International Nuclear Information System (INIS)
Nelson, M.J.; Klopper, J.F.
1985-01-01
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts
Energy Technology Data Exchange (ETDEWEB)
Nelson, M.J. (Provincial Hospital, Port Elizabeth (South Africa). Dept. of Nuclear Medicine); Klopper, J.F. (Stellenbosch Univ. (South Africa). Dept. of Nuclear Medicine)
1985-01-26
Liver scanning with radiocolloids is an important method to determine the presence, the position and the size of space-occupying lesions in the liver. Unfortunately, this information is nonspecific and it is not possible to distinguish between tumours, abscesses or cysts. Thirty-six patients in whom a definite diagnosis of hepatoma, amoebic liver abscess or echinococcus cyst had been made were examined with technetium-99m tin colloid and indium-113m chloride. The amoebic liver abscesses were avascular, showed a hyperaemic area surrounding the abscess and appeared smaller on the indium than on the technetium scan. The hepatomas showed greater vascularity and absence of the hyperaemic area. Cysts were avascular, did not show a hyperaemic rim and the size was equal on both scans. The experience of the observers had an influence on the accuracy of interpretation of the scans; experienced observers made a correct diagnosis in 73% of cases. It is suggested that simultaneous technetium-99m tin colloid and indium 113m-chloride scans provide additional specificity in the differential diagnosis between hepatoma, amoebic liver abscess and echinococcus cysts.
Preparation of an sup(113m) indium generator
International Nuclear Information System (INIS)
Ling, H.W.
1979-01-01
This paper describes the features related to the preparation of sup(113m) In from a generator for nuclear medicine application. 113 Sn radioisotope is adsorbed on a hidrated zirconium oxide column and sup(113m) In generated from the decay of 113 Sn is eluted with diluted hydrochloric acid. This procedure is simple and appropriate for the separation of the desired radionuclide. Parameters which may affect the adsorption of 113 Sn like tin and hydrochloric acid concentration and temperature are studied. The influence of eluent concentration and temperature and flow rate of elution on sup(113m) In separation yields are observed. The purity of eluted sup(113m) In is analysed and variation of elution yield in a generator prepared with enriched tin is studied. (Author) [pt
study on 113 Sn-113m In generator of the chromatographic column elution mode
International Nuclear Information System (INIS)
Abdel-Halim, A.A.
2002-01-01
this work has been carried out to study the optimum conditions required for local preparation of 113 Sn- 113m In radioisotope generator based on 12- molybdocerate- 113 Sn column matrix. this work was directed to: 1- investigate the optimum conditions of the tin target irradiation and dissolution processes. 2- study the different preparative conditions which affect the loading of 113 Sn radionuclide onto 12- molybdocerate (IV) columns and the elution of the generated 113m In radionuclide. 3- study the effect of generator life- time on the elution performance and quality control of the generated 113m In radionuclide over a period of 190 days
International Nuclear Information System (INIS)
Ramamoorthy, N.; Mani, R.S.
1976-01-01
Radioisotopes of tin, antimony, cadmium and indium such as tin-113, antimony-124, antimony-125, cadmium-109, cadmium-115, indium-113m and indium-111 find extensive applications as tracers in various fields. These isotopes are produced by irradiation of targets in a reactor or a cyclotron. It is usually observed that in addition to the nuclear reactions giving rise to the desired isotopes, side reactions also take place giving rise to radionuclidic contaminants. Thus, antimony-125, indium-114m and indium-114 will be present in the cyclotron produced indium-111. The authors have studied column chromatography over hydrous zirconia for the separation of antimony from tin and indium, and cadmium from indium. These studies have thrown light on the role and behaviour of antimony-125 present as an impurity in tin-113 during the preparation of tin-113-indium-113m generators and have indicated methods for the preparation of 115 Cd-sup(115m)In generators and for separation of 111 In from proton irradiated cadmium targets. (Authors)
International Nuclear Information System (INIS)
Omar, M.; Bowen, H.J.M.
1982-01-01
Tin(II) and tin(IV) are absorbed from aqueous solutions by Sephadex G-25 gel, from which they can be eluted by humates or fulvates, with which they interact more strongly. Methyltin species are not absorbed by Sephadex G-25, and so can be separated from inorganic tin. Both inorganic tin and methyltin species in natural waters at pH 7.4 can be quantitatively retained by passing through small columns of Chelex-100 resin: the methyltin species can then be washed off the resin with 4M nitric acid. Trimethyltin chloride 113 Sn in water scarcely interacts with fulvates, humates, kaolinite or montmorillonite but is absorbed by Sphagnum peat. Dimethyltin dichloride- 113 Sn reacts significantly with all the above materials after 2 hours equilibration. Methyltin trichloride- 113 Sn interacts weakly in alkaline solutions. (author)
Kamilli, Robert J.; Kimball, Bryn E.; Carlin, James F.; Schulz, Klaus J.; DeYoung,, John H.; Seal, Robert R.; Bradley, Dwight C.
2017-12-19
Tin (Sn) is one of the first metals to be used by humans. Almost without exception, tin is used as an alloy. Because of its hardening effect on copper, tin was used in bronze implements as early as 3500 B.C. The major uses of tin today are for cans and containers, construction materials, transportation materials, and solder. The predominant ore mineral of tin, by far, is cassiterite (SnO2).In 2015, the world’s total estimated mine production of tin was 289,000 metric tons of contained tin. Total world reserves at the end of 2016 were estimated to be 4,700,000 metric tons. China held about 24 percent of the world’s tin reserves and accounted for 38 percent of the world’s 2015 production of tin.The proportion of scrap used in tin production is between 10 and 25 percent. Unlike many metals, tin recycling is relatively efficient, and the fraction of tin in discarded products that get recycled is greater than 50 percent.Only about 20 percent of the world’s identified tin resources occur as primary hydrothermal hard-rock veins, or lodes. These lodes contain predominantly high-temperature minerals and almost invariably occur in close association with silicic, peraluminous granites. About 80 percent of the world’s identified tin resources occur as unconsolidated secondary or placer deposits in riverbeds and valleys or on the sea floor. The largest concentration of both onshore and offshore placers is in the extensive tin belt of Southeast Asia, which stretches from China in the north, through Thailand, Burma (also referred to as Myanmar), and Malaysia, to the islands of Indonesia in the south. Furthermore, tin placers are almost always found closely allied to the granites from which they originate. Other countries with significant tin resources are Australia, Bolivia, and Brazil.Most hydrothermal tin deposits belong to what can be thought of as a superclass of porphyry-greisen deposits. The hydrothermal tin deposits are all characterized by a close spatial
Khanderi, Jayaprakash; Shi, Lei; Rothenberger, Alexander
2015-01-01
Sn6O4(OH)4, a hydrolysis product of Sn(NMe2)2, is transformed to tin (II) or tin (IV) oxide by solid and solution phase processing. Tin (II) oxide is formed by heating Sn6O4(OH)4 at ≤200 °C in air or under inert atmosphere. Tin (IV) oxide
Dynamics of implanted muons at low temperatures in white tin
International Nuclear Information System (INIS)
Solt, G.; Zimmermann, U.; Herlach, D.
2008-01-01
The low temperature lattice site of the implanted μ + particle and its subsequent delocalization at higher temperatures was investigated in single crystal white tin for 2 + was found to reside at the interstitial sites of type d. With increasing temperature thermally activated hopping sets in at T=48±2K, resulting in complete delocalization near 60 K. The activation energy for hopping, E a =113±15meV, is substantially higher than that found previously for the equally tetragonal indium
Studies on Cementation of Tin on Copper and Tin Stripping from Copper Substrate
Directory of Open Access Journals (Sweden)
Rudnik E.
2016-06-01
Full Text Available Cementation of tin on copper in acid chloride-thiourea solutions leads to the formation of porous layers with a thickness dependent on the immersion time. The process occurs via Sn(II-Cu(I mechanism. Chemical stripping of tin was carried out in alkaline and acid solutions in the presence of oxidizing agents. It resulted in the dissolution of metallic tin, but refractory Cu3Sn phase remained on the copper surface. Electrochemical tin stripping allows complete tin removal from the copper substrate, but porosity and complex phase composition of the tin coating do not allow monitoring the process in unambiguous way.
DEFF Research Database (Denmark)
Cannon, Daniel C; Yang, Jeremy J; Mathias, Stephen L
2017-01-01
between proteins and diseases, based on text mining data processed from scientific literature. In the current implementation, TIN-X supports exploration of data for G-protein coupled receptors, kinases, ion channels, and nuclear receptors. TIN-X supports browsing and navigating across proteins......Motivation: The increasing amount of peer-reviewed manuscripts requires the development of specific mining tools to facilitate the visual exploration of evidence linking diseases and proteins. Results: We developed TIN-X, the Target Importance and Novelty eXplorer, to visualize the association...
On the electrochemistry of tin oxide coated tin electrodes in lithium-ion batteries
International Nuclear Information System (INIS)
Böhme, Solveig; Edström, Kristina; Nyholm, Leif
2015-01-01
As tin based electrodes are of significant interest in the development of improved lithium-ion batteries it is important to understand the associated electrochemical reactions. In this work it is shown that the electrochemical behavior of SnO_2 coated tin electrodes can be described based on the SnO_2 and SnO conversion reactions, the lithium tin alloy formation and the oxidation of tin generating SnF_2. The CV, XPS and SEM data, obtained for electrodeposited tin crystals on gold substrates, demonstrates that the capacity loss often observed for SnO_2 is caused by the reformed SnO_2 layer serving as a passivating layer protecting the remaining tin. Capacities corresponding up to about 80 % of the initial SnO_2 capacity could, however, be obtained by cycling to 3.5 V vs. Li"+/Li. It is also shown that the oxidation of the lithium tin alloy is hindered by the rate of the diffusion of lithium through a layer of tin with increasing thickness and that the irreversible oxidation of tin to SnF_2 at potentials larger than 2.8 V vs. Li"+/Li is due to the fact that SnF_2 is formed below the SnO_2 layer. This improved electrochemical understanding of the SnO_2/Sn system should be valuable in the development of tin based electrodes for lithium-ion batteries.
Boogaard, Peter J; Boisset, Michel; Blunden, Steve; Davies, Scot; Ong, Teng Jin; Taverne, Jean-Pierre
2003-12-01
Tin is present in low concentrations in most canned foods and beverages, the highest levels being found in products packaged in unlacquered or partially lacquered tinplate cans. A limited number of case-reports of acute gastrointestinal disorders after consumption of food containing 100-500 mg/kg tin have been reported, but these reports suffer many insufficiencies. Controlled clinical studies on acute effects of tin migrated from packaging suggest a threshold concentration for adverse effects (AEs) of >730 mg/kg. Two separate randomised, single-centre, double-blind, crossover studies, enabling comparison of the tolerability of tin added as tin(II) chloride at concentrations of soup in 24 volunteers (Study 2) were carried out. Distribution studies were conducted to get insight in the acute AEs of low molecular weight (clear dose-response relationship was only observed when tin was added as tin(II) chloride in tomato juice. No clinically significant AEs were reported in Study 2 and comparison of the incidence of tin-related AEs showed no difference between the dose levels (including control). Tin species of low molecular weight in supernatant represented 31-32% of total tin in canned tomato soup versus 56-61% in juice freshly spiked with tin(II) chloride. Differences in the incidence of AEs following administration of tomato juice with 161 and 264 mg of tin per kg and tomato soup with 201 and 267 mg of tin per kg likely results from differences in the concentration of low molecular weight tin species and in the nature of tin complexes formed. The results of this work demonstrate that tin levels up to 267 mg/kg in canned food cause no AEs in healthy adults and support the currently proposed tin levels of 200 mg/kg and 250 mg/kg for canned beverages and canned foods, respectively, as safe levels for adults in the general population.
Khanderi, Jayaprakash
2015-03-01
Sn6O4(OH)4, a hydrolysis product of Sn(NMe2)2, is transformed to tin (II) or tin (IV) oxide by solid and solution phase processing. Tin (II) oxide is formed by heating Sn6O4(OH)4 at ≤200 °C in air or under inert atmosphere. Tin (IV) oxide nanoparticles are formed in the presence of a carboxylic acid and base in air at room temperature. IR spectroscopy, Raman spectroscopy, thermogravimetry (coupled with infrared spectroscopy), powder X-ray diffraction, high temperature X-ray diffraction, scanning electron and transmission electron microscopy are used for the characterization of Sn6O4(OH)4 and the investigation of its selective decomposition into SnO or SnO2. Spectroscopic and X-ray diffraction results indicate that SnO is formed by the removal of water from crystalline Sn6O4(OH)4. SEM shows octahedral morphology of the Sn6O4(OH)4, SnO and SnO2 with particle size from 400 nm-2 μm during solid state conversion. Solution phase transformation of Sn6O4(OH)4 to SnO2 occurs in the presence of potassium glutarate and oxygen. SnO2 particles are 15-20 nm in size.
Energy Technology Data Exchange (ETDEWEB)
Liu, Wei-Sheng; Cheng, Huai-Ming; Hu, Hung-Chun; Li, Ying-Tse; Huang, Shi-Da; Yu, Hau-Wei [Department of Photonics Engineering, Yuan Ze University, Chung-Li 32003, Taiwan (China); Pu, Nen-Wen, E-mail: nwpuccit@gmail.com [Department of Photonics Engineering, Yuan Ze University, Chung-Li 32003, Taiwan (China); Liang, Shih-Chang [Materials & Electro-Optics Research Division, National Chung-Shan Institute of Science and Technology, Lung Tan 32599, Taiwan (China)
2015-11-01
Highlights: • Ti-doped indium tin oxide (ITO) films were deposited by DC magnetron sputtering. • Optimal optoelectronic properties were achieved at a sputtering power of 100 W. • Resistivity = 3.2 × 10{sup −4} Ω-cm without substrate heating or post growth annealing. • Mean visible and NIR transmittances of 83 and 80%, respectively, were achieved. • Efficient batteries (11.3%) were fabricated by applying ITO:Ti to CIGS solar cells. - Abstract: In this study, Ti-doped indium tin oxide (ITO:Ti) thin films were fabricated using a DC-magnetron sputtering deposition method. The thin films were grown without introducing oxygen or heating the substrate, and no post-growth annealing was performed after fabrication. The thickness of the ITO:Ti thin films (350 nm) was controlled while increasing the sputtering power from 50 to 150 W. According to the results, the optimal optoelectronic properties were observed in ITO:Ti thin films grown at a sputtering power of 100 W, yielding a reduced resistivity of 3.2 × 10{sup −4} Ω-cm and a mean high transmittance of 83% at wavelengths ranging from 400 to 800 nm. The optimal ITO:Ti thin films were used to fabricate a Cu(In,Ga)Se{sub 2} solar cell that exhibited a photoelectric conversion efficiency of 11.3%, a short-circuit current density of 33.1 mA/cm{sup 2}, an open-circuit voltage of 0.54 V, and a fill factor of 0.64.
International strategic minerals inventory summary report; tin
Sutphin, D.M.; Sabin, A.E.; Reed, B.L.
1990-01-01
The International Strategic Minerals Inventory tin inventory contains records for 56 major tin deposits and districts in 21 countries. These countries accounted for 98 percent of the 10 million metric tons of tin produced in the period 1934-87. Tin is a good alloying metal and is generally nontoxic, and its chief uses are as tinplate for tin cans and as solder in electronics. The 56 locations consist of 39 lode deposits and 17 placers and contain almost 7.5 million metric tons of tin in identified economic resources (R1E) and another 1.5 million metric tons of tin in other resource categories. Most of these resources are in major deposits that have been known for over a hundred years. Lode deposits account for 44 percent of the R1E and 87 percent of the resources in other categories. Placer deposits make up the remainder. Low-income and middle-income countries, including Bolivia and Brazil and countries along the Southeast Asian Tin Belt such as Malaysia, Thailand, and Indonesia account for 91 percent of the R1E resources of tin and for 61 percent of resources in other categories. The United States has less than 0.05 percent of the world's tin R1E in major deposits. Available data suggest that the Soviet Union may have about 4 percent of resources in this category. The industrial market economy countries of the United States, Japan, Federal Republic of Germany, and the United Kingdom are major consumers of tin, whereas the major tin-producing countries generally consume little tin. The Soviet Union and China are both major producers and consumers of tin. At the end of World War II, the four largest tin-producing countries (Bolivia, the Belgian Congo (Zaire), Nigeria, and Malaysia) produced over 80 percent of the world's tin. In 1986, the portion of production from the four largest producers (Malaysia, Brazil, Soviet Union, Indonesia) declined to about 55 percent, while the price of tin rose from about $1,500 to $18,000 per metric ton. In response to tin shortages
Chemistry of tin compounds and environment
International Nuclear Information System (INIS)
Ali, S.; Mazhar, M.; Mahmood, S.; Bhatti, M.H.; Chaudhary, M.A.
1997-01-01
Of the large volume of tin compounds reported in the literature, possible only 100 are commercially important. Tin compounds are a wide variety of purposes such as catalysts, stabilizers for many materials including polymer, biocidal agents, bactericides, insecticides, fungicides, wood preservatives, acaricides and anti fouling agents in paints, anticancer and antitumour agents, ceramic opacifiers, as textile additives, in metal finishing operations, as food additives and in electro conductive coating. All these applications make the environment much exposed to tin contamination. The application of organotin compounds as biocides account for about 30% of total tin consumption suggesting that the main environmental effects are likely to originate from this sector. Diorgano tins and mono-organo tins are used mainly in plastic industry which is the next big source for environmental pollution. In this presentation all environmental aspects of the use of tin compounds and the recommended preventive measures are discussed. (author)
Synthesising highly reactive tin oxide using Tin(II2- ethylhexanoate polynucleation as precursor
Directory of Open Access Journals (Sweden)
Alejandra Montenegro Hernández
2009-01-01
Full Text Available Tin oxide is a widely used compound in technological applications, particularity as a catalyst, gas sensor and in making varistors, transparent conductors, electrocatalytic electrodes and photovoltaic cells. An ethylhexanoate tin salt, a carboxylic acid and poly-esterification were used for synthesising highly reactive tin oxide in the present study. Synthesis was controlled by Fourier transform infrared (FTIR spectroscopy and recording changes in viscosity. The tin oxide characteristics so obtained were determined using FTIR spectroscopy, X-ray diffraction (XRD and scanning electron microscopy (SEM. The SnO2 dust synthesised and heat-treated at 550°C yielded high density aggregates, having greater than 50 μm particle size. This result demonstrates the high reactivity of the ceramic powders synthesised here.
Measuring the sustainability of tin in China.
Yang, Congren; Tan, Quanyin; Zeng, Xianlai; Zhang, Yuping; Wang, Zhishi; Li, Jinhui
2018-09-01
Tin is a component of many items used in daily activities, including solder in consumer electronics, tin can containing food and beverages, polyvinyl chloride stabilizers in construction products, catalysts in industrial processes, etc. China is the largest producer and consumer of refined tin, and more than 60% of this refined tin is applied in the electronics sector as solder. China is the leader in global economic growth; simultaneously, China is also a major producer and consumer of electrical and electronic equipment (EEE). Thus, future tin supply and demand in China are forecasted, based on the gross domestic product per capita and the average consumption of refined tin in past five years. Current tin reserves and identified resources in China can meet the future two decades of mine production, but import of tin will also be critical for China's future tin consumption. However, there will be a lot of uncertainty for import of tin from other countries. At the same time, virgin mining of geological ores is a process of high energy consumption and destruction of the natural environment. Hence recycling tin from Sn-bearing secondary resources like tailings and waste electrical and electronic equipment (WEEE) can not only address the shortage of tin mineral resources, but also save energy and protect the ecological environment. Copyright © 2018 Elsevier B.V. All rights reserved.
