. The most common were influenza A strains (17.9%), with pandemic influenza A(H1N1) 2009 and seasonal H3N2 strain accounting for 52% and 43% of these, respectively. Other virus detections included: rhinovirus (12.4%), enterovirus (8.9%), influenza B (8.3%), adenovirus (5.3%), parainfluenza (4.7%), respiratory syncytial virus (RSV) (3.9%), human coronavirus (3.0%) and human metapneumovirus (0.3%). The detection rate was greatest in the 0–5 year age group. Viral co-infections were identified in 148 (6.9%) cases. Discussion The outbreak in 2009 of the influenza A(H1N1) pandemic strain provided a practical test of the laboratory’s pandemic plan. This study shows that the availability of appropriate equipment and molecular-based testing can contribute to important individual and public health outcomes in geographical locations susceptible to emerging infections. PMID:23908924

Development Of Protocols For Simultaneous Measurements Of Rn, Tn Using Nuclear Track Detectors And Trial Application In Mining Areas Of Vietnam

International Nuclear Information System (INIS)

Bui Dac Dung; Trinh Van Giap; Le Dinh Cuong; Tran Khanh Minh; Nguyen Huu Quyet; Nguyen Van Khanh; Tran Ngoc Toan

2013-01-01

Radioactive gases Radon (Rn) and Thoron (Tn) contribute of more than 50% of natural radiation dose. However, separate measurements of Rn and Tn have not been paid enough attention. An Intergovernmental Cooperation Project was conducted at the Institute for Nuclear Science and Technology with the help from Hungarian experts. The main tasks of the project were to finalize 02 protocols for simultaneous measurements of Rn and Tn using nuclear track detectors and to test these protocols in investigating the concentrations of Rn and Tn, calculating the natural dose due to Rn and Tn, and evaluating the increased radiation dose and radiation safety due to mining activities. Main results of the project include 02 protocols for simultaneous measurements of Rn and Tn and the test results in the mining areas. Rn and Tn concentrations inside the coal mining tunnels are in the average level of Vietnam and the world. Tn concentration inside the factory for separating Zircon at the Ha Tinh Zircon Processing Plant was found to be very high, up to 2931 Bq/m 3 . Based on annual effective dose calculation, workers inside the factory for separating Zircon at the Ha Tinh Zircon Processing Plant could receive an annual effective dose due to Rn and Tn of 4.890 mSv/year, and the increasing dose of 4.710 mSv/year is for higher than 1 mSv/year recommended by the IAEA. (author)

Anti-UV Radiation Textiles Designed by Embracing with Nano-MIL (Ti, In)-Metal Organic Framework.

Science.gov (United States)

Emam, Hossam E; Abdelhameed, Reda M

2017-08-23

Protective textiles against harmful solar radiation are quite important materials for outdoor workers to secure their skin from several diseases. Current report focuses on production of anti-ultraviolet radiation (UVR) textiles by incorporation of nano-metal-organic frameworks (n-MOFs). Two different MIL-MOFs, namely, MIL-68(In)-NH 2 and MIL-125(Ti)-NH 2 , were immediately formed inside natural textiles (cotton and silk) matrix in nano size using quite simple and one-pot process. The formation of n-MIL-MOFs inside textiles were confirmed by using electron microscope and X-ray diffraction. Different size and morphology were seen depending on textile type reflecting the textiles' chemical composition role in the nature of prepared MIL-MOFs. For MIL-68(In)-NH 2 , particles with size distribution of 70.6-44.5 nm in cotton and 81.3-52.2 nm in silk were detected, while crystalline disc of MIL-125(Ti)-NH 2 was clearly seen inside textiles. The natural textiles exhibited full UVR blocking after modification, and the UV protection factor (UPF) was linearly proportional with MIL-MOFs and metal contents. Whatever metal type, direct incorporation of MIL-MOF contents greater than or equal to 10.4 g/kg was sufficient to attain excellent UV blocking property. Although 38.5-41.0% of MIL-MOFs was lost during five washings, the washed samples showed very good blocking rate (UPF = 26.7-36.2) supporting good laundering durability.

Influence of nasoalveolar molding on skeletal development in patients with unilateral cleft lip and palate at 5 years of age.

Science.gov (United States)

Akarsu-Guven, Bengisu; Arisan, Arda; Ozgur, Figen; Aksu, Muge

2018-04-01

The aim of this retrospective study was to assess the influence of presurgical nasoalveolar molding (NAM) on skeletal development in patients with operated unilateral cleft lip and palate at 5 years of age. Lateral cephalometric radiographs of 26 unilateral cleft lip and palate patients who had undergone presurgical NAM (NAM group) and 20 unilateral cleft lip and palate patients who did not have any presurgical NAM (non-NAM group) were analyzed. The radiographs were digitally traced using Quick Ceph Studio software (version 3.5.1.r (1151); Quick Ceph Systems, San Diego, Calif). Independent samples t tests were performed for statistical analysis. No significant differences were observed in sagittal and vertical skeletal measurements between the NAM and non-NAM groups. NAM resulted in no significant difference in skeletal development in unilateral cleft lip and palate patients compared with those without NAM in early childhood. Copyright © 2018. Published by Elsevier Inc.

Nicotinamide Improves Aspects of Healthspan, but Not Lifespan, in Mice.

Science.gov (United States)

Mitchell, Sarah J; Bernier, Michel; Aon, Miguel A; Cortassa, Sonia; Kim, Eun Young; Fang, Evandro F; Palacios, Hector H; Ali, Ahmed; Navas-Enamorado, Ignacio; Di Francesco, Andrea; Kaiser, Tamzin A; Waltz, Tyler B; Zhang, Ning; Ellis, James L; Elliott, Peter J; Frederick, David W; Bohr, Vilhelm A; Schmidt, Mark S; Brenner, Charles; Sinclair, David A; Sauve, Anthony A; Baur, Joseph A; de Cabo, Rafael

2018-03-06

The role in longevity and healthspan of nicotinamide (NAM), the physiological precursor of NAD + , is elusive. Here, we report that chronic NAM supplementation improves healthspan measures in mice without extending lifespan. Untargeted metabolite profiling of the liver and metabolic flux analysis of liver-derived cells revealed NAM-mediated improvement in glucose homeostasis in mice on a high-fat diet (HFD) that was associated with reduced hepatic steatosis and inflammation concomitant with increased glycogen deposition and flux through the pentose phosphate and glycolytic pathways. Targeted NAD metabolome analysis in liver revealed depressed expression of NAM salvage in NAM-treated mice, an effect counteracted by higher expression of de novo NAD biosynthetic enzymes. Although neither hepatic NAD + nor NADP + was boosted by NAM, acetylation of some SIRT1 targets was enhanced by NAM supplementation in a diet- and NAM dose-dependent manner. Collectively, our results show health improvement in NAM-supplemented HFD-fed mice in the absence of survival effects. Published by Elsevier Inc.

Anti- and Pro-Lipase Activity of Selected Medicinal, Herbal and Aquatic Plants, and Structure Elucidation of an Anti-Lipase Compound

Directory of Open Access Journals (Sweden)

Muhammad Abubakar Ado

2013-11-01

Full Text Available Plants that help in slowing down the digestion of triacylglycerols (TAGs in the pancreas and small intestine of humans play an important role in the reduction of obesity. On the other hand, there may be plants or plant parts that stimulate intestinal lipolytic activity, thus contributing to greater TAG assimilation. The aim of this study was to evaluate the aqueous methanolic extracts of ninety eight (98 medicinal, herbal and aquatic plant materials from Malaysia for their effect on porcine pancreatic lipase (PPL activity and to identify the structure of an anti-lipase compound from one of the sources. The degree of inhibition was also quantified as relative to orlistat activity against PPL (orlistat equivalents. Results revealed that while 19.4% of the extracts were found to have anti-lipase activity ≥80%, 12% were actually found to promote PPL activity. Twenty two percent (22.4% exhibited moderate inhibition (41%–80% and 2% were neutral toward PPL activity. The ripe fruit of Averrhoa carambola and the leaves of Archidendron jiringa (Jack I.C Nielsen L. (jering, Cynometra cauliflora (nam-nam and Aleurites moluccana (L. Willd (candle nut/buah keras had the highest (100% anti-lipase activity and are equivalent to 0.11 µg orlistat/mL. Plants that stimulated lipase activity included Pimpinella anisum L. (aniseed/jintan manis, activating the enzyme by 186.5%. Kaempferol 3-O-rhamnoside was isolated from the ethyl acetate fraction of C. cauliflora leaves and found to be an active lipase inhibitor. The structure was elucidated using 1H-NMR, 13C-NMR and 2D-NMR analyses.

The Innovative Structure Solution for Preventing Salt Intrusion and Retaining Freshwater In Mekong Delta VietNam

NARCIS (Netherlands)

Hong, S.T.; Vrijling, J.K.; Stive, M.J.F.

2013-01-01

In the Mekong Delta Vietnam, the construction of sluices with the purpose of retaining fresh water and preventing salt water intrusion potentially plays a very important role. However, the structures constructed in small rivers according to local or traditional technology revealed many disadvantages

Correlation analysis between forest carbon stock and spectral vegetation indices in Xuan Lien Nature Reserve, Thanh Hoa, Viet Nam

Science.gov (United States)

Dung Nguyen, The; Kappas, Martin

2017-04-01

In the last several years, the interest in forest biomass and carbon stock estimation has increased due to its importance for forest management, modelling carbon cycle, and other ecosystem services. However, no estimates of biomass and carbon stocks of deferent forest cover types exist throughout in the Xuan Lien Nature Reserve, Thanh Hoa, Viet Nam. This study investigates the relationship between above ground carbon stock and different vegetation indices and to identify the most likely vegetation index that best correlate with forest carbon stock. The terrestrial inventory data come from 380 sample plots that were randomly sampled. Individual tree parameters such as DBH and tree height were collected to calculate the above ground volume, biomass and carbon for different forest types. The SPOT6 2013 satellite data was used in the study to obtain five vegetation indices NDVI, RDVI, MSR, RVI, and EVI. The relationships between the forest carbon stock and vegetation indices were investigated using a multiple linear regression analysis. R-square, RMSE values and cross-validation were used to measure the strength and validate the performance of the models. The methodology presented here demonstrates the possibility of estimating forest volume, biomass and carbon stock. It can also be further improved by addressing more spectral bands data and/or elevation.

Contribution to Taxonomy and Distribution of the Genus Elaphropoda (Hymenoptera: Apidae: Apinae in Vietnam

Directory of Open Access Journals (Sweden)

Nguyen, Minh Phuong

2016-04-01

Full Text Available Taxonomic notes on the genus Elaphropoda Lieftinck, 1966 (Hymenoptera: Apidae from Vietnam are presented. Two species of the genus are reported: Elaphropoda percarinata (Cockerell, 1930 was first recorded from Vietnam based on specimens collected from Ha Tinh province in 1998, and is reconfirmed with a specimens collected from Bac Kan province in the Northeastern part of the country in this study, and Elaphropoda khasiana (Schulz, 1906 is recorded from Vietnam for the first time. Redescriptions of the male of E. percarinata and the female of E. khasiana are given with illustrations.

Primary drug-resistant tuberculosis in Hanoi, Viet Nam: present status and risk factors.

Directory of Open Access Journals (Sweden)

Nguyen Thi Le Hang

Full Text Available INTRODUCTION: Resistance of Mycobacterium tuberculosis (MTB to anti-tuberculosis (TB drugs presents a serious challenge to TB control worldwide. We investigated the status of drug resistance, including multidrug-resistant (MDR TB, and possible risk factors among newly diagnosed TB patients in Hanoi, the capital of Viet Nam. METHODS: Clinical and epidemiological information was collected from 506 newly diagnosed patients with sputum smear- and culture-positive TB, and 489 (96.6% MTB isolates were subjected to conventional drug susceptibility testing, spoligotyping, and 15-locus variable numbers of tandem repeats typing. Adjusted odds ratios (aORs were calculated to analyze the risk factors for primary drug resistance. RESULTS: Of 489 isolates, 298 (60.9% were sensitive to all drugs tested. Resistance to isoniazid, rifampicin, streptomycin, ethambutol, and MDR accounted for 28.2%, 4.9%, 28.2%, 2.9%, and 4.5%, respectively. Of 24 isolates with rifampicin resistance, 22 (91.7% were MDR and also resistant to streptomycin, except one case. Factors associated with isoniazid resistance included living in old urban areas, presence of the Beijing genotype, and clustered strains [aOR = 2.23, 95% confidence interval (CI 1.15-4.35; 1.91, 1.18-3.10; and 1.69, 1.06-2.69, respectively. The Beijing genotype was also associated with streptomycin resistance (aOR = 2.10, 95% CI 1.29-3.40. Human immunodeficiency virus (HIV coinfection was associated with rifampicin resistance and MDR (aOR = 5.42, 95% CI 2.07-14.14; 6.23, 2.34-16.58, respectively. CONCLUSION: Isoniazid and streptomycin resistance was observed in more than a quarter of TB patients without treatment history in Hanoi. Transmission of isoniazid-resistant TB among younger people should be carefully monitored in urban areas, where Beijing strains and HIV coinfection are prevalent. Choosing an optimal treatment regimen on the basis of the results of drug susceptibility tests and monitoring of treatment

Effects of the family schizophrenia psychoeducation program for individuals with recent onset schizophrenia in Viet Nam.

Science.gov (United States)

Ngoc, T N; Weiss, B; Trung, L T

2016-08-01

Although psychoeducation has been found effective for improving the life functioning of patients with schizophrenia in high income countries, there have been relatively few studies of schizophrenia psychoeducation adapted for low and middle-income countries (LMIC), particularly in Southeast Asia. The present study assessed effects of the Family Schizophrenia Psychoeducation Program (FSPP) among Vietnamese patients and their families on the patients' (1) quality of life and (2) medication non-compliance, and the family and patients' (3) stigma towards schizophrenia, and (4) consumer satisfaction. This intervention study involved 59 patients, and their families, from the Da Nang Psychiatric Hospital, randomly assigned to treatment (n=30) or control (n=29) conditions. Control subjects received services as usual (antipsychotic medication); treatment group subjects received the FSPP as well. Blind-rater assessments were conducted at T1 immediately after project enrollment (prior to participating in the FSPP) and at T2 six months later. There were significant treatment effects on: (1) quality of life, (2) stigma, (3) medication compliance, and (4) consumer satisfaction, with all effects favoring the treatment group. Effect sizes were moderate to large. This psychoeducation program appears to reduce stigma, improve quality of life and medication compliance, and increase consumer satisfaction of Vietnamese patients with schizophrenia and their families, beyond the effects of antipsychotic medication. It involves relatively little cost, and it may be useful for it or equivalent programs to be implemented in other hospitals in Viet Nam, and potentially other low-income Asian countries to improve the lives of patients with schizophrenia. Copyright © 2016 Elsevier B.V. All rights reserved.

Factors Influencing Blood Cadmium and Mercury Concentrations in Residents of Agro-Industries along Nam Phong River, Thailand

Directory of Open Access Journals (Sweden)

Wannanapa Srathonghon

2016-07-01

Full Text Available This cross-sectional analytical study aimed to determine the blood levels of cadmium (B-Cd and mercury (B-Hg and identify the factors influencing heavy metal accumulation in residents of Agro-Industries along the Nam Phong River. Quantitative data were collected, and systematic random sampling was used to obtain 420 samples for questionnaire interview and serum heavy metal testing for B-Cd and B-Hg. Multiple regression analysis was used to identify factors influencing the accumulation of heavy metals in the population and report mean differences, 95% confidence intervals and p-values. The results indicated that B-Cd levels were within the recommended safety limits for human health (5 µg/dL. However, 4.29% of respondents had Hg levels higher than the recommended safety limits for human health (10 µg/dL. Factors influencing Cd levels included sex (mean difference=0.13 µg/L, 95% CI: 0.03-0.24, p-value=0.02 and smoking (mean difference=0.14 µg/L, 95% CI: 0.09-0.19, p-value<0.001. Factors influencing Hg levels included smoking (mean difference=1.06 µg/L, 95% CI: 0.52-1.61, p-value<0.001, fish consumption (mean difference=1.11 µg/L, 95% CI: 0.22-2.01, p-value=0.01 and river snail consumption (mean difference=0.56 µg/L, 95% CI: 0.03-0.19, p-value=0.03.

Assessing error sources for Landsat time series analysis for tropical test sites in Viet Nam and Ethiopia

Science.gov (United States)

Schultz, Michael; Verbesselt, Jan; Herold, Martin; Avitabile, Valerio

2013-10-01

Researchers who use remotely sensed data can spend half of their total effort analysing prior data. If this data preprocessing does not match the application, this time spent on data analysis can increase considerably and can lead to inaccuracies. Despite the existence of a number of methods for pre-processing Landsat time series, each method has shortcomings, particularly for mapping forest changes under varying illumination, data availability and atmospheric conditions. Based on the requirements of mapping forest changes as defined by the United Nations (UN) Reducing Emissions from Forest Degradation and Deforestation (REDD) program, the accurate reporting of the spatio-temporal properties of these changes is necessary. We compared the impact of three fundamentally different radiometric preprocessing techniques Moderate Resolution Atmospheric TRANsmission (MODTRAN), Second Simulation of a Satellite Signal in the Solar Spectrum (6S) and simple Dark Object Subtraction (DOS) on mapping forest changes using Landsat time series data. A modification of Breaks For Additive Season and Trend (BFAST) monitor was used to jointly map the spatial and temporal agreement of forest changes at test sites in Ethiopia and Viet Nam. The suitability of the pre-processing methods for the occurring forest change drivers was assessed using recently captured Ground Truth and high resolution data (1000 points). A method for creating robust generic forest maps used for the sampling design is presented. An assessment of error sources has been performed identifying haze as a major source for time series analysis commission error.

The Impact of Para Rubber Expansion on Streamflow and Other Water Balance Components of the Nam Loei River Basin, Thailand

Directory of Open Access Journals (Sweden)

Winai Wangpimool

2016-12-01

Full Text Available At present, Para rubber is an economical crop which provides a high priced product and is in demand by global markets. Consequently, the government of Thailand is promoting the expansion of Para rubber plantations throughout the country. Traditionally, Para rubber was planted and grown only in the southern areas of the country. However, due to the Government’s support and promotion as well as economic reasons, the expansion of Para rubber plantations in the northeast has increased rapidly. This support has occurred without accounting for suitable cultivation of Para rubber conditions, particularly in areas with steep slopes and other factors which have significant impacts on hydrology and water quality. This study presents the impacts of Para rubber expansion by applying the Soil and Water Assessment Tool (SWAT hydrological model on the hydrology and water balance of the Nam Loei River Basin, Loei Province. The results showed that the displacement of original local field crops and disturbed forest land by Para rubber production resulted in an overall increase of evapotranspiration (ET of roughly 3%. The major factors are the rubber canopy and precipitation. Moreover, the water balance results showed an annual reduction of about 3% in the basin average water yield, especially during the dry season.

Effect of land use change on water discharge in Srepok watershed, Central Highland, Viet Nam

Directory of Open Access Journals (Sweden)

Nguyen Thi Ngoc Quyen

2014-09-01

Full Text Available Srepok watershed plays an important role in Central Highland in Viet Nam. It impacts to developing social-economic conditions. Therefore, it is necessary to research elements which impact to natural resources in this watershed. The Soil and Water Assessment Tool (SWAT model and Geography Information System (GIS were used to simulate water discharge in the Srepok watershed. The objectives of the research were to apply GIS and SWAT model for simulation water discharge and then, we assessed land use change which impacted on water discharge in the watershed. The observed stream flow data from Ban Don Stream gauge station was used to calibrate for the period from 1981 to 2000 and then validate for the period from 2001 to 2009. After using SWAT-CUP software to calibration, NSI reached 0.63 and R square value achieved 0.64 from 2004 to 2008 in calibration and NSI gained good level at 0.74 and R square got 0.75 from 2009 to 2012 in validation step at Ban Don Station. After that, land cover in 2010 was processed like land cover in 2000 and set up SWAT model again. The simulated water discharge in scenario 1 (land use 2000 was compared with scenario 2 (land use 2010, the simulation result was not significant difference between two scenarios because the change of area of land use was not much enough to affect the fluctuation of water discharge. However, the effect of land cover on water resource could be seen clearly via total water yield. The percentage of surface flow in 2000 was twice times more than in 2010; retard and base flow in 2000 was slightly more than in 2010. Therefore, decreased surface flow, increased infiltration capacity of water and enriched base flow resulted in the growth of land cover.

Dysplastic vs. Common Naevus-associated vs. De novo Melanomas: An Observational Retrospective Study of 1,021 Patients

Directory of Open Access Journals (Sweden)

Alejandro Martin-Gorgojo

2018-03-01

Full Text Available The aim of this case-case study was to determine the differences between dysplastic and common naevus-associated melanomas (NAM and de novo melanomas. A total of 1,021 prospectively collected patients with invasive cutaneous melanoma from an oncology referral centre were included in the study. Of these, 75.51% had de novo melanomas, 12.93% dysplastic NAM, and 11.56% common NAM. Dysplastic NAM, compared with de novo melanomas, were associated with intermittently photo-exposed sites, atypical melanocytic naevi, decreased tumour thickness, and presence of MC1R non-synonymous variants. Common NAM were more frequent on the trunk and of superficial spreading type. Comparison of dysplastic with common NAM showed significant difference only with regard to mitoses. Both subtypes of NAM shared less aggressive traits than de novo melanomas, albeit with no significant differences in survival after multivariate adjustment. In conclusion, NAM present with less aggressive traits, mostly due to a greater awareness among patients of changing moles than due to their intrinsic biological characteristics.

Nicotinamide Promotes Adipogenesis in Umbilical Cord-Derived Mesenchymal Stem Cells and Is Associated with Neonatal Adiposity: The Healthy Start BabyBUMP Project.

Directory of Open Access Journals (Sweden)

Allison L B Shapiro

Full Text Available The cellular mechanisms whereby excess maternal nutrition during pregnancy increases adiposity of the offspring are not well understood. However, nicotinamide (NAM, a fundamental micronutrient that is important in energy metabolism, has been shown to regulate adipogenesis through inhibition of SIRT1. Here we tested three novel hypotheses: 1 NAM increases the adipogenic response of human umbilical cord tissue-derived mesenchymal stem cells (MSCs through a SIRT1 and PPARγ pathway; 2 lipid potentiates the NAM-enhanced adipogenic response; and 3 the adipogenic response to NAM is associated with increased percent fat mass (%FM among neonates. MSCs were derived from the umbilical cord of 46 neonates born to non-obese mothers enrolled in the Healthy Start study. Neonatal %FM was measured using air displacement plethysmography (Pea Pod shortly after birth. Adipogenic differentiation was induced for 21 days in the 46 MSC sets under four conditions, +NAM (3mM/-lipid (200 μM oleate/palmitate mix, +NAM/+lipid, -NAM/+lipid, and vehicle-control (-NAM/-lipid. Cells incubated in the presence of NAM had significantly higher PPARγ protein (+24%, p <0.01, FABP4 protein (+57%, p <0.01, and intracellular lipid content (+51%, p <0.01. Lipid did not significantly increase either PPARγ protein (p = 0.98 or FABP4 protein content (p = 0.82. There was no evidence of an interaction between NAM and lipid on adipogenic response of PPARγ or FABP4 protein (p = 0.99 and p = 0.09. In a subset of 9 MSC, SIRT1 activity was measured in the +NAM/-lipid and vehicle control conditions. SIRT1 enzymatic activity was significantly lower (-70%, p <0.05 in the +NAM/-lipid condition than in vehicle-control. In a linear model with neonatal %FM as the outcome, the percent increase in PPARγ protein in the +NAM/-lipid condition compared to vehicle-control was a significant predictor (β = 0.04, 95% CI 0.01-0.06, p <0.001. These are the first data to support that chronic NAM exposure

Numerical and Experimental Investigation of the Electromechanical Behavior of REBCO Tapes

Science.gov (United States)

Allen, N. C.; Chiesa, L.; Takayasu, M.

2015-12-01

To fully characterize the electromechanical behavior of a Twisted Stacked-Tape Cable (TSTC) it is important to understand the performance of the individual REBCO tapes under various loading conditions. Numerical modeling and experimentation have been used to investigate the electromechanical characteristics of two commercially available REBCO tapes (SuperPower and SuNAM). Tension and combined tension-torsion experiments on single tapes have been continued, from prior preliminary studies, to characterize their critical current behavior and mechanical strength. Additionally, structural finite element analysis was performed on single tapes under tension and combined tension-torsion to investigate the strain dependence of the critical current. The numerical results were compared to the experimental findings for validation. The SuNAM experimental data matched the numerical model very well while the SuperPower tape experienced degradation at lower stress and strain than predicted in the model. The Superpower tape also displayed greater variability in critical current between different samples as compared with the SuNAM tape.

Genetic Vulnerability and the Relationship of Commercial Germplasms of Maize in Brazil with the Nested Association Mapping Parents.

Directory of Open Access Journals (Sweden)

Luciano Rogério Braatz de Andrade

Full Text Available A few breeding companies dominate the maize (Zea mays L. hybrid market in Brazil: Monsanto® (35%, DuPont Pioneer® (30%, Dow Agrosciences® (15%, Syngenta® (10% and Helix Sementes (4%. Therefore, it is important to monitor the genetic diversity in commercial germplasms as breeding practices, registration and marketing of new cultivars can lead to a significant reduction of the genetic diversity. Reduced genetic variation may lead to crop vulnerabilities, food insecurity and limited genetic gains following selection. The aim of this study was to evaluate the genetic vulnerability risk by examining the relationship between the commercial Brazilian maize germplasms and the Nested Association Mapping (NAM Parents. For this purpose, we used the commercial hybrids with the largest market share in Brazil and the NAM parents. The hybrids were genotyped for 768 single nucleotide polymorphisms (SNPs, using the Illumina Goldengate® platform. The NAM parent genomic data, comprising 1,536 SNPs for each line, were obtained from the Panzea data bank. The population structure, genetic diversity and the correlation between allele frequencies were analyzed. Based on the estimated effective population size and genetic variability, it was found that there is a low risk of genetic vulnerability in the commercial Brazilian maize germplasms. However, the genetic diversity is lower than those found in the NAM parents. Furthermore, the Brazilian germplasms presented no close relations with most NAM parents, except B73. This indicates that B73, or its heterotic group (Iowa Stiff Stalk Synthetic, contributed to the development of the commercial Brazilian germplasms.

Genetic Vulnerability and the Relationship of Commercial Germplasms of Maize in Brazil with the Nested Association Mapping Parents.

Science.gov (United States)

Andrade, Luciano Rogério Braatz de; Fritsche Neto, Roberto; Granato, Ítalo Stefanine Correia; Sant'Ana, Gustavo César; Morais, Pedro Patric Pinho; Borém, Aluízio

2016-01-01

A few breeding companies dominate the maize (Zea mays L.) hybrid market in Brazil: Monsanto® (35%), DuPont Pioneer® (30%), Dow Agrosciences® (15%), Syngenta® (10%) and Helix Sementes (4%). Therefore, it is important to monitor the genetic diversity in commercial germplasms as breeding practices, registration and marketing of new cultivars can lead to a significant reduction of the genetic diversity. Reduced genetic variation may lead to crop vulnerabilities, food insecurity and limited genetic gains following selection. The aim of this study was to evaluate the genetic vulnerability risk by examining the relationship between the commercial Brazilian maize germplasms and the Nested Association Mapping (NAM) Parents. For this purpose, we used the commercial hybrids with the largest market share in Brazil and the NAM parents. The hybrids were genotyped for 768 single nucleotide polymorphisms (SNPs), using the Illumina Goldengate® platform. The NAM parent genomic data, comprising 1,536 SNPs for each line, were obtained from the Panzea data bank. The population structure, genetic diversity and the correlation between allele frequencies were analyzed. Based on the estimated effective population size and genetic variability, it was found that there is a low risk of genetic vulnerability in the commercial Brazilian maize germplasms. However, the genetic diversity is lower than those found in the NAM parents. Furthermore, the Brazilian germplasms presented no close relations with most NAM parents, except B73. This indicates that B73, or its heterotic group (Iowa Stiff Stalk Synthetic), contributed to the development of the commercial Brazilian germplasms.

Genetic Vulnerability and the Relationship of Commercial Germplasms of Maize in Brazil with the Nested Association Mapping Parents

Science.gov (United States)

Fritsche Neto, Roberto; Granato, Ítalo Stefanine Correia; Sant’Ana, Gustavo César; Morais, Pedro Patric Pinho; Borém, Aluízio

2016-01-01

A few breeding companies dominate the maize (Zea mays L.) hybrid market in Brazil: Monsanto® (35%), DuPont Pioneer® (30%), Dow Agrosciences® (15%), Syngenta® (10%) and Helix Sementes (4%). Therefore, it is important to monitor the genetic diversity in commercial germplasms as breeding practices, registration and marketing of new cultivars can lead to a significant reduction of the genetic diversity. Reduced genetic variation may lead to crop vulnerabilities, food insecurity and limited genetic gains following selection. The aim of this study was to evaluate the genetic vulnerability risk by examining the relationship between the commercial Brazilian maize germplasms and the Nested Association Mapping (NAM) Parents. For this purpose, we used the commercial hybrids with the largest market share in Brazil and the NAM parents. The hybrids were genotyped for 768 single nucleotide polymorphisms (SNPs), using the Illumina Goldengate® platform. The NAM parent genomic data, comprising 1,536 SNPs for each line, were obtained from the Panzea data bank. The population structure, genetic diversity and the correlation between allele frequencies were analyzed. Based on the estimated effective population size and genetic variability, it was found that there is a low risk of genetic vulnerability in the commercial Brazilian maize germplasms. However, the genetic diversity is lower than those found in the NAM parents. Furthermore, the Brazilian germplasms presented no close relations with most NAM parents, except B73. This indicates that B73, or its heterotic group (Iowa Stiff Stalk Synthetic), contributed to the development of the commercial Brazilian germplasms. PMID:27780247

Evaluación de la corrosión de una aleación Pb-Ca-Sn por medio de técnicas electroquímicas

Directory of Open Access Journals (Sweden)

Hugo A. Estupiñán Duran

2014-06-01

Full Text Available In this paper, the influence of increasing temperature on the corrosion rate of Pb-Ca-Sn alloy, the primary component of the negative grid of a starter battery car, was evaluated by electrochemical techniques: RPL, potentiodynamic curves, Tafel and EIS. By optical microscopy, SEM -EDS and XRD, the compounds formed on the grids were characterized during testing. The passive layer formed on the grids used as cathode and anode in lead-acid batteries allows the anchor in grid-PAM interface (Positive Active Material or NAM (Negative Active Material. A bad process of to form this layer produces the detachment of PAM/NAM, leading to premature failure. The temperature directly affects the kinetics and thermodynamics degradation of the redox reactions taking place in the system grid-PAM/NAM. An increase in temperature causes variations in the chemical composition, favoring the formation of oxides and sulphates mixtures in grid-PAM/NAM interface, its volume and porous structure make it susceptible to failure by tri-axial stress on the interface, producing cracks and detachment of PAM or NAM and reducing the lifetime of the battery. It was found that the Pb-Ca-Sn alloys in 0.5M H2SO4 solution form a multilayer system, verified by the results of EIS and SEM, in which a compact layer of PbO2 and porous layer by PbSO4. Porous layer of PbSO4 was obtained, when the temperature was increased implying greater corrosion kinetics of Pb-Ca-Sn alloy were detected.

The harmony of family and the silence of women: sexual attitudes and practices among rural married women in northern Viet Nam.

Science.gov (United States)

Ha, Vu Song

2008-06-01

Women in Viet Nam have long had to face various sexual and reproductive health problems, ranging from abortion to reproductive tract infections (RTIs) and sexual coercion. These issues have increasingly been addressed by scholars in the fields of public health and social sciences through sexual and reproductive health research and in other ways. Despite this, there remains a lack of in-depth information on attitudes and practices regarding sex and sexuality of Vietnamese women today. This paper in part responds to the knowledge gap by reporting on findings from qualitative research on sexual attitudes and practices among rural married women in a Northern rural community, measured against the broader social and cultural context. Twenty-five women in total were interviewed; and two focus group discussions were conducted. The findings show that women generally believe that men are (or should be) the initiators in sexual relations. Many women feel reluctant to refuse sex to their husbands or communicate openly about sex and sexuality. However, this paper also demonstrates that women are not totally passive in sexual relations. Women in this study used a range of strategies to negotiate their sexual life, and sometimes 'silence' is used as a form of agency in order to maintain harmony and happiness within the family.

Risk factors for the presence of Aedes aegypti and Aedes albopictus in domestic water-holding containers in areas impacted by the Nam Theun 2 hydroelectric project, Laos.