Transient heat transfer phenomena of the liquid metal layer cooled by overlying R113 coolant
International Nuclear Information System (INIS)
Cho, J. S.; Seo, K. R.; Jung, C. H.; Park, R. J.; Kim, S. B.
1999-01-01
To understand the fundamental relationship of the natural convection heat transfer in the molten metal pool and the boiling mechanism of the overlying coolant, experiments were performed for the transient heat transfer of the liquid metal pool with overlying R113 coolant with boiling. The simulant molten pool material is tin (Sn) with the melting temperature of 232 deg C. The metal pool is heated from the bottom surface and the coolant is injected onto the molten metal pool. Tests were conducted by changing the bottom surface boundary condition. The bottom heating condition was varied from 8kW to 14kW. As a result the boiling mechanism of the R113 coolant is changed from the nuclear boiling to film boiling. The Nusselt number and the Rayleigh number in the molten metal pool region obtained as functions of time. Analysis was made for the relationship between the heat flux and the temperature difference of the metal layer surface temperature and the boiling coolant bulk temperature
Quality control of the 113Sn-113mIn generator
International Nuclear Information System (INIS)
Morin Zorilla, J.; Olive, E.; Isaac, M.; Cruz, J.
1989-01-01
Methods for quality control of 113 Sn- 113m In generators are compared and recommended the most convenient to applicate in hospitals and in more specialized quality control laboratories. The quality of 113 Sn- 113m In generator produced by POLATOM (Poland) is also evaluated. The product met the requirements of the International Pharmacopeia
Low-temperature Synthesis of Tin(II) Oxide From Tin(II) ketoacidoximate Precursor
Alshankiti, Buthainah
2015-01-01
Sn (II) oxide finds numerous applications in different fields such as thin film transistors1, solar cells2 and sensors.3 In this study we present the fabrication of tin monoxide SnO by using Sn (II) ketoacid oximate complexes as precursors. Tin (II
Structural studies of supported tin catalysts
Nava, Noel; Viveros, Tomás
1999-11-01
Tin oxide was supported on aluminium oxide, titanium oxide, magnesium oxide and silicon oxide, and the resulting interactions between the components in the prepared samples and after reduction were characterized by Mössbauer spectroscopy. It was observed that in the oxide state, tin is present as SnO2 on alumina, magnesia and silica, but on titania tin occupies Ti sites in the structure. After hydrogen treatment at high temperatures, tin is reduced from Sn(4) to Sn(2) on alumina and titania; it is reduced from Sn(4) to Sn(0) on silica, and is practically not reduced on magnesia. These results reveal the degree of interaction between tin and the different supports studied.
Structural studies of supported tin catalysts
International Nuclear Information System (INIS)
Nava, Noel; Viveros, Tomas
1999-01-01
Tin oxide was supported on aluminium oxide, titanium oxide, magnesium oxide and silicon oxide, and the resulting interactions between the components in the prepared samples and after reduction were characterized by Moessbauer spectroscopy. It was observed that in the oxide state, tin is present as SnO 2 on alumina, magnesia and silica, but on titania tin occupies Ti sites in the structure. After hydrogen treatment at high temperatures, tin is reduced from Sn(4) to Sn(2) on alumina and titania; it is reduced from Sn(4) to Sn(0) on silica, and is practically not reduced on magnesia. These results reveal the degree of interaction between tin and the different supports studied
Electrochemical dissolution of tin in methanesulphonic acid solutions
de Greef, R.A.T.; Janssen, L.J.J.
2001-01-01
High-rate electroplating of tin on a moving steel strip is generally carried out in cells with dimensionally stable anodes. To obtain a matt tin deposit a concentrated acidic tin methanesulphonate solution containing a small concentration of sulphuric acid is used. The concentrated tin
Tin-antimony oxide oxidation catalysts
Energy Technology Data Exchange (ETDEWEB)
Berry, Frank J. [Open University, Department of Chemistry (United Kingdom)
1998-12-15
Tin-antimony oxide catalysts for the selective oxidation of hydrocarbons have been made by precipitation techniques. The dehydration of the amorphous dried precipitate by calcination at increasingly higher temperatures induces the crystallisation of a rutile-related tin dioxide-type phase and the segregation of antimony oxides which volatilise at elevated temperatures. The rutile-related tin dioxide-type phase contains antimony(V) in the bulk and antimony(III) in the surface. Specific catalytic activity for the oxidative dehydrogenation of butene to butadiene is associated with materials with large concentrations of antimony(III) in the surface.
International Nuclear Information System (INIS)
Kato, Akinori; Endo, Kazutoyo; Sano, Hirotoshi
1980-01-01
By means of the conversion electron Moessbauer spectroscopy (CEMS), we studied surface layers of ''tin'' plates and tin-coated iron plates corroded by various acids. Transmission Moessbauer spectra and X-ray diffraction patterns were also measured. Metastannic acid was formed, when the ''tin'' plate was corroded by nitric acid solution. In corrosion by phosphoric acid solution, the X-ray diffractometry revealed the formation of tin(IV) pyrophosphate. In corrosion by various organic acid solutions, the formation of oxides was identified by the 119 Sn CEMS, but not by the X-ray diffractometry because of the too thin corrosion layer. In corrosion of tin-coated iron plates, maleic acid, malonic acid, formic acid, and oxalic acid were used. It was determined by CEMS that the corrosion products caused by these acids were tin(IV) oxides, although they could not be identified by the X-ray diffractometry. CEMS also confirmed that the surface of uncorroded tin-coated iron plate was already oxidized by air. Colorimetric determinations of Sn and Fe dissolved from tin-coated iron plates to various acid solutions confirmed that maleic acid had the strongest corrosion effect among the organic acids studied. (author)
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.310 Section 113... Discrimination on the Basis of Sex in Admission and Recruitment Prohibited § 113.310 Recruitment. (a) Nondiscriminatory recruitment. A recipient to which §§ 113.300 through 113.310 apply shall not discriminate on the...
Directly smelted lead-tin alloys: A historical perspective
Dube, R. K.
2010-08-01
This paper discusses evidence related to the genesis and occurrence of mixed lead-tin ore deposit consisting of cassiterite and the secondary minerals formed from galena. These evidences belong to a very long time period ranging from pre-historic to as late as the nineteenth century a.d. This type of mixed ore deposits was smelted to prepare lead-tin alloys. The composition of the alloy depended on the composition of the starting ore mixture. A nineteenth century evidence for the production of directly smelted lead-tin alloys in southern Thailand is discussed. A unique and rather uncommon metallurgical terminology in Sanskrit language— Nāgaja—was introduced in India for the tin recovered from impure lead. This suggests that Indians developed a process for recovering tin from lead-tin alloys, which in all probability was based on the general principle of fire refining. It has been shown that in the context of India the possibility of connection between the word Nāgaja and the directly smelted lead-tin alloys cannot be ruled out.
International Nuclear Information System (INIS)
Burba, J.V.
1982-01-01
Tin(II) or stannous ion as a reducing agent is important in nuclear medicine because it is an essential component and common denominator for many in vivo radiodiagnostic agents, commonly called kits for the preparation of radiopharmaceuticals. This report is intended to alert nuclear medicine community regarding the wide range of biological effects that the stannous ion is capable of producing, and is a review of a large number of selected publications on the toxicological potential of tin(II)
Characterization of tin selenides synthesized by high-energy milling
Directory of Open Access Journals (Sweden)
Marcela Achimovičová
2011-12-01
Full Text Available Tin selenides SnSeX (x=1,2 were synthesized from tin and selenium powder precursors by high-energy milling in the planetary ballmill Pulverisette 6 (Fritsch, Germany. The orthorhombic tin selenide SnSe and the hexagonal tin diselenide SnSe2 phases were formed after4 min and 5 min of milling, respectively. Specific surface area of both selenides increased with increasing time of mechanochemicalsynthesis. The particle size distribution analysis demonstrated that the synthesized products contain agglomerated selenide particlesconsisting of numerous idiomorphic tin selenide crystals, measuring from 2 to more than 100 nm in diameter, which were also documentedby TEM. UV-Vis spectrophotometry confirmed that tin selenide particles do not behave as quantum dots.
Preparation of textural lamellar tin deposits via electrodeposition
Wen, Xiaoyu; Pan, Xiaona; Wu, Libin; Li, Ruinan; Wang, Dan; Zhang, Jinqiu; Yang, Peixia
2017-06-01
Lamellar tin deposits were prepared by galvanostatical electroplating from the aqueous acidic-sulfate bath, with gelatin and benzalacetone dissolved in ethanol (ABA+EtOH) as additive, and their morphologies were investigated by scanning electron microscopy. Cathodic polarization curves revealed that the absorbability of ABA+EtOH on the cathode surface was higher than that of gelatin. X-ray diffraction analysis indicated preferred orientations of tin growth led to the formation of lamellar structure and distortion of tin lattice. The growth mechanism of lamellar tin was also discussed.
IMPEDANCE SPECTROSCOPY OF POLYCRYSTALLINE TIN DIOXIDE FILMS
Directory of Open Access Journals (Sweden)
D. V. Adamchuck
2016-01-01
Full Text Available The aim of this work is the analysis of the influence of annealing in an inert atmosphere on the electrical properties and structure of non-stoichiometric tin dioxide films by means of impedance spectroscopy method. Non-stoichiometric tin dioxide films were fabricated by two-step oxidation of metallic tin deposited on the polycrystalline Al2O3 substrates by DC magnetron sputtering. In order to modify the structure and stoichiometric composition, the films were subjected to the high temperature annealing in argon atmosphere in temperature range 300–800 °С. AC-conductivity measurements of the films in the frequency range 20 Hz – 2 MHz were carried out. Variation in the frequency dependencies of the real and imaginary parts of the impedance of tin dioxide films was found to occur as a result of high-temperature annealing. Equivalent circuits for describing the properties of films with various structure and stoichiometric composition were proposed. Possibility of conductivity variation of the polycrystalline tin dioxide films as a result of аnnealing in an inert atmosphere was demonstrated by utilizing impedance spectroscopy. Annealing induces the recrystallization of the films, changing in their stoichiometry as well as increase of the sizes of SnO2 crystallites. Variation of electrical conductivity and structure of tin dioxide films as a result of annealing in inert atmosphere was confirmed by X-ray diffraction analysis. Analysis of the impedance diagrams of tin dioxide films was found to be a powerful tool to study their electrical properties.
Mitigating tin whisker risks theory and practice
Handwerker, Carol A; Bath, Jasbir
2016-01-01
Discusses the growth mechanisms of tin whiskers and the effective mitigation strategies necessary to reduce whisker growth risks. This book covers key tin whisker topics, ranging from fundamental science to practical mitigation strategies. The text begins with a review of the characteristic properties of local microstructures around whisker and hillock grains to identify why these particular grains and locations become predisposed to forming whiskers and hillocks. The book discusses the basic properties of tin-based alloy finishes and the effects of various alloying elements on whisker formation, with a focus on potential mechanisms for whisker suppression or enhancement for each element. Tin whisker risk mitigation strategies for each tier of the supply chain for high reliability electronic systems are also described.
NMR studies of metallic tin confined within porous matrices
International Nuclear Information System (INIS)
Charnaya, E. V.; Tien, Cheng; Lee, M. K.; Kumzerov, Yu. A.
2007-01-01
119 Sn NMR studies were carried out for metallic tin confined within synthetic opal and porous glass. Tin was embedded into nanoporous matrices in the melted state under pressure. The Knight shift for liquid confined tin was found to decrease with decreasing pore size. Correlations between NMR line shapes, Knight shift, and pore filling were observed. The melting and freezing phase transitions of tin under confinement were studied through temperature dependences of NMR signals upon warming and cooling. Melting of tin within the opal matrix agreed well with the liquid skin model suggested for small isolated particles. The influence of the pore filling on the melting process was shown
Strategies to Reduce Tin and Other Metals in Electronic Cigarette Aerosol.
Directory of Open Access Journals (Sweden)
Monique Williams
Full Text Available Metals are present in electronic cigarette (EC fluid and aerosol and may present health risks to users.The objective of this study was to measure the amounts of tin, copper, zinc, silver, nickel and chromium in the aerosol from four brands of EC and to identify the sources of these metals by examining the elemental composition of the atomizer components.Four brands of popular EC were dissected and the cartomizers were examined microscopically. Elemental composition of cartomizer components was determined using integrated energy dispersive X-ray microanalysis, and the concentrations of the tin, copper, zinc silver, nickel, and chromium in the aerosol were determined for each brand using inductively coupled plasma optical emission spectroscopy.All filaments were made of nickel and chromium. Thick wires were copper coated with either tin or silver. Wires were joined to each other by tin solder, brazing, or by brass clamps. High concentrations of tin were detected in the aerosol when tin solder joints were friable. Tin coating on copper wires also contributed to tin in the aerosol.Tin concentrations in EC aerosols varied both within and between brands. Tin in aerosol was reduced by coating the thick wire with silver rather than tin, placing stable tin solder joints outside the atomizing chamber, joining wires with brass clamps or by brazing rather than soldering wires. These data demonstrate the feasibility of removing tin and other unwanted metals from EC aerosol by altering designs and using materials of suitable quality.
Effect of Graphene Addition on Mechanical Properties of TiN
International Nuclear Information System (INIS)
Shon, In-Jin; Yoon, Jin-Kook; Hong, Kyung-Tae
2017-01-01
Despite of many attractive properties of TiN, the current concern about the TiN focuses on its low fracture toughness below the ductile-brittle transition temperature. To improve its mechanical properties, the approach generally utilized has been the addition of a second phase to form composites and to make nanostructured materials. In this respect, highly dense nanostructured TiN and TiN-graphene composites were obtained within two min at 1250 ℃. The grain size of TiN was reduced remarkably by the addition of graphene. The addition of graphene to TiN simultaneously improved the fracture toughness and hardness of TiN-graphene composite due to refinement of TiN and deterring crack propagation by graphene. This study demonstrates that the graphene can be an effective reinforcing agent for improved hardness and fracture toughness of TiN composites.
Effect of Graphene Addition on Mechanical Properties of TiN
Energy Technology Data Exchange (ETDEWEB)
Shon, In-Jin [Chonbuk National University, Jeonju (Korea, Republic of); Yoon, Jin-Kook; Hong, Kyung-Tae [Korea Institute of Science and Technology, Seoul (Korea, Republic of)
2017-03-15
Despite of many attractive properties of TiN, the current concern about the TiN focuses on its low fracture toughness below the ductile-brittle transition temperature. To improve its mechanical properties, the approach generally utilized has been the addition of a second phase to form composites and to make nanostructured materials. In this respect, highly dense nanostructured TiN and TiN-graphene composites were obtained within two min at 1250 ℃. The grain size of TiN was reduced remarkably by the addition of graphene. The addition of graphene to TiN simultaneously improved the fracture toughness and hardness of TiN-graphene composite due to refinement of TiN and deterring crack propagation by graphene. This study demonstrates that the graphene can be an effective reinforcing agent for improved hardness and fracture toughness of TiN composites.
Microwave plasma CVD of NANO structured tin/carbon composites
Marcinek, Marek [Warszawa, PL; Kostecki, Robert [Lafayette, CA
2012-07-17
A method for forming a graphitic tin-carbon composite at low temperatures is described. The method involves using microwave radiation to produce a neutral gas plasma in a reactor cell. At least one organo tin precursor material in the reactor cell forms a tin-carbon film on a supporting substrate disposed in the cell under influence of the plasma. The three dimensional carbon matrix material with embedded tin nanoparticles can be used as an electrode in lithium-ion batteries.
Temperature measurement of tin under shock compression
International Nuclear Information System (INIS)
Hereil, Pierre-Louis; Mabire, Catherine
2002-01-01
The results of pyrometric measurements performed at the interface of a tin target with a LiF window material are presented for stresses ranging from 38 to 55 GPa. The purpose of the study is to analyze the part of the interface in the temperature measurement by a multi-channel pyrometric device. The results show that the glue used at target/window interface remains transparent under shock. The values of temperature measured at the tin/LiF interface are consistent with the behavior of tin under shock
Strategies to Reduce Tin and Other Metals in Electronic Cigarette Aerosol
Williams, Monique; To, An; Bozhilov, Krassimir; Talbot, Prue
2015-01-01
Background Metals are present in electronic cigarette (EC) fluid and aerosol and may present health risks to users. Objective The objective of this study was to measure the amounts of tin, copper, zinc, silver, nickel and chromium in the aerosol from four brands of EC and to identify the sources of these metals by examining the elemental composition of the atomizer components. Methods Four brands of popular EC were dissected and the cartomizers were examined microscopically. Elemental composition of cartomizer components was determined using integrated energy dispersive X-ray microanalysis, and the concentrations of the tin, copper, zinc silver, nickel, and chromium in the aerosol were determined for each brand using inductively coupled plasma optical emission spectroscopy. Results All filaments were made of nickel and chromium. Thick wires were copper coated with either tin or silver. Wires were joined to each other by tin solder, brazing, or by brass clamps. High concentrations of tin were detected in the aerosol when tin solder joints were friable. Tin coating on copper wires also contributed to tin in the aerosol. Conclusions Tin concentrations in EC aerosols varied both within and between brands. Tin in aerosol was reduced by coating the thick wire with silver rather than tin, placing stable tin solder joints outside the atomizing chamber, joining wires with brass clamps or by brazing rather than soldering wires. These data demonstrate the feasibility of removing tin and other unwanted metals from EC aerosol by altering designs and using materials of suitable quality. PMID:26406602
Diffuse scattering in metallic tin polymorphs
International Nuclear Information System (INIS)
Wehinger, Björn; Bosak, Alexeï; Piccolboni, Giuseppe; Krisch, Michael; Refson, Keith; Chernyshov, Dmitry; Ivanov, Alexandre; Rumiantsev, Alexander
2014-01-01
The lattice dynamics of the metallic tin β and γ polymorphs has been studied by a combination of diffuse scattering, inelastic x-ray scattering and density functional perturbation theory. The non-symmorphic space group of the β -tin structure results in unusual asymmetry of thermal diffuse scattering. Strong resemblance of the diffuse scattering intensity distribution in β and γ-tin were observed, reflecting the structural relationship between the two phases and revealing the qualitative similarity of the underlying electronic potential. The strong influence of the electron subsystem on inter-ionic interactions creates anomalies in the phonon dispersion relations. All observed features are described in great detail by the density functional perturbation theory for both β - and γ-tin at arbitrary momentum transfers. The combined approach delivers thus a complete picture of the lattice dynamics in harmonic description. (paper)
Telomere dysfunction and cell survival: roles for distinctTIN2-containing complexes
Energy Technology Data Exchange (ETDEWEB)
Kim, Sahn-Ho; Davalos, Albert R.; Heo, Seok-Jin; Rodier, Francis; Beausejour, Christian; Kaminker, Patrick; Campisi, Judith
2006-11-07
Telomeres are maintained by three DNA binding proteins, TRF1, TRF2 and POT1, and several associated factors. One factor, TIN2, binds TRF1 and TRF2 directly and POT1 indirectly. These and two other proteins form a soluble complex that may be the core telomere-maintenance complex. It is not clear whether subcomplexes exist or function in vivo. Here, we provide evidence for two TIN2 subcomplexes with distinct functions in human cells. TIN2 ablation by RNA interference caused telomere uncapping and p53-independent cell death in all cells tested. However, we isolated two TIN2 complexes from cell lysates, each selectively sensitive to a TIN2 mutant (TIN2-13, TIN2-15C). In cells with wild-type p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere uncapping and eventual growth arrest. In cells lacking p53 function, TIN215C more than TIN2-13 caused genomic instability and cell death. Thus, TIN2 subcomplexes likely have distinct functions in telomere maintenance, and may provide selective targets for eliminating cells with mutant p53.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Marketing. 1220.113 Section 1220.113 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS... CONSUMER INFORMATION Soybean Promotion and Research Order Definitions § 1220.113 Marketing. The term...
2010-07-01
... 32 National Defense 5 2010-07-01 2010-07-01 false Application. 724.113 Section 724.113 National... Definitions § 724.113 Application. In the context of this Manual, a written application to the NDRB for the... must be used for the application. ...
Directory of Open Access Journals (Sweden)
Maryam Ghorbani
2014-11-01
Full Text Available This research was conducted to investigate the effect of Tin oxide nanoparticles and heat treatment on decay resistance and physical properties of beech wood. Biological and physical test samples were prepared according to EN-113 and ASTM-D4446-05 standards respectively. Samples were classified into 4 groups: control, impregnation with Tin oxide nanoparticles, heat treatment and nano-heat treatment. Impregnation with Tin oxide nano at 5000ppm concentration was carried out in the cylinder according to Bethell method. Then, samples were heated at 140, 160 and 185˚C for 2 and 4 hours. According to results, decay resistance improved with increasing time and temperature of heat treatment. Least weight loss showed 46.39% reduction in nano-heat samples treated at 180˚C for 4 hours in comparison with control at highest weight loss. Nano-heat treated samples demonstrated the maximum amount of water absorption without significant difference with control and nanoparticles treated samples. Increase in heat treatment temperature reduced water absorption so that it is revealed 47.8% reduction in heat treated samples at 180°C for 4h after 24h immersion in water. In nano-heat treated samples at 180˚C for 2h was measured least volume swelling. Volume swelling in nano-treated samples decreased 8.7 and 22.76% after 2 and 24 h immersion in comparison with the control samples respectively.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Publications. 66.113 Section 66.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES FELLOWSHIPS, INTERNSHIPS, TRAINING NATIONAL RESEARCH SERVICE AWARDS Direct Awards § 66.113 Publications. Publication, distribution, and...
Telomere dysfunction and cell survival: Roles for distinct TIN2-containing complexes
Energy Technology Data Exchange (ETDEWEB)
Kim, Sahn-ho; Davalos, Albert R.; Heo, Seok-Jin; Rodier, Francis; Zou, Ying; Beausejour, Christian; Kaminker, Patrick; Yannone, Steven M.; Campisi, Judith
2007-10-02
Telomeres are maintained by three DNA binding proteins (TRF1, TRF2 and POT1), and several associated factors. One factor, TIN2, binds TRF1 and TRF2 directly and POT1 indirectly. Along with two other proteins, TPP1 and hRap1, these form a soluble complex that may be the core telomere maintenance complex. It is not clear whether sub-complexes also exist in vivo. We provide evidence for two TIN2 sub-complexes with distinct functions in human cells. We isolated these two TIN2 sub-complexes from nuclear lysates of unperturbed cells and cells expressing TIN2 mutants TIN2-13, TIN2-15C, which cannot bind TRF2 or TRF1, respectively. In cells with wild-type p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere uncapping and eventual growth arrest. In cells lacking p53 function, TIN2-15C was more potent than TIN2-13 in causing telomere dysfunction and cell death. Our findings suggest that distinct TIN2 complexes exist, and that TIN2-15C-sensitive subcomplexes are particularly important for cell survival in the absence of functional p53.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Counseling. 551.113 Section 551.113... Pretrial Inmates § 551.113 Counseling. (a) When consistent with institution security and good order, pretrial inmates may be allowed the opportunity to receive counseling services with convicted inmates. (b...
Preliminary study of tin slag concrete mixture
Hashim, Mohd Jamil; Mansor, Ishak; Pauzi Ismail, Mohamad; Sani, Suhairy; Azmi, Azhar; Sayuti, Shaharudin; Zaidi Ibrahim, Mohd; Adli Anuar, Abul; Rahim, Abdul Adha Abdul
2018-01-01
The study focuses on practices to facilitate tin smelting industry to reduce radioactive waste product (Tin Slag) by diluting its radioactivity to a safe level and turning it to a safer infrastructural building product. In the process the concrete mix which include Portland cement, sand, tin slag, water and plasticizer are used to produce interlocking brick pavements, piles and other infrastructural products. The mixing method follows DOE (UK) standard method of mixing targeted at in selected compressive strength suitable for its function and durability. A batching machine is used in the mixing and six test cubes are produced for the test. The testing equipment used are a compressional machine, ultrasonic measurement and a Geiger Muller counter to evaluate of the concrete mix to find the lowest emission of radiation surface dose without compromising the strength of concrete mix. The result obtained indicated the radioactivity of tin slag in the mixing process has reduced to background level that is 0.5μSv/h while the strength and workability of the concrete has not been severely affected. In conclusion, the concrete mix with tin slag has shown the potential it can be turned into a safe beneficial infrastructural product with good strength.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Containers. 113.60 Section 113.60 Food and Drugs... CONSUMPTION THERMALLY PROCESSED LOW-ACID FOODS PACKAGED IN HERMETICALLY SEALED CONTAINERS Control of Components, Food Product Containers, Closures, and In-Process Materials § 113.60 Containers. (a) Closures...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Housing. 113.405 Section 113.405... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.405 Housing. (a... different fees or requirements, or offer different services or benefits related to housing, except as...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Employment. 113.500 Section 113... Discrimination on the Basis of Sex in Employment in Education Programs Or Activities Prohibited § 113.500 Employment. (a) General. (1) No person shall, on the basis of sex, be excluded from participation in, be...
Microstructure and growth mechanism of tin whiskers on RESn3 compounds
International Nuclear Information System (INIS)
Li Caifu; Liu Zhiquan
2013-01-01
Graphical abstract: Large amount of intact tin whiskers were firstly prepared without post handling, and their microstructures were investigated systematically with TEM. A growth model was proposed to explain the observed growth characteristics from Sn–RE alloys. - Abstract: An exclusive method was developed to prepare intact tin whiskers as transmission electron microscope specimens, and with this technique in situ observation of tin whisker growth from RESn 3 (RE = Nd, La, Ce) film specimen was first achieved. Electron irradiation was discovered to have an effect on the growth of a tin whisker through its root. Large quantities of tin whiskers with diameters from 20 nm to 10 μm and lengths ranging from 50 nm to 500 μm were formed at a growth rate of 0.1–1.8 nm s −1 on the surface of RESn 3 compounds. Most (>85%) of these tin whiskers have preferred growth directions of 〈1 0 0〉, 〈0 0 1〉, 〈1 0 1〉 and 〈1 0 3〉, as determined by statistics. This kind of tin whisker is single-crystal β-Sn even if it has growth striations, steps and kinks, and no dislocations or twin or grain boundaries were observed within the whisker body. RESn 3 compounds undergo selective oxidation during whisker growth, and the oxidation provides continuous tin atoms for tin whisker growth until they are exhausted. The driving force for whisker growth is the compressive stress resulting from the restriction of the massive volume expansion (38–43%) during the oxidation by the surface RE(OH) 3 layer. Tin atoms diffuse and flow to feed the continuous growth of tin whiskers under a compressive stress gradient formed from the extrusion of tin atoms/clusters at weak points on the surface RE(OH) 3 layers. A growth model was proposed to discuss the characteristics and growth mechanism of tin whiskers from RESn 3 compounds.
2010-04-01
... CONSUMPTION CACAO PRODUCTS Requirements for Specific Standardized Cacao Products § 163.113 Cocoa. (a) Description. Cocoa is the food that conforms to the definition and standard of identity, and is subject to the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Cocoa. 163.113 Section 163.113 Food and Drugs FOOD...
23 CFR 660.113 - Construction.
2010-04-01
... 23 Highways 1 2010-04-01 2010-04-01 false Construction. 660.113 Section 660.113 Highways FEDERAL... (DIRECT FEDERAL) Forest Highways § 660.113 Construction. (a) No construction shall be undertaken on any FH... construction of FHs will be performed by the contract method, unless construction by the FHWA, the FS, or a...
NASA GSFC Tin Whisker Homepage http://nepp.nasa.gov/whisker
Shaw, Harry
2000-01-01
The NASA GSFC Tin Whisker Homepage provides general information and GSFC Code 562 experimentation results regarding the well known phenomenon of tin whisker formation from pure tin plated substrates. The objective of this www site is to provide a central repository for information pertaining to this phenomenon and to provide status of the GSFC experiments to understand the behavior of tin whiskers in space environments. The Tin Whisker www site is produced by Code 562. This www site does not provide information pertaining to patented or proprietary information. All of the information contained in this www site is at the level of that produced by industry and university researchers and is published at international conferences.
Atomic dynamics of tin nanoparticles embedded into porous glass
Energy Technology Data Exchange (ETDEWEB)
Parshin, P. P.; Zemlyanov, M. G., E-mail: zeml@isssph.kiae.ru; Panova, G. Kh.; Shikov, A. A. [Russian Research Centre Kurchatov Institute (Russian Federation); Kumzerov, Yu. A.; Naberezhnov, A. A. [Russian Academy of Sciences, Ioffe Physicotechnical Institute (Russian Federation); Sergueev, I.; Crichton, W. [European Synchrotron Radiation Facility (France); Chumakov, A. I. [Russian Research Centre Kurchatov Institute (Russian Federation); Rueffer, R. [European Synchrotron Radiation Facility (France)
2012-03-15
The method of resonant nuclear inelastic absorption of synchrotron radiation has been used to study the phonon spectrum for tin nanoparticles (with a natural isotope mixture) embedded into a porous glassy (silica) matrix with an average pore diameter of 7 nm in comparison to the analogous spectrum of bulk tin enriched with {sup 119}Sn isotope. Differences between the spectra have been observed, which are related to both the dimensional effects and specific structural features of the porous glass-tin nanocomposite. Peculiarities in the dynamics of tin atoms embedded into nanopores of glass are interpreted in terms of a qualitative model of the nanocomposite structure.
Atomic dynamics of tin nanoparticles embedded into porous glass
International Nuclear Information System (INIS)
Parshin, P. P.; Zemlyanov, M. G.; Panova, G. Kh.; Shikov, A. A.; Kumzerov, Yu. A.; Naberezhnov, A. A.; Sergueev, I.; Crichton, W.; Chumakov, A. I.; Rüffer, R.
2012-01-01
The method of resonant nuclear inelastic absorption of synchrotron radiation has been used to study the phonon spectrum for tin nanoparticles (with a natural isotope mixture) embedded into a porous glassy (silica) matrix with an average pore diameter of 7 nm in comparison to the analogous spectrum of bulk tin enriched with 119 Sn isotope. Differences between the spectra have been observed, which are related to both the dimensional effects and specific structural features of the porous glass-tin nanocomposite. Peculiarities in the dynamics of tin atoms embedded into nanopores of glass are interpreted in terms of a qualitative model of the nanocomposite structure.
Organic derivatives of tin (II/IV): Investigation of their structure
Energy Technology Data Exchange (ETDEWEB)
Szirtes, L., E-mail: szirtes@iki.kfki.h [Institute of Isotopes of the Hungarian Academy of Sciences, Budapest H-1525, P.O. Box 77 (Hungary); Megyeri, J., E-mail: megyeri@iki.kfki.h [Institute of Isotopes of the Hungarian Academy of Sciences, Budapest H-1525, P.O. Box 77 (Hungary); Kuzmann, E. [Laboratory of Nuclear Chemistry, CRC of the Hungarian Academy of Science at Eoetvoes University, H-1518 Budapest, P.O. Box 32 (Hungary); Beck, A. [Institute of Isotopes of the Hungarian Academy of Sciences, Budapest H-1525, P.O. Box 77 (Hungary)
2011-07-15
The structures of tin(II)-oxalate, tin(IV)Na-EDTA and tin(IV)Na{sub 8}-inositol hexaphosphate were investigated using XRD analysis. Samples were identified using the Moessbauer study, thermal analysis and FTIR spectrometry. The Moessbauer study determined two different oxidation states of tin atoms, and consequently two different tin surroundings in the end products. The tin oxalate was found to be orthorhombic with space group Pnma, a=9.2066(3) A, b=9.7590(1) A, c=13.1848(5) A, V=1184.62 A{sup 3} and Z=8. SnNa-EDTA was found to be monoclinic with space group P2{sub 1}/c{sub 1}, a=10.7544(3) A, b=10.1455(3) A, c=16.5130(6) A, {beta}=98.59(2){sup o}, V=1781.50(4) A{sup 3} and Z=4. Sn(C{sub 6}H{sub 6}Na{sub 8}O{sub 24}P{sub 6}) was found to be amorphous.
Proton transport properties of tin phosphate, chromotropic acid ...
Indian Academy of Sciences (India)
The functionalized materials of tin (IV) phosphate (SnP) like chromotropic acid anchored tin ... elemental analysis (ICP–AES), thermal analysis, X-ray analysis and FTIR spectroscopy. .... nal level below 1 V, interfaced to a minicomputer for data.
Studies on Nanocrystalline TiN Coatings Prepared by Reactive Plasma Spraying
Directory of Open Access Journals (Sweden)
Dong Yanchun
2008-01-01
Full Text Available Titanium nitride (TiN coatings with nanostructure were prepared on the surface of 45 steel (Fe-0.45%C via reactive plasma spraying (denoted as RPS Ti powders using spraying gun with self-made reactive chamber. The microstructural characterization, phases constitute, grain size, microhardness, and wear resistance of TiN coatings were systematically investigated. The grain size was obtained through calculation using the Scherrer formula and observed by TEM. The results of X-ray diffraction and electron diffraction indicated that the TiN is main phase of the TiN coating. The forming mechanism of the nano-TiN was characterized by analyzing the SEM morphologies of surface of TiN coating and TiN drops sprayed on the surface of glass, and observing the temperature and velocity of plasma jet using Spray Watch. The tribological properties of the coating under nonlubricated condition were tested and compared with those of the AISI M2 high-speed steel and Al2O3 coating. The results have shown that the RPS TiN coating presents better wear resistance than the M2 high-speed steel and Al2O3 coating under nonlubricated condition. The microhardness of the cross-section and longitudinal section of the TiN coating was tested. The highest hardness of the cross-section of TiN coating is 1735.43HV100 g.
Selective Recovery of Mushistonite from Gravity Tailings of Copper–Tin Minerals in Tajikistan
Lei Sun; Yuehua Hu; Wei Sun; Zhiyong Gao; Mengjie Tian
2017-01-01
Tajikistan has abundant copper–tin resources. In this study, mineralogical analysis of copper–tin ores from the Mushiston deposit of Tajikistan indicates that tin mainly occurred in mushistonite, cassiterite, and stannite, while copper mainly occurred in mushistonite, malachite, azurite, and stannite. The total grades of tin (Sn) and copper (Cu) were 0.65% and 0.66%, respectively, and the dissemination size of copper–tin minerals ranged from 4 μm to over 200 μm. Coarse particles of copper–tin...
14 CFR 1240.113 - Financial accounting.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Financial accounting. 1240.113 Section 1240.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION INVENTIONS AND CONTRIBUTIONS Awards for Scientific and Technical Contributions § 1240.113 Financial accounting. (a) An Award Check...
48 CFR 49.113 - Cost principles.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Cost principles. 49.113 Section 49.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT TERMINATION OF CONTRACTS General Principles 49.113 Cost principles. The cost principles and procedures in the...
Lifescience Database Archive (English)
Full Text Available CH (Link to library) CHC113 (Link to dictyBase) - - - Contig-U15579-1 CHC113P (Link... to Original site) CHC113F 198 CHC113Z 396 CHC113P 574 - - Show CHC113 Library CH (Link to library) Clone ID CHC113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15579-1 Original site URL http://dict...nif*KLENIIKKRNKLIFNYK KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICT...KK--- ---GFGCLAIPKNCNDNDPCTTDHCDPAIGCYYDKFDNCDACNAVDTCITNDLCFPRECN PRGNPPCLINPINCTSTDPCIFSYCENGVCIPTYICTPTPS
42 CFR 56.113 - Grantee accountability.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Grantee accountability. 56.113 Section 56.113 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES GRANTS GRANTS FOR MIGRANT HEALTH SERVICES General Provisions § 56.113 Grantee accountability. (a) Accounting for grant award...
Proton microprobe study of tin-polymetallic deposits
Energy Technology Data Exchange (ETDEWEB)
Murao, S [Geological Survey of Japan, Tsukuba, Ibaraki (Japan); Sie, S H; Suter, G F [Commonwealth Scientific and Industrial Research Organisation (CSIRO), North Ryde, NSW (Australia). Div. of Exploration Geoscience
1997-12-31
Tin-polymetallic vein type deposits are a complex mixture of cassiterite and sulfides and they are the main source of technologically important rare metals such as indium and bismuth. Constituent minerals are usually fine grained having wide range of chemical composition and often the elements of interest occur as trace elements not amenable to electron microprobe analysis. PIXE with a proton microprobe can be an effective tool to study such deposits by delineating the distribution of trace elements among carrier minerals. Two representative indium-bearing deposits of tin- polymetallic type, Tosham of India (Cu-ln-Bi-Sn-W-Ag), and Mount Pleasant of Canada (Zn-Cu-In-Bi-Sn-W), were studied to delineate the distribution of medical/high-tech rare metals and to examine the effectiveness of the proton probe analysis of such ore. One of the results of the study indicated that indium and bismuth are present in chalcopyrite in the deposits. In addition to these important rare metals, zinc, copper, arsenic, antimony, selenium, and tin are common in chalcopyrite and pyrite. Arsenopyrite contains nickel, copper, zinc, silver, tin, antimony and bismuth. In chalcopyrite and pyrite, zinc, arsenic, indium, bismuth and lead are richer in Mount Pleasant ore, but silver is higher at Tosham. Also thallium and gold were found only in Tosham pyrite. The Tosham deposit is related to S-type granite, while Mount Pleasant to A-type. It appears that petrographic character of the source magma is one of the factors to determine the trace element distribution in tin-polymetallic deposit. 6 refs., 2 figs.