Science.gov (United States)

Hiscox, Alexandra; Kaye, Angela; Vongphayloth, Khamsing; Banks, Ian; Piffer, Michele; Khammanithong, Phasouk; Sananikhom, Pany; Kaul, Surinder; Hill, Nigel; Lindsay, Steven W; Brey, Paul T

2013-06-01

We assessed risk factors for vectors of dengue and chikungunya viruses near a new hydroelectric project, Nam Theun 2, in Laos. Immature stages of Aedes aegypti were found only in sites within 40 km of the urban provincial capital, but Aedes albopictus was found throughout. Aedes aegypti pupae were most common in water storage jars (odds ratio [OR] = 4.72) and tires (OR = 2.99), and Ae. albopictus pupae were associated with tires in 2009 (OR = 10.87) and drums, tires, and jars in 2010 (drums OR = 3.05; tires OR = 3.45, jars OR = 6.59). Compared with water storage vessels, containers used for hygiene, cooking, and drinking were 80% less likely to harbor Ae. albopictus pupae in 2010 (OR = 0.20), and discarded waste was associated with a 3.64 increased odds of infestation. Vector control efforts should focus on source reduction of water storage containers, particularly concrete jars and tires.

Initial Detection and Molecular Characterization of Namaycush Herpesvirus (Salmonid Herpesvirus 5) in Lake Trout.

Science.gov (United States)

Glenney, Gavin W; Barbash, Patricia A; Coll, John A

2016-03-01

A novel herpesvirus was found by molecular methods in samples of Lake Trout Salvelinus namaycush from Lake Erie, Pennsylvania, and Lake Ontario, Keuka Lake, and Lake Otsego, New York. Based on PCR amplification and partial sequencing of polymerase, terminase, and glycoprotein genes, a number of isolates were identified as a novel virus, which we have named Namaycush herpesvirus (NamHV) salmonid herpesvirus 5 (SalHV5). Phylogenetic analyses of three NamHV genes indicated strong clustering with other members of the genus Salmonivirus, placing these isolates into family Alloherpesviridae. The NamHV isolates were identical in the three partially sequenced genes; however, they varied from other salmonid herpesviruses in nucleotide sequence identity. In all three of the genes sequenced, NamHV shared the highest sequence identity with Atlantic Salmon papillomatosis virus (ASPV; SalHV4) isolated from Atlantic Salmon Salmo salar in northern Europe, including northwestern Russia. These results lead one to believe that NamHV and ASPV have a common ancestor that may have made a relatively recent host jump from Atlantic Salmon to Lake Trout or vice versa. Partial nucleotide sequence comparisons between NamHV and ASPV for the polymerase and glycoprotein genes differ by >5% and >10%, respectively. Additional nucleotide sequence comparisons between NamHV and epizootic epitheliotropic disease virus (EEDV/SalHV3) in the terminase, glycoprotein, and polymerase genes differ by >5%, >20%, and >10%, respectively. Thus, NamHV and EEDV may be occupying discrete ecological niches in Lake Trout. Even though NamHV shared the highest genetic identity with ASPV, each of these viruses has a separate host species, which also implies speciation. Additionally, NamHV has been detected over the last 4 years in four separate water bodies across two states, which suggests that NamHV is a distinct, naturally replicating lineage. This, in combination with a divergence in nucleotide sequence from EEDV

STRES NA DELOVNEM MESTU V TRGOVSKI ORGANIZACIJI X

OpenAIRE

Kureš, Anita

2012-01-01

Stres je tegoba sedanjega časa. Zmeraj več ljudi trpi za posledicami stresa na delovnem mestu, saj nam delo povzroča preveliko odgovornost, njemu tudi namenimo večino svojega časa, kar nam posledično zmanjšuje čas za sprostitev. Tako nam primanjkuje časa za zabavo, druženje s prijatelji, sprehode v naravi, telesno aktivnost in druge možnosti za sprostitev. Življenje nam prinaša nenehno nove izzive in obremenitve, pritiske, bojazni, ki sčasoma kopičijo stres v našem telesu. Vse to se nam odraž...

Physiological changes in pre-harvest dropped fruits in the pummelo cultivars ‘Thong Dee’ and ‘Khao Nam Phueng’

Directory of Open Access Journals (Sweden)

Pongnart Nartvaranant

2012-09-01

Full Text Available This investigation of physiological changes in pummelo pre-harvest dropped fruit, termed “yellow fruit calyx symptoms” in Thailand, aimed to examine in two particular cultivars Thong Dee and Khao Nam Phueng grown in the central regionof Thailand. The results show that the normal pummelo fruits of either variety had statistically more total non-structuralcarbohydrate (TNC in their peel and pulp than did those of the dropped fruits. On the other hand, the leaves of normal fruittrees of both cultivars show less TNC than those found in the leaves of pre-harvest dropped fruit trees. There were significantdifferences in some plant nutrients in the leaves, peel and pulp of the dropped and normal pummelo cultivars. IAA concentration in fruit was determined with the result that normal fruits had a statistically higher IAA concentration than did those inpre-harvest dropped fruits. The PCR technique used for the greening disease test identified infections in leaves taken fromthe pre-harvest dropped fruit trees but none in leaves from the normal fruit trees. There were no differences in soil chemicalproperties between soil samples taken from the normal and pre-harvest dropped fruit trees. It seems likely that greeningdisease is the cause of ‘yellow fruit calyx symptom’ in Thailand and is the resulting from low TNC concentrations, low plantnutrients and low IAA concentrations in the pre-harvest dropped fruits in the pummelo cultivars.

Prevalence and Risk Factors of Dengue Infection in Khanh Hoa Province, Viet Nam: A Stratified Cluster Sampling Survey.

Science.gov (United States)

Mai, Vien Quang; Mai, Trịnh Thị Xuan; Tam, Ngo Le Minh; Nghia, Le Trung; Komada, Kenichi; Murakami, Hitoshi

2018-05-19

Dengue is a clinically important arthropod-borne viral disease with increasing global incidence. Here we aimed to estimate the prevalence of dengue infections in Khanh Hoa Province, central Viet Nam, and to identify risk factors for infection. We performed a stratified cluster sampling survey including residents of 3-60 years of age in Nha Trang City, Ninh Hoa District and Dien Khanh District, Khanh Hoa Province, in October 2011. Immunoglobulin G (IgG) and immunoglobulin M (IgM) against dengue were analyzed using a rapid test kit. Participants completed a questionnaire exploring clinical dengue incidence, socio-economic status, and individual behavior. A household checklist was used to examine environment, mosquito larvae presence, and exposure to public health interventions. IgG positivity was 20.5% (urban, 16.3%; rural, 23.0%), IgM positivity was 6.7% (urban, 6.4%; rural, 6.9%), and incidence of clinically compatible dengue during the prior 3 months was 2.8 per 1,000 persons (urban, 1.7; rural, 3.4). For IgG positivity, the adjusted odds ratio (AOR) was 2.68 (95% confidence interval [CI], 1.24-5.81) for mosquito larvae presence in water pooled in old tires and was 3.09 (95% CI, 1.75-5.46) for proximity to a densely inhabited area. For IgM positivity, the AOR was 3.06 (95% CI, 1.50-6.23) for proximity to a densely inhabited area. Our results indicated rural penetration of dengue infections. Control measures should target densely inhabited areas, and may include clean-up of discarded tires and water-collecting waste.

Changes in atmospheric circulation between solar maximum and minimum conditions in winter and summer

Science.gov (United States)

Lee, Jae Nyung

2008-10-01

Statistically significant climate responses to the solar variability are found in Northern Annular Mode (NAM) and in the tropical circulation. This study is based on the statistical analysis of numerical simulations with ModelE version of the chemistry coupled Goddard Institute for Space Studies (GISS) general circulation model (GCM) and National Centers for Environmental Prediction/National Center for Atmospheric Research (NCEP/NCAR) reanalysis. The low frequency large scale variability of the winter and summer circulation is described by the NAM, the leading Empirical Orthogonal Function (EOF) of geopotential heights. The newly defined seasonal annular modes and its dynamical significance in the stratosphere and troposphere in the GISS ModelE is shown and compared with those in the NCEP/NCAR reanalysis. In the stratosphere, the summer NAM obtained from NCEP/NCAR reanalysis as well as from the ModelE simulations has the same sign throughout the northern hemisphere, but shows greater variability at low latitudes. The patterns in both analyses are consistent with the interpretation that low NAM conditions represent an enhancement of the seasonal difference between the summer and the annual averages of geopotential height, temperature and velocity distributions, while the reverse holds for high NAM conditions. Composite analysis of high and low NAM cases in both the model and observation suggests that the summer stratosphere is more "summer-like" when the solar activity is near a maximum. This means that the zonal easterly wind flow is stronger and the temperature is higher than normal. Thus increased irradiance favors a low summer NAM. A quantitative comparison of the anti-correlation between the NAM and the solar forcing is presented in the model and in the observation, both of which show lower/higher NAM index in solar maximum/minimum conditions. The summer NAM in the troposphere obtained from NCEP/NCAR reanalysis has a dipolar zonal structure with maximum

Immunological and viral determinants of dengue severity in hospitalized adults in Ha Noi, Viet Nam.

Directory of Open Access Journals (Sweden)

Annette Fox

2011-03-01

Full Text Available The relationships between the infecting dengue serotype, primary and secondary infection, viremia and dengue severity remain unclear. This cross-sectional study examined these interactions in adult patients hospitalized with dengue in Ha Noi.158 patients were enrolled between September 16 and November 11, 2008. Quantitative RT-PCR, serology and NS1 detection were used to confirm dengue infection, determine the serotype and plasma viral RNA concentration, and categorize infections as primary or secondary. 130 (82% were laboratory confirmed. Serology was consistent with primary and secondary infection in 34% and 61%, respectively. The infecting serotype was DENV-1 in 42 (32%, DENV-2 in 39 (30% and unknown in 49 (38%. Secondary infection was more common in DENV-2 infections (79% compared to DENV-1 (36%, p<0.001. The proportion that developed dengue haemorrhagic fever (DHF was 32% for secondary infection compared to 18% for primary infection (p = 0.14, and 26% for DENV-1 compared to 28% for DENV-2. The time until NS1 and plasma viral RNA were undetectable was shorter for DENV-2 compared to DENV-1 (p≤0.001 and plasma viral RNA concentration on day 5 was higher for DENV-1 (p = 0.03. Plasma viral RNA concentration was higher in secondary infection on day 5 of illness (p = 0.046. We didn't find an association between plasma viral RNA concentration and clinical severity.Dengue is emerging as a major public health problem in Ha Noi. DENV-1 and DENV-2 were the prevalent serotypes with similar numbers and clinical presentation. Secondary infection may be more common amongst DENV-2 than DENV-1 infections because DENV-2 infections resulted in lower plasma viral RNA concentrations and viral RNA concentrations were higher in secondary infection. The drivers of dengue emergence in northern Viet Nam need to be elucidated and public health measures instituted.

Persisting stigma reduces the utilisation of HIV-related care and support services in Viet Nam

Directory of Open Access Journals (Sweden)

Thanh Duong Cong

2012-11-01

Full Text Available Abstract Background Seeking and utilisation of HIV prevention, treatment, care, and support services for people living with HIV is often hampered by HIV-related stigma. The study aimed to explore the perceptions and experiences regarding treatment, care, and support amongst people living with HIV in Viet Nam, where the HIV epidemic is concentrated among injecting drug users, sex workers, and men who have sex with men. Methods In-depth interviews and focus group discussions were conducted during September 2007 in 6 districts in Hai Phong with a very high HIV prevalence among injecting drug users. The information obtained was analysed and merged within topic areas. Illustrative quotes were selected. Results Stigma and discrimination against people living with HIV in the community and healthcare settings was commonly reported, and substantially hampered the seeking and the utilisation of HIV-related services. The informants related the high level of stigma to the way the national HIV preventive campaigns played on fear, by employing a “scare tactic” mainly focusing on drug users and sex workers, who were defined as “social evils” in the anti-drug and anti-prostitution policy. There was a strong exclusion effect caused by the stigma, with serious implications, such as loss of job opportunities and isolation. The support and care provided by family members was experienced as vital for the spirit and hope for the future among people living with HIV. Conclusions A comprehensive care and support programme is needed. The very high levels of stigma experienced seem largely to have been created by an HIV preventive scare tactic closely linked to the “social evil“ approach in the national policy on drug and prostitution. In order to reduce the stigma and create more effective interventions, this tactic will have to be replaced with approaches that create better legal and policy environments for drug users and sex workers.

Turbulent flux modelling with a simple 2-layer soil model and extrapolated surface temperature applied at Nam Co Lake basin on the Tibetan Plateau

Directory of Open Access Journals (Sweden)

T. Gerken

2012-04-01

Full Text Available This paper introduces a surface model with two soil-layers for use in a high-resolution circulation model that has been modified with an extrapolated surface temperature, to be used for the calculation of turbulent fluxes. A quadratic temperature profile based on the layer mean and base temperature is assumed in each layer and extended to the surface. The model is tested at two sites on the Tibetan Plateau near Nam Co Lake during four days during the 2009 Monsoon season. In comparison to a two-layer model without explicit surface temperature estimate, there is a greatly reduced delay in diurnal flux cycles and the modelled surface temperature is much closer to observations. Comparison with a SVAT model and eddy covariance measurements shows an overall reasonable model performance based on RMSD and cross correlation comparisons between the modified and original model. A potential limitation of the model is the need for careful initialisation of the initial soil temperature profile, that requires field measurements. We show that the modified model is capable of reproducing fluxes of similar magnitudes and dynamics when compared to more complex methods chosen as a reference.

Vibration of an Offshore Structure Having the Form of a Hollow Column Partially Filled with Multiple Fluids and Immersed in Water

Directory of Open Access Journals (Sweden)

Hsien-Yuan Lin

2012-01-01

Full Text Available This paper employs the numerical assembly method (NAM to determine the exact frequency-response amplitudes of an offshore structure such as piles or towers having the form of a hollow column filled with multiple fluids, immersed in water, carrying an eccentric tip mass supported by a translational spring and/or a rotational spring, and subjected to a harmonic force. The hollow column is modeled as a Bernoulli-Euler cantilever beam fixed at the bottom. For the case of zero harmonic force, the simultaneous equations of the vibration system reduce to an eigenvalue problem so that the natural frequencies and mode shapes of the beam can also be obtained. The effect of height of filled fluids on the characteristics of free vibration is also presented.

Effects of high pressure freezing (HPF) on denaturation of natural actomyosin extracted from prawn (Metapenaeus ensis).

Science.gov (United States)

Cheng, Lina; Sun, Da-Wen; Zhu, Zhiwei; Zhang, Zhihang

2017-08-15

Effects of protein denaturation caused by high pressure freezing, involving Pressure-Factors (pressure, time) and Freezing-Factors (temperature, phase transition, recrystallization, ice crystal types), are complicated. In the current study, the conformation and functional changes of natural actomyosin (NAM) under pressure assisted freezing (PAF, 100,150,300,400,500MPa P -20°C/25min ), pressure shift freezing (PSF, 200MPa P -20°C/25min ), and immersion freezing ( 0.1MPa P -20°C/5min ) after pressure was released to 0.1MPa, as compared to normal immersion freezing process (IF, 0.1MPa P -20°C/30min ). Results indicated that PSF ( 200MPa P -20°C/30min ) could reduce the denaturation of frozen NAM and a pressure of 300MPa was the critical point to induce such a denaturation. During the periods of B→D in PSF or B→C→D in PAF, the generation and growth of ice crystals played an important role on changing the secondary and tertiary structure of the treated NAM. Copyright © 2017 Elsevier Ltd. All rights reserved.

Die New Age beweging - oorsig en beoordeling

Directory of Open Access Journals (Sweden)

P. J. de Bruyn

1992-06-01

Full Text Available The New Age Movement (NAM is a leaderless but powerful network, working to bring about radical change in the world. In fact the NAM is a transplantation of Hindu philosophy, with Buddist elements from the East to the West. This article explicates the origin of the NAM and describes its mystic, occult and feminist character. In the article it is stated that the NAM rests on monistic and astrological pillars and that its main doctrines are as follows: pantheism, emanation (instead of creation, reincarnation and the fact that Christ is one of the great Masters controlling the world. The views and doctrines of the NAM are then judged in the light of Scripture.

An introduction to BIOSSAM: the South African BIOenergy systems sustainability assessment and management portal

CSIR Research Space (South Africa)

Stafford, W

2010-11-01

Full Text Available , currently retained de facto by NamPower, and its roles, obligations and gover- nance structure, particularly as they relate to the need to assure prospective Independent Power Producer (IPP) investors of a ?level playing field?. In addition, whether...

Evidence for the Convergence Model: The Emergence of Highly Pathogenic Avian Influenza (H5N1 in Viet Nam.

Directory of Open Access Journals (Sweden)

Sumeet Saksena

Full Text Available Building on a series of ground breaking reviews that first defined and drew attention to emerging infectious diseases (EID, the 'convergence model' was proposed to explain the multifactorial causality of disease emergence. The model broadly hypothesizes disease emergence is driven by the co-incidence of genetic, physical environmental, ecological, and social factors. We developed and tested a model of the emergence of highly pathogenic avian influenza (HPAI H5N1 based on suspected convergence factors that are mainly associated with land-use change. Building on previous geospatial statistical studies that identified natural and human risk factors associated with urbanization, we added new factors to test whether causal mechanisms and pathogenic landscapes could be more specifically identified. Our findings suggest that urbanization spatially combines risk factors to produce particular types of peri-urban landscapes with significantly higher HPAI H5N1 emergence risk. The work highlights that peri-urban areas of Viet Nam have higher levels of chicken densities, duck and geese flock size diversities, and fraction of land under rice or aquaculture than rural and urban areas. We also found that land-use diversity, a surrogate measure for potential mixing of host populations and other factors that likely influence viral transmission, significantly improves the model's predictability. Similarly, landscapes where intensive and extensive forms of poultry production overlap were found at greater risk. These results support the convergence hypothesis in general and demonstrate the potential to improve EID prevention and control by combing geospatial monitoring of these factors along with pathogen surveillance programs.

Nicotinamide clearance by Pnc1 directly regulates Sir2-mediated silencing and longevity.

Science.gov (United States)

Gallo, Christopher M; Smith, Daniel L; Smith, Jeffrey S

2004-02-01

The Saccharomyces cerevisiae Sir2 protein is an NAD(+)-dependent histone deacetylase (HDAC) that functions in transcriptional silencing and longevity. The NAD(+) salvage pathway protein, Npt1, regulates Sir2-mediated processes by maintaining a sufficiently high intracellular NAD(+) concentration. However, another NAD(+) salvage pathway component, Pnc1, modulates silencing independently of the NAD(+) concentration. Nicotinamide (NAM) is a by-product of the Sir2 deacetylase reaction and is a natural Sir2 inhibitor. Pnc1 is a nicotinamidase that converts NAM to nicotinic acid. Here we show that recombinant Pnc1 stimulates Sir2 HDAC activity in vitro by preventing the accumulation of NAM produced by Sir2. In vivo, telomeric, rDNA, and HM silencing are differentially sensitive to inhibition by NAM. Furthermore, PNC1 overexpression suppresses the inhibitory effect of exogenously added NAM on silencing, life span, and Hst1-mediated transcriptional repression. Finally, we show that stress suppresses the inhibitory effect of NAM through the induction of PNC1 expression. Pnc1, therefore, positively regulates Sir2-mediated silencing and longevity by preventing the accumulation of intracellular NAM during times of stress.

Viet Nam National Atomic Energy Commission

International Nuclear Information System (INIS)

1992-01-01

Vietnam National Atomic Energy Commission (VINATOM) is a governmental body in charge of organizing and coordinating activities related to use of nuclear energy for peaceful purpose. VINATOM in structure consists of the Nuclear Research Institute (Dalat), the Institute of Nuclear Science and Technology (Hanoi), the Institute for Technology of Radioactive and Rare Elements (Hanoi), and the Centre for Nuclear Technique Application (Ho Chi Minh City). This catalogue introduces profiles of nuclear R and D activities under management by VINATOM. (N.H.A)

The Arabidopsis thaliana NAC transcription factor family: structure-function relationships and determinants of ANAC019 stress signalling

DEFF Research Database (Denmark)

Jensen, Michael K; Kjaersgaard, Trine; Nielsen, Michael M.

2010-01-01

-termini. Nine of the ten NAC domains analysed bind a previously identified conserved DNA target sequence with a CGT[GA] core, although with different affinities. Likewise, all but one of the NAC proteins analysed is dependent on the C-terminal region for transactivational activity. In silico analyses show......TFs (transcription factors) are modular proteins minimally containing a DBD (DNA-binding domain) and a TRD (transcription regulatory domain). NAC [for NAM (no apical meristem), ATAF, CUC (cup-shaped cotyledon)] proteins comprise one of the largest plant TF families. They are key regulators...... of stress perception and developmental programmes, and most share an N-terminal NAC domain. On the basis of analyses of gene expression data and the phylogeny of Arabidopsis thaliana NAC TFs we systematically decipher structural and functional specificities of the conserved NAC domains and the divergent C...

Analysis of recombination QTLs, segregation distortion, and epistasis for fitness in maize multiple populations using ultra-high-density markers

Science.gov (United States)

Understanding the maize genomic features would be useful for the study of genetic diversity and evolution and for maize breeding. Here, we used two maize nested association mapping (NAM) populations separately derived in China (CN-NAM) and the US (US-NAM) to explore the maize genomic features. The t...

Genotoxicity of a Low-Dose Nitrosamine Mixture as Drinking Water Disinfection Byproducts in NIH3T3 Cells.

Science.gov (United States)

Wang, Hai-Yan; Qin, Ming; Dong, Lei; Lv, Jia-Ying; Wang, Xia

2017-01-01

N - nitrosamines (NAms), which can arise as byproducts of disinfection agents, are reportedly found in drinking water, and their potential carcinogenicity is a concern; however, little research exists regarding the genotoxicity or carcinogenicity of NAms exposure as a low-dose mixture. The three most common NAms components in China's drinking water are N -nitrosodimethylamine (NDMA), N -nitrosodiethylamine (NDEA) and N -nitrosomethylethylamine (NMEA). Thus, we measured the genotoxic and carcinogenic potential of these compounds and measured the cell cycle and gene expression. The data show that exposure to the NAms-mixture doubled the revertants in the TA98 and TA100 S. typhimurium strains and increased the DNA double-strand breaks and the micronuclear frequency in the NIH3T3 cells compared to a single exposure. After long-term NAms mixture exposure, a malignant transformation of NIH3T3 and a significantly increased G2/M distribution were observed. Furthermore, P53, CDK1, P38, CDC25A and CyclinB expressions were down-regulated in the NAms-mixture exposure group; however, P21 and GADD45A genes were up-regulated. Interestingly, the CHK1/CHK2 and CDC25A genes had two responses, depending on the NAms concentrations. Thus, we observed mutagenic, genotoxic and carcinogenic effects after a low-dose NAms-mixture exposure in drinking water, and DNA repair and apoptosis pathways may contribute to these adverse effects.

Free tuberculosis diagnosis and treatment are not enough: patient cost evidence from three continents

NARCIS (Netherlands)

Mauch, V.; Bonsu, F.; Gyapong, M.; Awini, E.; Suarez, P.; Marcelino, B.; Melgen, R. E.; Lönnroth, K.; Nhung, N. V.; Hoa, N. B.; Klinkenberg, E.

2013-01-01

The National Tuberculosis Programs of Ghana, Viet Nam and the Dominican Republic. To assess the direct and indirect costs of tuberculosis (TB) diagnosis and treatment for patients and households. Each country translated and adapted a structured questionnaire, the Tool to Estimate Patients' Costs. A

Pathogenesis of Cell Injury by Rickettsia conorii.

Science.gov (United States)

1984-06-15

infected soldiers in the Viet Nam War. These rickettsiae have continued to attract research support. Although R. conorii has received far less...principally for reasons of location related to cosmetic concern or proximity to vital structures, e.g., carotid artery. Other patients had boutonneuse fever

Preharvest bagging with wavelength-selective materials enhances development and quality of mango (Mangifera indica L.) cv. Nam Dok Mai #4.

Science.gov (United States)

Chonhenchob, Vanee; Kamhangwong, Damrongpol; Kruenate, Jittiporn; Khongrat, Krittaphat; Tangchantra, Nantavat; Wichai, Uthai; Singh, S Paul

2011-03-15

Preharvest bagging has been shown to improve development and quality of fruits. Different light transmittance bags showed different effects on fruit quality. This study presents the benefits of using newly developed plastic bagging materials with different wavelength-selective characteristics for mangoes (cv. Nam Dok Mai #4). Mangoes were bagged at 45 days after full bloom (DAFB) and randomly harvested at 65, 75, 85, 95, and 105 DAFB. The bags were removed on the harvest days. The wavelength-selective bags (no pigment, yellow, red, blue/violet, blue) were compared with the Kraft paper bag with black paper liner, which is currently used commercially for several fruits, and with non-bagging as a control. Bagging significantly (p⩽0.05) reduced diseases and blemishes. Mango weight at 95 DAFB was increased approximately 15% by VM and V plastic bagging, as compared to paper bagging and control. Plastic bagging accelerated mango ripening as well as growth. Plastic-bagged mangoes reached maturity stage at 95 DAFB, while non-bagged mangoes reached maturity stage at 105 DAFB. Paper bagging resulted in a pale-yellow peel beginning at 65 DAFB, while plastic bagging improved peel glossiness. Preharvest bagging with different wavelength-selective materials affected mango development and quality. Bagging mangoes with VM and V materials could reduce peel defects and diseases, increase weight, size, and sphericity, improve peel appearance, and shorten the development periods of mangoes. The results suggest a favorable practice using the newly developed VM and V plastic bags in the production of mangoes, and possibly other fruits as well. Copyright © 2010 Society of Chemical Industry.

Observed linkages between the northern annular mode/North Atlantic Oscillation, cloud incidence, and cloud radiative forcing

Science.gov (United States)

Li, Ying; Thompson, David W. J.; Huang, Yi; Zhang, Minghong

2014-03-01

The signature of the northern annular mode/North Atlantic Oscillation (NAM/NAO) in the vertical and horizontal distribution of tropospheric cloudiness is investigated in CloudSat and CALIPSO data from June 2006 to April 2011. During the Northern Hemisphere winter, the positive polarity of the NAM/NAO is marked by increases in zonally averaged cloud incidence north of ~60°N, decreases between ~25 and 50°N, and increases in the subtropics. The tripolar-like anomalies in cloud incidence associated with the NAM/NAO are largest over the North Atlantic Ocean basin/Middle East and are physically consistent with the NAM/NAO-related anomalies in vertical motion. Importantly, the NAM/NAO-related anomalies in tropospheric cloud incidence lead to significant top of atmosphere cloud radiative forcing anomalies that are comparable in amplitude to those associated with the NAM/NAO-related temperature anomalies. The results provide observational evidence that the most prominent pattern of Northern Hemisphere climate variability is significantly linked to variations in cloud radiative forcing. Implications for two-way feedback between extratropical dynamics and cloud radiative forcing are discussed.

Physicochemical properties of natural actomyosin from threadfin bream (Nemipterus spp.) induced by high hydrostatic pressure.

Science.gov (United States)

Zhou, Aimei; Lin, Liying; Liang, Yan; Benjakul, Soottawat; Shi, Xiaoling; Liu, Xin

2014-08-01

Changes of physicochemical properties in natural actomyosin (NAM) from threadfin bream (Nemipterus spp.) induced by high hydrostatic pressure (200, 400, 600MPa for 10, 30, 50min) were studied. The increase in turbidity of NAM was coincidental with the decrease in protein solubility with increasing pressure and time, suggesting the formation of protein aggregates. SDS-PAGE showed that polymerisation and degradation of myosin heavy chain were induced by high pressure. Ca(2+)-ATPase activity of NAM treated by high pressure was lost, suggesting the denaturation of myosin and the dissociation of actomyosin complex. Surface hydrophobicity of NAM increased when the pressure and pressurization time increased, indicating that the exposed hydrophobic residues increased upon application of high pressure. Decrease in total sulfhydryl content and increase in surface-reactive sulfhydryl content of NAM samples were observed with the extension of pressurizing time, indicating the formation of disulphide bonds through oxidation of SH groups or disulphide interchanges. The above changes of physicochemical properties suggested conformational changes of NAM from muscle of threadfin bream induced by high hydrostatic pressure. Copyright © 2014 Elsevier Ltd. All rights reserved.

Database Description - RPSD | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available base Description General information of database Database name RPSD Alternative nam...e Rice Protein Structure Database DOI 10.18908/lsdba.nbdc00749-000 Creator Creator Name: Toshimasa Yamazaki ... Ibaraki 305-8602, Japan National Institute of Agrobiological Sciences Toshimasa Yamazaki E-mail : Databas...e classification Structure Databases - Protein structure Organism Taxonomy Name: Or...or name(s): Journal: External Links: Original website information Database maintenance site National Institu

Simulating the Impact of Future Land Use and Climate Change on Soil Erosion and Deposition in the Mae Nam Nan Sub-Catchment, Thailand

Directory of Open Access Journals (Sweden)

Nitin Kumar Tripathi

2013-07-01

Full Text Available This paper evaluates the possible impacts of climate change and land use change and its combined effects on soil loss and net soil loss (erosion and deposition in the Mae Nam Nan sub-catchment, Thailand. Future climate from two general circulation models (GCMs and a regional circulation model (RCM consisting of HadCM3, NCAR CSSM3 and PRECIS RCM ware downscaled using a delta change approach. Cellular Automata/Markov (CA_Markov model was used to characterize future land use. Soil loss modeling using Revised Universal Soil Loss Equation (RUSLE and sedimentation modeling in Idrisi software were employed to estimate soil loss and net soil loss under direct impact (climate change, indirect impact (land use change and full range of impact (climate and land use change to generate results at a 10 year interval between 2020 and 2040. Results indicate that soil erosion and deposition increase or decrease, depending on which climate and land use scenarios are considered. The potential for climate change to increase soil loss rate, soil erosion and deposition in future periods was established, whereas considerable decreases in erosion are projected when land use is increased from baseline periods. The combined climate and land use change analysis revealed that land use planning could be adopted to mitigate soil erosion and deposition in the future, in conjunction with the projected direct impact of climate change.

Novel algorithm for image representation using non-symmetry and anti-packing model%基于非对称逆布局子模块合并的图像表示算法

Institute of Scientific and Technical Information of China (English)

吕泽华; 李华; 陈传波; 梁虎

2017-01-01

A algorithm for color image representation using the non-symmetry anti-packing pattern representation model with squares based color blocks merging (NAMS-CBM) was proposed.Euclidean distance in Lab color space was used in the proposed algorithm to measure the distance weight between two pixels, which largely preserved the relevance of the three color components of the pixels.The NAMS-CBM algorithm could merge the isolate pixels or small blocks to reduce the data redundancy.The experimental results show that the NAMS-CBM algorithm can get fewer sub-patterns as well as keep the structural similarity compared with the existing methods, such as the linear quad tree and the original non-symmetry and anti-packing model based method.The proposed algorithm can also enhance the contrast of the saliency region and background in the image.The NAMS-CBM algorithm is a better method for color image representation, especially for saliency detection, object tracking.%在非对称逆布局模式表示模型的基础上,提出了基于非对称逆布局正方形子模块合并的彩色图像表示(NAMS-CBM)算法.算法将Lab彩色空间下像素点之间的欧氏距离权重作为分块的标准,可以保持彩色图像各个色彩通道之间的联系;此外将逆布局子模块中的独立点和面积较小的子模块进行合并,可以减少因过分割而产生的数据冗余.理论分析和实验结果表明:与经典的线性四元树算法和原始的非对称逆布局彩色图像表示方法相比,NAMS-CBM算法可以在很大程度上减少子模块数的同时保持图像的结构、边缘和轮廓等信息,突显出图像的显著性区域,平滑图像的背景区域.对于显著性检测、目标追踪等图像处理算法预处理步骤而言,NAMS-CBM算法是一种更好的图像表示算法.

Review of the odd chrysidid genus Loboscelidia Westwood, 1874 (Hymenoptera, Chrysididae, Loboscelidiinae

Directory of Open Access Journals (Sweden)

Lynn Kimsey

2012-08-01

Full Text Available The chrysidid genus Loboscelidia is reviewed and 11 new species are described, including L. cinnamonea (Borneo, L. fulgens (Viet Nam, L. fulva (Thailand, L. incompleta (India, L. kafae (Borneo, L. laminata (Viet Nam, L. meifungae (Borneo, L. nasiformis (Thailand, L. nitidula (Thailand, L. pecki (Viet Nam, and L. sisik (Borneo. A key to males of the species of Loboscelidia is given.

Cross-sectional study of sexual behaviour and knowledge about HIV among urban, rural, and minority residents in Viet Nam.

Science.gov (United States)

Bui, T D; Pham, C K; Pham, T H; Hoang, L T; Nguyen, T V; Vu, T Q; Detels, R

2001-01-01

A cross-sectional survey was conducted in three districts of Quang Ninh province, Viet Nam, to find out what proportion of the people who lived there engaged in behaviour that put them at risk of becoming infected with HIV, and to measure their knowledge about HIV infection and AIDS. The survey was conducted in a rural district, Yen Hung; a mountainous district inhabited primarily by ethnic minority groups, Binh Lieu; and an urban district, Ha Long. Participants aged 15-45 years were randomly selected from the general population to be interviewed. A total of 630 people from 707 households were interviewed; 8% were not home despite repeated visits and 3% refused to participate. The prevalence of premarital intercourse ranged from 9% to 16% among married men and 4% to 7% among married women. Among single men the proportion who had ever had intercourse ranged from 6% to 16%. Fewer than 3% reported having ever had sex with a sex worker. The median number of extramarital sex partners was 1. Knowledge about HIV/AIDS was high in the urban and rural areas but low in the mountainous area. Being male and being 20-29 years old were associated with having multiple sex partners. The low prevalence of individuals reporting that they had had intercourse with sex workers and partners other than their spouse may explain the low rates of HIV infection among the heterosexual population; these rates are in contrast to the high rates of HIV infection found among injecting drug users. The association between having extramarital partners and being a younger man suggests that the tendency to have more sexual partners may increase in the future. If this happens, the potential for HIV to be spread through heterosexual sex will increase.

Knowledge and Attitude Towards Tobacco Smoking among 13-15 Year-Old School Children in Viet Nam - Findings from GYTS 2014.

Science.gov (United States)

Huong, Nguyen Thanh; Kien, Nguyen Trung; Giang, Kim Bao; Minh, Hoang Van; Hai, Phan Thi; Huyen, Doan Thu; Khue, Luong Ngoc; Linh, Nguyen Thuy; Lam, Nguyen Tuan; Nga, Pham Thi Quynh

2016-01-01

Studies have shown that smoking is a learnt behavior, often initiated during adolescence. This paper aims to describe tobacco-related knowledge, attitude and associations among school adolescents aged 13-15 with exposure to anti-smoking information. Using data from the Global Youth Tobacco Survey (GYTS) in Viet Nam, 2014, knowledge was measured through 4 questions about tobacco use, and attitude was assessed through 3 questions on personal, social and environmental aspects. Students giving most anti-tobacco responses to all questions were considered as having correct knowledge or appropriate attitude or both. Access to anti-smoking information was determined by exposure to any media messages on tobacco control during the past 30 days and teaching in school about the danger of tobacco use during the past 12 months. A substantial percentage of students thought that being near others who smoke might be harmful to them and smoking is harmful to health (89.4% and 89.6% respectively). However, only 46.4% reported that it is definitely difficult to quit smoking and 66.9% thought that smoking for only 1 or 2 years, once stopped, is harmful to health. Slightly more than half of the respondents reported appropriate attitude that young smokers have fewer friends than others and smoking makes them less attractive and less comfortable at social events. Noticing anti-smoking messages in the media together with having lessons in school about the dangers of tobacco substantially increased the likelihood of having correct knowledge, appropriate attitude and both. Despite relatively high awareness about smoking harms, effective educational communication is still highly needed to improve the level of comprehensive knowledge and an appropriate attitude regarding tobacco use.

VU0477573: Partial Negative Allosteric Modulator of the Subtype 5 Metabotropic Glutamate Receptor with In Vivo Efficacy.

Science.gov (United States)

Nickols, Hilary Highfield; Yuh, Joannes P; Gregory, Karen J; Morrison, Ryan D; Bates, Brittney S; Stauffer, Shaun R; Emmitte, Kyle A; Bubser, Michael; Peng, Weimin; Nedelcovych, Michael T; Thompson, Analisa; Lv, Xiaohui; Xiang, Zixiu; Daniels, J Scott; Niswender, Colleen M; Lindsley, Craig W; Jones, Carrie K; Conn, P Jeffrey

2016-01-01

Negative allosteric modulators (NAMs) of metabotropic glutamate receptor subtype 5 (mGlu5) have potential applications in the treatment of fragile X syndrome, levodopa-induced dyskinesia in Parkinson disease, Alzheimer disease, addiction, and anxiety; however, clinical and preclinical studies raise concerns that complete blockade of mGlu5 and inverse agonist activity of current mGlu5 NAMs contribute to adverse effects that limit the therapeutic use of these compounds. We report the discovery and characterization of a novel mGlu5 NAM, N,N-diethyl-5-((3-fluorophenyl)ethynyl)picolinamide (VU0477573) that binds to the same allosteric site as the prototypical mGlu5 NAM MPEP but displays weak negative cooperativity. Because of this weak cooperativity, VU0477573 acts as a "partial NAM" so that full occupancy of the MPEP site does not completely inhibit maximal effects of mGlu5 agonists on intracellular calcium mobilization, inositol phosphate (IP) accumulation, or inhibition of synaptic transmission at the hippocampal Schaffer collateral-CA1 synapse. Unlike previous mGlu5 NAMs, VU0477573 displays no inverse agonist activity assessed using measures of effects on basal [(3)H]inositol phosphate (IP) accumulation. VU0477573 acts as a full NAM when measuring effects on mGlu5-mediated extracellular signal-related kinases 1/2 phosphorylation, which may indicate functional bias. VU0477573 exhibits an excellent pharmacokinetic profile and good brain penetration in rodents and provides dose-dependent full mGlu5 occupancy in the central nervous system (CNS) with systemic administration. Interestingly, VU0477573 shows robust efficacy, comparable to the mGlu5 NAM MTEP, in models of anxiolytic activity at doses that provide full CNS occupancy of mGlu5 and demonstrate an excellent CNS occupancy-efficacy relationship. VU0477573 provides an exciting new tool to investigate the efficacy of partial NAMs in animal models. Copyright © 2015 by The American Society for Pharmacology and

Structural activation calculations due to proton beam loss in the APT accelerator design

International Nuclear Information System (INIS)

Lee, S. K.; Beard, C. A.; Wilson, W. B.; Daemen, L. L.; Liska, D. J.; Waters, L. S.; Adams, M. L.

1995-01-01

For the new, high-power accelerators currently being designed, the amount of activation of the accelerator structure has become an important issue. To quantify this activation, a methodology was utilized that coupled transport and depletion codes to obtain dose rate estimates at several locations near the accelerator. This research focused on the 20 and 100 MeV sections of the Bridge-Coupled Drift Tube Linear Accelerator. The peak dose rate was found to be approximately 6 mR/hr in the 100 MeV section near the quadrupoles at a 25-cm radius for an assumed beam loss of 1 nA/m. It was determined that the activation was dominated by the proton interactions and subsequent spallation product generation, as opposed to the presence of the generated neutrons. The worst contributors were the spallation products created by proton bombardment of iron, and the worst component was the beam pipe, which consists mostly of iron. No definitive conclusions about the feasibility of hands-on maintenance can be determined, as the design is still not finalized

Structural activation calculations due to proton beam loss in the APT accelerator design

International Nuclear Information System (INIS)

Lee, S.K.; Beard, C.A.; Wilson, W.B.; Daemen, L.L.; Liska, D.J.; Waters, L.S.; Adams, M.L.

1994-01-01

For the new, high-power accelerators currently being designed, the amount of activation of the accelerator structure has become an important issue. To quantify this activation, a methodology was utilized that coupled transport and depletion codes to obtain dose rate estimates at several locations near the accelerator. This research focused on the 20 and 100 MeV sections of the Bridge-Coupled Drift Tube Linear Accelerator. The peak dose rate was found to be approximately 6 mR/hr in the 100 MeV section near the quadrupoles at a 25-cm radius for an assumed beam loss of 1 nA/m. It was determined that the activation was dominated by the proton interactions and subsequent spallation product generation, as opposed to the presence of the generated neutrons. The worst contributors were the spallation products created by proton bombardment of iron, and the worst component was the beam pipe, which consists mostly of iron. No definitive conclusions about the feasibility of hands-on maintenance can be determined, as the design is still not finalized

Unvoiced Speech Recognition Using Tissue-Conductive Acoustic Sensor

Directory of Open Access Journals (Sweden)

Heracleous Panikos

2007-01-01

Full Text Available We present the use of stethoscope and silicon NAM (nonaudible murmur microphones in automatic speech recognition. NAM microphones are special acoustic sensors, which are attached behind the talker's ear and can capture not only normal (audible speech, but also very quietly uttered speech (nonaudible murmur. As a result, NAM microphones can be applied in automatic speech recognition systems when privacy is desired in human-machine communication. Moreover, NAM microphones show robustness against noise and they might be used in special systems (speech recognition, speech transform, etc. for sound-impaired people. Using adaptation techniques and a small amount of training data, we achieved for a 20 k dictation task a word accuracy for nonaudible murmur recognition in a clean environment. In this paper, we also investigate nonaudible murmur recognition in noisy environments and the effect of the Lombard reflex on nonaudible murmur recognition. We also propose three methods to integrate audible speech and nonaudible murmur recognition using a stethoscope NAM microphone with very promising results.

Partial mGlu₅ Negative Allosteric Modulators Attenuate Cocaine-Mediated Behaviors and Lack Psychotomimetic-Like Effects.

Science.gov (United States)

Gould, Robert W; Amato, Russell J; Bubser, Michael; Joffe, Max E; Nedelcovych, Michael T; Thompson, Analisa D; Nickols, Hilary H; Yuh, Johannes P; Zhan, Xiaoyan; Felts, Andrew S; Rodriguez, Alice L; Morrison, Ryan D; Byers, Frank W; Rook, Jerri M; Daniels, John S; Niswender, Colleen M; Conn, P Jeffrey; Emmitte, Kyle A; Lindsley, Craig W; Jones, Carrie K

2016-03-01

Cocaine abuse remains a public health concern for which pharmacotherapies are largely ineffective. Comorbidities between cocaine abuse, depression, and anxiety support the development of novel treatments targeting multiple symptom clusters. Selective negative allosteric modulators (NAMs) targeting the metabotropic glutamate receptor 5 (mGlu5) subtype are currently in clinical trials for the treatment of multiple neuropsychiatric disorders and have shown promise in preclinical models of substance abuse. However, complete blockade or inverse agonist activity by some full mGlu5 NAM chemotypes demonstrated adverse effects, including psychosis in humans and psychotomimetic-like effects in animals, suggesting a narrow therapeutic window. Development of partial mGlu5 NAMs, characterized by their submaximal but saturable levels of blockade, may represent a novel approach to broaden the therapeutic window. To understand potential therapeutic vs adverse effects in preclinical behavioral assays, we examined the partial mGlu5 NAMs, M-5MPEP and Br-5MPEPy, in comparison with the full mGlu5 NAM MTEP across models of addiction and psychotomimetic-like activity. M-5MPEP, Br-5MPEPy, and MTEP dose-dependently decreased cocaine self-administration and attenuated the discriminative stimulus effects of cocaine. M-5MPEP and Br-5MPEPy also demonstrated antidepressant- and anxiolytic-like activity. Dose-dependent effects of partial and full mGlu5 NAMs in these assays corresponded with increasing in vivo mGlu5 occupancy, demonstrating an orderly occupancy-to-efficacy relationship. PCP-induced hyperlocomotion was potentiated by MTEP, but not by M-5MPEP and Br-5MPEPy. Further, MTEP, but not M-5MPEP, potentiated the discriminative-stimulus effects of PCP. The present data suggest that partial mGlu5 NAM activity is sufficient to produce therapeutic effects similar to full mGlu5 NAMs, but with a broader therapeutic index.

Descriptive results of a prospective cohort study of avian influenza in the Mekong River Delta of Viet Nam.

Science.gov (United States)

Nguyen, Long V; Stevenson, M; Schauer, B; Nguyen, D T; Tran, Q D; Tien, T N; Tran, P T T; Jones, G; Prattley, D; Morris, R

2014-12-01

A prospective cohort study of avian influenza infection in poultry flocks was carried out in the Mekong River Delta of Viet Nam between December 2008 and April 2010. Our objectives were to (i) estimate the prevalence and incidence of avian influenza virus infection and (ii) assess the efficacy of H5N1 vaccination programmes as indicated by the presence of H5 antibody in vaccinated and unvaccinated poultry. Real-time PCR and H5 multiplex assays were used to detect the antigen of avian influenza viruses from swab samples. The haemagglutination inhibition test was used to detect H5 antibody. A total of 17 968 swab and 14 878 blood samples were collected from 5476 birds over the study period. The overall incidence rate of influenza type A virus infection was 5 (95% CI 4-7) positive birds per 100 bird-months at risk. The overall incidence rate of H5 virus infection was 0.2 (95% CI 0.1-0.5) positive birds per 100 bird-months at risk. Fifty (95% CI 48-52) birds per 100 tested birds were H5 HI positive in the unvaccinated group compared with 71 (95% CI 69-73) birds per 100 in the vaccinated group. Influenza type A and H5 viruses were circulating in village poultry throughout the study period with no recorded signs of clinical disease. This implies that interventions need to be carried out continuously throughout the year rather than only focusing on the established high-risk periods. Broiler ducks had an incidence rate of influenza H5 virus infection approximately four times greater than that of layer ducks and in-contact species. We conclude that broiler ducks are likely to be the main entry route for H5 virus into poultry flocks in the MRD. Control efforts would benefit from understanding why there is a difference between villages in H5 incidence and developing strategies to provide greater protection to broiler ducks. © 2013 Blackwell Verlag GmbH.

Muscle type-specific responses to NAD+ salvage biosynthesis promote muscle function in Caenorhabditis elegans.

Science.gov (United States)

Vrablik, Tracy L; Wang, Wenqing; Upadhyay, Awani; Hanna-Rose, Wendy

2011-01-15

Salvage biosynthesis of nicotinamide adenine dinucleotide (NAD(+)) from nicotinamide (NAM) lowers NAM levels and replenishes the critical molecule NAD(+) after it is hydrolyzed. This pathway is emerging as a regulator of multiple biological processes. Here we probe the contribution of the NAM-NAD(+) salvage pathway to muscle development and function using Caenorhabditis elegans. C. elegans males with mutations in the nicotinamidase pnc-1, which catalyzes the first step of this NAD(+) salvage pathway, cannot mate due to a spicule muscle defect. Multiple muscle types are impaired in the hermaphrodites, including body wall muscles, pharyngeal muscles and vulval muscles. An active NAD(+) salvage pathway is required for optimal function of each muscle cell type. However, we found surprising muscle-cell-type specificity in terms of both the timing and relative sensitivity to perturbation of NAD(+) production or NAM levels. Active NAD(+) biosynthesis during development is critical for function of the male spicule protractor muscles during adulthood, but these muscles can surprisingly do without salvage biosynthesis in adulthood under the conditions examined. The body wall muscles require ongoing NAD(+) salvage biosynthesis both during development and adulthood for maximum function. The vulval muscles do not function in the presence of elevated NAM concentrations, but NAM supplementation is only slightly deleterious to body wall muscles during development or upon acute application in adults. Thus, the pathway plays distinct roles in different tissues. As NAM-NAD(+) biosynthesis also impacts muscle differentiation in vertebrates, we propose that similar complexities may be found among vertebrate muscle cell types. Copyright © 2010 Elsevier Inc. All rights reserved.

Examination of the neighborhood activation theory in normal and hearing-impaired listeners.

Science.gov (United States)

Dirks, D D; Takayanagi, S; Moshfegh, A; Noffsinger, P D; Fausti, S A

2001-02-01

Experiments were conducted to examine the effects of lexical information on word recognition among normal hearing listeners and individuals with sensorineural hearing loss. The lexical factors of interest were incorporated in the Neighborhood Activation Model (NAM). Central to this model is the concept that words are recognized relationally in the context of other phonemically similar words. NAM suggests that words in the mental lexicon are organized into similarity neighborhoods and the listener is required to select the target word from competing lexical items. Two structural characteristics of similarity neighborhoods that influence word recognition have been identified; "neighborhood density" or the number of phonemically similar words (neighbors) for a particular target item and "neighborhood frequency" or the average frequency of occurrence of all the items within a neighborhood. A third lexical factor, "word frequency" or the frequency of occurrence of a target word in the language, is assumed to optimize the word recognition process by biasing the system toward choosing a high frequency over a low frequency word. Three experiments were performed. In the initial experiments, word recognition for consonant-vowel-consonant (CVC) monosyllables was assessed in young normal hearing listeners by systematically partitioning the items into the eight possible lexical conditions that could be created by two levels of the three lexical factors, word frequency (high and low), neighborhood density (high and low), and average neighborhood frequency (high and low). Neighborhood structure and word frequency were estimated computationally using a large, on-line lexicon-based Webster's Pocket Dictionary. From this program 400 highly familiar, monosyllables were selected and partitioned into eight orthogonal lexical groups (50 words/group). The 400 words were presented randomly to normal hearing listeners in speech-shaped noise (Experiment 1) and "in quiet" (Experiment 2) as

Consumer Based-Brand Equity

OpenAIRE

Ekinci, Yuksel

2014-01-01

Research Objectives The objectives of this study are to: - Assess external validity of Nam et al.’s (2011) CBBE model in different culture (Turkey) and new service context (fashion retailing). - Compare validity of Nam et al.’s (2011) CBBE model with the brand equity model introduced by Yoo and Donthu (2001). - Expand the Nam et al.’s (2011) model by introducing “brand awareness”. Universidad de Málaga. Campus de Excelencia Internacional Andalucía Tech.

A Study of China’s Possible Military Intervention in the Event of a Sudden Change in North Korea

Science.gov (United States)

2011-06-10

Kim Jong - nam , Kim Jong -chul or Kim Jong -un as Kim‘s successor. Some have asserted that there might not be a third generation of Kim ...The power struggle between Kim Jong - nam (eldest son) who is residing in China and Kim Jong -un has been observed in many places over time. Kim 29... Jong - nam , who is known to be receiving Chinese support, revealed his opposition to a third generation of dynastic succession in

Dissent and the College Student in Revolt.

Science.gov (United States)

Blocker, Clyde E.

To the familiar list that usually includes the war in Viet Nam, racial discrimination, capitalistic exploitation of the consumer, a breakdown in family structure, political corruption, the weakening position of organized religion, and a shift in the values of a large segment of society as supposed causes of campus unrest, the author adds the…

Unvoiced Speech Recognition Using Tissue-Conductive Acoustic Sensor

Directory of Open Access Journals (Sweden)

Hiroshi Saruwatari

2007-01-01

Full Text Available We present the use of stethoscope and silicon NAM (nonaudible murmur microphones in automatic speech recognition. NAM microphones are special acoustic sensors, which are attached behind the talker's ear and can capture not only normal (audible speech, but also very quietly uttered speech (nonaudible murmur. As a result, NAM microphones can be applied in automatic speech recognition systems when privacy is desired in human-machine communication. Moreover, NAM microphones show robustness against noise and they might be used in special systems (speech recognition, speech transform, etc. for sound-impaired people. Using adaptation techniques and a small amount of training data, we achieved for a 20 k dictation task a 93.9% word accuracy for nonaudible murmur recognition in a clean environment. In this paper, we also investigate nonaudible murmur recognition in noisy environments and the effect of the Lombard reflex on nonaudible murmur recognition. We also propose three methods to integrate audible speech and nonaudible murmur recognition using a stethoscope NAM microphone with very promising results.

Geostatistical Approach to Estimating the Gold Ore Characteristics and Gold Reserves: A Case Study Daksa Area, Quang Nam Province, Viet Nam

Science.gov (United States)

Luan Truong, Xuan; Luong Le, Van; Quang Truong, Xuan

2015-04-01

Daksa gold deposit is the biggest gold deposits in Vietnam. The Daksa geological structure complicated, distributed mainly metamorphosed sedimentary NuiVu formation (PR3-?1nv2). The sulfide gold ore bodies distributed in quartz schist, quartz - biotite related to faut and distribution wing anticline. The gold ore bodies form circuits, network circuits, circuits lenses; fill the cup surface layer of the developing northeast - southwest; is the less than or west longitude north - SE. The results show that, Au and accompanying elements (Ag, Pb and Zn) have correlated pretty closely. All of its consistent with the logarithmic distribution standard, in accordance with the law of distribution of content mineral rare. The structure functions have nugget effect and spherical models with show that Au and accompanying elements special variation are changes. Au contents shown local anisotropy, no clearly anisotropy (K=1,17) and weakly anisotropy (K=1,4). Intensity mineralization of the ore bodies are quite high with demand spherical conversion coefficient ranging from 0.49 to 0.75 and from 0.66 to 0.97 (for other body). With nugget effects, ore bodies shown that it is consistent with mineralization in the ore bodies study, ore erasable, micro vein, infilling fractures in quartz vein. All of variogram presents local anisotropy, indicated gold mineralization at study area has least two-mineralization stages, consistent with the analysis of mineralography samples. By the results of the structure function study, the authors present the system optimization for exploration deposit and used to evaluate gold reserves by Ordinary Kriging. High accuracy of Kriging estimation results are expressed in the minimum Kriging variance, by compare the results calculated by some other methods (such as distance inverse weighting method, ..) and specially compare to the results of a some blocks have been exploited. Key words: Geostat and gold deposits VN. Daksa and gold mineralization. Geostat

A novel technique for presurgical nasoalveolar molding using computer-aided reverse engineering and rapid prototyping.

Science.gov (United States)

Yu, Quan; Gong, Xin; Wang, Guo-Min; Yu, Zhe-Yuan; Qian, Yu-Fen; Shen, Gang

2011-01-01

To establish a new method of presurgical nasoalveolar molding (NAM) using computer-aided reverse engineering and rapid prototyping technique in infants with unilateral cleft lip and palate (UCLP). Five infants (2 males and 3 females with mean age of 1.2 w) with complete UCLP were recruited. All patients were subjected to NAM before the cleft lip repair. The upper denture casts were recorded using a three-dimensional laser scanner within 2 weeks after birth in UCLP infants. A digital model was constructed and analyzed to simulate the NAM procedure with reverse engineering software. The digital geometrical data were exported to print the solid model with rapid prototyping system. The whole set of appliances was fabricated based on these solid models. Laser scanning and digital model construction simplified the NAM procedure and estimated the treatment objective. The appliances were fabricated based on the rapid prototyping technique, and for each patient, the complete set of appliances could be obtained at one time. By the end of presurgical NAM treatment, the cleft was narrowed, and the malformation of nasoalveolar segments was aligned normally. We have developed a novel technique of presurgical NAM based on a computer-aided design. The accurate digital denture model of UCLP infants could be obtained with laser scanning. The treatment design and appliance fabrication could be simplified with a computer-aided reverse engineering and rapid prototyping technique.

Reduced serum brain-derived neurotrophic factor in patients with first onset vitiligo

OpenAIRE

Erfan, Gamze; Yanik,M. Emin; Albayrak,Yakup; Aydin,Murat; Kulac,Mustafa; Kuloglu,Murat

2014-01-01

M Emin Yanik,1 Gamze Erfan,1 Yakup Albayrak,2 Murat Aydin,3 Mustafa Kulac,1 Murat Kuloglu4 1Department of Dermatology, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 2Department of Psychiatry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 3Department of Biochemistry, Faculty of Medicine, Namık Kemal University, Tekirdag, Turkey; 4Department of Psychiatry, Faculty of Medicine, Akdeniz University, Antalya, Turkey Purpose: Vitiligo...

Interaction between surface water areas and groundwater in Hanoi city, Viet Nam

Science.gov (United States)

Hayashi, T.; Kuroda, K.; Do Thuan, A.; Tran Thi Viet, N.; Takizawa, S.

2012-12-01

Hanoi is the capital of Viet Nam and the second largest city in this country (population: 6.45 million in 2009). Hanoi city has developed along the Red River and has many lakes, ponds and canals. However, recent rapid urbanization of this city has reduced number of natural water areas such as ponds and lakes by reclamation not only in the central area but the suburban area. Canals also have been reclaimed or cut into pieces. Contrary, number of artificial water areas such as fish cultivation pond has rapidly increased. On the other hand, various kind of waste water flows into these natural and artificial water areas and induces pollution and eutrophication. These waste waters also have possibility of pollution of groundwater that is one of major water resources in this city. In addition, groundwater in this area has high concentrations of Arsenic, Fe and NH4. Thus, groundwater use may causes re-circulation of Arsenic. However, studies on the interaction between surface water areas and groundwater and on the role of surface water areas for solute transport with water cycle are a few. Therefore, we focused on these points and took water samples of river, pond and groundwater from four communities in suburban areas: two communities are located near the Red River and other two are far from the River. Also, columnar sediment samples of these ponds were taken and pore water was abstracted. Major dissolved ions, metals and stable isotopes of oxygen and hydrogen of water samples were analyzed. As for water cycle, from the correlation between δ18O and δD, the Red River water (after GNIR) were distributed along the LMWL (δD=8.2δ18O+14.1, calculated from precipitation (after GNIP)). On the other hand, although the pond waters in rainy season were distributed along the LMWL, that in dry season were distributed along the local evaporation line (LEL, slope=5.6). The LEL crossed with the LMWL at around the point of weighted mean values of precipitation in rainy season and of

Dengue virus in sub-tropical northern and central Viet Nam: population immunity and climate shape patterns of viral invasion and maintenance.

Directory of Open Access Journals (Sweden)

Maia A Rabaa

Full Text Available Dengue virus transmission occurs in both epidemic and endemic cycles across tropical and sub-tropical regions of the world. Incidence is particularly high in much of Southeast Asia, where hyperendemic transmission plagues both urban and rural populations. However, endemicity has not been established in some areas with climates that may not support year-round viral transmission. An understanding of how dengue viruses (DENV enter these environments and whether the viruses persist in inapparent local transmission cycles is central to understanding how dengue emerges in areas at the margins of endemic transmission. Dengue is highly endemic in tropical southern Vietnam, while increasingly large seasonal epidemics have occurred in northern Viet Nam over the last decade. We have investigated the spread of DENV-1 throughout Vietnam to determine the routes by which the virus enters northern and central regions of the country. Phylogeographic analysis of 1,765 envelope (E gene sequences from Southeast Asia revealed frequent movement of DENV between neighboring human populations and strong local clustering of viral lineages. Long-distance migration of DENV between human population centers also occurred regularly and on short time-scales, indicating human-mediated viral invasion into northern Vietnam. Human populations in southern Vietnam were found to be the primary source of DENV circulating throughout the country, while central and northern Vietnam acted as sink populations, likely due to reduced connectedness to other populations in the case of the central regions and to the influence of temperature variability on DENV replication and vector survival and competence in the north. Finally, phylogeographic analyses suggested that viral movement follows a gravity model and indicates that population immunity and physical and economic connections between populations may play important roles in shaping patterns of DENV transmission.

Polymorphism of Plasmodium falciparum Na+/H+ exchanger is indicative of a low in vitro quinine susceptibility in isolates from Viet Nam

Directory of Open Access Journals (Sweden)

Thanh Nguyen

2011-06-01

Full Text Available Abstract Background The Plasmodium falciparum NA+/H+ exchanger (pfnhe1, gene PF13_0019 has recently been proposed to influence quinine (QN susceptibility. However, its contribution to QN resistance seems to vary geographically depending on the genetic background of the parasites. Here, the role of this gene was investigated in in vitro QN susceptibility of isolates from Viet Nam. Method Ninety-eight isolates were obtained from three different regions of the Binh Phuoc and Dak Nong bordering Cambodia provinces during 2006-2008. Among these, 79 were identified as monoclonal infection and were genotyped at the microsatellite pfnhe1 ms4760 locus and in vitro QN sensitivity data were obtained for 51 isolates. Parasite growth was assessed in the field using the HRP2 immunodetection assay. Results Significant associations were found between polymorphisms at pfnhe1 microsatellite ms4760 and susceptibility to QN. Isolates with two or more DNNND exhibited much lower susceptibility to QN than those harbouring zero or one DNNND repeats (median IC50 of 682 nM versus median IC50 of 300 nM; p = 0.0146 while isolates with one NHNDNHNNDDD repeat presented significantly reduced QN susceptibility than those who had two (median IC50 of 704 nM versus median IC50 of 375 nM; p pfcrt76T and wild-type pfmdr1 (> 95% thus preventing analysis of associations with these mutations. Interestingly, area with the highest median QN IC50 showed also the highest percentage of isolates carrying the pfnhe1 haplotype 7. Conclusions The haplotype 7 which is the typical Asian profile is likely well-adapted to high drug pressure in this area and may constitute a good genetic marker to evaluate the dissemination of QNR in this part of the world.

The use of public participation and economic appraisal for public involvement in large-scale hydropower projects: Case study of the Nam Theun 2 Hydropower Project

International Nuclear Information System (INIS)

Mirumachi, Naho; Torriti, Jacopo

2012-01-01

Gaining public acceptance is one of the main issues with large-scale low-carbon projects such as hydropower development. It has been recommended by the World Commission on Dams that to gain public acceptance, public involvement is necessary in the decision-making process (). As financially-significant actors in the planning and implementation of large-scale hydropower projects in developing country contexts, the paper examines the ways in which public involvement may be influenced by international financial institutions. Using the case study of the Nam Theun 2 Hydropower Project in Laos, the paper analyses how public involvement facilitated by the Asian Development Bank had a bearing on procedural and distributional justice. The paper analyses the extent of public participation and the assessment of full social and environmental costs of the project in the Cost-Benefit Analysis conducted during the project appraisal stage. It is argued that while efforts were made to involve the public, there were several factors that influenced procedural and distributional justice: the late contribution of the Asian Development Bank in the project appraisal stage; and the issue of non-market values and discount rate to calculate the full social and environmental costs. - Highlights: ► Public acceptance in large-scale hydropower projects is examined. ► Both procedural and distributional justice are important for public acceptance. ► International Financial Institutions can influence the level of public involvement. ► Public involvement benefits consideration of non-market values and discount rates.

Report of year 2000 version on feasibility study. Feasibility study on the diffusion of fluidized bed cement kiln system in Socialist Republic of Viet Nam

Energy Technology Data Exchange (ETDEWEB)

NONE

2000-03-01

Evaluations were given on the possibility of saving energies and reducing CO2 emission by renewing the shaft kilns operated in four factories in Viet Nam into fluidized bed kilns. The feasibility study is intended to be linked to the clean development mechanism (CDM) in the future. The fluidized bed kiln is a most advanced technology developed to deal with social, economic and technological demands such as global environment preservation, energy conservation, effective utilization of resources, enhancement of economic performance, and diversification of cement needs. The technology is capable of largely reducing greenhouse effect gases, eliminating the problem of dust scattering from sintering facilities, producing stabilized and high-quality clinker, making possible of using inexpensive fuels including low-order coal, using less installation space, and reducing the production cost. The amount of energy reduction in all of the four factories is calculated 8,101 to 9,551 toe/year at an energy saving effect rate of 37 to 44%. CO2 emission is reduced as a result of reduction in fuel for sintering furnaces and in electric power consumption. The reduction amount would be 24,393 to 38,794 tons/year (converted into CO2), and the reduction effect rate would be 36 to 44%. The investment effect looks sufficient as payout of 10 to 12 years if the environment special Yen loan is used. Trial calculation was also performed for the nation-wide proliferation effect. (NEDO)

Biofabrication of a novel biomolecule-assisted reduced graphene oxide: an excellent biocompatible nanomaterial

Directory of Open Access Journals (Sweden)

Zhang X

2016-12-01

Full Text Available Xi-Feng Zhang,1 Sangiliyandi Gurunathan2 1College of Biological and Pharmaceutical Engineering, Wuhan Polytechnic University, Wuhan, People’s Republic of China; 2Department of Stem Cell and Regenerative Biotechnology, Konkuk University, Seoul, Republic of Korea Abstract: Graphene has been shown much interest, both in academics and industry due to its extraordinary physical, chemical, and biological proprieties. It shows great promises in biotechnological and biomedical applications as an antibacterial and anticancer agent, nanocarrier, sensor, etc. However, many studies demonstrated the toxicity of graphene in several cell lines, which is an obstacle to its use in biomedical applications. In this study, to improve the biocompatibility of graphene, we used nicotinamide (NAM as a reducing and stabilizing agent to catalyze the reduction of graphene oxide (GO to reduced graphene oxide (rGO. The resulted smaller-sized GO (NAM-rGO showed excellent biocompatibility with mouse embryonic fibroblast cells, evidenced by various cellular assays. Furthermore, NAM-rGO had no effect on mitochondrial membrane permeability and caspase-3 activity compared to GO. Reverse transcription polymerase chain reaction analysis allowed us to identify the molecular mechanisms responsible for NAM-rGO-induced biocompatibility. NAM-rGO significantly induced the expression of genes encoding tight junction proteins (TJPs such as zona occludens-1 (Tjp1 and claudins (Cldn3 without any effect on the expression of cytoskeleton proteins. Furthermore, NAM-rGO enhances the expression of alkaline phosphatase (ALP gene, and it does this in a time-dependent manner. Overall, our study depicted the molecular mechanisms underlying NAM-rGO biocompatibility depending on upregulation of TJPs and ALP. This potential quality of graphene could be used in diverse applications including tissue regeneration and tissue engineering. Keywords: biocompatibility, graphene oxide, nicotinamide, reduced

The Caenorhabditis elegans nicotinamidase PNC-1 enhances survival.