Proton microprobe study of tin-polymetallic deposits
Energy Technology Data Exchange (ETDEWEB)
Murao, S. [Geological Survey of Japan, Tsukuba, Ibaraki (Japan); Sie, S.H.; Suter, G.F. [Commonwealth Scientific and Industrial Research Organisation (CSIRO), North Ryde, NSW (Australia). Div. of Exploration Geoscience
1996-12-31
Tin-polymetallic vein type deposits are a complex mixture of cassiterite and sulfides and they are the main source of technologically important rare metals such as indium and bismuth. Constituent minerals are usually fine grained having wide range of chemical composition and often the elements of interest occur as trace elements not amenable to electron microprobe analysis. PIXE with a proton microprobe can be an effective tool to study such deposits by delineating the distribution of trace elements among carrier minerals. Two representative indium-bearing deposits of tin- polymetallic type, Tosham of India (Cu-ln-Bi-Sn-W-Ag), and Mount Pleasant of Canada (Zn-Cu-In-Bi-Sn-W), were studied to delineate the distribution of medical/high-tech rare metals and to examine the effectiveness of the proton probe analysis of such ore. One of the results of the study indicated that indium and bismuth are present in chalcopyrite in the deposits. In addition to these important rare metals, zinc, copper, arsenic, antimony, selenium, and tin are common in chalcopyrite and pyrite. Arsenopyrite contains nickel, copper, zinc, silver, tin, antimony and bismuth. In chalcopyrite and pyrite, zinc, arsenic, indium, bismuth and lead are richer in Mount Pleasant ore, but silver is higher at Tosham. Also thallium and gold were found only in Tosham pyrite. The Tosham deposit is related to S-type granite, while Mount Pleasant to A-type. It appears that petrographic character of the source magma is one of the factors to determine the trace element distribution in tin-polymetallic deposit. 6 refs., 2 figs.
Proton microprobe study of tin-polymetallic deposits
International Nuclear Information System (INIS)
Murao, S.; Sie, S.H.; Suter, G.F.
1996-01-01
Tin-polymetallic vein type deposits are a complex mixture of cassiterite and sulfides and they are the main source of technologically important rare metals such as indium and bismuth. Constituent minerals are usually fine grained having wide range of chemical composition and often the elements of interest occur as trace elements not amenable to electron microprobe analysis. PIXE with a proton microprobe can be an effective tool to study such deposits by delineating the distribution of trace elements among carrier minerals. Two representative indium-bearing deposits of tin- polymetallic type, Tosham of India (Cu-ln-Bi-Sn-W-Ag), and Mount Pleasant of Canada (Zn-Cu-In-Bi-Sn-W), were studied to delineate the distribution of medical/high-tech rare metals and to examine the effectiveness of the proton probe analysis of such ore. One of the results of the study indicated that indium and bismuth are present in chalcopyrite in the deposits. In addition to these important rare metals, zinc, copper, arsenic, antimony, selenium, and tin are common in chalcopyrite and pyrite. Arsenopyrite contains nickel, copper, zinc, silver, tin, antimony and bismuth. In chalcopyrite and pyrite, zinc, arsenic, indium, bismuth and lead are richer in Mount Pleasant ore, but silver is higher at Tosham. Also thallium and gold were found only in Tosham pyrite. The Tosham deposit is related to S-type granite, while Mount Pleasant to A-type. It appears that petrographic character of the source magma is one of the factors to determine the trace element distribution in tin-polymetallic deposit. 6 refs., 2 figs
24 CFR 27.113 - Foreclosure costs.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Foreclosure costs. 27.113 Section 27.113 Housing and Urban Development Office of the Secretary, Department of Housing and Urban... Single Family Mortgages § 27.113 Foreclosure costs. A commission may be allowed to the foreclosure...
10 CFR 71.113 - Document control.
2010-01-01
... 10 Energy 2 2010-01-01 2010-01-01 false Document control. 71.113 Section 71.113 Energy NUCLEAR....113 Document control. The licensee, certificate holder, and applicant for a CoC shall establish measures to control the issuance of documents such as instructions, procedures, and drawings, including...
9 CFR 113.7 - Multiple fractions.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Multiple fractions. 113.7 Section 113... § 113.7 Multiple fractions. (a) When a biological product contains more than one immunogenic fraction, the completed product shall be evaluated by tests applicable to each fraction. (b) When similar...
49 CFR 194.113 - Information summary.
2010-10-01
... 49 Transportation 3 2010-10-01 2010-10-01 false Information summary. 194.113 Section 194.113... Response Plans § 194.113 Information summary. (a) The information summary for the core plan, required by... state(s). (b) The information summary for the response zone appendix, required in § 194.107, must...
Tribological characterization of TiN coatings prepared by magnetron sputtering
Makwana, Nishant S.; Chauhan, Kamlesh V.; Sonera, Akshay L.; Chauhan, Dharmesh B.; Dave, Divyeshkumar P.; Rawal, Sushant K.
2018-05-01
Titanium nitride (TiN) coating deposited on aluminium and brass pin substrates using RF reactive magnetron sputtering. The structural properties and surface morphology were characterized by X-ray diffraction (XRD), atomic force microscope (AFM) and field emission scanning electron microscope (FE-SEM). There was formation of (101) Ti2N, (110) TiN2 and (102) TiN0.30 peaks at 3.5Pa, 2Pa and 1.25Pa sputtering pressure respectively. The tribological properties of coating were inspected using pin on disc tribometer equipment. It was observed that TiN coated aluminium and brass pins demonstrated improved wear resistance than uncoated aluminium and brass pins.
Characterization of tin oxide nanoparticles synthesized via oxidation from metal
International Nuclear Information System (INIS)
Abruzzi, R.C.; Dedavid, B.A.; Pires, M.J.R.; Streicher, M.
2014-01-01
The tin oxide (SnO_2) is a promising material with great potential for applications such as gas sensors and catalysts. This oxide nanostructures show higher activation efficiency due to its larger effective surface. This paper presents the synthesis and characterization of the tin oxide in different conditions, via oxidation of pure tin with nitric acid. Results obtained from the characterization of SnO_2 powder by X-ray diffraction (XRD), Scanning Electron Microscopy (SEM), Energy Dispersive Spectroscopy (EDX), Particle size by Dynamic Light Scattering (DLS) and Infrared Spectroscopy (FTIR) indicated that the conditions were suitable for the synthesis to obtain manometric tin oxide granules with crystalline structure of rutile. (author)
Energy Technology Data Exchange (ETDEWEB)
Qi Jia Fu; Shik Chi Tsang [University of Reading, Reading (United Kingdom). Surface and Catalysis Research Centre, School of Chemistry
2006-10-15
This paper is concerned with the effects of adding tin and/or titanium dopant to sodium aluminium hydride for both dehydrogenation and re-hydrogenation reactions during their reversible storage of molecular hydrogen. Temperature programmed decomposition (TPD) measurements show that the dehydrogenation kinetics of NaAlH{sub 4} are significantly enhanced upon doping the material with 2 mol% of tributyltin hydride, Sn(Bu)3H but the tin catalyst dopant is shown to be inferior than titanium. On the other hand, in this preliminary work, a significant synergetic catalytic effect is clearly revealed in material co-doped with both titanium and tin catalysts which shows the highest reversible rates of dehydrogenation and re-hydrogenation (after their hydrogen depletion). The re-hydrogenation rates of depleted Sn/Ti/NaAlH{sub 4} evaluated at both 9.5 and 140 bars hydrogen are also found to be favourable compared to the Ti/NaAlH{sub 4}, which clearly suggest the importance of the catalyst choice. Basing on these results some mechanistic insights for the catalytic reversible dehydrogenation and re-hydrogenation processes of Sn/Ti/NaAlH{sub 4} are therefore made. 31 refs., 8 figs., 2 tabs.
19 CFR 113.35 - Individual sureties.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Individual sureties. 113.35 Section 113.35 Customs... CUSTOMS BONDS Principals and Sureties § 113.35 Individual sureties. (a) Number required. If individuals...) Qualifications to act as surety—(1) Residency and citizenship. Each individual surety on a Customs bond must be...
7 CFR 1710.113 - Loan security.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Loan security. 1710.113 Section 1710.113 Agriculture... GENERAL AND PRE-LOAN POLICIES AND PROCEDURES COMMON TO ELECTRIC LOANS AND GUARANTEES Loan Purposes and Basic Policies § 1710.113 Loan security. (a) RUS makes loans only if, in the judgment of the...
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFB113 (Link to dictyBase) - - - Contig-U16478-1 VFB113P (Link... to Original site) VFB113F 584 VFB113Z 643 VFB113P 1227 - - Show VFB113 Library VF (Link to library) Clone ID VFB113 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U16478-1 Original site URL http://dict...rlstttrlptttrlptttrlstttr lptttrlptttrlptttrlptttrlsttrlstttrlstswctswctswictrygswissr llcwynhs*l*t*c*sfkksn...sequence. 42 5e-29 8 U03413 |U03413.1 Dictyostelium discoideum AX2 calcium binding protein mRNA, complete cd
STOPIC MILENA D.; FRIEDRICH BERND G.
2016-01-01
Tin-zinc alloy deposits are recognized as a potential alternative to toxic cadmium as corrosion resistant coatings. Tin-zinc alloy layers offer outstanding corrosion protection for steel by combining the barrier protection of tin with the galvanic protection of zinc. Tin-zinc coatings have been used on the chassis of electrical and electronic apparatus and on critical automotive parts such as fuel and brake line components. In this study, tin-zinc alloy deposits were successfully prepared fro...
Determination of tin in cassiterite ores by colorimetry of iodometry
International Nuclear Information System (INIS)
Rodriguez Hernandez, B.
1972-01-01
The analytical methods are described far the determination of tin in cassiterite ores. The gallein-colorimetric method is described for determining small amounts of tin, covering the 0,01-0,5 per cent range. The sample is decomposed by heating with ammonium iodide, and tin is analyzed colorimetrically by means of it s complex with gallein. The final measure may be brought about either visually or spectrophotometrically at 525 nm. (Author)
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Data breach. 75.113 Section 75.113 Pensions, Bonuses, and Veterans' Relief DEPARTMENT OF VETERANS AFFAIRS (CONTINUED) INFORMATION SECURITY MATTERS Data Breaches § 75.113 Data breach. Consistent with the definition of data breach in § 75.112 of this subpart, a data breach...
International Nuclear Information System (INIS)
Iorio, G.; Tyler, M.S.
1987-01-01
This report describes the results of testwork on the recovery of tin, niobium, and tantalum from a tin slag. The slag, which consisted mainly of amorphous silica, with varying amounts of calcuim, magnesium, manganese, iron, and aluminium, contained an average of 8,8 per cent niobium pentoxide and 6,2 per cent tantalum pentoxide. The metallic tin-ion phase was removed from the crushed slag by magnetic separation. The slag was then leached with hydrochloric acid to remove magnesium, calcium, aluminium, iron, manganese, and the remainder of the tin. Leaching with sodium hydroxide for the removal of silica and phosphorous was followed by a final leach with hydrochloric acid for the removal of sodium. The upgraded concentrate thus obtained was purified by leaching with hydrofluoric acid, solvent extraction of niobium and tantalum into tri-n-butyl phosphate and methyl isobutyl ketone, and selective stripping of niobium with sulphuric acid and tantalum with ammonium floride. Niobium pentoxide and potassium tantalum fluoride were then precipitated by the addition of ammonium hydroxide and potassium fluoride to the respective strip liquors. The overall recoveries in the upgraded concentrate were 98 per cent for tantalum and 92 per cent for niobium. Dissolutions and recoveries of over 99 per cent were obtained for both tantalum and niobium in the purification steps. The niobium pentoxide and potassium tantalum fluoride precipitates obtained were of high purity
Studies on tin based inorganic ion exchangers for fission products separation
International Nuclear Information System (INIS)
Dash, A.; Balasubramanian, K.R.; Murthy, T.S.
1993-01-01
Tin(IV) antimonate and hydrous tin(IV) oxide have been prepared and their characteristics are evaluated. A new method has been finalized for the separation of 95 Zr- 95 Nb from irradiated uranium using hydrous tin(IV) oxide. In this process, the irradiated sample is dissolved in concentrated HNO 3 , evaporated to near dryness and taken up in 0.5 M HNO 3 . The solution is passed over tin(IV) oxide column and the isotope eluted with 10 M HNO 3 . The product is obtained in pure nitrate form which is generally preferred for different applications. A method has been finalized for the separation of 106 Ru from fission product solution using tin(IV) antimonate. In this method fission product solution is adjusted to 2 M with respect to nitric acid, 137 Cs is separated on a column of ammonium phosphomolybdate, the effluent after adjustment of acidity to 0.2 M is then passed over a column of tin(IV) antimonate where the effluent contains pure 106 Ru. (author). 14 refs., 6 figs., 2 tabs
Tin electrodeposition from sulfate solution containing a benzimidazolone derivative
Directory of Open Access Journals (Sweden)
Said BAKKALI
2016-11-01
Full Text Available Tin electrodeposition in an acidic medium in the presence of N,N’-1,3-bis-[N-3-(6-deoxy-3-O-methyl-D-glucopyranose-6-yl-2-oxobenzimidazol-1-yl]-2-tetradecyloxypropane as an additive was investigated in this work. The adequate current density and the appropriate additive concentration were determined by gravimetric measurements. Chronopotentiometric curves showed that the presence of the additive caused an increase in the overpotential of tin reduction. The investigations by cyclic voltammetry technique revealed that, in the presence and in absence of the additive, there were two peaks, one in the cathodic side attributed to the reduction of Sn2+ and the other one in the anodic side assigned to the oxidation of tin previously formed during the cathodic scan. The surface morphology of the tin deposits was studied by scanning electron microscopy (SEM and XRD.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Advertising. 113.540 Section 113.540 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL... Advertising. A recipient shall not in any advertising related to employment indicate preference, limitation...
The Moessbauer effect in binary tin chalcogenides of tin 119
International Nuclear Information System (INIS)
Ortalli, I.; Fano, V.
1975-01-01
The values of the isomer shift, quadrupole splitting, Moessbauer coefficient, Debye temperature for the tin chalcogenides SnS. SnSe, SnTe are tabulated for the temperatures 80 and 300 K. Temperature dependences of the Moessbauer coefficient and of the effective Debye temperature for SnS, SnSe and SnTe in a temperature range of 78 to 300 K are presented. (Z.S.)
48 CFR 32.113 - Customary contract financing.
2010-10-01
... financing. 32.113 Section 32.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 32.113 Customary contract financing. The solicitation must specify the customary contract financing offerors may...
Research into tin and arsenical copper artefacts using nuclear analytical techniques
International Nuclear Information System (INIS)
Grant, M.R.
1995-01-01
This study includes the chemical analysis, sourcing and historical metallurgy of tin and arsenical copper artefacts discovered at Rooiberg and elsewhere in the Northern Transvaal and at Great Zimbabwe. A complete chemical analysis method for tin and cassiterite is presented, based on INAA (instrumental neutron activation analysis) and supplemented by PIXE or AAS for elements such as lead, bismuth and niobium. This is apparently the first study in which tin artefacts were analysed by INAA without chemical processing of the samples. INAA and PIXE returned the same results when a homogenized tin alloy block was analysed, but the structure and distribution of hardhead phases appear to produce an iron quantification problem in ancient tin. Ores and slags were analysed for light matrix elements by XRF or PIXE and INAA for the heavy trace metals. 108 refs., 24 figs., 130 tabs
Estimating the Probability of Electrical Short Circuits from Tin Whiskers. Part 2
Courey, Karim J.; Asfour, Shihab S.; Onar, Arzu; Bayliss, Jon A.; Ludwig, Larry L.; Wright, Maria C.
2010-01-01
To comply with lead-free legislation, many manufacturers have converted from tin-lead to pure tin finishes of electronic components. However, pure tin finishes have a greater propensity to grow tin whiskers than tin-lead finishes. Since tin whiskers present an electrical short circuit hazard in electronic components, simulations have been developed to quantify the risk of said short circuits occurring. Existing risk simulations make the assumption that when a free tin whisker has bridged two adjacent exposed electrical conductors, the result is an electrical short circuit. This conservative assumption is made because shorting is a random event that had an unknown probability associated with it. Note however that due to contact resistance electrical shorts may not occur at lower voltage levels. In our first article we developed an empirical probability model for tin whisker shorting. In this paper, we develop a more comprehensive empirical model using a refined experiment with a larger sample size, in which we studied the effect of varying voltage on the breakdown of the contact resistance which leads to a short circuit. From the resulting data we estimated the probability distribution of an electrical short, as a function of voltage. In addition, the unexpected polycrystalline structure seen in the focused ion beam (FIB) cross section in the first experiment was confirmed in this experiment using transmission electron microscopy (TEM). The FIB was also used to cross section two card guides to facilitate the measurement of the grain size of each card guide's tin plating to determine its finish .
48 CFR 432.113 - Customary contract financing.
2010-10-01
... financing. 432.113 Section 432.113 Federal Acquisition Regulations System DEPARTMENT OF AGRICULTURE GENERAL CONTRACTING REQUIREMENTS CONTRACT FINANCING Non-Commercial Item Purchase Financing 432.113 Customary contract financing. The contracting officer may determine the necessity for customary contract financing. The...
Synthesis, characterization and photoluminescence of tin oxide nanoribbons and nanowires
Energy Technology Data Exchange (ETDEWEB)
Duraia, El-Shazly M.A., E-mail: duraia_physics@yahoo.co [Suez Canal University, Faculty of Science, Physics Department, Ismailia (Egypt); Al-Farabi Kazakh National University, Almaty (Kazakhstan); Institute of Physics and Technology, 11 Ibragimov Street, 050032 Almaty (Kazakhstan); Mansorov, Z.A. [Al-Farabi Kazakh National University, Almaty (Kazakhstan); Tokmolden, S. [Institute of Physics and Technology, 11 Ibragimov Street, 050032 Almaty (Kazakhstan)
2009-11-15
In this work we report the successful formation of tin oxide nanowires and tin oxide nanoribbons with high yield and by using simple cheap method. We also report the formation of curved nanoribbon, wedge-like tin oxide nanowires and star-like nanowires. The growth mechanism of these structures has been studied. Scanning electron microscope was used in the analysis and the EDX analysis showed that our samples is purely Sn and O with ratio 1:2. X-ray analysis was also used in the characterization of the tin oxide nanowire and showed the high crystallinity of our nanowires. The mechanism of the growth of our1D nanostructures is closely related to the vapor-liquid-solid (VLS) process. The photoluminescence PL measurements for the tin oxide nanowires indicated that there are three stable emission peaks centered at wavelengths 630, 565 and 395 nm. The nature of the transition may be attributed to nanocrystals inside the nanobelts or to Sn or O vacancies occurring during the growth which can induce trapped states in the band gap.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Athletics. 113.450 Section 113.450 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE... female teams if a recipient operates or sponsors separate teams will not constitute noncompliance with...