Science.gov (United States)

van der Horst, Armando; Schavemaker, Jolanda M; Pellis-van Berkel, Wendy; Burgering, Boudewijn M T

2007-04-01

In yeast, increasing the copy number of the nicotinamide adenine dinucleotide (NAD)-dependent deacetylase Sir2 extends lifespan, which can be inhibited by nicotinamide (Nam), the end-product of Sir2-mediated NAD-breakdown. Furthermore, the yeast pyrazinamidase/nicotinamidase PNC-1 can extend yeast lifespan by converting Nam. In Caenorhabditis elegans (C. elegans), increased dosage of the gene encoding SIR-2.1 also increases lifespan. Here, we report that knockdown of the C. elegans homologue of yeast PNC-1 as well as growing worms on Nam-containing medium significantly decreases adult lifespan. Accordingly, increased gene dosage of pnc-1 increases adult survival under conditions of oxidative stress. These data show for the first time the involvement of PNC-1/Nam in the survival of a multicellular organism and may also contribute to our understanding of lifespan regulation in mammals.

Economy of Vietnam

OpenAIRE

Adam McCarty

2001-01-01

Viet Nam was a country ruled by colonists, divided, or at war for most of the 20th century. Unification of the country in 1976 was followed by the invasion of Cambodia in 1978, and a subsequent brief but violent war with the People’s Republic of China. This legacy had profound consequences for economic development in general and for attempts to impose central planning in particular. Central planning was introduced in North Viet Nam in the 1950s, and in South Viet Nam after 1976, but less exte...

Petrochemistry and zircon U-Pb geochronology of granitic rocks in the Wang Nam Khiao area, Nakhon Ratchasima, Thailand: Implications for petrogenesis and tectonic setting

Science.gov (United States)

Fanka, Alongkot; Tsunogae, Toshiaki; Daorerk, Veerote; Tsutsumi, Yukiyasu; Takamura, Yusuke; Sutthirat, Chakkaphan

2018-05-01

Carboniferous biotite granite, Late Permian hornblende granite, and Triassic biotite-hornblende granite, all of which belong to the Eastern Granite Belt, expose in the Wang Nam Khiao area, Nakhon Ratchasima, northeastern Thailand. The Carboniferous biotite granite is dominated by quartz, K-feldspar, plagioclase, and biotite. The Late Permian hornblende granite contains dominant assemblages of plagioclase, quartz, K-feldspar, hornblende, and minor amount of biotite, while the Triassic biotite-hornblende granite consists of quartz, plagioclase, K-feldspar with small amounts of biotite, and hornblende. The REE patterns with steep decrease from light to heavy REE together with the LILE (e.g. K, Sr) enrichment and depletion of some particular HFSE (e.g. Nb, Ti) indicate low degree of partial melting. Mineral chemistry of biotite and hornblende in the granites reflects crystallization from hydrous calc-alkaline arc-derived magmas possibly formed by subduction. Amphibole-plagioclase thermometry and Al-in-hornblende barometry indicate that the Late Permian hornblende granite and the Triassic biotite-hornblende granite may have equilibrated at 3.0-5.8 kbar/700-820 °C and 2.0-3.2 kbar/600-750 °C, respectively, in the middle-upper crust (about 10-15 km depth). Zircon U-Pb geochronology of the Carboniferous biotite granite, Late Permian hornblende granite and Triassic biotite-hornblende granite yielded intrusion ages of 314.6-284.9 Ma, 253.4 Ma, and 237.8 Ma, respectively, which implies multiple episodes of arc-magmatism formed by Palaeo-Tethys subduction beneath Indochina Terrane during Late Carboniferous/Early Permian, Late Permian and Middle Triassic.

Research and Policy on Parallel Courses

International Development Research Centre (IDRC) Digital Library (Canada)

Karen Kershaw

Despite its still considerable economic and social problems ... Some 80% of the Viet Nam's 80 million citizens live in rural ... successor, the five-year Viet Nam Economic and .... system and was therefore in need of research to guide its reforms.

The Norm Activation Model: An exploration of the functions of anticipated pride and guilt in environmental behaviour

NARCIS (Netherlands)

Onwezen, M.C.; Antonides, G.; Bartels, J.

2013-01-01

The Norm Activation Model (NAM; Schwartz, 1977) is a vested model that explains altruistic and environmentally friendly behaviour. Although research states that anticipated pride and guilt are associated with the NAM, these associations are not yet fully understood. The current study provides an

The Norm Activation Model: An exploration of the functions of anticipated pride and guilt in pro-environmental behaviour

NARCIS (Netherlands)

Onwezen, M.C.; Antonides, G.; Bartels, J.

2013-01-01

The Norm Activation Model (NAM; Schwartz, 1977) is a vested model that explains altruistic and environmentally friendly behaviour. Although research states that anticipated pride and guilt are associated with the NAM, these associations are not yet fully understood. The current study provides an

Arsenic and other trace elements in groundwater and human urine in Ha Nam province, the Northern Vietnam: contamination characteristics and risk assessment.

Science.gov (United States)

Pham, Long Hai; Nguyen, Hue Thi; Van Tran, Cuong; Nguyen, Ha Manh; Nguyen, Tung Hoang; Tu, Minh Binh

2017-06-01

The contamination characteristics of arsenic and other trace elements in groundwater and the potential risks of arsenic from the groundwater were investigated. Elevated contamination of arsenic, barium and manganese was observed in tube-well water of two villages (Chuyen Ngoai and Chau Giang) in Ha Nam province in the Northern Vietnam. Concentrations of As in the groundwater ranged from 12.8 to 884 µg/L with mean values in Chuyen Ngoai and Chau Giang were 614.7 and 160.1 µg/L, respectively. About 83 % of these samples contained As concentrations exceeding WHO drinking water guideline of 10 μg/L. The mean values of Mn and Ba in groundwater from Chuyen Ngoai and Chau Giang were 300 and 657 μg/L and 650 and 468 μg/L, respectively. The mean value of Ba concentration in groundwater in both Chuyen Ngoai and Chau Giang was about 22 % of the samples exceeded the WHO guideline (700 µg/L). Arsenic concentrations in human urine of residents from Chuyen Ngoai and Chau Giang were the range from 8.6 to 458 µg/L. The mean values of Mn and Ba in human urine of local people from Chuyen Ngoai were 46.9 and 62.8 μg/L, respectively, while those in people from Chau Giang were 25.9 and 45.9 μg/L, respectively. The average daily dose from ingesting arsenic for consuming both untreated and treated groundwater is from 0.02 to 11.5 and 0.003 to 1.6 μg/kg day, respectively. Approximately, 57 % of the families using treated groundwater and 64 % of the families using untreated groundwater could be affected by elevated arsenic exposure.

Roles of surface water areas for water and solute cycle in Hanoi city, Viet Nam

Science.gov (United States)

Hayashi, Takeshi; Kuroda, Keisuke; Do Thuan, An; Tran Thi Viet, Nga; Takizawa, Satoshi

2013-04-01

Hanoi city, the capital of Viet Nam, has developed beside the Red river. Recent rapid urbanization of this city has reduced a large number of natural water areas such as lakes, ponds and canals not only in the central area but the suburban area. Contrary, the urbanization has increased artificial water areas such as pond for fish cultivation and landscaping. On the other hand, the urbanization has induced the inflow of waste water from households and various kinds of factories to these water areas because of delay of sewerage system development. Inflow of the waste water has induced eutrophication and pollution of these water areas. Also, there is a possibility of groundwater pollution by infiltration of polluted surface water. However, the role of these water areas for water cycle and solute transport is not clarified. Therefore, this study focuses on the interaction between surface water areas and groundwater in Hanoi city to evaluate appropriate land development and groundwater resource management. We are carrying out three approaches: a) understanding of geochemical characteristics of surface water and groundwater, b) monitoring of water levels of pond and groundwater, c) sampling of soil and pond sediment. Correlation between d18O and dD of precipitation (after GNIP), the Red River (after GNIR) and the water samples of this study showed that the groundwater is composed of precipitation, the Red River and surface water that has evaporation process. Contribution of the surface water with evaporation process was widely found in the study area. As for groundwater monitoring, the Holocene aquifers at two sites were in unconfined condition in dry season and the groundwater levels in the aquifer continued to increase through rainy season. The results of isotopic analysis and groundwater level monitoring showed that the surface water areas are one of the major groundwater sources. On the other hand, concentrations of dissolved Arsenic (filtered by 0.45um) in the pore

Atmospheric behaviors of polycyclic aromatic hydrocarbons at a Japanese remote background site, Noto peninsula, from 2004 to 2014

Science.gov (United States)

Tang, Ning; Hakamata, Mariko; Sato, Kousuke; Okada, Yumi; Yang, Xiaoyang; Tatematsu, Michiya; Toriba, Akira; Kameda, Takayuki; Hayakawa, Kazuichi

2015-11-01

Total suspended particulates were collected at a Japanese remote background site (Noto Air Monitoring Station; NAMS) on the Noto Peninsula from September 2004 to June 2014. Nine polycyclic aromatic hydrocarbons (PAHs) in the particulates (fluoranthene, pyrene, benz[a]anthracene, chrysene, benzo[b]fluoranthene, benzo[k]fluoranthene, benzo[a]pyrene, benzo[ghi]perylene and indeno[1,2,3-cd]pyrene) were determined by HPLC with fluorescence detection. The mean total concentrations of the nine PAHs in the cold season (November to May for the years 2004-2014) was 670 pg m-3 (range 37-4100 pg m-3). The mean total concentration in the warm season (June to October for the same period) was 170 pg m-3 (range 31-960 pg m-3). The atmospheric PAH level at NAMS decreased in recent years, although no significant change was found in the warm season. An analysis of meteorological conditions showed that the atmospheric PAHs at NAMS were long range transported from Northeast China in the cold seasons and were contributed to by Japanese domestic sources in the warm seasons. Lower concentration ratios of reactive PAHs to their isomers at NAMS also supported these results. Activities associated with the Beijing Olympic and Paralympic Games in 2008 and reconstruction after the 2007 Noto Hanto earthquake may have contributed to the yearly variations of atmospheric PAH levels at NAMS during the period 2007-2009. Source control measures implemented by the Chinese and Japanese governments appear to have been effective in decreasing the atmospheric PAH levels at NAMS in recent years.

Main: 1UT7 [RPSD[Archive

Lifescience Database Archive (English)

Full Text Available 1UT7 シロイヌナズナ Arabidopsis Arabidopsis thaliana (L.) Heynh. Nac-Domain Containing Pro... Meristem Protein; Synonym: Nam, Anac, Abscisic Acid Responsive Nac, Dicyanoaurate Derivative; Chain: A, B; ...Fragment: Dna-Binding Nac Domain, Residues 1-168; Engineered: Yes; Other_details:...A.Ernst, A.N.Olsen, K.Skriver, S.Larsen, L.Lo Leggio Structure Of The Conserved Domain Of Anac, A Member Of ... Transcription Factor, Dna Binding, Abscisic Acid Response, Arabidopsis Thaliana, Crystal Structure, Nac Domai

The degree of doubly charged cation binding in solutions of (co)polymers of 2-acrylamido-2-methylpropanesulfonic acid salts

International Nuclear Information System (INIS)

Kurenkov, V.F.; Kolesnikova, I.Yu.; Antonovich, O.A.

2002-01-01

The degree of binding the ions of the alkaline-earth metals (M = Mg, Ca, Sr, Ba) by the polysulfate anions in the aqueous solutions of the polymers of the 2-acrylamido-2-methylpropanesulfonic acid (N-AMS) salts and their binary copolymers with the acrylamide (AA) and N-vinylpyrrolidone (VP) is quantitatively evaluated through the Terayama and Wall viscosimetric method. It is established, that the degree of binding decreases in the Sr>Ca>Mg sequence for the N-AMS polymer salts and in the reverse sequence (Mg>Ca>Sr(Ba)) for the binary copolymers of the N-AMS salts with AA and VP [ru

Situation of the Kinh poor and minority women and their use of the Maternal Care and Family Planning Service in Nam Dong Mountainous District, Thuathien-Hue Province, Vietnam.

Science.gov (United States)

Vo Van, T; Hoat, L N; Jan van Schie, T

2004-01-01

This study aimed to determine the barriers to the use of maternal care and family planning (MCFP) services by the disadvantaged Kinh people and Katu ethnic minority people in the remote and mountainous area of Nam Dong District in Central Vietnam. A survey was conducted using a random sample of 420 mothers with at least one child under the age of 5 years. These data were supplemented by interviews with key informants, focus group discussions and observations. Many barriers were identified. The difficulty of the terrain made travel to healthcare centers difficult. The cost of treatment was a barrier for the poorest people. The quality of the services and facilities, as well as the management of these services was perceived to be unsatisfactory. Traditional practices were often described as being contrary to the doctor's advice, and were presented as the reason for unsafe and unassisted home deliveries. Communication was difficult because of the minority languages of the client groups, the prevalence of illiteracy, and the absence of mass communication in this region. Finally, consulting a male healthcare worker was reported to bring the women shame. There is an urgent need for the MCFP services to build both clinical capacity and health promotion activities in a way that is gender sensitive, cognisant of traditional practices and accessible by both illiterate and minority language speaking people.

Intracellular delivery of oligonucleotides in Helicobacter pylori by fusogenic liposomes in the presence of gastric mucus.

Science.gov (United States)

Santos, Rita S; Dakwar, George R; Zagato, Elisa; Brans, Toon; Figueiredo, Céu; Raemdonck, Koen; Azevedo, Nuno F; De Smedt, Stefaan C; Braeckmans, Kevin

2017-09-01

The rising antimicrobial resistance contributes to 25000 annual deaths in Europe. This threat to the public health can only be tackled if novel antimicrobials are developed, combined with a more precise use of the currently available antibiotics through the implementation of fast, specific, diagnostic methods. Nucleic acid mimics (NAMs) that are able to hybridize intracellular bacterial RNA have the potential to become such a new class of antimicrobials and additionally could serve as specific detection probes. However, an essential requirement is that these NAMs should be delivered into the bacterial cytoplasm, which is a particular challenge given the fact that they are charged macromolecules. We consider these delivery challenges in relation to the gastric pathogen Helicobacter pylori, the most frequent chronic infection worldwide. In particular, we evaluate if cationic fusogenic liposomes are suitable carriers to deliver NAMs across the gastric mucus barrier and the bacterial envelope. Our study shows that DOTAP-DOPE liposomes post-PEGylated with DSPE-PEG (DSPE Lpx) can indeed successfully deliver NAMs into Helicobacter pylori, while offering protection to the NAMs from binding and inactivation in gastric mucus isolated from pigs. DSPE Lpx thus offer exciting new possibilities for in vivo diagnosis and treatment of Helicobacter pylori infections. Copyright © 2017 Elsevier Ltd. All rights reserved.

Sadhana | Indian Academy of Sciences

Indian Academy of Sciences (India)

Permanent link: https://www.ias.ac.in/article/fulltext/sadh/040/08/2411-2428. Keywords. Conceptual hydrological NAM model; calibration; sensitivity analysis; validation; Tapi basin; Purna catchment. Abstract. In present study, a lumped conceptual hydrological model, NAM (MIKE11), is calibrated while optimizing the runoff ...

Search Results | Page 816 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 8151 - 8160 of 8491 ... Marketing Information Products and Services: A Primer for Librarians and Information Professionals. Library and ... Viet Nam at the Crossroads: The Role of Science and Technology. Viet Nam continues ... The literature in this area, however, examines these issues strictly within national contexts.

The response of future projections of the North American monsoon when combining dynamical downscaling and bias correction of CCSM4 output

Science.gov (United States)

Meyer, Jonathan D. D.; Jin, Jiming

2017-07-01

A 20-km regional climate model (RCM) dynamically downscaled the Community Climate System Model version 4 (CCSM4) to compare 32-year historical and future "end-of-the-century" climatologies of the North American Monsoon (NAM). CCSM4 and other phase 5 Coupled Model Intercomparison Project models have indicated a delayed NAM and overall general drying trend. Here, we test the suggested mechanism for this drier NAM where increasing atmospheric static stability and reduced early-season evapotranspiration under global warming will limit early-season convection and compress the mature-season of the NAM. Through our higher resolution RCM, we found the role of accelerated evaporation under a warmer climate is likely understated in coarse resolution models such as CCSM4. Improving the representation of mesoscale interactions associated with the Gulf of California and surrounding topography produced additional surface evaporation, which overwhelmed the convection-suppressing effects of a warmer troposphere. Furthermore, the improved land-sea temperature gradient helped drive stronger southerly winds and greater moisture transport. Finally, we addressed limitations from inherent CCSM4 biases through a form of mean bias correction, which resulted in a more accurate seasonality of the atmospheric thermodynamic profile. After bias correction, greater surface evaporation from average peak GoC SSTs of 32 °C compared to 29 °C from the original CCSM4 led to roughly 50 % larger changes to low-level moist static energy compared to that produced by the downscaled original CCSM4. The increasing destabilization of the NAM environment produced onset dates that were one to 2 weeks earlier in the core of the NAM and northern extent, respectively. Furthermore, a significantly more vigorous NAM signal was produced after bias correction, with >50 mm month-1 increases to the June-September precipitation found along east and west coasts of Mexico and into parts of Texas. A shift towards more

Tirapazamine vs carbogen and nicotinamide with fractionated irradiation. What is the optimum time of giving tirapazamine during the course of irradiation?

International Nuclear Information System (INIS)

Elsaid, A.A.; Menke, D.; Dorie, M.J.; Brown, J.M.

1996-01-01

Purpose: 1) To compare in a fractionated regimen, with clinically relevant radiation doses, using human tumor xenografts, two radiation response modifiers that function by different mechanisms: A) Tirapazamine (TPZ), a bioreductive drug of the benzotriazine-di-N-oxide class which shows a highly selective cytotoxicity for hypoxic cells. B) Nicotinamide (NAM), an amide of vitamin B 3 , with Carbogen breathing (CBG), a combination that has been shown to reduce both acute (perfusion-limited) hypoxia and chronic (diffusion-limited) hypoxia. 2) To determine the optimum time of giving TPZ during the course of irradiation (XRT). Materials and Methods: Cell survival assays were used to examine the response of two different human tumor xenografts: FaDu, a carcinoma of the head and neck, and HT29, a colon carcinoma, in SCID mice. Growth delay studies were performed with the FaDu tumor to compare the following treatments: TPZ with XRT, NAM + CBG with XRT, and TPZ + NAM + CBG with XRT. Clinical phase I studies of TPZ have been completed and suggest that a fractionated course of 3 fractions/week of TPZ is tolerable at an effective cytotoxic dose. However, if hypoxic cells are present in the tumor on the days that TPZ is not given (i.e. rehypoxiation has occurred) then this will reduce the effectiveness of the drug-radiation combination. To investigate this we have given CBG and NAM on the days TPZ is not given with fractionated irradiation. The fractionated irradiation schedule consisted of 2.0 or 2.5 Gy once or twice daily for one or two weeks with and without drug pre treatment. TPZ was given i.p. at 0.08 mmol/kg 30 min before irradiation for the whole course, or for 3 fractions per week alone, or with 2 fractions per week of NAM and CBG. NAM was given i.p. at 1000 mg/kg, 1 hr prior to irradiation, with CBG exposure 5 min. prior to and during the irradiation. Another growth delay study is being performed to investigate which schedule produces the most enhancement: TPZ during

Application of the Consolidated Framework for Implementation Research to assess factors that may influence implementation of tobacco use treatment guidelines in the Viet Nam public health care delivery system.

Science.gov (United States)

VanDevanter, Nancy; Kumar, Pritika; Nguyen, Nam; Nguyen, Linh; Nguyen, Trang; Stillman, Frances; Weiner, Bryan; Shelley, Donna

2017-02-28

Services to treat tobacco dependence are not readily available to smokers in low-middle income countries (LMICs) where smoking prevalence remains high. We are conducting a cluster randomized controlled trial comparing the effectiveness of two strategies for implementing tobacco use treatment guidelines in 26 community health centers (CHCs) in Viet Nam. Guided by the Consolidated Framework for Implementation Research (CFIR), prior to implementing the trial, we conducted formative research to (1) identify factors that may influence guideline implementation and (2) inform further modifications to the intervention that may be necessary to translate a model of care delivery from a high-income country (HIC) to the local context of a LMIC. We conducted semi-structured qualitative interviews with CHC medical directors, health care providers, and village health workers (VHWs) in eight CHCs (n = 40). Interviews were transcribed verbatim and translated into English. Two qualitative researchers used both deductive (CFIR theory driven) and inductive (open coding) approaches to analysis developed codes and themes relevant to the aims of this study. The interviews explored four out of five CFIR domains (i.e., intervention characteristics, outer setting, inner setting, and individual characteristics) that were relevant to the analysis. Potential facilitators of the intervention included the relative advantage of the intervention compared with current practice (intervention characteristics), awareness of the burden of tobacco use in the population (outer setting), tension for change due to a lack of training and need for skill building and leadership engagement (inner setting), and a strong sense of collective efficacy to provide tobacco cessation services (individual characteristics). Potential barriers included the perception that the intervention was more complex (intervention characteristic) and not necessarily compatible (inner setting) with current workflows and staffing

Asian Partnership for Avian Influenza Research : Effectiveness of ...

International Development Research Centre (IDRC) Digital Library (Canada)

... Indonesia, Thailand and Viet Nam for collaboration on research and research capacity building in avian influenza prevention and control. This grant will allow APAIR to investigate the effectiveness of the measures employed by China, Thailand and Viet Nam and evaluate the factors contributing to their success or failure.

Assessing the impact of climate change on the water intake of the headworks on the Red River Basin in Viet Nam

Directory of Open Access Journals (Sweden)

Pham Thi Huong Lan

2017-01-01

Full Text Available The irrigation systems for the Red River Delta usually get water by pumping and gravity.The results determine the possible minimum water level line in the dry-season months under climate change scenarios (B2, SC5 and SC6 and current scenario is B2, SC4 on the river system of the Red River – Thai Binh River in study areas of project as below: Water levels on the Red River in the dry season under climate change scenarios significantly reduced compared with 2010. At Ha Noi station on Red River, the water levels reduce in 2050 about 6.5cm (B2 and 7.5cm (A2 and 6cm (B1. At Nam Dinh station on Dao River, the water levels reduce in 2050 about 4cm (B2 and 5cm (A2 and 3cm (B1. At Cat Khe on Thai Binh River, the water levels reduce in 2050 about 2cm (B2 and 3cm (A2 and 1.5cm (B1. At An Bai on Kinh Thay River, the water levels reduce in 2050 about 5cm (B2 and 6cm (A2 and 4cm (B1. At Truc Phuong on Ninh Co River, the water levels reduce in 2050 about 6.5cm (B2 and 7.2cm (A2 and 5.8cm (B1. In the scenario in which 50% of the socio-economic development plans are achieved (SC6, the water demand is lower than the scenario of full development (SC5. The decrease in the average water level in the whole Red River system is about 1.3-1.8 cm less than in SC5, and in Thai Binh river this figure is about 1.4-2.1cm. The lowering of the water level under climate change in the river has caused problems for irrigation during the dry season, in order to reach the target level in Hanoi.

OGLAŠEVANJE NA FACEBOOKU

OpenAIRE

Renko, Katica

2013-01-01

V magistrskem delu smo se seznanili z oglaševanjem na Facebooku. S pregledom gradiva, ki nam je ponujeno, smo preverili pogoje, načine, oblike … oglaševanja, ki pa smo jih s pregledom situacije v praksi preverili in dopolnili. Ob zaključku dela lahko rečemo, da je oglaševanje preko FB enostavnejše, cenejše, dostopnejše, omogoča nam ažurnost in samo komunikacijo z naslovniki, ki so potencialni kupci naših ponudb. Množični mediji nam omogočajo mnogotero obliko oglaševanja. Izbrana oblika ponuja...

Water in Pyroxene and Olivine from Martian Meteorites

Science.gov (United States)

Peslier, A. H.

2012-01-01

Water in the interior of terrestrial planets can be dissolved in fluids or melts and hydrous phases, but can also be locked as protons attached to structural oxygen in lattice defects in nominally anhydrous minerals (NAM) like olivine, pyroxene, or feldspar [1-3]. Although these minerals contain only tens to hundreds of ppm H2O, this water can amount to at least one ocean in mass when added at planetary scales because of the modal dominance of NAM in the mantle and crust [4]. Moreover these trace amounts of water can have drastic effects on melting temperature, rheology, electrical and heat conductivity, and seismic wave attenuation [5]. There is presently a debate on how much water is present in the martian mantle. Secondary ionization mass spectrometry (SIMS) studies of NAM [6], amphiboles and glass in melt inclusions [7-10], and apatites [11, 12] from Martian meteorites report finding as much water as in the same phases from Earth's igneous rocks. Most martian hydrous minerals, however, generally have the relevant sites filled with Cl and F instead of H [13, 14], and experiments using Cl [15] in parent melts can reproduce Martian basalt compositions as well as those with water [16]. We are in the process of analyzing Martian meteorite minerals by Fourier transform infrared spectrometry (FTIR) in order to constrain the role of water in this planet s formation and magmatic evolution

TRAINING TYPIST IN THE INDUSTRIAL ENVIRONMENT, AN EVALUATIONAL REPORT.

Science.gov (United States)

BALL, SAMUEL

THE NATIONAL ASSOCIATION OF MANUFACTURERS (NAM) HELD FOUR TYPING LABORATORIES IN 1965 AND 1966 AT NAM HEADQUARTERS (NEW YORK CITY), COLLEGE LIFE INSURANCE COMPANY (INDIANAPOLIS), CHEMICAL BANK NEW YORK TRUST COMPANY (NEW YORK CITY), AND PACIFIC TELEPHONE AND TELEGRAPH COMPANY (SAN FRANCISCO) TO DEVELOP A SYSTEM OF TRAINING TYPISTS WITHIN THE…

Urinary Excretion of Niacin Metabolites in Humans After Coffee Consumption.

Science.gov (United States)

Kremer, Jonathan Isaak; Gömpel, Katharina; Bakuradze, Tamara; Eisenbrand, Gerhard; Richling, Elke

2018-04-01

Coffee is a major natural source of niacin in the human diet, as it is formed during coffee roasting from the alkaloid trigonelline. The intention of our study was to monitor the urinary excretion of niacin metabolites after coffee consumption under controlled diet. We performed a 4-day human intervention study on the excretion of major niacin metabolites in the urine of volunteers after ingestion of 500 mL regular coffee containing 34.8 μmol nicotinic acid (NA) and 0.58 μmol nicotinamide (NAM). In addition to NA and NAM, the metabolites N 1 -methylnicotinamide (NMNAM), N 1 -methyl-2-pyridone-5-carboxamide (2-Py), and nicotinuric acid (NUA) were identified and quantified in the collected urine samples by stable isotope dilution analysis (SIVA) using HPLC-ESI-MS/MS. Rapid urinary excretion was observed for the main metabolites (NA, NAM, NMNAM, and 2-Py), with t max values within the first hour after ingestion. NUA appeared in traces even more rapidly. In sum, 972 nmol h -1 of NA, NAM, NMNAM, and 2-Py were excreted within 12 h after coffee consumption, corresponding to 6% of the ingested NA and NAM. The results indicate regular coffee consumption to be a source of niacin in human diet. © 2018 The Authors. Published by WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

Nicotinamide supplementation phenocopies SIR2 inactivation by modulating carbon metabolism and respiration during yeast chronological aging.

Science.gov (United States)

Orlandi, Ivan; Pellegrino Coppola, Damiano; Strippoli, Maurizio; Ronzulli, Rossella; Vai, Marina

2017-01-01

Nicotinamide (NAM), a form of vitamin B 3 , is a byproduct and noncompetitive inhibitor of the deacetylation reaction catalyzed by Sirtuins. These represent a family of evolutionarily conserved NAD + -dependent deacetylases that are well-known critical regulators of metabolism and aging and whose founding member is Sir2 of Saccharomyces cerevisiae. Here, we investigated the effects of NAM supplementation in the context of yeast chronological aging, the established model for studying aging of postmitotic quiescent mammalian cells. Our data show that NAM supplementation at the diauxic shift results in a phenocopy of chronologically aging sir2Δ cells. In fact, NAM-supplemented cells display the same chronological lifespan extension both in expired medium and extreme Calorie Restriction. Furthermore, NAM allows the cells to push their metabolism toward the same outcomes of sir2Δ cells by elevating the level of the acetylated Pck1. Both these cells have the same metabolic changes that concern not only anabolic pathways such as an increased gluconeogenesis but also respiratory activity in terms both of respiratory rate and state of respiration. In particular, they have a higher respiratory reserve capacity and a lower non-phosphorylating respiration that in concert with a low burden of superoxide anions can affect positively chronological aging. Copyright © 2016 The Authors. Published by Elsevier B.V. All rights reserved.

Livres | Page 24 | CRDI - Centre de recherches pour le ...

International Development Research Centre (IDRC) Digital Library (Canada)

Couverture du livre Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and Impact. Socioeconomic Renovation in Viet Nam : The Origin, Evolution, and Impact of Doi Moi. Maison(s) d'édition : ISEAS, CRDI. ISBN: Épuisé. Couverture du livre Les politiques sociales transnationales : Les nouveaux défis de la ...

Treatment of bastnaesite ore from Vietnamese Socialist Republic

International Nuclear Information System (INIS)

Formanek, J.; Jerabek, J.; Jancarek, J.

1987-01-01

From the Vietnamese deposit at Nam Nam Xe Czechoslovakia imported several hundred tons of ore. Several methods of ore dressing were used: gravitational, preconcentration in electromagnetic field, magnetic separation, high-intesity electromagnetic separation. Flotation evidently was the best dressing method tried. The results are presented of testing using different flotation agents. (E.S.)

Potential relocation of climatic environments suggests high rates of climate displacement within the North American protection network.

Science.gov (United States)

Batllori, Enric; Parisien, Marc-André; Parks, Sean A; Moritz, Max A; Miller, Carol

2017-08-01

Ongoing climate change may undermine the effectiveness of protected area networks in preserving the set of biotic components and ecological processes they harbor, thereby jeopardizing their conservation capacity into the future. Metrics of climate change, particularly rates and spatial patterns of climatic alteration, can help assess potential threats. Here, we perform a continent-wide climate change vulnerability assessment whereby we compare the baseline climate of the protected area network in North America (Canada, United States, México-NAM) to the projected end-of-century climate (2071-2100). We estimated the projected pace at which climatic conditions may redistribute across NAM (i.e., climate velocity), and identified future nearest climate analogs to quantify patterns of climate relocation within, among, and outside protected areas. Also, we interpret climatic relocation patterns in terms of associated land-cover types. Our analysis suggests that the conservation capacity of the NAM protection network is likely to be severely compromised by a changing climate. The majority of protected areas (~80%) might be exposed to high rates of climate displacement that could promote important shifts in species abundance or distribution. A small fraction of protected areas (climates that represent analogs of conditions currently characterizing almost a fifth of the protected areas across NAM. However, the majority of nearest climatic analogs for protected areas are in nonprotected locations. Therefore, unprotected landscapes could pose additional threats, beyond climate forcing itself, as sensitive biota may have to migrate farther than what is prescribed by the climate velocity to reach a protected area destination. To mitigate future threats to the conservation capacity of the NAM protected area network, conservation plans will need to capitalize on opportunities provided by the existing availability of natural land-cover types outside the current network of NAM

Search Results | Page 29 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 281 - 290 of 420 ... China 73 Apply China filter · Viet Nam 44 Apply Viet Nam filter .... Indian Telecentre Academy. IDRC's telecentre.org has developed a global program in support of building the capacity of ... The Arab Reform Initiative (ARI) is a consortium of 15 members comprising Arab research and policy institutes, ...

MOVPE growth of position-controlled InGaN / GaN core-shell nanorods

Energy Technology Data Exchange (ETDEWEB)

Mandl, Martin [Osram Opto Semiconductors GmbH, Regensburg (Germany); Institut fuer Halbleitertechnik, TU Braunschweig (Germany); Schimpke, Tilman; Binder, Michael; Galler, Bastian; Lugauer, Hans-Juergen; Strassburg, Martin [Osram Opto Semiconductors GmbH, Regensburg (Germany); Wang, Xue; Ledig, Johannes; Ehrenburg, Milena; Wehmann, Hergo-Heinrich; Waag, Andreas [Institut fuer Halbleitertechnik, TU Braunschweig (Germany); Kong, Xiang; Trampert, Achim [Paul-Drude-Institut fuer Festkoerperelektronik, Berlin (Germany)

2013-07-01

Core-shell group III-nitride nano- and microrods (NAMs) enable a significant increase of the active layer area by exploiting the non-polar side facets (m-planes) and thus can potentially contribute to mitigating the so-called efficiency droop in LEDs. GaN NAMs exhibiting high aspect ratios were grown in a production-type MOVPE system. Low V/III ratio, hydrogen-rich carrier gas mixture and surfactants supported the 3D growth of the pencil-shape n-type GaN core. Desired narrow distributions of shape, diameter and height were achieved. The arrangement of the NAMs was controlled by patterns etched into SiO{sub 2} masks deposited on GaN templates. The active layer (InGaN/GaN SQW and MQWs) and the layer for the p-side were deposited with 2D-like conditions wrapped around the core. The crystalline quality of the NAMs, shell growth rates and the Indium distribution were investigated by high resolution transmission electron microscopy. Furthermore, optical emission was studied using density-dependent photoluminescence spectroscopy.

Estimation of soil respiration using automated chamber systems in an oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea.

Science.gov (United States)

Joo, Seung Jin; Park, Soon-Ung; Park, Moon-Soo; Lee, Chang Seok

2012-02-01

Soil respiration (R(soil)) is the largest component of ecosystem respiration produced by the autotrophic and heterotrophic respirations. Its variability on multiple time scales strongly depends on environmental variables such as temperature and moisture. To investigate the temporal variations of R(soil) in a cool-temperate oak (Quercus mongolica) forest at the Nam-San site in Seoul, Korea, continuous measurements of R(soil) using the automated chamber systems, air and soil temperatures and soil moisture are made for the period from April 2010 to March 2011. The observed data indicate that the R(soil) shows a remarkable seasonal variation in accordance with temperatures with high in summer and low in winter. The R(soil) is found to be strongly correlated with soil temperature (T(s)) at the 5cm depth throughout the year. However, the high fluctuation of R(soil) is found to be related with soil moisture content (M(s)) during the forest growing season. The estimated annual Q(10) value using the 1.5m-high air temperature is found to be 2.4 that is comparable with other studies in temperate forest ecosystems. The optimal regression equation of R(soil) with the T(s) at 5cm depth and the M(s) at 15cm depth is found to be R(soil)=124.3 exp (0.097T(s))-55.3 (M(s))(2)+2931.9 (M(s))-38516 for T(s)≥0°C and R(soil)=0 for T(s)soil). The annual total soil respiration estimated by the optimal regression equation is found to be 1264gCm(-2) with a maximum of 685gCm(-2) in the summer season and a minimum of 33gCm(-2) in the winter season. The present study can be implemented for the determination of the carbon balance of a cool-temperate Q. mongolica forest with the provision of photosynthesis. Copyright © 2011 Elsevier B.V. All rights reserved.

Test Event | Center for Cancer Research

Science.gov (United States)

Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

MultiDay Test | Center for Cancer Research

Science.gov (United States)

Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

Normal Test | Center for Cancer Research

Science.gov (United States)

Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

Repeat Event | Center for Cancer Research

Science.gov (United States)

Lorem ipsum dolor sit amet, consectetur adipiscing elit. Nam posuere egestas risus eget venenatis. Integer in metus a leo sodales pulvinar in sed dolor. Fusce tincidunt iaculis condimentum. Nam semper sapien nec est consequat, eu pretium arcu facilisis. Donec non viverra mauris. Pellentesque porttitor risus sit amet iaculis finibus. Ut quis justo consequat, fermentum sem in,

Search Results | Page 6 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Remove Mongolia filter Mongolia; China 367 Apply China filter · Indonesia 245 Apply Indonesia filter · Thailand 216 Apply Thailand filter · Philippines 213 Apply Philippines filter · Viet Nam 198 Apply Viet Nam filter · Cambodia 149 Apply Cambodia filter · South of Sahara 1913 Apply South of Sahara filter · North of Sahara ...

Search Results | Page 43 | IDRC - International Development ...

International Development Research Centre (IDRC) Digital Library (Canada)

Results 411 - 420 of 420 ... China 49 Apply China filter · Philippines 30 Apply Philippines filter · Viet Nam 28 Apply Viet Nam filter · Cambodia 27 Apply Cambodia filter · Thailand 26 Apply Thailand filter · Indonesia 25 Apply Indonesia filter · Laos 12 Apply Laos filter · Malaysia 12 Apply Malaysia filter · Singapore 7 Apply ...

North American Monsoon Response to Eemian Climate Forcings and its Effect on Rocky Mountain Forests

Science.gov (United States)

Insel, N.; Berkelhammer, M. B.

2017-12-01

The key to recognizing and predicting future changes in regional climate and ecosystems lies in understanding the causes and characteristics of paleovariations. The Last Interglacial (LIG: 130-116 ka) is the most recent period in Earth history when temperatures are believed to have exceeded those of today. In this study, we are focusing on the response of the North American monsoon (NAM) to shifts in orbital forcings during LIG. In particular, we are using regional climate model (RegCM) simulations under LIG (115ka, 125 ka and 135 ka) and modern forcings to evaluate changes in the strength, timing, duration, and amount of moisture transported from different sources during the NAM season. Understanding these variations is critical to forecast seasonal supply of water to the southwestern U.S. under current warming conditions. In addition, cellulose extracted stable isotopes from Rocky Mountain Eemian wood samples provides both a tool to diagnose the model simulations and to evaluate the response of western U.S. tree species to changes in temperature and moisture availability. Our preliminary results indicate enhanced summer precipitation, wind shifts and changes in NAM characteristics in response to increased Northern Hemisphere insolation. The following features were observed: (1) The NAM strengthens and extends slightly more northward during the Eemian due to a shift in upper-level divergence. (2) The onset and duration of the NAM seems to be similar between modern and Eemian simulations. (3) Consistent with modern observations, simulations suggest a western NAM region in Arizona that receives most of its monsoonal moisture from the Gulf of California, while the eastern NAM region in New Mexico obtains most of its summer rains from the Gulf of Mexico. In the Eemian, we see a spatial shift from more depleted to more enriched source waters throughout the monsoon season. These changes in the summer climate are confirmed by the tree ring isotope data, which show a

Hydrogeologic reconnaissance of the Mekong Delta in South Vietnam and Cambodia

Science.gov (United States)

Anderson, Henry R.

1978-01-01

The present report describes the results of a hydrogeologic reconnaissance in the Mekong Delta region by the writer, a hydrogeologist of the U.S. Geological Survey, while on assignment as an adviser to the Vietnamese Directorate of Water Supply from October 1968 to April 1970 under the auspices of the U.s. Agency for International Development. The delta of the Mekong River, comprising an area of about 70,000 square kilometres in South Vietnam and Cambodia, is an almost featureless plain rising gradually from sea level to about 5 metres above sea level at its apex 300 kilometres inland. Most of the shallow ground water in the Holocene Alluvium of the delta in Vietnam is brackish or saline down to depths of 50 to 100 metres. Moreover, in the Dong Thap Mu?oi (Plain of Reeds) the shallow ground water is alum-bearing. Locally, however, perched bodies of fresh ground water occur in ancient beach and dune ridges and are tapped by shallow dug wells or pits for village and domestic water supply. The Old Alluvium beneath the lower delta contains freshwater in some areas, notably in the Ca Mau Peninsula and adjacent areas, in the viciniy of Bau Xau near Saigon, and in the Tinh Long An area. Elsewhere in the lower delta both the Holocene and Old Alluvium may contain brackish or saline water from the land surface to depths of as much as 568 metres, as for example in Tinh Vinh Binh. Ground water in the outcrop area of Old Alluvium northwest of Saigon is generally fresh and potable, but high iron and low pH are locally troublesome. Although considerable exploratory drilling for ground water down to depths of as much as 568 metres has already been completed, large areas of the delta remain yet to be explored before full development of the ground-water potential can be realized. With careful development and controlled management to avoid saltwater contamination, however, it is estimated that freshwater aquifers could provide approximately 80 percent of existing needs for village

Ecologically least vulnerable sites for exploration drilling in the Wadden Sea and the North Sea coastal area

International Nuclear Information System (INIS)

Lindeboom, H.J.; Bergman, M.J.N.; De Gee, A.

1996-01-01

The Dutch Oil Company (NAM, abbreviated in Dutch) applied for a number of exploration drilling in the Dutch part of the Wadden Sea and the North Sea coastal area. NAM is obliged to draft a so-called MER (environmental impact report) to indicate the most environment-friendly alternative for the test drilling. By order of NAM, NIOZ and the IBN-DLO (Institute for Research on Forests and Nature) analyzed samples of the animal life in all the potential sites. Based on the results of the analyses, literature and expert knowledge the ecologically least vulnerable sites and the ecologically least vulnerable season were selected during a workshop. In this report the results are given of the workshop, the field sample analyses and a sailing trip along the sites

Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009-2013.

Science.gov (United States)

Dang, Tran Ngoc; Seposo, Xerxes T; Duc, Nguyen Huu Chau; Thang, Tran Binh; An, Do Dang; Hang, Lai Thi Minh; Long, Tran Thanh; Loan, Bui Thi Hong; Honda, Yasushi

2016-01-01

The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC) rule (i.e. a smaller AIC value indicates a better model). High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11-1.83; low temperature effect, RR=2.0, 95% CI=1.13-3.52), females (low temperature effect, RR=2.19, 95% CI=1.14-4.21), people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91-6.63), and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15-2.22; low temperature effect, RR=1.99, 95% CI=0.92-4.28). In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases). These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City.

Parent-youth communication and concordance between parents and adolescents on reported engagement in social relationships and sexually intimate behaviors in Ha Noi and Khanh Hoa Province, Viet Nam

Science.gov (United States)

Kaljee, Linda M.; Green, Mackenzie; Lerdboon, Porntip; Riel, Rosemary; Pham, Van; Tho, Le Huu; Ha, Nguyen T; Minh, Truong Tan; Li, Xiaoming; Chen, Xinguang; Stanton, Bonita

2010-01-01

Purpose Parent-child communication is associated with positive outcomes for youths’ engagement in sexual behaviors. Limited data are available regarding parent-child communication in transitional countries. We present data from Vietnamese parent-youth dyads on parent reproductive health knowledge, comfort of communication, frequency of talk, and discordancy between youths’ reported and parents’ perceptions for engagement in relationships and sexually intimate behaviors. Methods 185 randomly selected parent-youth dyads in four communes in Ha Noi and Khanh Hoa Province. Descriptive and comparative analysis included chi-square tests, independent samples t-tests, and ANOVA. Linear regression analysis was utilized to assess relationships between parental knowledge, level of comfort, frequency of talk, and discordancy. Results Seventy-six percent of parents and 44% of youth were female. Youth mean age was 17.2 years. For parental “reproductive health knowledge” mean score was 24.74 (SD 3.84: range 15–34). Lower parental reproductive health knowledge was positively associated with lower levels of education [F=2.983, df 184: p=0.014]. Data indicate a linear model in which knowledge is related to “comfort” (β =0.17; p=0.048) and “comfort” to frequency of “talk” (β =0.6; psexual touching (β =0.57; p=0.60). Conclusions Parent and youth in Viet Nam are engaged in limited communication about reproductive health. There is need for more data to assess the impact of these communication patterns on youths’ engagement in sexual behaviors and for development of family-centered interventions to increase parental knowledge and skills for positive communication. PMID:21338898

Changes of the uniaxial compressive strength of rocks under the dynamic load with different frequencies

Directory of Open Access Journals (Sweden)

Petr Žůrek

2005-11-01

Full Text Available Článek přináší výsledky měření série horninových vzorků na testovacím zařízení MTS 816 systém. Jednoosá tlaková pevnost při dynamickém namáhání byla zjišťována s frekvencí v rozsahu 0-100 Hz. Tyto dynamické pevnostní charakteristiky jsou srovnávány s pevnostními charakteristikami při statickém namáhání. Laboratorní výzkum při dynamickém namáhání by měl co nejvíce odpovídat charakteru namáhání hornin při seismických jevech v horském masivu. Z tohoto důvodu jsou v článku nejprve rozebrány seismické vlnové parametry při důlních otřesech a jiných seismických jevech v horském masivu.

Relative Bioavailability of Niacin Supplements for Dairy Cows: Effects of Rumen Protection and of Feed Processing.

Science.gov (United States)

Tienken, Reka; Kersten, Susanne; Hüther, Liane; Frahm, Jana; Meyer, Ulrich; Dänicke, Sven

2015-12-16

The present study aimed to examine the effective systemic bioavailability of niacin- with particular focus on its galenic form-and feed processing. Experiment 1 was conducted with 35 dairy cows to investigate the effects of various doses of oral supplemented nicotinic acid (NA) either in differing galenic forms (non-rumen protected (nRP) vs. rumen protected form (RP)) on serum niacin concentrations. Experiment 2 was designed as a pharmacokinetic study examining the serum niacin kinetics over 24 h after giving a single oral bolus of 24 g nRP or RP NA admixed in either pelleted or ground concentrate. In both experiments, only the niacin vitamer nicotinamide (NAM) was detected. Results of experiment 1 showed that both galenic forms at a dose of 24 g/cow daily elevated NAM concentrations at the beginning of the experiment. Despite a daily supplementation, NAM concentrations decreased continuously towards the end of the experiment which was more steeply in nRP NA ( p = 0.03). On experimental day 21, NAM concentrations were higher when feeding RP NA ( p = 0.03) and the highest dose (24 g/day and cow) ( p counterbalancing alterations. Pelleting seemed not to influence the relative bioavailability.

Isonicotinamide Enhances Sir2 Protein-mediated Silencing and Longevity in Yeast by Raising Intracellular NAD+ Concentration*

Science.gov (United States)

McClure, Julie M.; Wierman, Margaret B.; Maqani, Nazif; Smith, Jeffrey S.

2012-01-01

Sirtuins are an evolutionarily conserved family of NAD+-dependent protein deacetylases that function in the regulation of gene transcription, cellular metabolism, and aging. Their activity requires the maintenance of an adequate intracellular NAD+ concentration through the combined action of NAD+ biosynthesis and salvage pathways. Nicotinamide (NAM) is a key NAD+ precursor that is also a byproduct and feedback inhibitor of the deacetylation reaction. In Saccharomyces cerevisiae, the nicotinamidase Pnc1 converts NAM to nicotinic acid (NA), which is then used as a substrate by the NAD+ salvage pathway enzyme NA phosphoribosyltransferase (Npt1). Isonicotinamide (INAM) is an isostere of NAM that stimulates yeast Sir2 deacetylase activity in vitro by alleviating the NAM inhibition. In this study, we determined that INAM stimulates Sir2 through an additional mechanism in vivo, which involves elevation of the intracellular NAD+ concentration. INAM enhanced normal silencing at the rDNA locus but only partially suppressed the silencing defects of an npt1Δ mutant. Yeast cells grown in media lacking NA had a short replicative life span, which was extended by INAM in a SIR2-dependent manner and correlated with increased NAD+. The INAM-induced increase in NAD+ was strongly dependent on Pnc1 and Npt1, suggesting that INAM increases flux through the NAD+ salvage pathway. Part of this effect was mediated by the NR salvage pathways, which generate NAM as a product and require Pnc1 to produce NAD+. We also provide evidence suggesting that INAM influences the expression of multiple NAD+ biosynthesis and salvage pathways to promote homeostasis during stationary phase. PMID:22539348

Isonicotinamide enhances Sir2 protein-mediated silencing and longevity in yeast by raising intracellular NAD+ concentration.

Science.gov (United States)

McClure, Julie M; Wierman, Margaret B; Maqani, Nazif; Smith, Jeffrey S

2012-06-15

Sirtuins are an evolutionarily conserved family of NAD(+)-dependent protein deacetylases that function in the regulation of gene transcription, cellular metabolism, and aging. Their activity requires the maintenance of an adequate intracellular NAD(+) concentration through the combined action of NAD(+) biosynthesis and salvage pathways. Nicotinamide (NAM) is a key NAD(+) precursor that is also a byproduct and feedback inhibitor of the deacetylation reaction. In Saccharomyces cerevisiae, the nicotinamidase Pnc1 converts NAM to nicotinic acid (NA), which is then used as a substrate by the NAD(+) salvage pathway enzyme NA phosphoribosyltransferase (Npt1). Isonicotinamide (INAM) is an isostere of NAM that stimulates yeast Sir2 deacetylase activity in vitro by alleviating the NAM inhibition. In this study, we determined that INAM stimulates Sir2 through an additional mechanism in vivo, which involves elevation of the intracellular NAD(+) concentration. INAM enhanced normal silencing at the rDNA locus but only partially suppressed the silencing defects of an npt1Δ mutant. Yeast cells grown in media lacking NA had a short replicative life span, which was extended by INAM in a SIR2-dependent manner and correlated with increased NAD(+). The INAM-induced increase in NAD(+) was strongly dependent on Pnc1 and Npt1, suggesting that INAM increases flux through the NAD(+) salvage pathway. Part of this effect was mediated by the NR salvage pathways, which generate NAM as a product and require Pnc1 to produce NAD(+). We also provide evidence suggesting that INAM influences the expression of multiple NAD(+) biosynthesis and salvage pathways to promote homeostasis during stationary phase.

Mechanism of action of electrochemically active carbons on the processes that take place at the negative plates of lead-acid batteries

Energy Technology Data Exchange (ETDEWEB)

Pavlov, D.; Rogachev, T.; Nikolov, P.; Petkova, G. [Institute of Electrochemistry and Energy Systems, Bulgarian Academy of Sciences, Acad. G. Bonchev Street, bl. 10, Sofia 1113 (Bulgaria)

2009-06-01

It is known that negative plates of lead-acid batteries have low charge acceptance when cycled at high rates and progressively accumulate lead sulphate on high-rate partial-state-of-charge (HRPSoC) operation in hybrid-electric vehicle (HEV) applications. Addition of some carbon or graphite forms to the negative paste mix improves the charge efficiency and slows down sulfation of the negative plates. The present investigation aims to elucidate the contribution of electrochemically active carbon (EAC) additives to the mechanism of the electrochemical reactions of charge of the negative plates. Test cells are assembled with four types of EAC added to the negative paste mix in five different concentrations. Through analysis of the structure of NAM (including specific surface and pore radius measurements) and of the electrochemical parameters of the test cells on HRPSoC cycling, it is established that the electrochemical reaction of charge Pb{sup 2+} + 2e{sup -} {yields} Pb proceeds at 300-400 mV lower over-potentials on negative plates doped with EAC additives as compared to the charge potentials of cells with no carbon additives. Hence, electrochemically active carbons have a highly catalytic effect on the charge reaction and are directly involved in it. Consequently, the reversibility of the charge/discharge processes is improved, which eventually leads to longer battery cycle life. Thus, charging of the negative plates proceeds via a parallel mechanism on the surfaces of both Pb and EAC particles, at a higher rate on the EAC phase. Cells with EAC in NAM have the longest cycle life when their NAM specific surface is up to 4 m{sup 2} g{sup -1} against 0.5 m{sup 2} g{sup -1} for the lead surface. The proposed parallel mechanism of charge is verified experimentally on model Pb/EAC/PbSO{sub 4} and Pb/EAC electrodes. During the charge and discharge cycles of the HRPSoC test, the EAC particles are involved in dynamic adsorption/desorption on the lead sulfate and lead

Deciphering Natural Allelic Variation in Switchgrass for Biomass Yield and Quality Using a Nested Association Mapping Population

Energy Technology Data Exchange (ETDEWEB)

Saha, Malay C. [The Samuel Roberts Noble Foundation, Inc., Ardmore, OK (United States). Forage Improvement Division (FID); Brummer, E. Charles [The Samuel Roberts Noble Foundation, Inc., Ardmore, OK (United States); Kaeppler, Shawn [Univ. of Wisconsin, Madison, WI (United States); Bhandari, Hem S. [Univ. of Tennessee, Knoxville, TN (United States)

2016-10-28

Switchgrass (Panicum virgatum L.) is a C4 grass with high biomass yield potential and a model species for bioenergy feedstock development. Understanding the genetic basis of quantitative traits is essential to facilitate genome-enabled breeding programs. The nested association mapping (NAM) analysis combines the best features of both bi-parental and association analyses and can provide high power and high resolution in QTL detection and will ensure significant improvements in biomass yield and quality. To develop a NAM population of switchgrass, 15 highly diverse genotypes with specific characteristics were selected from a diversity panel and crossed to a recurrent parent, AP13, a genotype selected for whole genome sequencing and parent of a mapping population. Ten genotypes from each of the 15 F1 families were then chain crossed. Progenies form each family were randomly selected to develop the NAM population. The switchgrass NAM population consists of a total of 2000 genotypes from 15 families. All the progenies, founder parents, F1 parents (n=2350) were evaluated in replicated field trials at Ardmore, OK and Knoxville, TN. Phenotypic data on plant height, tillering ability, regrowth, flowering time, and biomass yield were collected. Dried biomass samples were also analyzed using prediction equations of NIRS at the Noble Foundation and for lignin content, S/G ratio, and sugar release characteristics at the NREL. Genomic shotgun sequencing of 15 switchgrass NAM founder parental genomes at JGI produced 28-66 Gb high-quality sequence data. Alignment of these sequences with the reference genome, AP13 (v3.0), revealed that up to 99% of the genomic sequences mapped to the reference genome. A total of 2,149 individuals from NAM populations were sequenced by exome capture and two sets of 15 SNP matrices (one for each family) were generated. QTL associated with important traits have been identified and verified in breeding populations. The QTL detected and their associated

Aircraft Battle Damage Repair for the 90’s and Beyond

Science.gov (United States)

1994-03-01

far greater than was the US system during the Viet - nam Conflict. In fact, the United States mounted a large-scale resupply effort to assirt the...8217,luded. The procedures restore suffi. ciezu strength to accomplish the required mnission while avoidilig unnecessar-y or cosmetic repairs. The ABDR...from a mission with structural damage. 4 As the war escalated in 1964, the Viet Cong began their attack on US Air Force bases and during the course of

Ocular dominance affects magnitude of dipole moment: an MEG study.

Science.gov (United States)

Shima, Hiroshi; Hasegawa, Mitsuhiro; Tachibana, Osamu; Nomura, Motohiro; Yamashita, Junkoh; Ozaki, Yuzo; Kawai, Jun; Higuchi, Masanori; Kado, Hisashi

2010-08-23

To investigate whether the ocular dominance affects laterality in the activity of the primary visual cortex, we examined the relationship between the ocular dominance and latency or dipole moment measured by checkerboard-pattern and magnetoencephalography in 11 right-handed healthy male participants. Participants with left-eye dominance showed a dipole moment of 21.5+/-6.1 nAm with left-eye stimulation and 16.1+/-3.6 nAm with right, whereas those with right-eye dominance showed a dipole moment of 18.0+/-5.2 and 21.5+/-2.7 nAm with left-eye and right-eye stimulation of the infero-medial quadrant visual field, respectively. Thus, the dipole moment was higher when the dominant eye was stimulated, which implies that ocular dominance is regulated by the ipsilateral occipital lobe.

Identification of entomopathogenic nematodes and symbiotic bacteria from Nam Nao National Park in Thailand and larvicidal activity of symbiotic bacteria against Aedes aegypti and Aedes albopictus.

Science.gov (United States)

Yooyangket, Temsiri; Muangpat, Paramaporn; Polseela, Raxsina; Tandhavanant, Sarunporn; Thanwisai, Aunchalee; Vitta, Apichat

2018-01-01

Entomopathogenic nematodes (EPNs) that are symbiotically associated with Xenorhabdus and Photorhabdus bacteria can kill target insects via direct infection and toxin action. There are limited reports identifying such organisms in the National Park of Thailand. Therefore, the objectives of this study were to identify EPNs and symbiotic bacteria from Nam Nao National Park, Phetchabun Province, Thailand and to evaluate the larvicidal activity of bacteria against Aedes aegypti and Ae. albopictus. A total of 12 EPN isolates belonging to Steinernema and Heterorhabditis were obtained form 940 soil samples between February 2014 and July 2016. EPNs were molecularly identified as S. websteri (10 isolates) and H. baujardi (2 isolates). Symbiotic bacteria were isolated from EPNs and molecularly identified as P. luminescens subsp. akhurstii (13 isolates), X. stockiae (11 isolates), X. vietnamensis (2 isolates) and X. japonica (1 isolate). For the bioassay, bacterial suspensions were evaluated for toxicity against third to early fourth instar larvae of Aedes spp. The larvae of both Aedes species were orally susceptible to symbiotic bacteria. The highest larval mortality of Ae. aegypti was 99% after exposure to X. stockiae (bNN112.3_TH) at 96 h, and the highest mortality of Ae. albopictus was 98% after exposure to P. luminescens subsp. akhurstii (bNN121.4_TH) at 96 h. In contrast to the control groups (Escherichia coli and distilled water), the mortality rate of both mosquito larvae ranged between 0 and 7% at 72 h. Here, we report the first observation of X. vietnamensis in Thailand. Additionally, we report the first observation of P. luminescens subsp. akhurstii associated with H. baujardi in Thailand. X. stockiae has potential to be a biocontrol agent for mosquitoes. This investigation provides a survey of the basic diversity of EPNs and symbiotic bacteria in the National Park of Thailand, and it is a bacterial resource for further studies of bioactive compounds.

Access to Anti-smoking Information among School Children and its Potential Impact on Preventing Smoking Initiation: Results from the Global Youth Tobacco Use Survey (GYTS) 2014 in Viet Nam.

Science.gov (United States)

Minh, Hoang Van; Minh, Hoang Van; Giang, Kim Bao; Hai, Phan Thi; Hoang, Trinh Dinh; Huyen, Doan Thu; Khue, Luong Ngoc; Linh, Nguyen Thuy; Lam, Nguyen Tuan; Nga, Pham Thi Quynh

2016-01-01

Scientific evidence on all aspects of smoking amongst youth is very important for designing appropriate interventions to reduce smoking among this vulnerable population. This paper describes current access to antismoking information among school children aged 13 to 15 years in Vietnam in 2014 and examines its potential impact on preventing smoking initiation. The data used in this paper were obtained from the 2014 Global Youth Tobacco Survey (GYTS) in Vietnam. Students were asked questions about their level of awareness of anti-smoking information from various sources in the past 30 days and about lessons in school regarding the dangers of tobacco use during the last 12 months. Those who have never smoked were asked "whether or not they thought about avoiding cigarettes because of health warnings on cigarette packages" and answers were analyzed in combination with data on access to anti-smoking information from other sources. The prevalence of exposure to antismoking campaigns was high among school children in Viet Nam: 55.3% of current smokers reported thoughts of smoking cessation because of health warnings on cigarette packages; 60.5% of never smokers avoided initiating smoking because of the same health warnings. The potential impact of graphic health warnings to prevent school-aged children from smoking initiation would be stronger if there was concurrent access to anti-smoking programs on the dangers of tobacco use in schools. However, school education for tobacco prevention and control has not been as strong as expected. A more comprehensive school curriculum on tobacco prevention and control is recommended to reinforce antismoking messages among school children.

The New North Korean Problem: History and Responsibilities in the Age of Kim Jong Un

Science.gov (United States)

2012-03-29

Kim Jong Un is the youngest of Kim Jong Il’s three male children. The oldest, Kim Jong Nam was once favored to...passport.49 In a series of interviews with Japanese reporter Yogi Gomi, Kim Jong Nam related his concerns about the future of North Korea and the...4. TITLE AND SUBTITLE THE NEW NORTH KOREAN PROBLEM: HISTORY AND RESPONSIBILITIES IN THE AGE OF KIM JONG UN 5. FUNDING NUMBERS

Vietnam and ASEAN: Should They Integrate?

Science.gov (United States)

2013-11-01

NOTES 1 Suiwah Leung, " Viet Nam : Economy," Europaworld Web. Accessed on August 30, 2013, http://www.europaworld.com/entry/vn.ec. 2 Ibid...2013, 1278. 9 Ibid. 10 Ibid. 11 Ibid. 12 Suiwah Leung, " Viet Nam : Economy". 13 Overview, ASEAN. Accessed on September 20, 2013, http...provide are commonly found in fertilizers, cosmetics , livestock, and plant imports. 48 Therefore, the Vietnamese Ministries of Agriculture and

Molecular dynamics simulations suggest ligand's binding to nicotinamidase/pyrazinamidase.

Science.gov (United States)

Zhang, Ji-Long; Zheng, Qing-Chuan; Li, Zheng-Qiang; Zhang, Hong-Xing

2012-01-01

The research on the binding process of ligand to pyrazinamidase (PncA) is crucial for elucidating the inherent relationship between resistance of Mycobacterium tuberculosis and PncA's activity. In the present study, molecular dynamics (MD) simulation methods were performed to investigate the unbinding process of nicotinamide (NAM) from two PncA enzymes, which is the reverse of the corresponding binding process. The calculated potential of mean force (PMF) based on the steered molecular dynamics (SMD) simulations sheds light on an optimal binding/unbinding pathway of the ligand. The comparative analyses between two PncAs clearly exhibit the consistency of the binding/unbinding pathway in the two enzymes, implying the universality of the pathway in all kinds of PncAs. Several important residues dominating the pathway were also determined by the calculation of interaction energies. The structural change of the proteins induced by NAM's unbinding or binding shows the great extent interior motion in some homologous region adjacent to the active sites of the two PncAs. The structure comparison substantiates that this region should be very important for the ligand's binding in all PncAs. Additionally, MD simulations also show that the coordination position of the ligand is displaced by one water molecule in the unliganded enzymes. These results could provide the more penetrating understanding of drug resistance of M. tuberculosis and be helpful for the development of new antituberculosis drugs.

Niacin and its metabolites as master regulators of macrophage activation.

Science.gov (United States)

Montserrat-de la Paz, Sergio; Naranjo, M Carmen; Lopez, Sergio; Abia, Rocio; Muriana, Francisco J Garcia; Bermudez, Beatriz

2017-01-01

Niacin is a broad-spectrum lipid-regulating drug used for clinical therapy of chronic high-grade inflammatory diseases. However, the mechanisms by which either niacin or the byproducts of its catabolism ameliorate these inflammatory diseases are not clear yet. Human circulating monocytes and mature macrophages were used to analyze the effects of niacin and its metabolites (NAM, NUA and 2-Pyr) on oxidative stress, plasticity and inflammatory response by using biochemical, flow cytometry, quantitative real-time PCR and Western blot technologies. Niacin, NAM and 2-Pyr significantly decreased ROS, NO and NOS2 expression in LPS-treated human mature macrophages. Niacin and NAM skewed macrophage polarization toward antiinflammatory M2 macrophage whereas a trend toward proinflammatory M1 macrophage was noted following treatment with NUA. Niacin and NAM also reduced the inflammatory competence of LPS-treated human mature macrophages and promoted bias toward antiinflammatory CD14 + CD16 ++ nonclassical human primary monocytes. This study reveals for the first time that niacin and its metabolites possess antioxidant, reprogramming and antiinflammatory properties on human primary monocytes and monocyte-derived macrophages. Our findings imply a new understanding of the mechanisms by which niacin and its metabolites favor a continuous and gradual plasticity process in the human monocyte/macrophage system. Copyright © 2016 Elsevier Inc. All rights reserved.

Managing nursing assistants with a web-based system: an empirical investigation of the mixed-staff strategy.

Science.gov (United States)

Lin, I-Chun; Hou, Ying-Hui; Huang, Hui-Ling; Chu, Tsui-Ping; Chang, Ray-E

2010-06-01

Under the global shortage of Registered Nurses (RNs), some hospitals have integrated nursing assistants (NAs) into their teams to help to provide maximum quality care for acute patients, while keeping the hospital's staff-related costs down. However, the RNs may have to shoulder an increased burden of assigning and overseeing NAs. A web-based Nursing Assistants Management System (NAMS) was developed and evaluated for a case hospital in Taiwan to compare the processes of assigning and managing NAs before and after the NAMS intervention. The results showed that NAMS saved 80% of the time needed for manual operation and there were no more complains about NAs being slow in dealing with patients after the system intervention. The satisfaction levels of all NA managers and RNs were acceptable. Based on the research findings, the implication and limitations of this study were discussed.

Stac3 is a component of the excitation-contraction coupling machinery and mutated in Native American myopathy

Science.gov (United States)

Horstick, Eric J.; Linsley, Jeremy W.; Dowling, James J.; Hauser, Michael A.; McDonald, Kristin K.; Ashley-Koch, Allison; Saint-Amant, Louis; Satish, Akhila; Cui, Wilson W.; Zhou, Weibin; Sprague, Shawn M.; Stamm, Demetra S.; Powell, Cynthia M.; Speer, Marcy C.; Franzini-Armstrong, Clara; Hirata, Hiromi; Kuwada, John Y.