Influence of Microstructure on the Electrical Properties of Heteroepitaxial TiN Films
Xiang, Wenfeng; Liu, Yuan; Zhang, Jiaqi
2018-03-01
Heteroepitaxial TiN films were deposited on Si substrates by pulse laser deposition at different substrate temperature. The microstructure and surface morphology of the films were investigated by X-ray diffraction (θ-2θ scan, ω-scan, and ϕ-scan) and atomic force microscopy. The electrical properties of the prepared TiN films were studied using a physical property measurement system. The experimental results showed that the crystallinity and surface morphology of the TiN films were improved gradually with increasing substrate temperature below 700 °C. Specially, single crystal TiN films were prepared when substrate temperature is above 700 °C; However, the quality of TiN films gradually worsened when the substrate temperature was increased further. The electrical properties of the films were directly correlated to their crystalline quality. At the optimal substrate temperature of 700 °C, the TiN films exhibited the lowest resistivity and highest mobility of 25.7 μΩ cm and 36.1 cm2/V s, respectively. In addition, the mechanism concerning the influence of substrate temperature on the microstructure of TiN films is discussed in detail.
Electrochemical reduction of trinitrotoluene on core-shell tin-carbon electrodes
International Nuclear Information System (INIS)
Grigoriants, Irena; Markovsky, Boris; Persky, Rachel; Perelshtein, Ilana; Gedanken, Aharon; Aurbach, Doron; Filanovsky, Boris; Bourenko, Tatiana; Felner, Israel
2008-01-01
In this work, we studied the electrochemical process of 2,4,6-trinitrotoluene (TNT) reduction on a new type of electrodes based on a core-shell tin-carbon Sn(C) structure. The Sn(C) composite was prepared from the precursor tetramethyl-tin Sn(CH 3 ) 4 , and the product contained a core of submicron-sized tin particles uniformly enveloped with carbon shells. Cyclic voltammograms of Sn(C) electrodes in aqueous sodium chloride solutions containing TNT show three well-pronounced reduction waves in the potential range of -0.50 to -0.80 V (vs. an Ag/AgCl/Cl - reference electrode) that correspond to the multistep process of TNT reduction. Electrodes containing Sn(C) particles annealed at 800 deg. C under argon develop higher voltammetric currents of TNT reduction (comparing to the as-prepared tin-carbon material) due to stabilization of the carbon shell. It is suggested that the reduction of TNT on core-shell tin-carbon electrodes is an electrochemically irreversible process. A partial oxidation of the TNT reduction products occurred at around -0.20 V. The electrochemical response of TNT reduction shows that it is not controlled by the diffusion of the active species to/from the electrodes but rather by interfacial charge transfer and possible adsorption phenomena. The tin-carbon electrodes demonstrate significantly stable behavior for TNT reduction in NaCl solutions and provide sufficient reproducibility with no surface fouling through prolonged voltammetric cycling. It is presumed that tin nanoparticles, which constitute the core, are electrochemically inactive towards TNT reduction, but Sn or SnO 2 formed on the electrodes during TNT reduction may participate in this reaction as catalysts or carbon-modifying agents. The nitro-groups of TNT can be reduced irreversibly (via two possible paths) by three six-electron transfers, to 2,4,6-triaminotoluene, as follows from mass-spectrometric studies. The tin-carbon electrodes described herein may serve as amperometric sensors
5 CFR 831.113 - Payments to children.
2010-01-01
... 5 Administrative Personnel 2 2010-01-01 2010-01-01 false Payments to children. 831.113 Section 831.113 Administrative Personnel OFFICE OF PERSONNEL MANAGEMENT (CONTINUED) CIVIL SERVICE REGULATIONS (CONTINUED) RETIREMENT Administration and General Provisions § 831.113 Payments to children. For purposes of...
Shanghai Futures Exchange Published Draft of Tin and Nickel Futures Contract
Institute of Scientific and Technical Information of China (English)
2015-01-01
Shanghai Futures Exchange published draft for soliciting opinions for tin and nickel futures contract on its official website on January 19,which implies the marketing time of the long awaited tin and nickel futures is drawing near.According to the draft for soliciting opinions,the transaction unit of tin futures contract is 1tonne/lot,minimum variation unit is 10 yuan/tonne,daily maximum price fluctuation shall
VO2 /TiN Plasmonic Thermochromic Smart Coatings for Room-Temperature Applications.
Hao, Qi; Li, Wan; Xu, Huiyan; Wang, Jiawei; Yin, Yin; Wang, Huaiyu; Ma, Libo; Ma, Fei; Jiang, Xuchuan; Schmidt, Oliver G; Chu, Paul K
2018-03-01
Vanadium dioxide/titanium nitride (VO 2 /TiN) smart coatings are prepared by hybridizing thermochromic VO 2 with plasmonic TiN nanoparticles. The VO 2 /TiN coatings can control infrared (IR) radiation dynamically in accordance with the ambient temperature and illumination intensity. It blocks IR light under strong illumination at 28 °C but is IR transparent under weak irradiation conditions or at a low temperature of 20 °C. The VO 2 /TiN coatings exhibit a good integral visible transmittance of up to 51% and excellent IR switching efficiency of 48% at 2000 nm. These unique advantages make VO 2 /TiN promising as smart energy-saving windows. © 2018 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
21 CFR 113.5 - Current good manufacturing practice.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Current good manufacturing practice. 113.5 Section... CONTAINERS General Provisions § 113.5 Current good manufacturing practice. The criteria in §§ 113.10, 113.40..., methods, practices, and controls used by the commercial processor in the manufacture, processing, or...
Tinned fish with radioprotective ingredients
International Nuclear Information System (INIS)
Chaneva, M.; Minkova, M.; Zajko, G.
1992-01-01
A survey of food ingredients with pronounced radioprotective properties is made. The protective effect of fish proteins and some vegetable oils is mentioned. As suitable additives to tinned fish during the manufacturing process the β carotene, anthocyans and apple pectin are pointed out. β-carotene possesses the ability to absorb radiations. It can be added either as a pure crystalline substance or dissolved in the vegetable oil. Anthocyans have an antimutagen effect due to their ability to inhibit free radical reactions. Some vegetable polyphenols can be added with wine. The Bulgarian anthocyan concentrate Enobagrin (made by extraction of marc and wine) is also proposed. A combination of Enobagrin, β-tocopherol and pyracetam decreases the postradiation hypoplasia. Special attention is paid to the importance of the pectin in intoxication with heavy radioactive metals. It is thought that the pectin forms unsoluble complex compounds with Fe, Zn, Cd, Co, Pb, Hg, Mn, Cr. The binding energy depends on the available carboxylic groups. Some experiments showing the interaction of the pectin with 90 Sr are mentioned. In the tinned fish the pectin can be introduced with tomato paste. Vegetables rich in pectin and carotene - carrots and tomato concentrate - can be added as well. Proposed enriched tinned fish can be used as a preventive radioprotective food under conditions of increased radiation risk. 19 refs
Separation of substandard tin ores by x-ray fluorescence method
International Nuclear Information System (INIS)
Kotler, N.I.; Konovalov, V.M.; Kamenskij, Yu.V.; Neverov, A.D.; Ogorodnikov, Yu.V.
1987-01-01
Analysis of pure tin ores on X-ray fluorescence separation (XFS) is carried out. The volumes of lump sampling are substantiated; several variants of technical and economical efficiency of XFS application have been calculated. It is shown that at XFS of -400+25 mm classes conditional as to tin content intermediate product with high efficiency factor may be prepared. Separation of -25+10 mm class is unsuitable, as it doesn't allow to increase tin content to conditional, and the process efficiency is low
Tin - an unlikely ally for silicon field effect transistors?
Hussain, Aftab M.
2014-01-13
We explore the effectiveness of tin (Sn), by alloying it with silicon, to use SiSn as a channel material to extend the performance of silicon based complementary metal oxide semiconductors. Our density functional theory based simulation shows that incorporation of tin reduces the band gap of Si(Sn). We fabricated our device with SiSn channel material using a low cost and scalable thermal diffusion process of tin into silicon. Our high-κ/metal gate based multi-gate-field-effect-transistors using SiSn as channel material show performance enhancement, which is in accordance with the theoretical analysis. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
2010-07-01
... Pollution Contingency Plan and identified in approved Regional Oil and Hazardous Substances Pollution Contingency Plans. (h) Oil means oil of any kind or in any form, including but not limited to, petroleum, fuel... 40 Protection of Environment 21 2010-07-01 2010-07-01 false Definitions. 113.3 Section 113.3...
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Recruitment. 113.510 Section 113... Recruitment. (a) Nondiscriminatory recruitment and hiring. A recipient shall not discriminate on the basis of sex in the recruitment and hiring of employees. Where a recipient has been found to be presently...
2010-04-01
... general authority and powers of the Commissioner of Customs in requiring bonds, bond approval and... 19 Customs Duties 1 2010-04-01 2010-04-01 false Scope. 113.0 Section 113.0 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS...
34 CFR 668.113 - Request for review.
2010-07-01
... review determination in paragraph (a) of this section results from an administrative, accounting, or... 34 Education 3 2010-07-01 2010-07-01 false Request for review. 668.113 Section 668.113 Education... Program Review Determinations § 668.113 Request for review. (a) An institution or third-party servicer...
46 CFR 113.25-6 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.25-6 Section 113.25-6 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT General Emergency Alarm Systems § 113.25-6 Power supply. The emergency power source...
14 CFR 1214.113 - Allocation of risk.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Allocation of risk. 1214.113 Section 1214.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION SPACE FLIGHT General....113 Allocation of risk. The U.S. Government will assume no risk for damages to the customer resulting...
Tin Whisker Formation — A Stress Relieve Phenomenon
Dittes, M.; Oberndorff, P.; Crema, P.; Su, P.
2006-02-01
With the move towards lead-free electronics also the solderable finish of electronic components' terminations are converted. While the typical finish was containing 5 % to 20 % lead (Pb) and thus was almost whisker free, lead (Pb)-free finishes such as pure tin or high tin alloys are rather prone to grow whisker. These whiskers are spontaneous protrusions that grow to a significant length of up to millimeters with a typical diameter in the range of few microns and are suspect to cause shorts in electronic assemblies. The latest details of the mechanisms are not yet understood. However it appears to be well established that the driving force for tin whisker growth is a compressive stress in the tin layer and that this stress is released by whisker formation. Besides the mechanism for whisker growth therefore the mechanism of the stress induction is of interest. The origin of that stress may have multiple sources. Among others the most important one is the volume increase within the tin layer due the formation of intermetallics at the interface to the base material. This applies to all copper based material. For base materials with a coefficient of thermal expansion (cte) significantly different from the tin finish another mechanism plays the dominant role. This is the induction of stress during thermal cycling due to the different expansion of the materials with every temperature change. Another mechanism for stress induction may be the oxidation of the finish, which also leads to a local volume increase. Based on the knowledge of stress induction various mitigation strategies can be deducted. Most common is the introduction of a diffusion barrier (e.g. Ni) in order to prevent the growth of the Cu-Sn intermetallics, the controlled growth of Cu-Sn intermetallics in order to prevent their irregularity or the introduction of a mechanical buffer material targeting at the minimisation of the cte mismatch between base and finish material. With respect to the stress
Electrochemical migration of tin in electronics and microstructure of the dendrites
DEFF Research Database (Denmark)
Minzari, Daniel; Grumsen, Flemming Bjerg; Jellesen, Morten Stendahl
2011-01-01
The macro-, micro-, and nano-scale morphology and structure of tin dendrites, formed by electrochemical migration on a surface mount ceramic chip resistor having electrodes consisting of tin with small amounts of Pb (∼2wt.%) was investigated by scanning electron microscopy and transmission electr...... by the dehydration of the hydrated oxide originally formed in solution ex-situ in ambient air.......The macro-, micro-, and nano-scale morphology and structure of tin dendrites, formed by electrochemical migration on a surface mount ceramic chip resistor having electrodes consisting of tin with small amounts of Pb (∼2wt.%) was investigated by scanning electron microscopy and transmission electron...... microscopy including Energy dispersive X-ray spectroscopy and electron diffraction. The tin dendrites were formed under 5 or 12V potential bias in 10ppm by weight NaCl electrolyte as a micro-droplet on the resistor during electrochemical migration experiments. The dendrites formed were found to have...
Trace hydrogen extraction from liquid lithium tin alloy
International Nuclear Information System (INIS)
Xie Bo; Hu Rui; Xie Shuxian; Weng Kuiping
2010-01-01
In order to finish the design of tritium extraction system (TES) of fusion fission hybrid reactor (FFHR) tritium blanket, involving the dynamic mathematical model of liquid metal in contact with a gaseous atmosphere, approximate mathematical equation of tritium in lithium tin alloy was deduced. Moreover, carrying process used for trace hydrogen extraction from liquid lithium tin alloy was investigated with hydrogen being used to simulate tritium in the study. The study results indicate that carrying process is effective way for hydrogen extraction from liquid lithium tin alloy, and the best flow velocity of carrier gas is about 4 L/min under 1 kg alloy temperatures and carrying numbers are the main influencing factors of hydrogen number. Hydrogen extraction efficiency can reach 85% while the alloy sample is treated 6 times at 823 K. (authors)
Selective Recovery of Mushistonite from Gravity Tailings of Copper–Tin Minerals in Tajikistan
Directory of Open Access Journals (Sweden)
Lei Sun
2017-12-01
Full Text Available Tajikistan has abundant copper–tin resources. In this study, mineralogical analysis of copper–tin ores from the Mushiston deposit of Tajikistan indicates that tin mainly occurred in mushistonite, cassiterite, and stannite, while copper mainly occurred in mushistonite, malachite, azurite, and stannite. The total grades of tin (Sn and copper (Cu were 0.65% and 0.66%, respectively, and the dissemination size of copper–tin minerals ranged from 4 μm to over 200 μm. Coarse particles of copper–tin minerals were partially recovered by shaking table concentrators with a low recovery rate. Based on the mineralogical analysis, flotation recovery was used for the first time on the fine particles of copper–tin minerals, including mushistonite, from shaking table tailings. Single factor flotation experiments, open circuit flotation tests, and closed circuit flotation tests were performed to determine the optimized flotation conditions. Results indicated that benzohydroxamic acid (C6H5CONHOH and lead nitrate could effectively recover the mushistonite, cooperating with other depressants. The final concentrate contained 13.28% Sn, with a recovery rate of 61.56%, and 18.51% Cu, with a recovery rate of 86.52%. This method proved effective for the exploitation and use of this type of copper–tin resource in Tajikistan.
6 CFR 11.3 - Demand for payment.
2010-01-01
... 6 Domestic Security 1 2010-01-01 2010-01-01 false Demand for payment. 11.3 Section 11.3 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CLAIMS § 11.3 Demand for payment. (a) Notice requirements. Generally, before DHS starts the collection actions described in this subpart, DHS...
9 CFR 113.4 - Exemptions to tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Exemptions to tests. 113.4 Section 113.4 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... § 113.4 Exemptions to tests. (a) The test methods and procedures contained in all applicable Standard...
Energy Technology Data Exchange (ETDEWEB)
Perring, Loic; Basic-Dvorzak, Marija [Department of Quality and Safety Assurance, Nestle Research Centre, P.O. Box 44, Vers chez-les-Blanc, 1000, Lausanne (Switzerland)
2002-09-01
Tin is considered to be a priority contaminant by the Codex Alimentarius Commission. Tin can enter foods either from natural sources, environmental pollution, packaging material or pesticides. Higher concentrations are found in processed food and canned foods. Dissolution of the tinplate depends on the of food matrix, acidity, presence of oxidising reagents (anthocyanin, nitrate, iron and copper) presence of air (oxygen) in the headspace, time and storage temperature. To reduce corrosion and dissolution of tin, nowadays cans are usually lacquered, which gives a marked reduction of tin migration into the food product. Due to the lack of modern validated published methods for food products, an ICP-AES (Inductively coupled plasma-atomic emission spectroscopy) method has been developed and evaluated. This technique is available in many laboratories in the food industry and is more sensitive than atomic absorption. Conditions of sample preparation and spectroscopic parameters for tin measurement by axial ICP-AES were investigated for their ruggedness. Two methods of preparation involving high-pressure ashing or microwave digestion in volumetric flasks were evaluated. They gave complete recovery of tin with similar accuracy and precision. Recoveries of tin from spiked products with two levels of tin were in the range 99{+-}5%. Robust relative repeatabilities and intermediate reproducibilities were <5% for different food matrices containing >30 mg/kg of tin. Internal standard correction (indium or strontium) did not improve the method performance. Three emission lines for tin were tested (189.927, 283.998 and 235.485 nm) but only 189.927 nm was found to be robust enough with respect to interferences, especially at low tin concentrations. The LOQ (limit of quantification) was around 0.8 mg/kg at 189.927 nm. A survey of tin content in a range of canned foods is given. (orig.)
Inductively coupled plasma atomic emission spectrometric determination of tin in canned food.
Sumitani, H; Suekane, S; Nakatani, A; Tatsuka, K
1993-01-01
Various canned foods were digested sequentially with HNO3 and HCl, diluted to 100 mL, and filtered, and then tin was determined by inductively coupled plasma atomic emission spectrometry (ICP/AES). Samples of canned Satsuma mandarin, peach, apricot, pineapple, apple juice, mushroom, asparagus, evaporated milk, short-necked clam, spinach, whole tomato, meat, and salmon were evaluated. Sample preparations did not require time-consuming dilutions, because ICP/AES has wide dynamic range. The standard addition method was used to determine tin concentration. Accuracy of the method was tested by analyzing analytical standards containing tin at 2 levels (50 and 250 micrograms/g). The amounts of tin found for the 50 and 250 micrograms/g levels were 50.5 and 256 micrograms/g, respectively, and the repeatability coefficients of variation were 4.0 and 3.8%, respectively. Recovery of tin from 13 canned foods spiked at 2 levels (50 and 250 micrograms/g) ranged from 93.9 to 109.4%, with a mean of 99.2%. The quantitation limit for tin standard solution was about 0.5 microgram/g.
46 CFR 113.05-7 - Environmental tests.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Environmental tests. 113.05-7 Section 113.05-7 Shipping... SYSTEMS AND EQUIPMENT General Provisions § 113.05-7 Environmental tests. Communication, alarm system, control, and monitoring equipment must meet the environmental tests of— (a) Section 4-9-7, Table 9, of ABS...
9 CFR 113.33 - Mouse safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Mouse safety tests. 113.33 Section 113.33 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... Procedures § 113.33 Mouse safety tests. One of the mouse safety tests provided in this section shall be...
Quadtree of TIN: a new algorithm of dynamic LOD
Zhang, Junfeng; Fei, Lifan; Chen, Zhen
2009-10-01
Currently, Real-time visualization of large-scale digital elevation model mainly employs the regular structure of GRID based on quadtree and triangle simplification methods based on irregular triangulated network (TIN). TIN is a refined means to express the terrain surface in the computer science, compared with GRID. However, the data structure of TIN model is complex, and is difficult to realize view-dependence representation of level of detail (LOD) quickly. GRID is a simple method to realize the LOD of terrain, but contains more triangle count. A new algorithm, which takes full advantage of the two methods' merit, is presented in this paper. This algorithm combines TIN with quadtree structure to realize the view-dependence LOD controlling over the irregular sampling point sets, and holds the details through the distance of viewpoint and the geometric error of terrain. Experiments indicate that this approach can generate an efficient quadtree triangulation hierarchy over any irregular sampling point sets and achieve dynamic and visual multi-resolution performance of large-scale terrain at real-time.
Energy Technology Data Exchange (ETDEWEB)
Sanal, K.C., E-mail: sanalcusat@gmail.com [Nanophotonic and Optoelectronic Devices Laboratory, Department of Physics, Cochin University of Science and Technology, Kerala 682 022 (India); Inter University Center for Nanomaterials and Devices (IUCND), Cochin University of Science and Technology (India); Jayaraj, M.K. [Nanophotonic and Optoelectronic Devices Laboratory, Department of Physics, Cochin University of Science and Technology, Kerala 682 022 (India)
2013-07-01
Highlights: • Growth of p-type semiconducting SnO thin films by rf sputtering. • Varying the type of charge carriers with oxygen partial pressure. • Atomic percentage of SnO{sub x} thin films from the XPS analysis. • Demonstration of transparent p–n hetero junctions fabricated in the structure glass/ITO/n-ZnO/p-SnO. -- Abstract: p-Type and n-type tin oxide thin films were deposited by rf-magnetron sputtering of metal tin target by varying the oxygen pressure. Chemical composition of SnO thin film according to the intensity of the XPS peak is about 48.85% and 51.15% for tin and oxygen respectively. Nearest neighbor distance of the atoms calculated from SAED patterns is 2.9 Åand 2.7 Åfor SnO and SnO{sub 2} respectively. The Raman scattering spectrum obtained from SnO thin films showed two peaks, one at 113 cm{sup −1} and the other at 211 cm{sup −1}. Band gap of as-deposited SnO{sub x} thin films vary from 1.6 eV to 3.2 eV on varying the oxygen partial pressure from 3% to 30% which indicates the oxidization of metallic phase Sn to SnO and SnO{sub 2}. p-Type conductivity of SnO thin films and n-type conductivity of SnO{sub 2} thin films were confirmed through Hall coefficient measurement. Transparent p–n hetero junction fabricated in the structure glass/ITO/n-ZnO/p-SnO shows rectification with forward to reverse current ratio as 12 at 4.5 V.
Properties of Polydisperse Tin-doped Dysprosium and Indium Oxides
Directory of Open Access Journals (Sweden)
Malinovskaya Tatyana
2017-01-01
Full Text Available The results of investigations of the complex permittivity, diffuse-reflectance, and characteristics of crystal lattices of tin-doped indium and dysprosium oxides are presented. Using the methods of spectroscopy and X-ray diffraction analysis, it is shown that doping of indium oxide with tin results in a significant increase of the components of the indium oxide complex permittivity and an appearance of the plasma resonance in its diffuse-reflectance spectra. This indicates the appearance of charge carriers with the concentration of more than 1021 cm−3 in the materials. On the other hand, doping of the dysprosium oxide with the same amount of tin has no effect on its optical and electromagnetic properties.
Rustandi, Andi; Wafa' Nawawi, Fuad; Pratesa, Yudha; Cahyadi, Agung
2018-01-01
Tin slag, a by-product of tin production has been used in cementitious application. The present investigation focuses on the suitability of tin slag as primary component in cement and as component that substitute some amount of Portland Cement. The tin slags studied were taken from Bangka, Indonesia. The main contents of the tin slag are SiO2, Al2O3, and Fe2O3 according to the XRF investigation. The aim of this article was to study the mechanical behaviour (compressive strength), microstructure and leaching behaviour of tin slag blended cement. This study used air-cooled tin slag that had been passed through 400# sieve to replace Portland Cement with ratio 0, 10, 20, 30, 40 by weight. Cement pastes and tin slag blended cement pastes were prepared by using water/cement ratio (W/C) of 0.40 by weight and hydrated for various curing ages of 3, 7, 14 days The microstructure of the raw tin slag was investigated using Scanning Electron Microscope (SEM). The phase composition of each cement paste was investigated using X-ray Diffraction (XRD). The aim of the leachability test was to investigate the environmental impacts of tin slag blended cement product in the range 4-8 pH by using static pH-dependent leaching test. The result show that the increase of the tin slag content decreasing the mortar compressive strength at early ages. The use of tin slag in cement provide economic benefits for all related industries.
9 CFR 113.326 - Avian Pox Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Avian Pox Vaccine. 113.326 Section 113... Vaccines § 113.326 Avian Pox Vaccine. Fowl Pox Vaccine and Pigeon Pox Vaccine shall be prepared from virus... established as follows: (1) Fowl pox susceptible birds all of the same age and from the same source, shall be...
9 CFR 113.39 - Cat safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Cat safety tests. 113.39 Section 113... Procedures § 113.39 Cat safety tests. The safety tests provided in this section shall be conducted when... recommended for use in cats. (a) The cat safety test provided in this paragraph shall be used when the Master...
46 CFR 113.10-9 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.10-9 Section 113.10-9 Shipping COAST... SYSTEMS AND EQUIPMENT Fire and Smoke Detecting and Alarm Systems § 113.10-9 Power supply. (a) General... battery, the charger must be supplied from the final emergency power source. Upon loss of power to the...
46 CFR 113.43-5 - Power supply.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Power supply. 113.43-5 Section 113.43-5 Shipping COAST... SYSTEMS AND EQUIPMENT Steering Failure Alarm Systems § 113.43-5 Power supply. Each steering failure alarm system must be supplied by a circuit that: (a) Is independent of other steering gear system and steering...
9 CFR 113.40 - Dog safety tests.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Dog safety tests. 113.40 Section 113... Procedures § 113.40 Dog safety tests. The safety tests provided in this section shall be conducted when... recommended for use in dogs. Serials which are not found to be satisfactory when tested pursuant to the...
NASA Goddard Space Flight Center Tin Whisker (and Other Metal Whisker) Homepage
Brusse, Jay; Sampson, Mike; Leidecker, Henning; Kadesch, Jong
2004-01-01
This website provides information about tin whiskers and related research. The independent research performed during the past 50+ years is so vast that it is impractical to cover all aspects of tin whiskers in this one resource. Therefore, the absence of information in this website about a particular aspect of tin whiskers should NOT be construed as evidence of absence.
Tin in canned food: a review and understanding of occurrence and effect.
Blunden, Steve; Wallace, Tony
2003-12-01
Tinplate is light gauge, steel sheet or strip, coated on both sides with commercially pure tin and has been used for well over a hundred years as a robust form of food packaging. Altogether, about 25,000 million food cans are produced and filled in Europe per annum, about 20% of these having plain internal (unlacquered) tin-coated steel bodies. Worldwide, the total for food packaging is approximately 80,000 million cans. Tinplate is also extensively used for the production of beverage cans. Europe produces and fills over 15,000 million tinplate beverage cans per annum all of which are internally lacquered. The use of tinplate for food and beverage packaging, will result in some tin dissolving into the food content, particularly when plain uncoated internal surfaces are used. The Provisional Tolerable Weekly Intake for tin is 14 mg/kg body weight and recommended maximum permissible levels of tin in food are typically 250 mg/kg (200 mg/kg UK) for solid foods and 150 mg/kg for beverages. However, the question arises as to whether evidence exists that such elevated levels of tin in food in any way constitute a risk to human health. This review considers the factors affecting the dissolution of tin, the reported measurements/surveys of actual levels of tin in canned foods and the studies and reports of acute (short term) toxicity relating to the ingestion of elevated levels of tin in food products. Chronic studies are mentioned, but are not covered in detail, since the review is mainly concerned with possible effects from the ingestion of single high doses. From published data, there appears to be a small amount of evidence suggesting that consumption of food or beverages containing tin at concentrations at or below 200 ppm has caused adverse gastrointestinal effects in an unknown but possibly small proportion of those exposed. However, the evidence supporting this assertion is derived from reports of adverse effects which offer data that are limited, incomplete or of
49 CFR 214.113 - Head protection.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Head protection. 214.113 Section 214.113 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION... conform to the national consensus standards for industrial head protection (American National Standards...
Determination of tungsten and tin ions after preconcentration by flotation
International Nuclear Information System (INIS)
Dietze, U.; Kunze, S.
1990-01-01
A highly sensitive and selective combined method of flotation followed by spectrophotometry/d.c. polarography for the determination of tungsten and tin ions in acid and alkaline waste waters and hydrometallurgical solutions is presented here. Both kinds of ions are coprecipitated in the analyte solution with zirconium hydroxide after addition of ZrOCl 2 solution and ammonia. Afterwards, the collector precipitate is separated from the aqueous phase and preconcentrated by flotation for which sodium oleate and a frother are added. The precipitate is dissolved in a small amount of acid, with the organic reagents being destroyed by oxidation. The enrichment factor of the proposed technique is 100, with variations possible. Recovery is 94 % for tungsten and 99 % for tin. Spectrophotometry of the thiocyanate complex and d.c. polarography are applied as determination techniques for tungsten and tin, respectively. Detection limits attainable by this technique are 6 ng.ml -1 for tungsten and 5 ng.ml -1 for tin for the initial sample. (Authors)
33 CFR 136.113 - Other compensation.
2010-07-01
...) MARINE POLLUTION FINANCIAL RESPONSIBILITY AND COMPENSATION OIL SPILL LIABILITY TRUST FUND; CLAIMS PROCEDURES; DESIGNATION OF SOURCE; AND ADVERTISEMENT General Procedure § 136.113 Other compensation. A... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Other compensation. 136.113...
7 CFR 1955.113 - Price (housing).
2010-01-01
... 7 Agriculture 14 2010-01-01 2009-01-01 true Price (housing). 1955.113 Section 1955.113 Agriculture Regulations of the Department of Agriculture (Continued) RURAL HOUSING SERVICE, RURAL BUSINESS-COOPERATIVE... REGULATIONS (CONTINUED) PROPERTY MANAGEMENT Disposal of Inventory Property Rural Housing (rh) Real Property...
Radiation levels and countermeasure research on radiological protection in tin mine in china
International Nuclear Information System (INIS)
Yang Fengfang; Yuan Yongling
2010-01-01
Objective: To study the distribution of radiation level in our nation's tin mine, therefore comes up with proposals on radiological protection and provide scientific evidence on how to protect lives and health of worker underground in tin mine. Methods: To get the radiation level of the underground workplaces in tin mine by analysis of research papers and the measuring results from on-scene investigations. Results: Majority of the absorbed dose rates of γ radiation in the air of underground workplaces in tin mine falls within the range of radiation levels of normal background. Earlier, the typical values of radon concentration and potential alpha energy concentration of radon daughters in the air of underground workplaces in tin mine are 3.12 kBq/m 3 and 5.61 μJ/m 3 respectively. Now, radon concentration and potential alpha energy concentration of radon daughters in the air of underground workplaces in majority of tin mine are lower than 1000 Bq/m 3 and 3.57 μJ/m 3 . Conclusion: For these tin mine workers with an average of annual effective dose greater than 1 mSv or these of their specific activity for natural uranium in materials are greater than 1 Bq/g need to have regulation of radiological protection. The control limits for the radon concentration and the potential alpha energy concentration of radon daughters and the absorbed dose rates of γ radiation in the air of underground workplaces in tin mine are 1000 Bq/m3, 3.57 μJ/m 3 and 1 μGy/h respectively. The administrative individual dose for workers working under the ground of tin mine is 10 mSv/a. If a worker's total annual effective dose is greater than 10 mSv, he/she should be considered as radioactive worker. (authors)
PCBs with immersion tin finish - some experiences with lead-free reflow process
Energy Technology Data Exchange (ETDEWEB)
Bukat, K.; Koziol, G.; Sitek, J.; Borecki, J.; Hackiewicz, H. [Tele and Radio Research Inst., Warsaw (Poland); Merkle, H.; Schroeder, S. [Ormecon Chemie GmbH and Co. KG, Ammersbek (Germany); Girulska, A.; Gardela, K. [Eldos Sp. z o.o., Wroclaw (Poland)
2004-07-01
Substitution of lead-free solders in electronic assemblies requires changes in the conventional SnPb finishes of PCBs. The Craft project ''PRINT'' objectives respond to this challenge. Its main goal is to develop and implement the new technology of high solderability immersion tin for printed circuit boards at small and medium enterprises. The subject of the research was organic based immersion tin coating which would fulfil demands of SMT. In the paper the results of reflow soldering process on PCBs covered by Ormecon registered immersion tin finish with using lead-free solder pastes will be described. Solderability of tin coating as well as wettability of lead-free solder paste will be presented. (orig.)
Electrochemical migration of tin in electronics and microstructure of the dendrites
Energy Technology Data Exchange (ETDEWEB)
Minzari, Daniel, E-mail: dmin@mek.dtu.d [Section for Materials and Surface Technology, Department for Mechanical Engineering, Technical University of Denmark (Denmark); Grumsen, Flemming Bjerg; Jellesen, Morten S.; Moller, Per; Ambat, Rajan [Section for Materials and Surface Technology, Department for Mechanical Engineering, Technical University of Denmark (Denmark)
2011-05-15
Graphical abstract: The electrochemical migration of tin in electronics forms dendritic structures, consisting of a metallic tin core, which is surrounded by oxide layers having various thickness. Display Omitted Research highlights: Electrochemical migration occurs if two conductors are connected by condensed moisture. Metallic ions are dissolved and grow in a dendritic structure that short circuit the electrodes. The dendrite consists of a metallic tin core with oxide layers of various thickness surrounding. Detailed microstructure of dendrites is investigated using electron microscopy. The dendrite microstructure is heterogeneous along the growth direction. - Abstract: The macro-, micro-, and nano-scale morphology and structure of tin dendrites, formed by electrochemical migration on a surface mount ceramic chip resistor having electrodes consisting of tin with small amounts of Pb ({approx}2 wt.%) was investigated by scanning electron microscopy and transmission electron microscopy including Energy dispersive X-ray spectroscopy and electron diffraction. The tin dendrites were formed under 5 or 12 V potential bias in 10 ppm by weight NaCl electrolyte as a micro-droplet on the resistor during electrochemical migration experiments. The dendrites formed were found to have heterogeneous microstructure along the growth direction, which is attributed to unstable growth conditions inside the micro-volume of electrolyte. Selected area electron diffraction showed that the dendrites are metallic tin having sections of single crystal orientation and lead containing intermetallic particles embedded in the structure. At certain areas, the dendrite structure was found to be surrounded by an oxide crust, which is believed to be due to unstable growth conditions during the dendrite formation. The oxide layer was found to be of nanocrystalline structure, which is expected to be formed by the dehydration of the hydrated oxide originally formed in solution ex-situ in ambient air.
Study on the removal of iron impurities in methanesulfonic acid tin plating bath
Hou-li, LIU; Jian-Jun, CHEN; Hong-Liang, PAN
2018-03-01
This thesis investigated the the influence of sodium sulfite as reducing agent on the recovery rate of tin ion. The approach is that HZ016 type cation exchange resin was used to adsorb Sn2+ and Fe2+ in electroplated tin solution first. After adsorption, the resin was removed by sulfuric acid, which was added with NaOH to adjust pH value to form precipitation and separate tin. X-ray diffraction (XRD) and energy spectrum (EDS) method were used to analyze the composition of the precipitates adjusted by pH. The results show that when the mass ratio of resin to bath is 1:2, the adsorption efficiency of resin reaches 98.3% and 97.1% respectively, and the elution efficiency of tin and iron reaches 95.1% and 94% respectively when the mass ratio of resin to eluent sulfuric acid is 1:4. Sodium sulfite was added to increase the efficiency of tin recovery by 8.1%. EDS and XRD atlas showed that after pH regulation, the main composition of the filtration precipitation was the hydroxides of tin.
Electrical Properties of Electrospun Sb-Doped Tin Oxide Nanofibers
International Nuclear Information System (INIS)
Leon-Brito, Neliza; Melendez, Anamaris; Ramos, Idalia; Pinto, Nicholas J; Santiago-Aviles, Jorge J
2007-01-01
Transparent and conducting tin oxide fibers are of considerable interest for solar energy conversion, sensors and in various electrode applications. Appropriate doping can further enhance the conductivity of the fibers without loosing optical transparency. Undoped and antimony-doped tin oxide fibers have been synthesized by our group in previous work using electrospinning and metallorganic decomposition techniques. The undoped tin oxide fibers were obtained using a mixture of pure tin oxide sol made from tin (IV) chloride : water : propanol : isopropanol at a molar ratio of 1:9:9:6, and a viscous solution made from poly(ethylene oxide) (PEO) and chloroform at a ratio of 200 mg PEO/10 mL chloroform. In this work, antimony doped fibers were obtained by adding a dopant solution of antimony trichloride and isopropanol at a ratio of 2.2812 g antimony trichloride/10 ml isopropanol to the original tin oxide precursor solution. The Sb concentration in the precursor solution is 1.5%. After deposition, the fibers were sintered 600deg. C in air for two hours. The electrical conductivity of single fibers measured at room temperature increases by up to three orders of magnitude when compared to undoped fibers prepared using the same method. The resistivity change as a function of the annealing temperature can be attributed to the thermally activated formation of a nearly stoichoimetric solid. The resistivity of the fibers changes monotonically with temperature from 714Ω-cm at 2 K to 0.1Ω-cm at 300 K. In the temperature range from 2 to 8 K the fibers have a positive magnetoresistance (MR) with the highest value of 155 % at 2 K and ±9 T. At temperatures of 10 and 12 K the sign of MR changes to negative values for low magnetic fields and positive for high magnetic fields. For higher temperatures (15 K and above) the MR becomes negative and its magnitude decreases with temperature
Combined TiN- and TaN temperature compensated thin film resistors
International Nuclear Information System (INIS)
Malmros, Anna; Andersson, Kristoffer; Rorsman, Niklas
2012-01-01
The opposite signs of the temperature coefficient of resistance (TCR) of two thin film materials, titanium nitride (TiN) and tantalum nitride (TaN), were used to form temperature compensated thin film resistors (TFRs). The principle of designing temperature compensated TFRs by connecting TFRs of each compound in series or in parallel was demonstrated. TiN, TaN, and combined TiN and TaN TFRs for monolithic microwave integrated circuits (MMICs) were fabricated by reactive sputtering. DC characterization was performed over the temperature range of 30–200 °C. The TiN TFRs exhibited an increase in resistivity with temperature with TCRs of 540 and 750 ppm/°C. The TaN TFR on the other hand exhibited a negative TCR of − 470 ppm/°C. The shunted TFRs were fabricated by serial deposition of TiN and TaN to form a bilayer component. The TCRs of the series- and shunt configurations were experimentally reduced to − 60 and 100 ppm/°C, respectively. The concept of temperature compensation was used to build a Wheatstone bridge with an application in on-chip temperature sensing.
Synthesis, Spectral Characterization and Antioxidant Activity of Tin(II-Morin Complex
Directory of Open Access Journals (Sweden)
Shahabuddin Memon
2012-12-01
Full Text Available The study focuses on the interaction between morin and Tin(II and the resulting complex was characterized through various analytical techniques by comparing it with morin. The complexation was confirmed at first by UV-Vis study, which shows that addition of Tin(II to morin may produce bathochromic shifts indicative of complex formation. IR spectral studies indicated that carbonyl has involved in coordination with Tin(II. Moreover, 1H-NMR studies validated that in conjunction with carbonyl, 3-OH of morin is more appropriate to be involved in complexation by replacement of its proton. Scavenging activities of morin and its Tin(II complex on DPPH• radical showed the inhibitory rates of 65% and 49%, respectively. In addition, the reducing capacity of morin was outstanding at 0.5 and 2.0 mg/ml concentrations relative to Tin(II complex. Overall, the study potentially shows the strong impact in order to design the anticancer drugs jointly from its cytotoxic potential and antioxidant activities, thereby selectively targeting the cancerous cells in result increasing their therapeutic index as well as extra advantages over other anticancer drugs.