2013-01-01

Excitation-contraction coupling, the process that regulates contractions by skeletal muscles, transduces changes in membrane voltage by activating release of Ca2+ from internal stores to initiate muscle contraction. Defects in EC coupling are associated with muscle diseases. Here we identify Stac3 as a novel component of the EC coupling machinery. Using a zebrafish genetic screen, we generate a locomotor mutation that is mapped to stac3. We provide electrophysiological, Ca2+ imaging, immunocytochemical and biochemical evidence that Stac3 participates in excitation-contraction coupling in muscles. Furthermore, we reveal that a mutation in human STAC3 as the genetic basis of the debilitating Native American myopathy (NAM). Analysis of NAM stac3 in zebrafish shows that the NAM mutation decreases excitation-contraction coupling. These findings enhance our understanding of both excitation-contraction coupling and the pathology of myopathies. PMID:23736855

Database Description - SAHG | LSDB Archive [Life Science Database Archive metadata

Lifescience Database Archive (English)

Full Text Available base Description General information of database Database name SAHG Alternative nam...h: Contact address Chie Motono Tel : +81-3-3599-8067 E-mail : Database classification Structure Databases - ...e databases - Protein properties Organism Taxonomy Name: Homo sapiens Taxonomy ID: 9606 Database description... Links: Original website information Database maintenance site The Molecular Profiling Research Center for D...stration Not available About This Database Database Description Download License Update History of This Database Site Policy | Contact Us Database Description - SAHG | LSDB Archive ...

Piezoelectric Nanogenerators for Self-Powered Nanosystems and Nanosensors

Science.gov (United States)

2013-05-15

researchers 1. Sangmin Lee, Sung-Hwan Bae, Long Lin, Seunghyun Ahn, Chan Park, Seung Nam Cha, Young Jun Park, Hyuk Chang, Sang-Woo Kim and...Sohn, Seung Nam Cha, Dukhyun Choi * Zhong Lin Wang * Sang-Woo Kim * “ P-Type Polymer–Hybridized High-Performance Piezoelectric Nanogenerators”, Nano...Yoon Lee, † Sang-Woo Kim , *,$ Jae-Young Choi, *,† Jong Min Kim , † and Zhong Lin Wang *, “Flexible Hybrid Multi-Type Energy Scavenger”, Energy

Military Ethics and Professionalism: A Collection of Essays

Science.gov (United States)

1981-01-01

was also affected by other elements of the Viet - nam era: military scandals; instances of junior officers and NCOs lying on reports; shootings and...soldiers in Viet - nam were reluctant to fight for "ticket-punching" officers who rotated every six months and for a system that treated them as expendable...discover training strengths and weaknesses, but junior commanders state that it is used to write their OERs. For them, the cosmetic effect of

Divergence and diversification in North American Psoraleeae (Fabaceae) due to climate change

Science.gov (United States)

Egan, Ashley N; Crandall, Keith A

2008-01-01

Background Past studies in the legume family (Fabaceae) have uncovered several evolutionary trends including differential mutation and diversification rates across varying taxonomic levels. The legume tribe Psoraleeae is shown herein to exemplify these trends at the generic and species levels. This group includes a sizable diversification within North America dated at approximately 6.3 million years ago with skewed species distribution to the most recently derived genus, Pediomelum, suggesting a diversification rate shift. We estimate divergence dates of North American (NAm) Psoraleeae using Bayesian MCMC sampling in BEAST based on eight DNA regions (ITS, waxy, matK, trnD-trnT, trnL-trnF, trnK, trnS-trnG, and rpoB-trnC). We also test the hypothesis of a diversification rate shift within NAm Psoraleeae using topological and temporal methods. We investigate the impact of climate change on diversification in this group by (1) testing the hypothesis that a shift from mesic to xeric habitats acted as a key innovation and (2) investigating diversification rate shifts along geologic time, discussing the impact of Quaternary climate oscillations on diversification. Results NAm Psoraleeae represents a recent, rapid radiation with several genera originating during the Pleistocene, 1 to 2 million years ago. A shift in diversification rate is supported by both methods with a 2.67-fold increase suggested around 2 million years ago followed by a 8.73-fold decrease 440,000 years ago. The hypothesis that a climate regime shift from mesic to xeric habitats drove increased diversification in affected taxa was not supported. Timing of the diversification rate increase supports the hypothesis that glaciation-induced climate changes during the Quaternary influenced diversification of the group. Nonrandom spatial diversification also exists, with greater species richness in the American Southwest. Conclusion This study outlines NAm Psoraleeae as a model example of a recent, rapid

Divergence and diversification in North American Psoraleeae (Fabaceae due to climate change

Directory of Open Access Journals (Sweden)

Crandall Keith A

2008-12-01

Full Text Available Abstract Background Past studies in the legume family (Fabaceae have uncovered several evolutionary trends including differential mutation and diversification rates across varying taxonomic levels. The legume tribe Psoraleeae is shown herein to exemplify these trends at the generic and species levels. This group includes a sizable diversification within North America dated at approximately 6.3 million years ago with skewed species distribution to the most recently derived genus, Pediomelum, suggesting a diversification rate shift. We estimate divergence dates of North American (NAm Psoraleeae using Bayesian MCMC sampling in BEAST based on eight DNA regions (ITS, waxy, matK, trnD-trnT, trnL-trnF, trnK, trnS-trnG, and rpoB-trnC. We also test the hypothesis of a diversification rate shift within NAm Psoraleeae using topological and temporal methods. We investigate the impact of climate change on diversification in this group by (1 testing the hypothesis that a shift from mesic to xeric habitats acted as a key innovation and (2 investigating diversification rate shifts along geologic time, discussing the impact of Quaternary climate oscillations on diversification. Results NAm Psoraleeae represents a recent, rapid radiation with several genera originating during the Pleistocene, 1 to 2 million years ago. A shift in diversification rate is supported by both methods with a 2.67-fold increase suggested around 2 million years ago followed by a 8.73-fold decrease 440,000 years ago. The hypothesis that a climate regime shift from mesic to xeric habitats drove increased diversification in affected taxa was not supported. Timing of the diversification rate increase supports the hypothesis that glaciation-induced climate changes during the Quaternary influenced diversification of the group. Nonrandom spatial diversification also exists, with greater species richness in the American Southwest. Conclusion This study outlines NAm Psoraleeae as a model example

Extra natural gas by foam injection; Extra aardgas door foam-injectie

Energy Technology Data Exchange (ETDEWEB)

De Boer, B.

2008-07-01

The Dutch Petroleum Company (NAM) has further developed an originally American technology for expanding the economic lifespan of gas fields. Injection of environment-friendly foam enables further extraction of natural gas from nearly depleted gas fields. [mk]. [Dutch] De Nederlandse Aardolie Maatschappij (NAM) heeft een van origine Amerikaanse techniek om de economische levensduur van gasvelden te verlengen verder ontwikkeld. Het injecteren van een milieuvriendelijke zeep (foam) maakt het mogelijk om langer aardgas te produceren uit bijna lege gasvelden.

Analýza aktivit agentury Czech Trade na vybraných trzích

OpenAIRE

Dobrovolná, Adéla

2010-01-01

This Master Thesis analyses activities of the agency CzechTrade on Vietnamese market. Viet Nam is one of the perspective market for czech exporters not only for very well established business between Czech Republic and Viet Nam but also for a high growth potential of Vietnamese market. In today's globalised world, the institutional assistance and promotion is essential for foreign trade especially in a relative small economies. Countries today do not increase wealth only through trade but pro...

Serbo-Croatian. SC-15A. Part 3. Advanced Grammar and Syntax,

Science.gov (United States)

1983-09-01

Skolska, Knjiga Zagreb, 1979, helped me write this textbook on advanced Serbo-Croatian grammar and syntax. I am indebted to the above colleagues for...student to read, write , and speak Serbo-Croatian in a grammatically and stylistically correct manner. Perfective verbs, as we already know, may indicate...umakli (sigurno biste zelefi umaci). Pucao bi nam u lecra (mogao/ ielt -c bi nam pucati u leda). The C I. examples clearly connote desire, while the C II

Market testing of irradiated food

International Nuclear Information System (INIS)

Duc, Ho Minh

2001-01-01

Viet Nam has emerged as one of the three top producers and exporters of rice in the world. Tropical climate and poor infrastructure of preservation and storage lead to huge losses of food grains, onions, dried fish and fishery products. Based on demonstration irradiation facility pilot scale studies and marketing of irradiated rice, onions, mushrooms and litchi were successfully undertaken in Viet Nam during 1992-1998. Irradiation technology is being used commercially in Viet Nam since 1991 for insect control of imported tobacco and mould control of national traditional medicinal herbs by both government and private sectors. About 30 tons of tobacco and 25 tons of herbs are irradiated annually. Hanoi Irradiation Centre has been continuing open house practices for visitors from school, universities and various different organizations and thus contributed in improved public education. Consumers were found to prefer irradiated rice, onions, litchi and mushrooms over those nonirradiated. (author)

Thermal expansion of the nuclear fuel-sodium reaction product Na3(U0.84(2),Na0.16(2))O4 - Structural mechanism and comparison with related sodium-metal ternary oxides

Science.gov (United States)

Illy, Marie-Claire; Smith, Anna L.; Wallez, Gilles; Raison, Philippe E.; Caciuffo, Roberto; Konings, Rudy J. M.

2017-07-01

Na3.16(2)UV,VI0.84(2)O4 is obtained from the reaction of sodium with uranium dioxide under oxygen potential conditions typical of a sodium-cooled fast nuclear reactor. In the event of a breach of the steel cladding, it would be the dominant reaction product forming at the rim of the mixed (U,Pu)O2 fuel pellets. High-temperature X-ray diffraction measurements show that a distortion of the uranium environment in Na3.16(2)UV,VI0.84(2)O4 results in a strongly anisotropic thermal expansion. A comparison with several related sodium metallates Nan-2Mn+On-1 - including Na3SbO4 and Na3TaO4, whose crystal structures are reported for the first time - has allowed us to assess the role played in the lattice expansion by the Mn+ cation radius and the Na/M ratio. On this basis, the thermomechanical behavior of the title compound is discussed, along with those of several related double oxides of sodium and actinide elements, surrogate elements, or fission products.

Genome-Wide Analysis of the NAC Gene Family in Physic Nut (Jatropha curcas L.).

Science.gov (United States)

Wu, Zhenying; Xu, Xueqin; Xiong, Wangdan; Wu, Pingzhi; Chen, Yaping; Li, Meiru; Wu, Guojiang; Jiang, Huawu

2015-01-01

The NAC proteins (NAM, ATAF1/2 and CUC2) are plant-specific transcriptional regulators that have a conserved NAM domain in the N-terminus. They are involved in various biological processes, including both biotic and abiotic stress responses. In the present study, a total of 100 NAC genes (JcNAC) were identified in physic nut (Jatropha curcas L.). Based on phylogenetic analysis and gene structures, 83 JcNAC genes were classified as members of, or proposed to be diverged from, 39 previously predicted orthologous groups (OGs) of NAC sequences. Physic nut has a single intron-containing NAC gene subfamily that has been lost in many plants. The JcNAC genes are non-randomly distributed across the 11 linkage groups of the physic nut genome, and appear to be preferentially retained duplicates that arose from both ancient and recent duplication events. Digital gene expression analysis indicates that some of the JcNAC genes have tissue-specific expression profiles (e.g. in leaves, roots, stem cortex or seeds), and 29 genes differentially respond to abiotic stresses (drought, salinity, phosphorus deficiency and nitrogen deficiency). Our results will be helpful for further functional analysis of the NAC genes in physic nut.

Is the Local Seismicity in Haiti Capable of Imaging the Northern Caribbean Subduction?

Science.gov (United States)

Corbeau, J.; Clouard, V.; Rolandone, F.; Leroy, S. D.; de Lepinay, B. M.

2017-12-01

The boundary between the Caribbean (CA) and North American (NAM) plates in the Hispaniola region is the western prolongation of the NAM plate subduction evolving from a frontal subduction in the Lesser Antilles to an oblique collision against the Bahamas platform in Cuba. We analyze P-waveforms arriving at 27 broadband seismic temporary stations deployed along a 200 km-long N-S transect across Haiti, during the Trans-Haiti project. We compute teleseismic receiver functions using the ETMTRF method, and determine crustal thickness and bulk composition (Vp/Vs) using the H-k stacking method. Three distinctive crustal domains are imaged. We relate these domains to crustal terranes that have been accreted along the plate boundary during the northeastwards displacement of the CA plate. We propose a N-S crustal profile across Haiti accounting for the surface geology, shallow structural history and these new seismological constraints. Local seismicity recorded by the temporary network from April 2013 to June 2014 is used to relocate the seismicity. A total of 593 events were identified with magnitudes ranging from 1.6 to 4.5. This local seismicity, predominantly shallow (accommodation of an important part of convergence in this area.

Elevated urinary levels of carcinogenic N-nitrosamines in patients with urinary tract infections measured by isotope dilution online SPE LC–MS/MS

International Nuclear Information System (INIS)

Hu, Chiung-Wen; Shih, Ying-Ming; Liu, Hung-Hsin; Chiang, Yi-Chen; Chen, Chih-Ming; Chao, Mu-Rong

2016-01-01

Highlights: • Nine N-nitrosamines in urine were quantified by LC–MS/MS. • N-nitrosodiphenylamine was firstly identified in human urine. • UTI patients had much higher N-nitrosamines concentrations than healthy subjects. • N-nitrosamines were dramatically decreased after antibiotic treatment. • NDMA was correlated with the pH, WBC esterase activity or nitrite in UTI patients. - Abstract: N-nitrosamines (NAms) are well-documented for their carcinogenic potential. Human exposure to NAms may arise from the daily environment and endogenous formation via the reaction of secondary amines with nitrites or from bacteria infection. We describe the use of isotope dilution online solid-phase extraction (SPE) LC–MS/MS to quantify nine NAms in human urine. This method was validated and further applied to healthy subjects and patients with urinary tract infection (UTI). N-nitrosodimethylamine (NDMA), N-nitrosomethylethylamine (NMEA), N-nitrosopyrrolidine (NPYR) and N-nitrosomorpholine (NMOR) were analyzed with an APCI source, while N-nitrosodiethylamine (NDEA), N-nitrosopiperidine (NPIP), N-nitrosodi-n-propylamine (NDPA), N-nitrosodibutylamine (NDBA) and N-nitrosodiphenylamine (NDPhA) were quantified with an ESI source, due to their effect on the sensitivity and chromatography. NDMA was the most abundant N-nitrosamine, while NDPhA was firstly identified in human. UTI patients had three to twelve-fold higher concentrations for NDMA, NPIP, NDEA, NMOR and NDBA in urine than healthy subjects, and the NAms were significantly decreased after antibiotics treatment. NDMA concentrations were also significantly correlated with the pH value, leukocyte esterase activity or nitrite in urines of UTI patients. Our findings by online SPE LC–MS/MS method evidenced that UTI patients experienced various NAms exposures, especially the potent carcinogen NDMA, which was likely induced by bacteria infection.

Elevated urinary levels of carcinogenic N-nitrosamines in patients with urinary tract infections measured by isotope dilution online SPE LC–MS/MS

Energy Technology Data Exchange (ETDEWEB)

Hu, Chiung-Wen [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Shih, Ying-Ming [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Division of Chest Medicine, Department of Internal Medicine, Changhua Christian Hospital, Changhua 500, Taiwan (China); Liu, Hung-Hsin [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Chiang, Yi-Chen [Department of Public Health, Chung Shan Medical University, Taichung 402, Taiwan (China); School of Public Health, Xiamen University, Xiamen 361102, Fujian (China); Chen, Chih-Ming [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Chao, Mu-Rong, E-mail: chaomurong@gmail.com [Department of Occupational Safety and Health, Chung Shan Medical University, Taichung 402, Taiwan (China); Department of Occupational Medicine, Chung Shan Medical University Hospital, Taichung 402, Taiwan (China)

2016-06-05

Highlights: • Nine N-nitrosamines in urine were quantified by LC–MS/MS. • N-nitrosodiphenylamine was firstly identified in human urine. • UTI patients had much higher N-nitrosamines concentrations than healthy subjects. • N-nitrosamines were dramatically decreased after antibiotic treatment. • NDMA was correlated with the pH, WBC esterase activity or nitrite in UTI patients. - Abstract: N-nitrosamines (NAms) are well-documented for their carcinogenic potential. Human exposure to NAms may arise from the daily environment and endogenous formation via the reaction of secondary amines with nitrites or from bacteria infection. We describe the use of isotope dilution online solid-phase extraction (SPE) LC–MS/MS to quantify nine NAms in human urine. This method was validated and further applied to healthy subjects and patients with urinary tract infection (UTI). N-nitrosodimethylamine (NDMA), N-nitrosomethylethylamine (NMEA), N-nitrosopyrrolidine (NPYR) and N-nitrosomorpholine (NMOR) were analyzed with an APCI source, while N-nitrosodiethylamine (NDEA), N-nitrosopiperidine (NPIP), N-nitrosodi-n-propylamine (NDPA), N-nitrosodibutylamine (NDBA) and N-nitrosodiphenylamine (NDPhA) were quantified with an ESI source, due to their effect on the sensitivity and chromatography. NDMA was the most abundant N-nitrosamine, while NDPhA was firstly identified in human. UTI patients had three to twelve-fold higher concentrations for NDMA, NPIP, NDEA, NMOR and NDBA in urine than healthy subjects, and the NAms were significantly decreased after antibiotics treatment. NDMA concentrations were also significantly correlated with the pH value, leukocyte esterase activity or nitrite in urines of UTI patients. Our findings by online SPE LC–MS/MS method evidenced that UTI patients experienced various NAms exposures, especially the potent carcinogen NDMA, which was likely induced by bacteria infection.

Pnc1p-mediated nicotinamide clearance modifies the epigenetic properties of rDNA silencing in Saccharomyces cerevisiae.

Science.gov (United States)

McClure, Julie M; Gallo, Christopher M; Smith, Daniel L; Matecic, Mirela; Hontz, Robert D; Buck, Stephen W; Racette, Frances G; Smith, Jeffrey S

2008-10-01

The histone deacetylase activity of Sir2p is dependent on NAD(+) and inhibited by nicotinamide (NAM). As a result, Sir2p-regulated processes in Saccharomyces cerevisiae such as silencing and replicative aging are susceptible to alterations in cellular NAD(+) and NAM levels. We have determined that high concentrations of NAM in the growth medium elevate the intracellular NAD(+) concentration through a mechanism that is partially dependent on NPT1, an important gene in the Preiss-Handler NAD(+) salvage pathway. Overexpression of the nicotinamidase, Pnc1p, prevents inhibition of Sir2p by the excess NAM while maintaining the elevated NAD(+) concentration. This growth condition alters the epigenetics of rDNA silencing, such that repression of a URA3 reporter gene located at the rDNA induces growth on media that either lacks uracil or contains 5-fluoroorotic acid (5-FOA), an unusual dual phenotype that is reminiscent of telomeric silencing (TPE) of URA3. Despite the similarities to TPE, the modified rDNA silencing phenotype does not require the SIR complex. Instead, it retains key characteristics of typical rDNA silencing, including RENT and Pol I dependence, as well as a requirement for the Preiss-Handler NAD(+) salvage pathway. Exogenous nicotinamide can therefore have negative or positive impacts on rDNA silencing, depending on the PNC1 expression level.

Relative Bioavailability of Niacin Supplements for Dairy Cows: Effects of Rumen Protection and of Feed Processing

Directory of Open Access Journals (Sweden)

Reka Tienken

2015-12-01

Full Text Available The present study aimed to examine the effective systemic bioavailability of niacin— with particular focus on its galenic form—and feed processing. Experiment 1 was conducted with 35 dairy cows to investigate the effects of various doses of oral supplemented nicotinic acid (NA either in differing galenic forms (non-rumen protected (nRP vs. rumen protected form (RP on serum niacin concentrations. Experiment 2 was designed as a pharmacokinetic study examining the serum niacin kinetics over 24 h after giving a single oral bolus of 24 g nRP or RP NA admixed in either pelleted or ground concentrate. In both experiments, only the niacin vitamer nicotinamide (NAM was detected. Results of experiment 1 showed that both galenic forms at a dose of 24 g/cow daily elevated NAM concentrations at the beginning of the experiment. Despite a daily supplementation, NAM concentrations decreased continuously towards the end of the experiment which was more steeply in nRP NA (p = 0.03. On experimental day 21, NAM concentrations were higher when feeding RP NA (p = 0.03 and the highest dose (24 g/day and cow (p < 0.01. Results of experiment 2 indicated that nRP and RP were characterized by similar pharmacokinetic profiles resulting in similar areas under the curves as a net result of the kinetic counterbalancing alterations. Pelleting seemed not to influence the relative bioavailability.

Deforestation in Viet Nam

International Development Research Centre (IDRC) Digital Library (Canada)

PO Box 8500, Ottawa, ON, Canada K1G 3H9 ..... Nothing so efficiently reduces the impact of heavy downpours as the thick tropical moist forest. ..... economic growth; an increasing demand for food and export crops; and an increasing demand for ...... 1 210. 359 331. 1 110. Tay-Thai. 108 950. 1 510. 180 028. 1 370. 244 373.

North Korean Policy Elites

Science.gov (United States)

2004-06-01

by Kim’s former Japanese chef , Kenji Fujimoto, reveal that Kim could get just about anything he wanted in his personal life, from foreign delicacies...for his table to Japanese jet skis and Sony home electronics.9 Likewise, the account of Yi Nam-oak (Li Nam-ok), who grew up as a companion to Kim’s...title Kin Seinichi no Ryoryinin [Kim Jong-il’s Chef ], Tokyo: Fusosha, 2003. The title of the Korean edition is Kim Jong-il ui yorisa. FBIS translated

Inhibition of Follicle-Stimulating Hormone-Induced Preovulatory Follicles in Rats Treated with a Nonsteroidal Negative Allosteric Modulator of Follicle-Stimulating Hormone Receptor1

OpenAIRE

Dias, James A.; Campo, Brice; Weaver, Barbara A.; Watts, Julie; Kluetzman, Kerri; Thomas, Richard M.; Bonnet, Béatrice; Mutel, Vincent; Poli, Sonia M.

2013-01-01

We previously described a negative allosteric modulator (NAM) of FSHR (ADX61623) that blocked FSH-induced cAMP and progesterone production but did not block estradiol production. That FSHR NAM did not affect FSH-induced preovulatory follicle development as evidenced by the lack of an effect on the number of FSH-dependent oocytes found in the ampullae following ovulation with hCG. A goal is the development of a nonsteroidal contraceptive. Toward this end, a high-throughput screen using human F...

Water in Nominally Anhydrous Minerals from Nakhlites and Shergottites

Science.gov (United States)

Peslier, Anne H.

2013-01-01

Estimating the amount of water in the interior of terrestrial planets has tremendous implications on our understanding of solar nebula evolution, planet formation and geological history, and extraterrestrial volcanism. Mars has been a recent focus of such enquiry with complementary datasets from spacecrafts, rovers and martian meteorite studies. In planetary interiors, water can be dissolved in fluids or melts and hydrous phases, but can also be locked as protons attached to structural oxygen in lattice defects in nominally anhydrous minerals (NAM) such as olivine, pyroxene, or feldspar [1-3]. Measuring water in Martian meteorite NAM is challenging because the minerals are fragile and riddled with fractures from impact processes that makes them break apart during sample processing. Moreover, curing the sample in epoxy causes problems for the two main water analysis techniques, Fourier transform infrared spectrometry (FTIR) and secondary ionization mass spectrometry (SIMS). Measurements to date have resulted in a heated debate on how much water the mantle of Mars contains. SIMS studies of NAM [4], amphiboles [5], and apatites [6-8] from Martian meteorites report finding enough water in these phases to infer that the martian mantle is as hydrous as that of the Earth. On the other hand, a SIMS study of glass in olivine melt inclusions from shergottites concludes that the Martian mantle is much drier [9]. The latter interpretation is also supported by the fact that most martian hydrous minerals generally have the relevant sites filled with Cl and F instead of H [10,11]. As for experimental results, martian basalt compositions can be reproduced using water as well as Cl in the parent melts [12,13]. Here FTIR is used to measure water in martian meteorite minerals in order to constrain the origin of the distribution of water in martian meteorite phases.

Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009–2013

Science.gov (United States)

Dang, Tran Ngoc; Seposo, Xerxes T.; Duc, Nguyen Huu Chau; Thang, Tran Binh; An, Do Dang; Hang, Lai Thi Minh; Long, Tran Thanh; Loan, Bui Thi Hong; Honda, Yasushi

2016-01-01

Background The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Objectives Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. Design We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC) rule (i.e. a smaller AIC value indicates a better model). Results High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11–1.83; low temperature effect, RR=2.0, 95% CI=1.13–3.52), females (low temperature effect, RR=2.19, 95% CI=1.14–4.21), people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91–6.63), and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15–2.22; low temperature effect, RR=1.99, 95% CI=0.92–4.28). Conclusions In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases). These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City. PMID:26781954

Characterizing the relationship between temperature and mortality in tropical and subtropical cities: a distributed lag non-linear model analysis in Hue, Viet Nam, 2009–2013

Directory of Open Access Journals (Sweden)

Tran Ngoc Dang

2016-01-01

Full Text Available Background: The relationship between temperature and mortality has been found to be U-, V-, or J-shaped in developed temperate countries; however, in developing tropical/subtropical cities, it remains unclear. Objectives: Our goal was to investigate the relationship between temperature and mortality in Hue, a subtropical city in Viet Nam. Design: We collected daily mortality data from the Vietnamese A6 mortality reporting system for 6,214 deceased persons between 2009 and 2013. A distributed lag non-linear model was used to examine the temperature effects on all-cause and cause-specific mortality by assuming negative binomial distribution for count data. We developed an objective-oriented model selection with four steps following the Akaike information criterion (AIC rule (i.e. a smaller AIC value indicates a better model. Results: High temperature-related mortality was more strongly associated with short lags, whereas low temperature-related mortality was more strongly associated with long lags. The low temperatures increased risk in all-category mortality compared to high temperatures. We observed elevated temperature-mortality risk in vulnerable groups: elderly people (high temperature effect, relative risk [RR]=1.42, 95% confidence interval [CI]=1.11–1.83; low temperature effect, RR=2.0, 95% CI=1.13–3.52, females (low temperature effect, RR=2.19, 95% CI=1.14–4.21, people with respiratory disease (high temperature effect, RR=2.45, 95% CI=0.91–6.63, and those with cardiovascular disease (high temperature effect, RR=1.6, 95% CI=1.15–2.22; low temperature effect, RR=1.99, 95% CI=0.92–4.28. Conclusions: In Hue, the temperature significantly increased the risk of mortality, especially in vulnerable groups (i.e. elderly, female, people with respiratory and cardiovascular diseases. These findings may provide a foundation for developing adequate policies to address the effects of temperature on health in Hue City.

Groningen: catalyst for Europe

International Nuclear Information System (INIS)

Correlje, A.F.; Odell, P.R.

1999-01-01

An overview of the development of the Nederlandse Aardolie Maatschappij (NAM) operated Dutch Groningen gas field from its inception in 1969 to the present is presented, and the marketing of the gas by NAM, and the natural monopoly position of Gasunie and Groningen are discussed. The emergence of alternative suppliers, the declaration that gas was a scarce commodity leading to the restraining of gas demand, the development of other supplies including those from Algeria and the UK, and finally the discarding of the fallacy that gas was scarce are examined. A 1969 estimate of NAM gas exports planned for 1975 and competition for Groningen gas in the 1970's are illustrated, and the cumulative production from 1965-1990 is plotted. The liberalisation of the Dutch gas industry with customers allowed to choose their supplier as set out in the draft 1998 Gas Law, the rejuvenation of Gasunie marketing strategy, and the benefits of liberalisation are considered. (UK)

Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system.

Science.gov (United States)

Minh An, Dao Thi; Ngoc, Nguyen Thi Bich; Nilsson, Maria

2014-01-01

Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000-500,000 deaths worldwide. The World Health Organization (WHO) recommends 'sentinel surveillance' for influenza-like illness (ILI) because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. 1) To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2) to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3) to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of cases three times higher than the average threshold. There was a

Lessons learned from implementation of a demonstration program to reduce the burden of anemia and hookworm in women in Yen Bai Province, Viet Nam

Directory of Open Access Journals (Sweden)

Thach Tran D

2009-07-01

Full Text Available Abstract Background Iron deficiency, anemia and hookworm disease are important public health problems for women of reproductive age living in developing countries and affect the health of newborns and infants. Iron supplementation and deworming treatment are effective in addressing these problems in both pregnant and non-pregnant women. Daily iron supplementation and deworming after the first trimester is recommended for pregnant women although these programs usually do not operate efficiently or effectively. Weekly iron-folic acid supplementation and regular deworming for non-pregnant women may be a viable approach for improving iron status and preventing anemia during the reproductive years. Addressing these diseases at a population level before women become pregnant could significantly improve women's health before and during pregnancy, as well as their infants' growth and development. Methods and Results This paper describes the major processes undertaken in a demonstration intervention of preventive weekly iron-folic acid supplementation with regular deworming for all 52,000 women aged 15–45 years in two districts of Yen Bai province, in northern Viet Nam. The intervention strategy included extensive consultation with community leaders and village, commune, district and provincial health staff, and training for village health workers. Distribution of the drugs was integrated with the existing health service infrastructure and the village health workers were the direct point of contact with women. Iron-folic acid tablets and deworming treatment were provided free of charge from May 2006. An independent Vietnamese NGO was commissioned to evaluate compliance and identify potential problems. The program resulted in effective distribution of iron-folic acid tablets and deworming treatment to all villages in the target districts, with full or partial compliance of 85%. Conclusion Training for health staff, the strong commitment of all partners

Molecular dynamics simulations suggest ligand's binding to nicotinamidase/pyrazinamidase.

Directory of Open Access Journals (Sweden)

Ji-Long Zhang

Full Text Available The research on the binding process of ligand to pyrazinamidase (PncA is crucial for elucidating the inherent relationship between resistance of Mycobacterium tuberculosis and PncA's activity. In the present study, molecular dynamics (MD simulation methods were performed to investigate the unbinding process of nicotinamide (NAM from two PncA enzymes, which is the reverse of the corresponding binding process. The calculated potential of mean force (PMF based on the steered molecular dynamics (SMD simulations sheds light on an optimal binding/unbinding pathway of the ligand. The comparative analyses between two PncAs clearly exhibit the consistency of the binding/unbinding pathway in the two enzymes, implying the universality of the pathway in all kinds of PncAs. Several important residues dominating the pathway were also determined by the calculation of interaction energies. The structural change of the proteins induced by NAM's unbinding or binding shows the great extent interior motion in some homologous region adjacent to the active sites of the two PncAs. The structure comparison substantiates that this region should be very important for the ligand's binding in all PncAs. Additionally, MD simulations also show that the coordination position of the ligand is displaced by one water molecule in the unliganded enzymes. These results could provide the more penetrating understanding of drug resistance of M. tuberculosis and be helpful for the development of new antituberculosis drugs.

Ocular dominance affects magnitude of dipole moment: An MEG study

OpenAIRE

Shima, Hiroshi; Hasegawa, Mitsuhiro; Tachibana, Osamu; Nomura, Motohiro; Yamashita, Junkoh; Ozaki, Yuzo; Kawai, Jun; Higuchi, Masanori; Kado, Hisashi

2010-01-01

To investigate whether the ocular dominance affects laterality in the activity of the primary visual cortex, we examined the relationship between the ocular dominance and latency or dipole moment measured by checkerboard-pattern and magnetoencephalography in 11 right-handed healthy male participants. Participants with left-eye dominance showed a dipole moment of 21.5±6.1 nAm with left-eye stimulation and 16.1±3.6 nAm with right, whereas those with right-eye dominance showed a dipole moment of...

Nutritional and Microbial Parameters of Earthworm Cast, Termite Mound and Surrounding Bulk Soil

OpenAIRE

Kawaguchi, Sadao; Nishi, Shingo

2007-01-01

A comparative analysis of nutritional and microbial parameters was conducted on two types of biogenetic structures of earthworm cast (8.7 cm in height, 7 casts/1m×1m) formed by litter eating Pheretima sp., and mound (64 cm in height, 1.0 mounds/10m×50m) built by fungus growing termite, Macrotermes gilvus, and compared to the surrounding bulk soil as control in the tropical monsoon forest in Cu Chi National Park of Viet Nam. The proportion of the sand in the earthworm cast was higher than in t...