International Nuclear Information System (INIS)
Guzman Acevedo, C.
1981-08-01
Studies aimed at evaluating the utility of sup(113m)In-EDTMP as a bone imaging agent in regions of the world where supplies of sup(99m)Tc are difficult to ensure are reported. Preliminary studies were concerned with characterization of unlabelled EDTMP, its toxicity in rats, its labelling with sup(113m)In and the radiochemical purity of the labelled product. Dosimetric studies were carried out with the labelled product on 15 normal human volunteers after intravenous administration of the labelled material. Preliminary imaging studies were carried out on 5 normal human volunteers. Finally, clinical studies were carried out on 199 patients with various diseases involving bone. It is concluded that sup(113m)In-EDTMP is a appropriate agent to use for bone imaging where sup(99m)Tc is unavailable
DEFF Research Database (Denmark)
Verdingovas, Vadimas; Jellesen, Morten Stendahl; Ambat, Rajan
2017-01-01
A majority of printed circuit board surfaces are covered with tin, therefore tin corrosion under humid conditions and movement of tin ions under the influence of an electric field plays an important role in the corrosion failure development. Tracking tin corrosion products spread on the printed c...
The tin mining and heavy mineral processing industry in the Kinta Valley, Perak, Malaysia
International Nuclear Information System (INIS)
Lee Swee Ching
1994-01-01
Overview of the tin mining and heavy mineral processing in the Kinta Valley, Perak, Malaysia was presented. Amang, a mixture composed of tin ore, sand, ilmenite, monazite, zircon, xenotime, struvite, etc , as a product from tin mining activities was discussed too in this paper
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Testing aids. 113.2 Section 113.2... Testing aids. To better ensure consistent and reproducible test results when Standard Requirement tests... Agriculture, may provide testing aids, when available, to licensees, permittees, and applicants for licenses...
27 CFR 21.113 - Isopropyl alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Isopropyl alcohol. 21.113 Section 21.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS FORMULAS FOR DENATURED ALCOHOL AND RUM Specifications for Denaturants § 21...
9 CFR 113.451 - Tetanus Antitoxin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tetanus Antitoxin. 113.451 Section 113.451 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE... which conforms to the National Institute of Standards and Technology requirements shall be used. The...
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Scar rule. 11.3 Section 11.3 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE ANIMAL... inflammation, and, other bilateral evidence of abuse indicative of soring including, but not limited to...
77 FR 34938 - Certain Tin Mill Products From Japan: Continuation of Antidumping Duty Order
2012-06-12
... DEPARTMENT OF COMMERCE International Trade Administration [A-588-854] Certain Tin Mill Products... duty order on certain tin mill products from Japan would likely lead to continuation or recurrence of...: Background On August 28, 2000, the Department published the antidumping duty order on certain tin mill...
13 CFR 113.410 - Comparable facilities.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Comparable facilities. 113.410... Discrimination on the Basis of Sex in Education Programs Or Activities Prohibited § 113.410 Comparable facilities. A recipient may provide separate toilet, locker room, and shower facilities on the basis of sex, but...
State of the Art Power-in Tube Niobium-Tin Superconductors
Energy Technology Data Exchange (ETDEWEB)
Godeke, A.; Ouden, A. Den; Nijhuis, A.; ten Kate, H.H.J.
2008-06-01
Powder-in-Tube (PIT) processed Niobium-Tin wires are commercially manufactured for nearly three decades and have demonstrated a combination of very high current density (presently up to 2500 A mm{sup -2} non-Cu at 12 T and 4.2 K) with fine (35 {micro}m), well separated filaments. We review the developments that have led to the present state of the art PIT Niobium-Tin wires, discuss the wire manufacturing and A15 formation processes, and describe typical superconducting performance in relation to magnetic field and strain. We further highlight successful applications of PIT wires and conclude with an outlook on possibilities for further improvements in the performance of PIT Niobium-Tin wires.
Interesterification of rapeseed oil catalyzed by tin octoate
International Nuclear Information System (INIS)
Galia, Alessandro; Centineo, Alessio; Saracco, Guido; Schiavo, Benedetto; Scialdone, Onofrio
2014-01-01
The interesterification of rapeseed oil was performed for the first time by using tin octoate as Lewis acid homogeneous catalysts and methyl or ethyl acetate as acyl acceptors in a batch reactor, within the temperature range 393–483 K. The yields in fatty acid ethyl esters (FAEE) and triacetin (TA) after 20 h of reaction time increased from 8% and 2%–to 61% and 22%, respectively, when the reaction temperature increased from 423 to 483 K. An optimum value of 40 for the acyl acceptor to oil molar ratio was found to be necessary to match good fatty acid alkyl ester yields with high enough reaction rate. The rate of generation of esters was significantly higher when methyl acetate was used as acyl acceptor instead of its ethyl homologue. The collected results suggest that tin octoate can be used as effective catalyst for the interesterification of rapeseed oil with methyl or ethyl acetate being highly soluble in the reaction system, less expensive than enzymes and allowing the operator to work under milder conditions than supercritical interesterification processes. - Highlights: • We study the interesterification of rapeseed oil catalyzed by tin(II) octoate. • Tin(II) octoate is an effective homogeneous catalyst at 483 K. • The acyl acceptor to oil molar ratio must be optimized. • Higher rate of reaction is obtained with methyl acetate as acyl acceptor
Highly conducting and transparent sprayed indium tin oxide
Energy Technology Data Exchange (ETDEWEB)
Rami, M.; Benamar, E.; Messaoudi, C.; Sayah, D.; Ennaoui, A. (Faculte des Sciences, Rabat (Morocco). Lab. de Physique des Materiaux)
1998-03-01
Indium tin oxide (ITO) has a wide range of applications in solar cells (e.g. by controlling the resistivity, we can use low conductivity ITO as buffer layer and highly conducting ITO as front contact in thin films CuInS[sub 2] and CuInSe[sub 2] based solar cells) due to its wide band gap (sufficient to be transparent) in both visible and near infrared range, and high carrier concentrations with metallic conduction. A variety of deposition techniques such as reactive electron beam evaporation, DC magnetron sputtering, evaporation, reactive thermal deposition, and spray pyrolysis have been used for the preparation of undoped and tin doped indium oxide. This latter process which makes possible the preparation of large area coatings has attracted considerable attention due to its simplicity and large scale with low cost fabrication. It has been used here to deposit highly transparent and conducting films of tin doped indium oxide onto glass substrates. The electrical, optical and structural properties have been investigated as a function of various deposition parameters namely dopant concentrations, temperature and nature of substrates. X-ray diffraction patterns have shown that deposited films are polycrystalline without second phases and have preferred orientation [400]. INdium tin oxide layers with small resistivity value around 7.10[sup -5] [omega].cm and transmission coefficient in the visible and near IR range of about 85-90% have been easily obtained. (authors) 13 refs.
XPS investigations of tribolayers formed on TiN and (Ti,Re)N coatings
Energy Technology Data Exchange (ETDEWEB)
Oktay, Serkan; Kahraman, Zafer; Urgen, Mustafa; Kazmanli, Kursat, E-mail: kursat@itu.edu.tr
2015-02-15
Graphical abstract: - Highlights: • The (Ti,Re)N coating (8 ± 1.9 at.% Re) consisted of TiN and ReNx (x > 1.33) phases. • TiO{sub 2} provided low friction coefficient to TiN coating at 150 °C. • Re addition to TiN drastically dropped the friction coefficients to 0.17–0.22. • Re{sub 2}O{sub 7} provided very low friction coefficient to (Ti,Re)N coating. • Re addition to TiN improved the wear behavior. - Abstract: TiN and (Ti,Re)N coatings were deposited on high-speed-steel substrates by a hybrid coating system composed of cathodic arc PVD and magnetron sputtering techniques. In order to keep rhenium content low (8 ± 1.9 at.%) in the coating, magnetron sputtering technique was utilized to evaporate rhenium. The (Ti,Re)N coating consisted of TiN and ReN{sub x} (x > 1.33) phases. The hardness of TiN and (Ti,Re)N were 31 GPa and 29 GPa ( ± 2 GPa), respectively. Tribological behaviors of the samples were tested against Al{sub 2}O{sub 3} balls at 21 °C (RT) and 150 °C (HT) by reciprocating wear technique. The tribolayers were analyzed by XPS technique. Friction coefficients of TiN were 0.56, 0.35 for 21 °C and 150 °C tests, respectively. Rhenium addition to TiN drastically dropped the friction coefficients to 0.22 and 0.17 for RT and HT samples. Rhenium addition also improved the wear resistance of the coating at both test temperatures. For TiN, main oxide component of the tribolayers was Ti{sub 2}O{sub 3} for RT tests and TiO{sub 2} for HT tests. The oxide layer formed on (Ti,Re)N were the mixture of TiO{sub 2}, Ti−O−N, ReO{sub 2} and Re{sub 2}O{sub 7} for both test temperatures. Re{sub 2}O{sub 7} provided very low friction coefficient to (Ti,Re)N. The findings are consistent with the crystal chemistry approach.
21 CFR 113.81 - Product preparation.
2010-04-01
...) Blanching by heat, when required in the preparation of food for canning, should be effected by heating the... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Product preparation. 113.81 Section 113.81 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR...
Reversible storage of lithium in a rambutan-like tin-carbon electrode.
Deng, Da; Lee, Jim Yang
2009-01-01
Fruity electrodes: A simple bottom-up self-assembly method was used to fabricate rambutan-like tin-carbon (Sn@C) nanoarchitecture (see scheme, green Sn) to improve the reversible storage of lithium in tin. The mechanism of the growth of the pear-like hairs is explored.
Creemers, H.M.J.C.; Verbeek, F.; Noltes, J.G.
1968-01-01
Starting from the tetrakis(diethylamino) derivatives of titanium and zirconium and pheyltin hydrides six intermetalic compounds contianing up to nine tin and titanium(or zirconium) atoms have been obtained by hydrostannolysis type reactions.
Effect of pulsed voltage on electrochemical migration of tin in electronics
DEFF Research Database (Denmark)
Verdingovas, Vadimas; Jellesen, Morten Stendahl; Ambat, Rajan
2015-01-01
formation and increases the charge transferred between the electrodes over time. With increase of duty cycle, increases the anodic dissolution of tin, which was visualized using a tin ion indicator applied on the components prior to applying the voltage. The anodic dissolution of tin significantly...... respectively at 10 and 5 V, while the duty cycle and the pulse width were varied in the range of ms. The results showed that varying of pulse width at fixed duty cycle has a minor effect under investigated conditions, whereas increasing duty cycle significantly reduces the time to short due to dendrite...
Hydrothermal synthesis of tungsten doped tin dioxide nanocrystals
Zhou, Cailong; Li, Yufeng; Chen, Yiwen; Lin, Jing
2018-01-01
Tungsten doped tin dioxide (WTO) nanocrystals were synthesized through a one-step hydrothermal method. The structure, composition and morphology of WTO nanocrystals were characterized by x-ray diffraction, x-ray photoelectron spectroscopy, energy dispersive x-ray spectroscopy, UV-vis diffuse reflectance spectra, zeta potential analysis and high-resolution transmission electron microscopy. Results show that the as-prepared WTO nanocrystals were rutile-type structure with the size near 13 nm. Compared with the undoped tin dioxide nanocrystals, the WTO nanocrystals possessed better dispersity in ethanol phase and formed transparent sol.
Thermal interaction for molten tin dropped into water
Energy Technology Data Exchange (ETDEWEB)
Arakeri, V.H.; Catton, I.; Kastenberg, W.E.; Plesset, M.S.
1978-03-01
Multiflash photography with extremely short duration exposure times per flash was used to observe the interaction of molten tin dropped into a water bath. Detailed photographic evidence is presented which demonstrates that transition, or nucleate boiling, is a possible triggering mechanism for vapor explosions. It was also found that the thermal constraints required to produce vapor explosions could be relaxed by introducing a stable thermal stratification within the coolant. In the present work, the threshold value of the initial tin temperature required for vapor explosion was reduced from about 500 to 343/sup 0/C.
Investigation of Surface Phenomena in Shocked Tin in Converging Geometry
Energy Technology Data Exchange (ETDEWEB)
Rousculp, Christopher L. [Los Alamos National Laboratory; Oro, David Michael [Los Alamos National Laboratory; Griego, Jeffrey Randall [Los Alamos National Laboratory; Turchi, Peter John [Los Alamos National Laboratory; Reinovsky, Robert Emil [Los Alamos National Laboratory; Bradley, Joseph Thomas [Los Alamos National Laboratory; Cheng, Baolian [Los Alamos National Laboratory; Freeman, Matthew Stouten [Los Alamos National Laboratory; Patten, Austin Randall [Los Alamos National Laboratory
2016-03-21
There is great interest in the behavior of the free surface of tin under shock loading. While it is known that meso-scale surface imperfections can seed the Richtmyer- Meshkov Instability (RMI) for a surface that is melted on release, much less is known about a tin surface that is solid, but plastically deforming. Here material properties such as shear and yield strength come into play especially in converging geometry. Previous experiments have been driven by direct contact HE. Usually a thin, flat target coupon is fielded with various single-mode, sinusoidal, machined, profiles on the free surface. The free surface is adjacent to either vacuum or an inert receiver gas. Most of these previous driver/target configurations have been nominal planer geometry. With modern HE it has been straightforward to shock tin into melt on release. However it has been challenging to achieve a low enough pressure for solid state on release. Here we propose to extend the existing base of knowledge to include the behavior of the free surface of tin in cylindrical converging geometry. By shock loading a cylindrical tin shell with a magnetically driven cylindrical liner impactor, the free surface evolution can be diagnosed with proton radiography. With the PHELIX capacitor bank, the drive can easily be varied to span the pressure range to achieve solid, mixed, and liquid states on release. A conceptual cylindrical liner and target is shown in Figure 1.
49 CFR 230.113 - Wheels and tire defects.
2010-10-01
... tires may not have a seam running lengthwise that is within 33/4 inches of the flange. (g) Worn flanges... 49 Transportation 4 2010-10-01 2010-10-01 false Wheels and tire defects. 230.113 Section 230.113... Tenders Wheels and Tires § 230.113 Wheels and tire defects. Steam locomotive and tender wheels or tires...
Recovery Of Valuable Metals In Tin-Based Anodic Slimes By Carbothermic Reaction
Han Chulwoong; Kim Young-Min; Son Seong Ho; Choi Hanshin; Kim Tae Bum; Kim Yong Hwan
2015-01-01
This study investigated the recovery of anodic slimes by carbothermic reaction in the temperature range of 973~1,273K and amount of carbon as a function of time. Tin anodic slime samples were collected from the bottom of the electrolytic cells during the electro-refining of tin. The anodic slimes are consisted of high concentrated tin, silver, copper and lead oxides. The kinetics of reduction were determined by means of the weight-loss measurement technique. In order to understand in detail o...
NMR as a tool for kinetic studies: application to the assessment of organo tin reactivity
Energy Technology Data Exchange (ETDEWEB)
Fouquet, E.; Roulet, T. [Bordeaux-1 Univ., 33 - Talence (France); Pianet, I. [Bordeaux-1 Univ., 33 -Talence (France) CNRS, Centre d`Etudes Structurales et d`Analyse des Molecules Organiques; Willem, R. [Brussels University (VUB), Brussels (Belgium)
1998-02-01
There is a growing interest for the research of an answer to the environmental problems related to the industrial use of tetra organo tins. An interesting alternative would be to develop the chemistry of mono organo tins because of their lower toxicity and of the easy removal of ``inorganic`` tin side products. In this work, halogen exchange rates are measured for various mono organo tins with NMR techniques (EXSY spectra and 1 D {sup 119} Sn NMR), and an exchange mechanism is proposed. A correlation between kinetic data and the reactivity of the mono organo tins is then exemplified with radical allylic transfer and palladium catalyzed coupling reactions. (authors) 14 refs.
Determination of total tin in silicate rocks by graphite furnace atomic absorption spectrometry
Elsheimer, H.N.; Fries, T.L.
1990-01-01
A method is described for the determination of total tin in silicate rocks utilizing a graphite furnace atomic absorption spectrometer with a stabilized-temperature platform furnace and Zeeman-effect background correction. The sample is decomposed by lithium metaborate fusion (3 + 1) in graphite crucibles with the melt being dissolved in 7.5% hydrochloric acid. Tin extractions (4 + 1 or 8 + 1) are executed on portions of the acid solutions using a 4% solution of tricotylphosphine oxide in methyl isobutyl ketone (MIBK). Ascorbic acid is added as a reducing agent prior to extraction. A solution of diammonium hydrogenphosphate and magnesium nitrate is used as a matrix modifier in the graphite furnace determination. The limit of detection is > 10 pg, equivalent to > 1 ??g l-1 of tin in the MIBK solution or 0.2-0.3 ??g g-61 in the rock. The concentration range is linear between 2.5 and 500 ??g l-1 tin in solution. The precision, measured as relative standard deviation, is < 20% at the 2.5 ??g l-1 level and < 7% at the 10-30 ??g l-1 level of tin. Excellent agreement with recommended literature values was found when the method was applied to the international silicate rock standards BCR-1, PCC-1, GSP-1, AGV-1, STM-1, JGb-1 and Mica-Fe. Application was made to the determination of tin in geological core samples with total tin concentrations of the order of 1 ??g g-1 or less.
Occupational irritant contact folliculitis associated with triphenyl tin fluoride (TPTF) exposure
DEFF Research Database (Denmark)
Andersen, Klaus Ejner; Petri, M
1982-01-01
Triphenyl tin fluoride (TPTF) is a bioactive organo-tin compound used in concentrations 2-12% as anti-foulants in boat paints. The chemical is moderately toxic to the skin. An occupational irritant contact folliculitis from TPTF in a marine paint plant worker is described. Contact allergy...
Numerical Simulation of Wave Propagation and Phase Transition of Tin under Shock-Wave Loading
International Nuclear Information System (INIS)
Hai-Feng, Song; Hai-Feng, Liu; Guang-Cai, Zhang; Yan-Hong, Zhao
2009-01-01
We undertake a numerical simulation of shock experiments on tin reported in the literature, by using a multiphase equation of state (MEOS) and a multiphase Steinberg Guinan (MSG) constitutive model for tin in the β, γ and liquid phases. In the MSG model, the Bauschinger effect is considered to better describe the unloading behavior. The phase diagram and Hugoniot of tin are calculated by MEOS, and they agree well with the experimental data. Combined with the MEOS and MSG models, hydrodynamic computer simulations are successful in reproducing the measured velocity profile of the shock wave experiment. Moreover, by analyzing the mass fraction contour as well as stress and temperature profiles of each phase for tin, we further discuss the complex behavior of tin under shock-wave loading. (condensed matter: structure, mechanical and thermal properties)
Effects on stress rupture life and tensile strength of tin additions to Inconel 718
Dreshfield, R. L.; Johnson, W.