The 2012 Hormone Therapy Position Statement of The North American Menopause Society

Science.gov (United States)

2012-01-01

Objective This position statement aimed to update the evidence-based position statement published by The North American Menopause Society (NAMS) in 2010 regarding recommendations for hormone therapy (HT) for postmenopausal women. This updated position statement further distinguishes the emerging differences in the therapeutic benefit-risk ratio between estrogen therapy (ET) and combined estrogen-progestogen therapy (EPT) at various ages and time intervals since menopause onset. Methods An Advisory Panel of expert clinicians and researchers in the field of women’s health was enlisted to review the 2010 NAMS position statement, evaluate new evidence, and reach consensus on recommendations. The Panel’s recommendations were reviewed and approved by the NAMS Board of Trustees as an official NAMS position statement. Results Current evidence supports the use of HT for perimenopausal and postmenopausal women when the balance of potential benefits and risks is favorable for the individual woman. This position statement reviews the effects of ET and EPT on many aspects of women’s health and recognizes the greater safety profile associated with ET. Conclusions Recent data support the initiation of HT around the time of menopause to treat menopause-related symptoms and to prevent osteoporosis in women at high risk of fracture. The more favorable benefit-risk ratio for ET allows more flexibility in extending the duration of use compared with EPT, where the earlier appearance of increased breast cancer risk precludes a recommendation for use beyond 3 to 5 years. PMID:22367731

Nuclear asset management. Slide notes

International Nuclear Information System (INIS)

Puglia, W.; Bailey, H.; Kubinova, J.

2004-01-01

Nuclear asset management is defined as the process for making resource allocation and risk management decisions at all levels of nuclear generation business to maximize value/profitability for all stakeholders while maintaining plant safety. In the presentation, the NAM concept is explained, financial benefits achieved in US industry over the past 12 years are outlined, Data Systems and Solutions (DS and S) is presented as a joint venture between Rolls-Royce and SAIC, and NAM benefits in nuclear industry from DS and S client experience are demonstrated. (P.A.)

Strateški marketing za popularizacijo ritmične gimnastike

OpenAIRE

Möderndorfer, Tjaša

2018-01-01

Uvodoma smo predstavili in preučili ključne pojme za lažje razumevanje trženjskih osnov. V nadaljevanju predstavimo metode in tehnike, ki nam pomagajo pri raziskovanju in posledično pri določanju trga in ciljev. Predstavljeni so nekateri osnovni modeli, ki nam pomagajo razumeti, kako trg deluje in kaj vse vpliva nanj. Naša tema se nanaša na šport, zato si v nadaljevanju pogledamo delovanje športnih organizacij. Za pripravo strategije trženja pregledamo okolje in vse deležnike, ki so pos...

Kinome-wide Decoding of Network-Attacking Mutations Rewiring Cancer Signaling

DEFF Research Database (Denmark)

Creixell, Pau; Schoof, Erwin M; Simpson, Craig D.

2015-01-01

Cancer cells acquire pathological phenotypes through accumulation of mutations that perturb signaling networks. However, global analysis of these events is currently limited. Here, we identify six types of network-attacking mutations (NAMs), including changes in kinase and SH2 modulation, network...... and experimentally validated several NAMs, including PKCγ M501I and PKD1 D665N, which encode specificity switches analogous to the appearance of kinases de novo within the kinome. We discover mutant molecular logic gates, a drift toward phospho-threonine signaling, weakening of phosphorylation motifs, and kinase...

Differential modulation of thresholds for intracranial self-stimulation by mGlu5 positive and negative allosteric modulators: implications for effects on drug self-administration

Directory of Open Access Journals (Sweden)

M. Foster eOlive

2012-01-01

Full Text Available Pharmacological manipulation of the type 5 metabotropic glutamate (mGlu5 receptor alters various addiction related behaviors such as drug self-administration and the extinction and reinstatement of drug-seeking behavior. However, the effects of pharmacological modulation of mGlu5 receptors on brain reward function have not been widely investigated. We examined the effects of acute administration of positive and negative allosteric modulators (PAMs and NAMs, respectively on brain reward function by assessing thresholds for intracranial self-stimulation (ICSS. In addition, when acute effects were observed, we examined potential changes in altered ICSS thresholds following repeated administration. Male Sprague-Dawley rats were implanted with bipolar electrodes into the medial forebrain bundle and trained to respond for ICSS, followed by assessment of effects of mGlu5 ligands on ICSS thresholds using a discrete trials current intensity threshold determination procedure. Acute administration of the selective mGlu5 NAMs MTEP (0, 0.3, 1 or 3 mg/kg and fenobam (0, 3, 10, or 30 mg/kg dose-dependently increased ICSS thresholds (~70% at the highest dose tested, suggesting a deficit in brain reward function. Acute administration of the mGlu5 PAMs CDPPB (0, 10, 30 and 60 mg/kg or ADX47273 (0, 10, 30 and 60 mg/kg was without effect at any dose tested. When administered once daily for 5 consecutive days, the development of tolerance to the ability of threshold-elevating doses of MTEP and fenobam to increase ICSS thresholds was observed. We conclude that mGlu5 PAMs and NAMs differentially affect brain reward function, and that tolerance to the ability of mGlu5 NAMs to reduce brain reward function develops with repeated administration. These brain reward deficits should be taken into consideration when interpreting acute effects of mGlu5 NAMs on drug self-administration, and repeated administration may be an effective method to reduce these deficits.

Influenza-like illness in a Vietnamese province: epidemiology in correlation with weather factors and determinants from the surveillance system

Directory of Open Access Journals (Sweden)

Dao Thi Minh An

2014-12-01

Full Text Available Background: Seasonal influenza affects from 5 to 15% of the world's population annually and causes an estimated 250,000–500,000 deaths worldwide. The World Health Organization (WHO recommends ‘sentinel surveillance’ for influenza-like illness (ILI because it is simple and calls for standardized methods at a relatively low cost that can be implemented throughout the world. In Vietnam, ILI is a key priority for public health also because of its annually recurring temporal pattern. Two major factors, on which the spread of influenza depends, are the strain of the virus and its rate of mutation, since flu strains constantly mutate as they compete with host immune systems. In the context of global climate change, the role of climatic factors has been discussed, as they may significantly contribute to the cause of large outbreaks of ILI. Objectives: 1 To describe the epidemiology of ILI in Ha Nam province, Vietnam; 2 to seek scientific evidence on the association of ILI occurrence with weather factors in Ha Nam province; and 3 to analyze factors from the Ha Nam ILI surveillance system that contribute to explaining the correlation between the ILI and the weather factors. Design: A data set of 89,270 monthly reported ILI cases from 2008 to 2012 in Ha Nam was used to describe ILI epidemiological characteristics. Spearman correlation analyses between ILI cases and weather factors were conducted to identify which preceding period of months and weather patterns influenced the occurrence of ILI cases. Ten in-depth interviews with health workers in charge of recording and reporting ILI cases at different levels of the ILI surveillance system were conducted to gain a deeper understanding of factors contributing to explaining the relation between the ILI and the weather factors. Results: The results indicated that the ILI occurred annually in all districts of the Ha Nam province in the five studied years. An epidemic occurred in 2009 with the number of

NAC Transcription Factors in Stress Responses and Senescence

DEFF Research Database (Denmark)

O'Shea, Charlotte

Plant-specific NAM/ATAF/CUC (NAC) transcription factors have recently received considerable attention due to their significant roles in plant development and stress signalling. This interest has resulted in a number of physiological, genetic and cell biological studies of their functions. Some...... of these studies have also revealed emerging gene regulatory networks and protein-protein interaction networks. However, structural studies relating structure to function are lagging behind. Structure-function analysis of the NAC transcription factors has therefore been the main focus of this PhD thesis...... not involve significant folding-upon-binding but fuzziness or an extended ANAC046 region. The ANAC046 regulatory domain functions as an entropic chain with a bait for interactions with for example RCD1. RCD1 interacts with transcription factors from several different families, and the large stress...

L’instabilité organisationnelle des districts industriels. Dynamiques des transformations internes d’un village de métier au nord du Viêt Nam The Organizational Instability of Industrial Districts: Dynamic Internal Transformations of a Craft Village in Northern Vietnam

Directory of Open Access Journals (Sweden)

Nguyen Quy Nghi

2012-11-01

Full Text Available Le village de métier est un sujet d’étude attractif, mais rarement traité comme une forme d’agglomération industrielle ou abordé sous l’angle de la sociologie industrielle. Le développement actuel des villages de métier montre bien la présence intensive des entreprises de tailles variées et l’implication d’autres acteurs en dehors du milieu de production (par exemple les autorités locales, le milieu de l’éducation. L’introduction d’acteurs nouveaux implique le changement des relations existantes, contribuant ainsi à la mise en place d’une nouvelle configuration. L’objectif de cet article est de montrer que l’organisation des villages de métier, qui est conçue comme un type de district industriel, est marquée par l’instabilité ou le changement permanent de la configuration générale, mais aussi par une transformation interne des acteurs au sein du district. À travers une étude de cas à Bát Tràng – un centre de production céramique au nord du Viêt Nam – cet article a pour objectif de montrer comment des entreprises familiales se réorganisent en structure plus formalisée, comment elles mobilisent du capital social pour régler leurs difficultés et les stratégies d’innovation qu’elles développent.Craft village is an attractive research subject, however it is rarely treated as a form of industrial agglomeration or studied from industrial sociology perspective. The current development of craft villages demonstrates the intensive presence of entreprises of all sizes and involvement of non productive actors (e.g. local authorities, education sector. The introduction of new actors therefore implies a change of existing relationships, contributing to the formulation of new configuration. The objective of this paper is to demonstrate that the organization of craft villages, as a type of industrial district, is marked by instability or permanent change in the overall configuration, but also by

The Leishmania nicotinamidase is essential for NAD+ production and parasite proliferation.

Science.gov (United States)

Gazanion, E; Garcia, D; Silvestre, R; Gérard, C; Guichou, J F; Labesse, G; Seveno, M; Cordeiro-Da-Silva, A; Ouaissi, A; Sereno, D; Vergnes, B

2011-10-01

NAD+ is a central cofactor that plays important roles in cellular metabolism and energy production in all living cells. Genomics-based reconstruction of NAD+ metabolism revealed that Leishmania protozoan parasites are NAD+ auxotrophs. Consequently, these parasites require assimilating NAD+ precursors (nicotinamide, nicotinic acid, nicotinamide riboside) from their host environment to synthesize NAD+ by a salvage pathway. Nicotinamidase is a key enzyme of this salvage pathway that catalyses conversion of nicotinamide (NAm) to nicotinic acid (Na), and that is absent in higher eukaryotes. We present here the biochemical and functional characterizations of the Leishmania infantum nicotinamidase (LiPNC1). Generation of Lipnc1 null mutants leads to a decrease in NAD+ content, associated with a metabolic shutdown-like phenotype with an extensive lag phase of growth. Both phenotypes could be rescued by an add-back construct or by addition of exogenous Na. In addition, Lipnc1 null mutants were unable to establish a sustained infection in a murine experimental model. Altogether, these results illustrate that NAD+ homeostasis is a fundamental component of Leishmania biology and virulence, and that NAm constitutes its main NAD+ source in the mammalian host. The crystal structure of LiPNC1 we solved allows now the design of rational inhibitors against this new promising therapeutic target. © 2011 Blackwell Publishing Ltd.

An in situ generated carbon as integrated conductive additive for hierarchical negative plate of lead-acid battery

Science.gov (United States)

Saravanan, M.; Ganesan, M.; Ambalavanan, S.

2014-04-01

In this work, we report an in situ generated carbon from sugar as additive in the Negative Active Mass (NAM) which enhances the charge-discharge characteristics of the lead-acid cells. In situ formed sugar derived carbon (SDC) with leady oxide (LO) provides a conductive network and excellent protection against NAM irreversible lead sulfation. The effect of SDC and carbon black (CB) added negative plates are characterized by X-ray diffraction (XRD), Raman spectroscopy, scanning electron microscopy (SEM), galvanostatic charge-discharge, cyclic voltammetry (CV) and electrochemical impedance spectroscopy (EIS), respectively. The results show that subtle changes in the addition of carbon to NAM led to subsequent changes on the performance during partial-state-of-charge (PSoC) operations in lead-acid cells. Furthermore, SDC added cells exhibit remarkable improvement in the rate capability, active material utilization, cycle performance and charge acceptance compared to that of the conventional CB added cells. The impact of SDC with LO at various synthesis conditions on the electrochemical performance of the negative plate is studied systematically.

POLYELECTROLYTE MULTILAYER STAMPING IN AQUEOUS PHASE AND NON-CONTACT MODE

Science.gov (United States)

Mehrotra, Sumit; Lee, Ilsoon; Liu, Chun; Chan, Christina

2011-01-01

Polyelectrolyte multilayer (PEM) transfer printing has been previously achieved by stamping under dry conditions. Here, we show for the first time, that PEM can be transferred from a stamp to the base substrate under aqueous conditions whereby the two surfaces are in a non-contact mode. Degradable multilayers of (PAA/PEG)10.5 followed by non-degradable multilayers of (PDAC/SPS)80.5 were fabricated under acidic pH conditions on either PDMS or glass (stamp), and subsequently transferred over top of another multilayer prepared on a different substrate (base substrate), with a spacing of ~ 200 μm between the stamping surface and the base substrate. This multilayer transfer was performed under physiological pH conditions. This process is referred to herein as non-contact, aqueous-phase multilayer (NAM) transfer. NAM transfer can be useful for applications such as fabricating three-dimensional (3-D) cellular scaffolds. We attempted to create a 3-D cellular scaffold using NAM transfer, and characterized the scaffolds with conventional and fluorescence microscopy. PMID:21860540

Intercomparison of hydrological model structures and calibration approaches in climate scenario impact projections

Science.gov (United States)

Vansteenkiste, Thomas; Tavakoli, Mohsen; Ntegeka, Victor; De Smedt, Florimond; Batelaan, Okke; Pereira, Fernando; Willems, Patrick

2014-11-01

The objective of this paper is to investigate the effects of hydrological model structure and calibration on climate change impact results in hydrology. The uncertainty in the hydrological impact results is assessed by the relative change in runoff volumes and peak and low flow extremes from historical and future climate conditions. The effect of the hydrological model structure is examined through the use of five hydrological models with different spatial resolutions and process descriptions. These were applied to a medium sized catchment in Belgium. The models vary from the lumped conceptual NAM, PDM and VHM models over the intermediate detailed and distributed WetSpa model to the fully distributed MIKE SHE model. The latter model accounts for the 3D groundwater processes and interacts bi-directionally with a full hydrodynamic MIKE 11 river model. After careful and manual calibration of these models, accounting for the accuracy of the peak and low flow extremes and runoff subflows, and the changes in these extremes for changing rainfall conditions, the five models respond in a similar way to the climate scenarios over Belgium. Future projections on peak flows are highly uncertain with expected increases as well as decreases depending on the climate scenario. The projections on future low flows are more uniform; low flows decrease (up to 60%) for all models and for all climate scenarios. However, the uncertainties in the impact projections are high, mainly in the dry season. With respect to the model structural uncertainty, the PDM model simulates significantly higher runoff peak flows under future wet scenarios, which is explained by its specific model structure. For the low flow extremes, the MIKE SHE model projects significantly lower low flows in dry scenario conditions in comparison to the other models, probably due to its large difference in process descriptions for the groundwater component, the groundwater-river interactions. The effect of the model

Effect of low-dose versus higher-dose antenatal iron supplementation on child health outcomes at 36 months of age in Viet Nam: longitudinal follow-up of a cluster randomised controlled trial.

Science.gov (United States)

Hanieh, Sarah; Ha, Tran T; Simpson, Julie A; Braat, Sabine; Thuy, Tran T; Tran, Thach D; King, Janet; Tuan, Tran; Fisher, Jane; Biggs, Beverley-Ann

2017-01-01

Intermittent iron-folic acid supplementation (IFA) is currently recommended for pregnant women in populations where anaemia prevalence among pregnant women is Viet Nam among children of 36 months of age, born to women previously enrolled in a cluster randomised controlled trial of antenatal micronutrient supplementation (daily IFA (60 mg elemental iron) vs twice-weekly IFA (60 mg elemental iron) vs twice-weekly multiple micronutrient (MMN) supplementation (60 mg elemental iron)). Primary outcomes were height-for-age z-scores (HAZ), according to WHO growth standards and cognitive composite scores (Bayley Scales of Infant and Toddler Development, third edition) at 36 months of age. A total of 1017 children born to mothers enrolled in the cluster randomised trial were assessed at 36 months of age. Adjusted mean differences (MDs) in HAZ were -0.14 (95% CI -0.28 to -0.01) and -0.15 (95% CI -0.29 to -0.01) in children born to mothers who received twice-weekly IFA or MMN compared with those who received daily IFA. Children born to mothers who received twice-weekly MMN had lower composite motor scores compared with those who received daily IFA (MD -2.07, 95% CI -4.11 to -0.03). There were no differences in composite cognitive scores in the twice-weekly compared with daily regimens. Low-dose antenatal IFA supplementation (120 mg elemental iron per week) resulted in lower HAZ and motor composite scores in children compared with higher-dose antenatal IFA supplementation (420 mg elemental iron per week). This highlights the importance of adequate iron stores during pregnancy and the need for careful monitoring when lower-dose antenatal iron regimens are used. Australia New Zealand Clinical Trials Registry: 12610000944033.

Improved cancer risk stratification and diagnosis via quantitative phase microscopy (Conference Presentation)

Science.gov (United States)

Liu, Yang; Uttam, Shikhar; Pham, Hoa V.; Hartman, Douglas J.

2017-02-01

Pathology remains the gold standard for cancer diagnosis and in some cases prognosis, in which trained pathologists examine abnormality in tissue architecture and cell morphology characteristic of cancer cells with a bright-field microscope. The limited resolution of conventional microscope can result in intra-observer variation, missed early-stage cancers, and indeterminate cases that often result in unnecessary invasive procedures in the absence of cancer. Assessment of nanoscale structural characteristics via quantitative phase represents a promising strategy for identifying pre-cancerous or cancerous cells, due to its nanoscale sensitivity to optical path length, simple sample preparation (i.e., label-free) and low cost. I will present the development of quantitative phase microscopy system in transmission and reflection configuration to detect the structural changes in nuclear architecture, not be easily identifiable by conventional pathology. Specifically, we will present the use of transmission-mode quantitative phase imaging to improve diagnostic accuracy of urine cytology and the nuclear dry mass is progressively correlate with negative, atypical, suspicious and positive cytological diagnosis. In a second application, we will present the use of reflection-mode quantitative phase microscopy for depth-resolved nanoscale nuclear architecture mapping (nanoNAM) of clinically prepared formalin-fixed, paraffin-embedded tissue sections. We demonstrated that the quantitative phase microscopy system detects a gradual increase in the density alteration of nuclear architecture during malignant transformation in animal models of colon carcinogenesis and in human patients with ulcerative colitis, even in tissue that appears histologically normal according to pathologists. We evaluated the ability of nanoNAM to predict "future" cancer progression in patients with ulcerative colitis.

Real-Time Monitoring of Mountain Conifer Growth Response to Seasonal Climate and the Summer Monsoon in the Great Basin of North America

Science.gov (United States)

Strachan, S.; Biondi, F.

2013-12-01

Tree rings in the American intermountain west are often used for palaeoclimatic purposes, including reconstructions of precipitation, temperature, and drought. Specific seasonal phenomena such as the North American Monsoon (NAM) are also being identified in tree-ring studies as being related to certain growth features in the rings (such as early-onset 'false' latewood). These relationships have historically been developed using statistical relationships between tree-ring chronologies and regional weather observations. In zones near the periphery of the NAM, summertime precipitation may be more sporadic, yet localized vegetation assemblages in the northern Mojave desert and Great Basin regions indicate that these events are still important for some ecosystems which have established in areas where NAM activity is present. Major shifts in NAM behavior in the past may have been recorded by tree rings, and identifying the specific mechanisms/circumstances by which this occurs is critical for efforts seeking to model ecosystem response to climate changes. By establishing in-situ monitoring of climate/weather, soils, and tree-growth variables in Pinus ponderosa scopulorum and Pinus monophylla zones at study sites in eastern/southern Nevada, we are able to address these issues at very fine spatial and temporal scales. Data from two seasons of monitoring precipitation, solar radiation, air temperature, soil temperature, soil water content, tree sap flow, tree radial distance increment, and hourly imagery are presented. Point dendrometers along with sap flow sensors monitor growth in these ponderosa pine around the clock to help researchers understand tree-ring/climate relationships.

PREFACE: Modern Archaeoastronomy: From Material Culture to Cosmology

Science.gov (United States)

Brown, Daniel

2016-02-01

The Royal Astronomical Society National Astronomy Meeting (NAM) 2014 was hosted by the Institute of Cosmology and Gravitation (ICG) at the University of Portsmouth. It was held from June 23-26 2014 and was sponsored by the RAS, STFC, SEPnet and Winton Capital. As part of this meeting a session stream titled Modern Archaeoastronomy: From Material Culture to Cosmology took place on Monday 23rd proposed and organized by Brian Sheen (Roseland Observatory) and Daniel Brown (Nottingham Trent University). It consisted of an illustration of the many aspects of archaeoastronomy or cultural-astronomy as it has developed and embraced areas such as anthropology, public engagement and sociology. Anita Heward (Press Officer NAM) stated that 'sessions on the history of astronomy have been a feature of many NAM programmes over the years, but NAM 2014 was the first to include a dedicated session on archaeoastronomy.' It was motivated from past decades where our understanding of astronomy of our ancestors has become more strongly based on factual data. As such it allowed researchers to identify possible traces of astronomical knowledge in archaeological remains and artefacts. Archaeoastronomy is an ideal example of the advancement in this area as well as the power of interdisciplinary work that in recent times has started to interpret these findings through cultural, anthropological and educational research. This session will offer an opportunity to present a multitude of different approaches of analyzing the perception and origins of astronomy in ancient and modern cultures, and also bring together young researchers and students in the field to present their research to a wider community.

Analysis Components Investigation Report

Science.gov (United States)

2014-10-01

integration n (1.4.1) t r to integra Solr separa nstrate the resco. Ther e file system f 22 ATION context, ocument software ased on visualize d offers...query. NLTK8 libr uments. Th locations, b neral Ling rdNet9 is a ts of spee tionships. aning of a w approach rdnet sema ween two w ilar words...Te The this doc The nam inte Mo sea exa this gro .2.4 Do A m que lea An Fea que If w wh libr out Vow Mic nam com 2 http://zinko s Investigation MENT

Radiation accident in Viet Nam

International Nuclear Information System (INIS)

Wheatley, J.

1998-01-01

In November 1992 a Vietnamese research physicist was working with a microtron accelerator when he received a radiation overexposure that required the subsequent amputation of his right hand. A team from the International Atomic Energy Agency visited Hanoi in March 1993 to carry out an investigation. It was concluded that the accident occurred primarily due to a lack of safety systems although the lack of both written procedures and training in basic radiation safety were also major contributors. (author)

Biomass Business Opportunities Viet Nam

Energy Technology Data Exchange (ETDEWEB)

Zwebe, D [SNV Netherlands Development Organisation, Ha Noi (Viet Nam)

2012-03-15

The goal of this survey is to provide a more specific and integral perspective in which niches, relevant policy development by the Vietnamese government, legislation and sustainability criteria are clearly addressed to benefit both the Dutch Private sector as well as to stimulate Dutch-Vietnamese cooperation and support the Vietnamese government in its search for tangible options to develop the desired enabling environment for a sustainable biomass/biofuel market. The following activities are defined to be executed to reach the goal of the project: Biomass availability in Vietnam (Chapter 2); Government of Vietnam and Energy (Chapter 3); The opportunities and barriers to enter the market in Vietnam (Chapter 4 and 5); Stakeholder analysis of the bio-energy sector (Chapter 6); and Recommendations (Chapter 7)

Inhibition of follicle-stimulating hormone-induced preovulatory follicles in rats treated with a nonsteroidal negative allosteric modulator of follicle-stimulating hormone receptor.

Science.gov (United States)

Dias, James A; Campo, Brice; Weaver, Barbara A; Watts, Julie; Kluetzman, Kerri; Thomas, Richard M; Bonnet, Béatrice; Mutel, Vincent; Poli, Sonia M

2014-01-01

We previously described a negative allosteric modulator (NAM) of FSHR (ADX61623) that blocked FSH-induced cAMP and progesterone production but did not block estradiol production. That FSHR NAM did not affect FSH-induced preovulatory follicle development as evidenced by the lack of an effect on the number of FSH-dependent oocytes found in the ampullae following ovulation with hCG. A goal is the development of a nonsteroidal contraceptive. Toward this end, a high-throughput screen using human FSHR identified an additional nonsteroidal small molecule (ADX68692). Although ADX68692 behaved like ADX61623 in inhibiting production of cAMP and progesterone, it also inhibited FSH-induced estradiol in an in vitro rat granulosa primary cell culture bioassay. When immature, noncycling female rats were injected subcutaneously or by oral dosing prior to exogenous FSH administration, it was found that ADX68692 decreased the number of oocytes recovered from the ampullae. The estrous cycles of mature female rats were disrupted by administration by oral gavage of 25 mg/kg and 10 mg/kg ADX68692. In the highest dose tested (25 mg/kg), 55% of animals cohabited with mature males had implantation sites compared to 33% in the 10 mg/kg group and 77% in the control group. A surprising finding was that a structural analog ADX68693, while effectively blocking progesterone production with similar efficacy as ADX68692, did not block estrogen production and despite better oral availability did not decrease the number of oocytes found in the ampullae even when used at 100 mg/kg. These data demonstrate that because of biased antagonism of the FSHR, nonsteroidal contraception requires that both arms of the FSHR steroidogenic pathway must be effectively blocked, particularly estrogen biosynthesis. Thus, a corollary to these findings is that it seems reasonable to propose that the estrogen-dependent diseases such as endometriosis may benefit from inhibition of FSH action at the ovary using the FSHR

Accurate determination of ultra-trace levels of Ti in blood serum using ICP-MS/MS

International Nuclear Information System (INIS)

Balcaen, Lieve; Bolea-Fernandez, Eduardo; Resano, Martín; Vanhaecke, Frank

2014-01-01

Graphical abstract: -- Highlights: •Novel method for determination of Ti at ultra-trace levels in clinical samples (serum). •Novel method based on Ti(NH 3 ) 6 + reaction product ion formation and double mass selection using recently introduced ICP-QQQ instrumentation. •Lowest limits of detection ever obtained using quadrupole-based instrumentation for Ti. •Accurate determination of basal levels of Ti in blood serum. -- Abstract: Ti is frequently used in implants and prostheses and it has been shown before that the presence of these in the human body can lead to elevated Ti concentrations in body fluids such as serum and urine. As identification of the exact mechanisms responsible for this increase in Ti concentrations, and the risks associated with it, are not fully understood, it is important to have sound analytical methods that enable straightforward quantification of Ti levels in body fluids (for both implanted and non-implanted individuals). Until now, only double-focusing sector field ICP-mass spectrometry (SF-ICP-MS) offered limits of detection that are good enough to deal with the very low basal levels of Ti in human serum. This work reports on the development of a novel method for the accurate and precise determination of trace levels of Ti in human serum samples, based on the use of ICP-MS/MS. O 2 and NH 3 /He have been compared as reaction gases. While the use of O 2 did not enable to overcome all spectral interferences, it has been shown that conversion of Ti + ions into Ti(NH 3 ) 6 + cluster ions by using NH 3 /He as a reaction gas in an ICP-QQQ-MS system, operated in MS/MS mode, provided interference-free conditions and sufficiently low limits of detection, down to 3 ng L −1 (instrumental detection limit obtained for the most abundant Ti isotope). The accuracy of the method proposed was evaluated by analysis of a Seronorm Trace Elements Serum L-1 reference material and by comparing the results obtained with those achieved by means of SF

Statistical Analysis of Model Data for Operational Space Launch Weather Support at Kennedy Space Center and Cape Canaveral Air Force Station

Science.gov (United States)

Bauman, William H., III

2010-01-01

The 12-km resolution North American Mesoscale (NAM) model (MesoNAM) is used by the 45th Weather Squadron (45 WS) Launch Weather Officers at Kennedy Space Center (KSC) and Cape Canaveral Air Force Station (CCAFS) to support space launch weather operations. The 45 WS tasked the Applied Meteorology Unit to conduct an objective statistics-based analysis of MesoNAM output compared to wind tower mesonet observations and then develop a an operational tool to display the results. The National Centers for Environmental Prediction began running the current version of the MesoNAM in mid-August 2006. The period of record for the dataset was 1 September 2006 - 31 January 2010. The AMU evaluated MesoNAM hourly forecasts from 0 to 84 hours based on model initialization times of 00, 06, 12 and 18 UTC. The MesoNAM forecast winds, temperature and dew point were compared to the observed values of these parameters from the sensors in the KSC/CCAFS wind tower network. The data sets were stratified by model initialization time, month and onshore/offshore flow for each wind tower. Statistics computed included bias (mean difference), standard deviation of the bias, root mean square error (RMSE) and a hypothesis test for bias = O. Twelve wind towers located in close proximity to key launch complexes were used for the statistical analysis with the sensors on the towers positioned at varying heights to include 6 ft, 30 ft, 54 ft, 60 ft, 90 ft, 162 ft, 204 ft and 230 ft depending on the launch vehicle and associated weather launch commit criteria being evaluated. These twelve wind towers support activities for the Space Shuttle (launch and landing), Delta IV, Atlas V and Falcon 9 launch vehicles. For all twelve towers, the results indicate a diurnal signal in the bias of temperature (T) and weaker but discernable diurnal signal in the bias of dewpoint temperature (T(sub d)) in the MesoNAM forecasts. Also, the standard deviation of the bias and RMSE of T, T(sub d), wind speed and wind

Metabotropic glutamate receptor 5 as a potential target for smoking cessation.

Science.gov (United States)

Chiamulera, Cristiano; Marzo, Claudio Marcello; Balfour, David J K

2017-05-01

Most habitual smokers find it difficult to quit smoking because they are dependent upon the nicotine present in tobacco smoke. Tobacco dependence is commonly treated pharmacologically using nicotine replacement therapy or drugs, such as varenicline, that target the nicotinic receptor. Relapse rates, however, remain high, and there remains a need to develop novel non-nicotinic pharmacotherapies for the dependence that are more effective than existing treatments. The purpose of this paper is to review the evidence from preclinical and clinical studies that drugs that antagonise the metabotropic glutamate receptor 5 (mGluR5) in the brain are likely to be efficacious as treatments for tobacco dependence. Imaging studies reveal that chronic exposure to tobacco smoke reduces the density of mGluR5s in human brain. Preclinical results demonstrate that negative allosteric modulators (NAMs) at mGluR5 attenuate both nicotine self-administration and the reinstatement of responding evoked by exposure to conditioned cues paired with nicotine delivery. They also attenuate the effects of nicotine on brain dopamine pathways implicated in addiction. Although mGluR5 NAMs attenuate most of the key facets of nicotine dependence, they potentiate the symptoms of nicotine withdrawal. This may limit their value as smoking cessation aids. The NAMs that have been employed most widely in preclinical studies of nicotine dependence have too many "off-target" effects to be used clinically. However, newer mGluR5 NAMs have been developed for clinical use in other indications. Future studies will determine if these agents can also be used effectively and safely to treat tobacco dependence.

Avaliação de desempenho de lagoa de polimento para pós-tratamento de reator anaeróbio de manta de lodo (UASB no tratamento de águas residuárias de suinocultura Evaluation of the performance of a polishing pond for the post-treatment of the effluent from an upflow anaerobic sludge blanket (UASB reactor treating swine wastewater

Directory of Open Access Journals (Sweden)

L.S. Rodrigues

2009-12-01

Full Text Available Avaliou-se o desempenho de uma lagoa de polimento, no tratamento de efluentes de águas residuárias de suinocultura de um reator anaeróbio de manta de lodo (UASB. O sistema foi composto de decantador, reator UASB, em escala real, e lagoa de polimento em escala experimental. As análises físico-químicas realizadas foram: temperatura, pH, demanda bioquímica de oxigênio (DBO, demanda química de oxigênio (DQO, sólidos suspensos totais (SST e sólidos suspensos voláteis (SSV, nitrogênio total kjedhal (NTK, nitrogênio amoniacal (N-am. e orgânico (N-org., fósforo total (Pt, coliformes totais e termotolerantes. A lagoa de polimento apresentou alto desempenho, com remoção média de 58,9% de DBO, 60,1% de NTK, 57% de N-am. e 95,34% de coliformes termotolerantes.The performance of a polishing pond for treating swine wastewater from an upflow anaerobic sludge blanket (UASB reactor was evaluated. The system was assembled with a slat settler, followed by an UASB reactor, on a real scale, and a post-treatment pond, on a demonstration scale. The following parameters were analyzed: temperature, pH, biochemical oxygen demand (BOD, chemical oxygen demand (COD, total suspended solids (TSS, volatile suspended solids (VSS, total Kjedahl nitrogen (NTK, ammonia nitrogen (N-am., organic nitrogen, total phosphorus, and total and thermotolerant coliforms. The polishing pond was highly efficient, removing an average of 58.9% of BOD, 60.1% of NTK, 57% of N-am., and 95.34% of thermotolerant coliforms.

Monitoring of the natural gas exploitation in the Wadden Sea from the locations Moddergat, Lauwersoog and Vierhuizen, Netherlands. Advice of the Audit Committee 2011; Monitoring van de aardgaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen. Advies 2011 van de Auditcommissie

Energy Technology Data Exchange (ETDEWEB)

NONE

2012-04-15

The Dutch governmental decree ('Rijksprojectenbesluit') on the project for natural gas exploitation in the Wadden Sea for the locations Moddergat, Lauwersoog and Vierhuizen gives the Dutch Petroleum Company (NAM) the possibility to produce natural gas under specific conditions in the Wadden Sea area from the six fields Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog East and Vierhuizen East. The precondition is that the (dynamic) nature in and around the Wadden Sea is not affected by subsidence as a result of the gas exploitation. For this, the NAM must monitor the subsidence and the nature values and report annually to the Dutch government. Also in the Rijksprojectbesluit it is determined that the Commission for Environmental Impact Assessment (EIA), as the independent auditor, will annually advise the responsible ministers on the EIA-report. This is the 2011 recommendation of the Audit Committee for exploitation of natural gas in the Wadden Sea [Dutch] Het Rijksprojectbesluit Gaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen geeft de Nederlandse Aardolie Maatschappij (NAM) de mogelijkheid om onder randvoorwaarden aardgas te produceren in het Waddenzeegebied uit de zes velden Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog Oost en Vierhuizen Oost. De randvoorwaarde is dat de (dynamische) natuur in en rondom de Waddenzee niet wordt aangetast door bodemdaling als gevolg van de gaswinning. Daarvoor moet de NAM de bodemdaling en de natuurwaarden monitoren en jaarlijks rapporteren aan de Nederlandse overheid. Ook is in het Rijksprojectbesluit bepaald dat de Commissie voor de milieueffectrapportage (m.e.r.) als onafhankelijke auditor de verantwoordelijke ministers jaarlijks zal adviseren over deze Rapportage. Dit is het 2011 advies van de Auditcommissie gaswinning onder de Waddenzee.

Predicting the occurrence of channelized debris flow by an integrated cascading model: A case study of a small debris flow-prone catchment in Zhejiang Province, China

Science.gov (United States)

Wei, Zhen-lei; Xu, Yue-Ping; Sun, Hong-yue; Xie, Wei; Wu, Gang

2018-05-01

Excessive water in a channel is an important factor that triggers channelized debris flows. Floods and debris flows often occur in a cascading manner, and thus, calculating the amount of runoff accurately is important for predicting the occurrence of debris flows. In order to explore the runoff-rainfall relationship, we placed two measuring facilities at the outlet of a small, debris flow-prone headwater catchment to explore the hydrological response of the catchment. The runoff responses generally consisted of a rapid increase in runoff followed by a slower decrease. The peak runoff often occurred after the rainfall ended. The runoff discharge data were simulated by two different modeling approaches, i.e., the NAM model and the Hydrologic Engineering Center-Hydrologic Modeling System (HEC-HMS) model. The results showed that the NAM model performed better than the HEC-HMS model. The NAM model provided acceptable simulations, while the HEC-HMS model did not. Then, we coupled the calculated results of the NAM model with an empirically based debris flow initiation model to obtain a new integrated cascading disaster modeling system to provide improved disaster preparedness and hazard management. In this case study, we found that the coupled model could correctly predict the occurrence of debris flows. Furthermore, we evaluated the effect of the range of input parameter values on the hydrographical shape of the runoff. We also used the grey relational analysis to conduct a sensitivity analysis of the parameters of the model. This study highlighted the important connections between rainfall, hydrological processes, and debris flow, and it provides a useful prototype model system for operational forecasting of debris flows.

Estrogen and progestogen use in postmenopausal women: July 2008 position statement of The North American Menopause Society

Science.gov (United States)

2009-01-01

Objective To update for both clinicians and the lay public the evidence-based position statement published by The North American Menopause Society (NAMS) in March 2007 regarding its recommendations for menopausal hormone therapy (HT) for postmenopausal women, with consideration for the therapeutic benefit-risk ratio at various times through menopause and beyond. Design An Advisory Panel of clinicians and researchers expert in the field of women’s health was enlisted to review the March 2007 NAMS position statement, evaluate new evidence through an evidence-based analysis, and reach consensus on recommendations. The Panel’s recommendations were reviewed and approved by the NAMS Board of Trustees as an official NAMS position statement. The document was provided to other interested organizations to seek their endorsement. Results Current evidence supports a consensus regarding the role of HT in postmenopausal women, when potential therapeutic benefits and risks around the time of menopause are considered. This paper lists all these areas along with explanatory comments. Conclusions that vary from the 2007 position statement are highlighted. Addenda include a discussion of risk concepts, a new component not included in the 2007 paper, and a recommended list of areas for future HT research. A suggested reading list of key references is also provided. Conclusions Recent data support the initiation of HT around the time of menopause to treat menopause-related symptoms; to treat or reduce the risk of certain disorders, such as osteoporosis or fractures in select postmenopausal women; or both. The benefit-risk ratio for menopausal HT is favorable close to menopause but decreases with aging and with time since menopause in previously untreated women. PMID:18580541

Monitoring of the natural gas exploitation in the Wadden Sea from the locations Moddergat, Lauwersoog and Vierhuizen, Netherlands. Advice of the Audit Committee 2009; Monitoring van de aardgaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen. Advies 2009 van de Auditcommissie

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-05-07

The Dutch governmental decree ('Rijksprojectenbesluit') on the project for natural gas exploitation in the Wadden Sea for the locations Moddergat, Lauwersoog Vierhuizen gives the Dutch Petroleum Company (NAM) the possibility to produce natural gas under specific conditions in the Wadden Sea area from the six fields Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog East and Vierhuizen East. The precondition is that the (dynamic) nature in and around the Wadden Sea is not affected by subsidence as a result of the gas exploitation. For this, the NAM must monitor the subsidence and the nature values and report annually to the Dutch government. Also in the Rijksprojectbesluit it is determined that the Commission for Environmental Impact Assessment (EIA), as the independent auditor, will annually advise the responsible ministers on the EIA-report. This is the 2009 recommendation of the Audit Committee for exploitation of natural gas in the Wadden Sea. [Dutch] Het Rijksprojectbesluit Gaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen geeft de Nederlandse Aardolie Maatschappij (NAM) de mogelijkheid om onder randvoorwaarden aardgas te produceren in het Waddenzeegebied uit de zes velden Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog Oost en Vierhuizen Oost. De randvoorwaarde is dat de (dynamische) natuur in en rondom de Waddenzee niet wordt aangetast door bodemdaling als gevolg van de gaswinning. Daarvoor moet de NAM de bodemdaling en de natuurwaarden monitoren en jaarlijks rapporteren aan de Nederlandse overheid. Ook is in het Rijksprojectbesluit bepaald dat de Commissie voor de milieueffectrapportage (m.e.r.) als onafhankelijke auditor de verantwoordelijke ministers jaarlijks zal adviseren over deze Rapportage. Dit is het 2009 advies van de Auditcommissie gaswinning onder de Waddenzee.

Monitoring of the natural gas exploitation in the Wadden Sea from the locations Moddergat, Lauwersoog and Vierhuizen, Netherlands. Advice of the Audit Committee 2010; Monitoring van de aardgaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen. Advies 2010 van de Auditcommissie

Energy Technology Data Exchange (ETDEWEB)

NONE

2010-10-15

The Dutch governmental decree ('Rijksprojectenbesluit') on the project for natural gas exploitation in the Wadden Sea for the locations Moddergat, Lauwersoog and Vierhuizen gives the Dutch Petroleum Company (NAM) the possibility to produce natural gas under specific conditions in the Wadden Sea area from the six fields Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog East and Vierhuizen East. The precondition is that the (dynamic) nature in and around the Wadden Sea is not affected by subsidence as a result of the gas exploitation. For this, the NAM must monitor the subsidence and the nature values and report annually to the Dutch government. Also in the Rijksprojectbesluit it is determined that the Commission for Environmental Impact Assessment (EIA), as the independent auditor, will annually advise the responsible ministers on the EIA-report. This is the 2010 recommendation of the Audit Committee for exploitation of natural gas in the Wadden Sea. [Dutch] Het Rijksprojectbesluit Gaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen geeft de Nederlandse Aardolie Maatschappij (NAM) de mogelijkheid om onder randvoorwaarden aardgas te produceren in het Waddenzeegebied uit de zes velden Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog Oost en Vierhuizen Oost. De randvoorwaarde is dat de (dynamische) natuur in en rondom de Waddenzee niet wordt aangetast door bodemdaling als gevolg van de gaswinning. Daarvoor moet de NAM de bodemdaling en de natuurwaarden monitoren en jaarlijks rapporteren aan de Nederlandse overheid. Ook is in het Rijksprojectbesluit bepaald dat de Commissie voor de milieueffectrapportage (m.e.r.) als onafhankelijke auditor de verantwoordelijke ministers jaarlijks zal adviseren over deze Rapportage. Dit is het 2010 advies van de Auditcommissie gaswinning onder de Waddenzee.

A vigorous Mesoamerican monsoon during the Last Glacial Maximum driven by orbital and oceanic forcing

Science.gov (United States)

Lachniet, M. S.; Asmerom, Y.; Bernal, J. P.; Polyak, V.; Vazquez-Selem, L. V.

2012-12-01

The external forcings on global monsoon strength include summer orbital insolation and ocean circulation changes, both of which are key control knobs on Earth's climate. However, few records of the North American Monsoon (NAM) are available to test its sensitivity to variations in the precession-dominated insolation signal and Atlantic Meridional Overturning Circulation (AMOC) for the Last Glacial Maximum (LGM; 21 ± 3 cal ka BP) and deglacial periods. In particular, well-dated and high-resolution records from the southern sector of the NAM, referred to informally as the Mesoamerican monsoon to distinguish it from the more northerly 'core' NAM, are needed to better elucidate paleoclimate change in North America. Here, we present a 22 ka (ka = kilo years) rainfall history from absolutely-dated speleothems from tropical southwestern Mexico that documents a vigorous LGM summer monsoon, in contradiction to previous interpretations, and that the monsoon collapsed during the Heinrich stadial 1 and Younger Dryas cold events. We conclude that a strong Mesoamerican monsoon requires both a large ocean-to-land temperature contrast, driven as today by summer insolation, and a proximal latitudinal position of the Intertropical Convergence Zone, forced by active AMOC.

An Objective Verification of the North American Mesoscale Model for Kennedy Space Center and Cape Canaveral Air Force Station

Science.gov (United States)

Bauman, William H., III

2010-01-01

The 45th Weather Squadron (45 WS) Launch Weather Officers (LWO's) use the 12-km resolution North American Mesoscale (NAM) model (MesoNAM) text and graphical product forecasts extensively to support launch weather operations. However, the actual performance of the model at Kennedy Space Center (KSC) and Cape Canaveral Air Force Station (CCAFS) has not been measured objectively. In order to have tangible evidence of model performance, the 45 WS tasked the Applied Meteorology Unit (AMU; Bauman et ai, 2004) to conduct a detailed statistical analysis of model output compared to observed values. The model products are provided to the 45 WS by ACTA, Inc. and include hourly forecasts from 0 to 84 hours based on model initialization times of 00, 06, 12 and 18 UTC. The objective analysis compared the MesoNAM forecast winds, temperature (T) and dew pOint (T d), as well as the changes in these parameters over time, to the observed values from the sensors in the KSC/CCAFS wind tower network shown in Table 1. These objective statistics give the forecasters knowledge of the model's strengths and weaknesses, which will result in improved forecasts for operations.

Baština Starog grada Zrinskih

OpenAIRE

Kovač, Ivana

2017-01-01

Stari grad Zrinskih priča bogate, zanimljive i velike priče u svakom svojem kutku. Dvorac je prepun kulturne baštine koja će svakog ostaviti bez daha i dat će nam nove poglede na hrvatsku povijest, a još više na međimursku povijest. U ovom završnom radu pisat ću o ljepotama kraja, povijesnim zbivanjima i kulturnoj baštini grada, od samog početka pa do danas. Posebno ću se posvetiti predmetima koji su nam ostavili naši preci, a najviše umjetnosti grada i okolice. Čakovečki stari grad ima djelo...

Geomagnetic activity forcing of the Northern Annular Mode via the stratosphere

Directory of Open Access Journals (Sweden)

D. R. Palamara

2004-03-01

Full Text Available We consider various aspects of the link between solar-modulated geomagnetic activity and the Northern Annular Mode (NAM. Our results indicate that the geomagnetic forcing of atmospheric circulation in the Northern Hemisphere is temporally and seasonally restricted, modulated by the Quasi-Biennial Oscillation (QBO, and reliant on stratosphere-troposphere coupling. When the data are restricted to January values after 1965, for years in which the January QBO is eastwards, the correlation coefficient between the geomagnetic AA index and the NAM is 0.85. These results can account for many of the enigmatic features of Northern Hemisphere circulation.

Key words. Meterology and atmospheric dynamics (general circulation, climatology

Geomagnetic activity forcing of the Northern Annular Mode via the stratosphere

Directory of Open Access Journals (Sweden)

D. R. Palamara

2004-03-01

Full Text Available We consider various aspects of the link between solar-modulated geomagnetic activity and the Northern Annular Mode (NAM. Our results indicate that the geomagnetic forcing of atmospheric circulation in the Northern Hemisphere is temporally and seasonally restricted, modulated by the Quasi-Biennial Oscillation (QBO, and reliant on stratosphere-troposphere coupling. When the data are restricted to January values after 1965, for years in which the January QBO is eastwards, the correlation coefficient between the geomagnetic AA index and the NAM is 0.85. These results can account for many of the enigmatic features of Northern Hemisphere circulation. Key words. Meterology and atmospheric dynamics (general circulation, climatology

External exposure measurements at Bikini Atoll

International Nuclear Information System (INIS)

Greenhouse, N.A.; Miltenberger, R.P.; Lessard, E.T.

1979-01-01

External exposure rate surveys from 1975 to 1977 on the islands Nam, Eneu and Bikini of Bikini Atoll gave average external exposure rates of 24, 5.7, and 32 μR/hr respectively. The exposure rate on Eneu Island is uniform, whereas those on Bikini and Nam range from 7.0 to 80. μR/hr. Based on an assumed living pattern at Bikini Island, the adult male Bikinian is estimated to be in the presence of an external radiation field corresponding to 16 μR/hr due to debris and fallout from the 1954 BRAVO incident. This corresponds to a 30 year dose equivalent of 2.8 rem

Daily dietary intake

International Nuclear Information System (INIS)

Dang, H.S.

1998-01-01

As part of study on ''Reference Asian Man'' to strengthen radiation protection, the data on the dietary consumption patterns of the Asian region were collected. Eight provided dietary data - Bangladesh, China, India, Indonesia, Japan, Pakistan, Philippines, and Viet Nam. Whereas the dietary information from Bangladesh, Indonesia, Pakistan and Viet Nam are preliminary in nature, the dietary information from China, India, Japan and Philippines, on the other hand, is quite substantial. The population of the countries from which sufficient dietary data are available represents more than 2/3 of the population of the Asian region. The details of the individual data available on dietary parameters from different Asian countries are listed below

ORF Sequence: NC_003070 [GENIUS II[Archive

Lifescience Database Archive (English)

Full Text Available NC_003070 gi|18407972 >gi|18407972|ref|NP_564823.1| no apical meristem (NAM) famil...y protein [Arabidopsis thaliana] MQAEEIICRVSDEEIIENYLRPKINGETSSIPRYVVELAEELYTVEPWLLPRQTAPILNPGEWFYFGKRNRKYSN

Argentina : tous les projets | Page 7 | CRDI - Centre de recherches ...

International Development Research Centre (IDRC) Digital Library (Canada)

Sujet: INTERNATIONAL AGREEMENTS, WOMEN'S RIGHTS, LEGISLATION, ACCESS TO ... SERVICES, GENDER DISCRIMINATION, GENDER EQUALITY, Gender ... Région: Argentina, Bangladesh, Brazil, India, Lebanon, Malawi, Viet Nam.

Electric Power Research in 1991

International Nuclear Information System (INIS)

1991-05-01

This book of contents are a study of desalination by Kim, Young Bu, a study on efficiency test for nuclear power security by Jo, Sung Je; Ann, Nam Sung; Kim, Ho Gi, augmentation of EMS and RYU by Jung, Tae Hoe; Shin, Young Chuel, research on application for electric cars by Yu, Ann Gue, practical use oft robot for nuclear industry by Woo, He Gone; Shin, Hen Beom, a study on the characteristics of coolant structure in generator by Choi, Beng Hwan; Song, Young Chel; Kim, Jong Hark, and research of penetration rate of appliances by Park, Hong Ho; Kim, Beng Cheal; Kim, Dong Hwen.

Interannual and Decadal Variations of Planetary Wave Activity, Stratospheric Cooling, and Northern Hemisphere Annular Mode.

Science.gov (United States)

Hu, Yongyun; Kit Tung, Ka

2002-07-01

Using NCEP-NCAR 51-yr reanalysis data, the interannual and decadal variations of planetary wave activity and its relationship to stratospheric cooling, and the Northern Hemisphere Annular mode (NAM), are studied. It is found that winter stratospheric polar temperature is highly correlated on a year-to-year basis with the Eliassen-Palm (E-P) wave flux from the troposphere, implying a dynamical control of the former by the latter, as often suggested. Greater (lower) wave activity from the troposphere implies larger (smaller) poleward heat flux into the polar region, which leads to warmer (colder) polar temperature. A similar highly correlated antiphase relationship holds for E-P flux divergence and the strength of the polar vortex in the stratosphere. It is tempting to extrapolate these relationships found for interannual timescales to explain the recent stratospheric polar cooling trend in the past few decades as caused by decreased wave activity in the polar region. This speculation is not supported by the data. On timescales of decades the cooling trend is not correlated with the trend in planetary wave activity. In fact, it is found that planetary wave amplitude, E-P flux, and E-P flux convergence all show little statistical evidence of decrease in the past 51 yr, while the stratosphere is experiencing a cooling trend and the NAM index has a positive trend during the past 30 yr. This suggests that the trends in the winter polar temperature and the NAM index can reasonably be attributed to the radiative cooling of the stratosphere, due possibly to increasing greenhouse gases and ozone depletion. It is further shown that the positive trend of the NAM index in the past few decades is not through the inhibition of upward planetary wave propagation from the troposphere to the stratosphere, as previously suggested.

Automated detection of alveolar arches for nasoalveolar molding in cleft lip and palate treatment

Directory of Open Access Journals (Sweden)

Bauer Franz X.

2016-09-01

Full Text Available Nasoalveolar moulding (NAM has become a widely accepted and evidence-based treatment strategy for newborns with cleft lip and palate (CLP, attempting to reduce the cleft gap and to form an appropriately shaped alveolar arch by an intraoral patient-specific NAM plate and to erect the usually flattened nostrils towards a natural nose wing occurrence. The generation of such an appropriately shaped NAM plate requires, besides 3d information of the patient’s initially cleft lip and palate, an estimated target model of the maxilla. Previous studies showed the applicability of curve-based approaches to describe the maxilla during early infancy. We have developed an automated algorithm implemented with the programming language Python, describing the alveolar arch by an approximated ellipse. Therefore, the digitalized data sets of human maxillae were aligned to a global coordinate system with a total least square method and subsequently analyzed with the curvature-based algebraic point set surfaces (APSS algorithm. The gathered information of height ratio and curvature allows the detection of points on the alveolar segments and therewith the fit of an ellipse describing the human maxilla. In 84.5% of 193 maxilla impressions of healthy newborns the fitted ellipses described the course of the maxilla within defined margins. Applying the algorithm to 38 newborns suffering from unilateral cleft lip and palate in 76.3% the fitted ellipses bridge the CLP alveolar segments, so that a harmonic alveolar arch can be deduced. Describing the alveolar arch by one or multiple ellipses allows (i to automatically measure the dimensions of the maxilla, (ii to derive a growth model during early infancy, (iii to derive a healthy harmonic arch from CLP alveolar segments and (iv to automatically generate a basic NAM device on the basis of the virtually modified maxilla.

Negative Allosteric Modulators of Metabotropic Glutamate Receptors Subtype 5 in Addiction: a Therapeutic Window

Science.gov (United States)

2016-01-01

Background: Abundant evidence at the anatomical, electrophysiological, and molecular levels implicates metabotropic glutamate receptor subtype 5 (mGluR5) in addiction. Consistently, the effects of a wide range of doses of different mGluR5 negative allosteric modulators (NAMs) have been tested in various animal models of addiction. Here, these studies were subjected to a systematic review to find out if mGluR5 NAMs have a therapeutic potential that can be translated to the clinic. Methods: Literature on consumption/self-administration and reinstatement of drug seeking as outcomes of interest published up to April 2015 was retrieved via PubMed. The review focused on the effects of systemic (i.p., i.v., s.c.) administration of the mGluR5 NAMs 3-((2-Methyl-4-thiazolyl)ethynyl)pyridine (MTEP) and 2-Methyl-6-(phenylethynyl)pyridine (MPEP) on paradigms with cocaine, ethanol, nicotine, and food in rats. Results: MTEP and MPEP were found to reduce self-administration of cocaine, ethanol, and nicotine at doses ≥1mg/kg and 2.5mg/kg, respectively. Dose-response relationship resembled a sigmoidal curve, with low doses not reaching statistical significance and high doses reliably inhibiting self-administration of drugs of abuse. Importantly, self-administration of cocaine, ethanol, and nicotine, but not food, was reduced by MTEP and MPEP in the dose range of 1 to 2mg/kg and 2.5 to 3.2mg/kg, respectively. This dose range corresponds to approximately 50% to 80% mGluR5 occupancy. Interestingly, the limited data found in mice and monkeys showed a similar therapeutic window. Conclusion: Altogether, this review suggests a therapeutic window for mGluR5 NAMs that can be translated to the treatment of substance-related and addictive disorders. PMID:26802568

Monitoring of the natural gas exploitation in the Wadden Sea from the locations Moddergat, Lauwersoog and Vierhuizen, Netherlands. Advice of the Audit Committee on method for monitoring and null-measurement; Monitoring van de aardgaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen. Advies van de Auditcommissie over de opzet van de monitoring en de nulmeting

Energy Technology Data Exchange (ETDEWEB)

NONE

2007-12-21

The Dutch governmental decree ('Rijksprojectenbesluit') on the project for natural gas exploitation in the Wadden Sea for the locations Moddergat, Lauwersoog Vierhuizen gives the Dutch Petroleum Company (NAM) the possibility to produce natural gas under specific conditions in the Wadden Sea area from the six fields Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog East and Vierhuizen East. The precondition is that the (dynamic) nature in and around the Wadden Sea is not affected by subsidence as a result of the gas exploitation. For this, the NAM must monitor the subsidence and the nature values and report annually to the Dutch government. Also in the Rijksprojectbesluit it is determined that the Commission for Environmental Impact Assessment (EIA), as the independent auditor, will annually advise the responsible ministers on the EIA-report. This is the first recommendation of the Audit Committee for exploitation of natural gas in the Wadden Sea which in particular deals with the method for the monitoring and baseline measurement. [Dutch] Het Rijksprojectbesluit Gaswinning onder de Waddenzee vanaf de locaties Moddergat, Lauwersoog en Vierhuizen geeft de Nederlandse Aardolie Maatschappij (NAM) de mogelijkheid om onder randvoorwaarden aardgas te produceren in het Waddenzeegebied uit de zes velden Moddergat, Nes, Lauwersoog C, Lauwersoog West, Lauwersoog Oost en Vierhuizen Oost. De randvoorwaarde is dat de (dynamische) natuur in en rondom de Waddenzee niet wordt aangetast door bodemdaling als gevolg van de gaswinning. Daarvoor moet de NAM de bodemdaling en de natuurwaarden monitoren en jaarlijks rapporteren aan de Nederlandse overheid. Ook is in het Rijksprojectbesluit bepaald dat de Commissie voor de milieueffectrapportage (m.e.r.) als onafhankelijke auditor de verantwoordelijke ministers jaarlijks zal adviseren over deze Rapportage. Dit is het eerste advies van de Auditcommissie gaswinning onder de Waddenzee waarin specifiek wordt ingegaan op de

Namık Kemal’in Sanat/Sanatçı Algısında Romantizm ve Victor Hugo Etkisi Influence of Romanticism and Victor Hugo on Namık Kemal’s Perception of Art/Artist

Directory of Open Access Journals (Sweden)

Abdulhalim AYDIN

2012-09-01

�ağdaşlaşma, yenilenme ihtiyacıyla yüzünü Batı’ya çevirdiği bir yapılanma dönemidir. Tanzimat edebiyatı da bu sürecin edebi tarafını oluşturmuştur. Dönemin diğer yazarları gibi bu edebiyatın en büyük simalarından N. Kemal’in üzerinde de romantizmin ve özellikle Hugo’nun etkilerinin büyük boyutlarda olduğu bilinen bir şeydir. Hugo’nun şiirlerini de okumakla beraber tiyatroları ve romanlarına daha büyük ilgi duyan N. Kemal’de bu ilginin sonuçları kendini göstermekte gecikmez. Eserlerinde, büyük bir Hugo hayranlığı sonucu, romantizmin ve şefinin etkileri aslında artık herkesin bildiği “Hernani-Zavallı Çocuk” ve “Cromwell Önsözü-Celaleddin Önsözü” ile sınırlı değildir. Ama bu çalışmada asıl üzerinde durmak istediğimiz şey, N. Kemal’in sanat ve sanatçı algısında romantizm ve Hugo’nun etki veya katkısının mahiyetidir. Klasik okulun akılcılığı, kuralcılığı ve hitapta benimsediği seçkinciliğine karşı bir devrim gerçekleştiren romantik okulla, edebiyatı geniş bir perspektife yaymakla beraber bir tezin savunulması (litterature engagée biçiminde de algılayan Hugo’nun yazarımız üzerindeki etki ve/ya yönlendirmelerin ne kadar etkin olduğu çalışmamızın cevabını bulmaya çalıştığı temel soru olacaktır. Çalışmada da üzerinde durduğumuz gibi, esasen Hugo tarzı sanat ve edebiyat yapma biçimi Namık Kemal’in edebiyattan beklentilerine büyük ölçüde uyuyordu. Ne de olsa o da Hugo gibi, kemal de yeni bir toplum oluşturmada sanat ve edebiyatın büyük rolüne inanıyordu. Bu bağlamda, “Realizme ve temsilcilerine yönelseydi acaba bu gün karşımızda yine aynı Kemal’i bulur muyduk? Kemal’in gür halkçı sesiyle romantik bireyciliği nasıl bağdaştırmalı?” gibi sorular çalışmada bizi meşgul edecek sorulardır.

A dam in the heart of the forest

International Nuclear Information System (INIS)

Arnaud, B.

2006-01-01

The Nam Theun 2 dam in Laos, is presented as an exemplary project for two reasons. This giant constructive work is supposed to save the country from poverty and the project is carried out with an extreme care of the environment and of the habitants: relocation of populations in the vicinity of the dam, preservation of the animal species, protection of the 4000 km 2 upstream area. The construction work is controlled by the Nam Theun Power Company (NTPC) consortium which gathers EDF (France, 35%), EGCO (Thailand, 25%), Laos Electricity (25%) and Italian-Thai Development Company (15%). 95% of the power generated will be exported to Thailand, and the remaining 5% will supply southern Laos. (J.S.)

Anti-synthetase syndrome associated with anti PL-12 and anti-Signal recognition particle antibodies and a necrotizing auto-immune myositis.

Science.gov (United States)

Malkan, Ashish; Cappelen-Smith, Cecilia; Beran, Roy; Griffith, Neil; Toong, Catherine; Wang, Min-Xia; Cordato, Dennis

2015-02-01

We report a 37-year-old woman with a 2 month history of proximal muscle weakness and extremely high creatine kinase (21,808 U/L) due to necrotizing auto-immune myositis (NAM) in association with anti-synthetase syndrome. Myositis-specific auto-immune antibody panel was positive for anti-Signal recognition particle and anti-PL-12. CT scan of the chest confirmed interstitial lung disease. Prednisolone, intravenous immunoglobulin and cyclophosphamide therapy was given with gradual improvement. This patient is notable for the unusual combination of NAM and anti-synthetase syndrome with the rare finding of two myositis-specific autoantibodies, which directed testing for associated extramuscular features and management with more aggressive immunotherapy. Copyright © 2014 Elsevier Ltd. All rights reserved.

Territorial disputes simmer in areas of South China Sea

International Nuclear Information System (INIS)

Anon.

1992-01-01

This paper reports that China's award of an exploration cooperation contact in the Nansha area of the South China Sea has revived territorial disputes in the area centering ton the Spratly and Paracel islands. The key dispute is between China and Viet Nam, which earlier engaged in military action over ownership of the islands, believed to have world class potential for hydrocarbon discoveries. Those two nations, as well as Brunei, Malaysia, Philippines, and Taiwan, lay claim to overlapping boundaries of the Spratly Islands. Separately, China and Viet Nam dispute territorial claims in the Paracels. Tensions continue to mount, and regional governments are trying to negotiate compromises to avoid a repeat of warfare

[13N]ammonia in organic solvents; a potent synthetic precursor for 13N-labeling

International Nuclear Information System (INIS)

Tominaga, Toshiyoshi; Hirobe, Masaaki

1987-01-01

13 NH 3 in an organic solvent was prepared and its utility as a labeling precursor was studied. [ 13 N]adenine ([ 13 N]ADN), [ 13 N]nicotinamide ([ 13 N]NAM), [ 13 N]p-nitrophenyl carbamate ([ 13 N]NPC), and [ 13 N]L-glutamine ([ 13 N]Gln) were labeled utilizing this precursor. [ 13 N]ADN and [ 13 N]NAM were labeled in much better yields than from an aqueous solution of 13 NH 3 . [ 13 N]NPC and [ 13 N]Gln, which could not be labeled in an aqueous solution, were labeled in high radiochemical yields. Thus, the advantages of this precursor are the improvement of the labeling yield and the feasibility of labeling compounds unstable in aqueous conditions. (author)

First simultaneous measurements of peroxyacetyl nitrate (PAN) and ozone at Nam Co in the central Tibetan Plateau: impacts from the PBL evolution and transport processes

Science.gov (United States)

Xu, Xiaobin; Zhang, Hualong; Lin, Weili; Wang, Ying; Xu, Wanyun; Jia, Shihui

2018-04-01

Both peroxyacetyl nitrate (PAN) and ozone (O3) are key photochemical products in the atmosphere. Most of the previous in situ observations of both gases have been made in polluted regions and at low-altitude sites. Here we present the first simultaneous measurements of PAN and O3 at Nam Co (NMC; 30°46' N, 90°57' E, 4745 m a.s.l.), a remote site in the central Tibetan Plateau (TP). The observations were made during summer periods in 2011 and 2012. The PAN levels averaged 0.36 ppb (range: 0.11-0.76 ppb) and 0.44 ppb (range: 0.21-0.99 ppb) during 17-24 August 2011 and 15 May to 13 July 2012, respectively. The O3 level varied from 27.9 to 96.4 ppb, with an average of 60.0 ppb. Profound diurnal cycles of PAN and O3 were observed with minimum values around 05:00 LT, steep rises in the early morning, and broader platforms of high values during 09:00-20:00 LT. The evolution of the planetary boundary layer (PBL) played a key role in shaping the diurnal patterns of both gases, particularly the rapid increases of PAN and O3 in the early morning. Air entrainment from the free troposphere into the PBL seemed to cause the early-morning increase and be a key factor for sustaining the daytime high concentrations of both gases. The days with higher daytime PBL (about 3 km) showed stronger diurnal variations in both gases and were mainly distributed in the drier pre-monsoon period, while those with shallower daytime PBL (about 2 km) showed minor diurnal variations and were mainly distributed in the humid monsoon period. Episodes of higher PAN levels were occasionally observed at NMC. These PAN episodes were caused either by rapid downward transport of air masses from the middle/upper troposphere or by long-range transport of PAN plumes from north India, north Pakistan, and Nepal. The maximum PAN level in the downward transport cases ranged from 0.5 to 0.7 ppb. In the long-range transport case, the PAN level varied in the range of 0.3-1.0 ppb, with an average of 0.6 ppb. This long