1982-01-01
Because Inconel 718 represents a major use of columbium and a large potential source of columbium for aerospace alloys could be that of columbium derived from tin slags, the effects of tin additions to Inconel 718 at levels which might be typical of or exceed those anticipated if tin slag derived columbium were used as a melting stock were investigated. Tin was added to 15 pound Inconel 718 heats at levels varying from none added to approximately 10,000 ppm (1 wt%). Limited 1200 F stress rupture testing was performed at stresses from 68,000 to 115,000 psi and a few tensile tests were performed at room temperature, 800 and 1200 F. Additions of tin in excess of 800 ppm were detrimental to ductility and stress rupture life.
Formation of Ti-N graded bioceramic layer by DC hollow-cathode plasma nitriding
Institute of Scientific and Technical Information of China (English)
ZHENG Chuan-lin
2004-01-01
Ti-N graded ceramic layer was formed on titanium by using DC hollow-cathode plasma nitriding technique. The structure of Ti-N layer was analyzed using X-ray diffractometry(XRD) with Cu Kα radiation, and the microhardness( HV0.1) was measured from the surface to inner along the cross section of Ti-N layer. The results indicate that the Ti-N graded layer is composed of ε-Ti2 N, δ-TiN and α-Ti(N) phases. Mechanism discussion shows that hollow-cathode discharge can intensify gas ionization, increase current density and enhance the nitriding potential, which directly increases the thickness of the diffusion coatings compared with traditional nitriding methods.
47 CFR 25.113 - Station licenses and launch authority.
2010-10-01
... 47 Telecommunication 2 2010-10-01 2010-10-01 false Station licenses and launch authority. 25.113 Section 25.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED) COMMON CARRIER SERVICES SATELLITE COMMUNICATIONS Applications and Licenses General Application Filing Requirements § 25.113 Station...
Metalorganic atomic layer deposition of TiN thin films using TDMAT and NH3
International Nuclear Information System (INIS)
Kim, Hyo Kyeom; Kim, Ju Youn; Park, Jin Yong; Kim, Yang Do; Kim, Young Do; Jeon, Hyeong Tag; Kim, Won Mok
2002-01-01
TiN films were deposited by using the metalorganic atomic layer deposition (MOALD) method using tetrakis-dimethyl-amino-titanium (TDMAT) as the titanium precursor and ammonia (NH 3 ) as the reactant gas. Two saturated TiN film growth regions were observed in the temperature ranges from 175 and 190 .deg. C and from 200 and 210 .deg. C. TiN films deposited by the MOALD technique showed relatively lower carbon content than films deposited by metalorganic chemical vapor deposition (MOCVD) method. TiN films deposited at around 200 .deg. C under standard conditions showed the resistivity values as low as 500 μΩ-cm, which is about one order lower than the values for TiN films deposited by MOCVD using TDMAT or TDMAT with NH 3 . Also, the carbon incorporation and the resistivity were further decreased with increasing Ar purge time and flow rate. TiN films deposited at temperature below 300 .deg. C showed amorphous characteristics. TiN film deposited on contact holes, about 0.4-μm wide and 0.8-μm deep, by using the MOALD method showed excellent conformal deposition with almost 100% step coverage. This study demonstrates that the processing parameters need to be carefully controlled to optimize the film properties that the processing parameters need to be carefully controlled to optimize the film properties when using the ALD technique and that TiN films deposited by using the MOALD method exhibited excellent film properties compared to those of films deposited by using other CVD methods
Stability of tinned food from pigs radiated with various doses of ionizing rays
International Nuclear Information System (INIS)
Kossakowska, A.; Kossakowski, S.; Widenska, T.; Wojton, B.
1978-01-01
The examinations were carried out on 347 tinned food made of meat from pigs exposed to radiation of 300 and 600 R. The animals were irradiated with 60 Co. The pigs irradiated with 300 R were slaughtered after 7 and 14 days, and these with 600 R after 7 and 12 days; the control animals were killed after 14 days. Post-slaughter visual and microbiological examinations were performed by seeding the samples of the blood, muscles, lymphnodes and internal organs for the presence of Salmonella sp. Meat was pickled and heated up to 67-68 0 C (in the center of tinned food). The lowest stability showed the tinned food made of pigs irradiated with 600 R and killed after 12 days. Chemical examinations of the tinned food stored at 6 0 C revealed the prevalence of oxydative processes in fat over hydrolitic ones. The difference in acid number between tinned food under test and controls appeared after 6 months. Peroxides occurred in the control after 6 months and in these under examination after 3 months, and the level was 4.00-5.80 apart from the tins made of meat of pigs irradiated with 300 R and slaughtered after 7 days. (author)
Understanding the gas sensing properties of polypyrrole coated tin oxide nanofiber mats
Bagchi, Sudeshna; Ghanshyam, C.
2017-03-01
Tin oxide-polypyrrole composites have been widely studied for their enhanced sensing performance towards ammonia vapours, but further investigations are required for an understanding of the interaction mechanisms with different target analytes. In this work, polypyrrole coated tin oxide fibers have been synthesized using a two-step approach of electrospinning and vapour phase polymerization for the sensing of ammonia, ethanol, methanol, 2-propanol and acetone vapours. The resistance variation in the presence of these vapours of different nature and concentration is investigated for the determination of sensor response. A decrease in resistance occurred on interaction of tin oxide-polypyrrole with ammonia, as opposed to previous reported works. Partial reduction of polypyrrole due to interfacial interaction with tin oxide has been proposed to explain this behavior. High sensitivity of 7.45 is achieved for 1 ppm ammonia concentration. Furthermore, the sensor exhibited high sensitivity and a faster response towards ethanol vapours although methanol has the highest electron donating capability. The catalytic mechanism has been discussed to explain this interesting behavior. The results reveal that interaction between tin oxide and polypyrrole is crucial to control the predominant sensing mechanism.
Heavy metal content of tinned soup as a function of storage time
Energy Technology Data Exchange (ETDEWEB)
Stelte, W.
1983-01-01
Samples were taken from soups prior to their preservation in tins. None of the samples showed an increased content of the investigated heavy metals lead and mercury exceeding the amounts normally found in food. Thus it may be considered as certain that the heavy metal content of soups is not adversely affected by technical processes during their preparation. Increase in heavy metal content by metallic residues from tin manufacture is slight and mainly due to tin, whose content is on average increased in the soup by 0.4 mg/kg. For lead the influence is smaller and for mercury it is not significantly demonstrable. The metallic residues from tin manufacture are an irrelevant quantity in terms of nutrition physiology. Within the investigated 4-year storage-period the lead content shows a tendency to increase towards saturation. Cadmium remains essentially constant, the content of mercury has a downward tendency and reaches zero after 2 to 4 years. Consumers' exposure is in a range known for the consumption of other foodstuffs as well. The use of varnished tins to package industrial soups involves no exposure of consumers to heavy metals justifying any apprehension even after prolonged storage.
Broad spectral response photodetector based on individual tin-doped CdS nanowire
Directory of Open Access Journals (Sweden)
Weichang Zhou
2014-12-01
Full Text Available High purity and tin-doped 1D CdS micro/nano-structures were synthesized by a convenient thermal evaporation method. SEM, EDS, XRD and TEM were used to examine the morphology, composition, phase structure and crystallinity of as-prepared samples. Raman spectrum was used to confirm tin doped into CdS effectively. The effect of impurity on the photoresponse properties of photodetectors made from these as-prepared pure and tin-doped CdS micro/nano-structures under excitation of light with different wavelength was investigated. Various photoconductive parameters such as responsivity, external quantum efficiency, response time and stability were analyzed to evaluate the advantage of doped nanowires and the feasibility for photodetector application. Comparison with pure CdS nanobelt, the tin-doped CdS nanowires response to broader spectral range while keep the excellect photoconductive parameters. Both trapped state induced by tin impurity and optical whispering gallery mode microcavity effect in the doped CdS nanowires contribute to the broader spectral response. The micro-photoluminescence was used to confirm the whispering gallery mode effect and deep trapped state in the doped CdS nanowires.
Bae, Sang-Dae; Kwon, Soo-Hun; Jeong, Hwan-Seok; Kwon, Hyuck-In
2017-07-01
In this work, we investigated the effects of low-temperature argon (Ar)-plasma surface treatments on the physical and chemical structures of p-type tin oxide thin-films and the electrical performance of p-type tin oxide thin-film transistors (TFTs). From the x-ray photoelectron spectroscopy measurement, we found that SnO was the dominant phase in the deposited tin oxide thin-film, and the Ar-plasma treatment partially transformed the tin oxide phase from SnO to SnO2 by oxidation. The resistivity of the tin oxide thin-film increased with the plasma-treatment time because of the reduced hole concentration. In addition, the root-mean-square roughness of the tin oxide thin-film decreased as the plasma-treatment time increased. The p-type oxide TFT with an Ar-plasma-treated tin oxide thin-film exhibited excellent electrical performance with a high current on-off ratio (5.2 × 106) and a low off-current (1.2 × 10-12 A), which demonstrates that the low-temperature Ar-plasma treatment is a simple and effective method for improving the electrical performance of p-type tin oxide TFTs.
77 FR 32998 - Tin- and Chromium-Coated Steel Sheet From Japan
2012-06-04
...-Coated Steel Sheet From Japan Determination On the basis of the record \\1\\ developed in the subject five... order on tin- and chromium-coated steel sheet from Japan would be likely to lead to continuation or... USITC Publication 4325 (May 2012), entitled Tin- and Chromium-Coated Steel Sheet from Japan...
9 CFR 113.208 - Avian Encephalomyelitis Vaccine, Killed Virus.
2010-01-01
..., Killed Virus. 113.208 Section 113.208 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.208 Avian Encephalomyelitis Vaccine, Killed Virus. Avian...
9 CFR 113.210 - Feline Calicivirus Vaccine, Killed Virus.
2010-01-01
... Virus. 113.210 Section 113.210 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.210 Feline Calicivirus Vaccine, Killed Virus. Feline Calicivirus...
9 CFR 113.211 - Feline Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.211 Section 113.211 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.211 Feline Rhinotracheitis Vaccine, Killed Virus. Feline...
9 CFR 113.216 - Bovine Rhinotracheitis Vaccine, Killed Virus.
2010-01-01
... Virus. 113.216 Section 113.216 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.216 Bovine Rhinotracheitis Vaccine, Killed Virus. Infectious Bovine...
9 CFR 113.203 - Feline Panleukopenia Vaccine, Killed Virus.
2010-01-01
... Virus. 113.203 Section 113.203 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.203 Feline Panleukopenia Vaccine, Killed Virus. Feline Panleukopenia...
Characterization of tin films synthesized from ethaline deep eutectic solvent
International Nuclear Information System (INIS)
Ghosh, Swatilekha; Roy, Sudipta
2014-01-01
Highlights: • Tin deposition was achieved by galvanostatic method on the basic substrates from ethaline deep eutectic solvent without use of any additives. • The current potential behaviour of tin system changes with increase in concentration of hydrated tin chloride in ethaline. • The deposition rate in ethaline display three times lower value compared to aqueous electrolytes. • Fine grained crystals of 62 ± 10 nm were obtained for tin deposits. • The deposition process is economical and can be adapted for industrial applications. - Abstract: Tin (Sn) films were electrodeposited by galvanostatic method from ethaline deep eutectic solvent (DES), without any additives. The effect of various deposition parameters on the microstructure was studied. With increase in metal salt concentration from 0.01 to 0.1 M, changes in current–potential behaviour were observed in the polarization scans. This might be due to the existence of [SnCl 3 ] − , [Sn 2 Cl 5 ] − complexes in ethaline DES. Smooth and homogeneous deposits were obtained on a steel substrate surface by applying current density of 1.57 × 10 −3 A/cm 2 at 25 °C. Under these conditions the deposition rate was found to be 0.1 ± 10% μm/min and current efficiency was obtained as 84 ± 3%. XRD analysis of the deposit confirmed the polycrystalline tetragonal structure with mostly (2 0 0) orientation having a crystallite size about 62 ± 16% nm along with an internal strain of 0.0031 ± 22%. The present deposition method is simple, economical and can be adapted for industrial applications
Tin-Silver Alloys for Flip-Chip Bonding Studied with a Rotating Cylinder Electrode
DEFF Research Database (Denmark)
Tang, Peter Torben; Pedersen, E.H.; Bech-Nielsen, G.
1999-01-01
Electrodeposition of solder for flip-chip bonding is studied in the form of a pyrophosphate/iodide tin-silver alloy bath. The objective is to obtain a uniform alloy composition, with 3.8 At.% silver, over a larger area. This specific alloy will provide an eutectic solder melting at 221°C (or 10°C...... photoresist, have shown a stable and promising alternative to pure tin and tin-lead alloys for flip-chip bonding applications....
Synthesis of antimony-doped tin oxide (ATO) nanoparticles by the nitrate-citrate combustion method
International Nuclear Information System (INIS)
Zhang Jianrong; Gao Lian
2004-01-01
Antimony-doped tin oxide (ATO) nanoparticles having rutile structure have been synthesized by the combustion method using citric acid (CA) as fuel and nitrate as an oxidant, the metal sources were granulated tin and Sb 2 O 3 . The influence of citric acid (fuel) to metal ratio on the average crystallite size, specific surface area and morphology of the nanoparticles has been investigated. X-ray diffraction showed the tin ions were reduced to elemental tin during combustion reaction. The average ATO crystallite size increased with the increase of citric acid (fuel). Powder morphology and the comparison of crystallite size and grain size shows that the degree of agglomeration of the powder decreased with an increase of the ratio. The highest specific surface area was 37.5 m 2 /g when the citric acid to tin ratio was about 6
Thermal interaction for molten tin dropped into water
International Nuclear Information System (INIS)
Arakeri, V.H.; Catton, I.; Kastenberg, W.E.; Plesset, M.S.
1978-01-01
Multiflash photography with extremely short duration exposure times per flash has been used to observe the interaction of molten tin dropped into a water bath. Detailed photographic evidence is presented which demonstrates that transition, or nucleate boiling, is a possible triggering mechanism for vapour explosions. It was also found that the thermal constraints required to produce vapour explosions could be relaxed by introducing a stable thermal stratification within the coolant. In the present work, the threshold value of the initial tin temperature required for vapour explosion was reduced from about 500 to 343 0 C. (author)
14 CFR 13.113 - Noncompliance with the investigative process.
2010-01-01
... process. 13.113 Section 13.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... an Order of Investigation § 13.113 Noncompliance with the investigative process. If any person fails... Officer or the designee of the Presiding Officer, judicial enforcement may be initiated against that...
9 CFR 113.205 - Newcastle Disease Vaccine, Killed Virus.
2010-01-01
... Virus. 113.205 Section 113.205 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.205 Newcastle Disease Vaccine, Killed Virus. Newcastle Disease Vaccine...
2012-02-06
... DEPARTMENT OF COMMERCE International Trade Administration [A-588-854] Certain Tin Mill Products... duty order covering certain tin mill products from Japan. The period of review is August 1, 2010... parties to request an administrative review of the antidumping duty order on certain tin mill products...
2011-03-18
... DEPARTMENT OF COMMERCE International Trade Administration [A-588-854] Certain Tin Mill Products... duty order covering certain tin mill products from Japan. The period of review is August 1, 2009... parties to request an administrative review of the antidumping duty order on certain tin mill products...
9 CFR 113.104 - Leptospira Grippotyphosa Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Grippotyphosa Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.104 Leptospira Grippotyphosa Bacterin. Leptospira Grippotyphosa Bacterin shall be produced from a culture of Leptospira grippotyphosa which has been inactivated...
Rustandi, Andi; Cahyadi, Agung; Taruli Siallagan, Sonia; Wafa' Nawawi, Fuad; Pratesa, Yudha
2018-01-01
Tin slag is a byproduct of tin ore smelting process which is rarely utilized. The main purpose of this work is to investigate the use of tin slag for concrete cement material application compared to the industrial Ordinary Portland Cement (OPC). Tin slag composition was characterized by XRD and XRF analysis. The characterization results showed the similar chemical composition of tin slag and OPC. It also revealed the semi crystalline structure of tin slag sample. Several electrochemical tests were performed to evaluate corrosion behavior of tin slag, OPC and various mixed composition of both materials and the addition of CaO. The corrosion behavior of OPC and tin slag were evaluated by using Cyclic Polarization, Electrochemical Impedance Spectroscopy (EIS) and Electrochemical Frequency Modulation (EFM) methods. Aqueous sodium chloride (NaCl) solution with 3.5% w.t concentration which similar to seawater was used as the electrolyte in this work. The steel specimen used as the reinforce bar (rebar) material of the concrete was carbon steel AISI 1045. The rebar was embedded in the concrete cement which composed of OPC and the various composition of tin slag including slag without addition of CaO and slag mixed with addition of 50 % CaO. The electrochemical tests results revealed that tin slag affected its corrosion behavior which becoming more active and increasing the corrosion rate as well as decreasing the electrochemical impedance.
Discovery of the calcium, indium, tin, and platinum isotopes
International Nuclear Information System (INIS)
Amos, S.; Gross, J.L.; Thoennessen, M.
2011-01-01
Currently, twenty-four calcium, thirty-eight indium, thirty-eight tin, and thirty-nine platinum isotopes have been observed and the discovery of these isotopes is discussed here. For each isotope a brief synopsis of the first refereed publication, including the production and identification method, is presented. - Highlights: Documentation of the discovery of all calcium, indium, tin and platinum isotopes. → Summary of author, journal, year, place and country of discovery for each isotope. → Brief description of discovery history of each isotope.
Wear of tin coating and Al-Si alloy substrate against carburized steel under mixed lubrication
Wang, Q.; Cheng, H. S.; Fine, M. E.
1994-04-01
Tin coatings on Al-Si alloys are widely used in the automotive industries. The soft tin coating and the harder substrate alloy form a tribological system with the advantages of low friction and reasonably high load-bearing capacity. Wear tests of tin coated Al-Si Z332 alloy in conformal contact against carburized 1016 steel have been carried out under mixed lubrications with SAE 10W30 oil to study the wear mechanisms. Two major wear mechanisms, uniform wear of the tin coating due to micro-plowing and spall pitting related to the substrate are found to contribute to the bearing material loss when the fluid lubrication film is relatively thick (Lambda about 1.6). Under conditions of thinner films (Lambda approximately = 0.8), some local coating debonding occurs. The pitting and local coating debounding are closely related to fracture in the substrate. The bonding between silicon and tin seems to be weaker than between aluminum and tin. During wear, oxidation occurs.
Nickel-Tin Electrode Materials for Nonaqueous Li-Ion Cells
Ehrlich, Grant M.; Durand, Christopher
2005-01-01
Experimental materials made from mixtures of nickel and tin powders have shown promise for use as the negative electrodes of rechargeable lithium-ion electrochemical power cells. During charging (or discharging) of a lithium-ion cell, lithium ions are absorbed into (or desorbed from, respectively) the negative electrode, typically through an intercalation or alloying process. The negative electrodes (for this purpose, designated as anodes) in state-of-the-art Li-ion cells are made of graphite, in which intercalation occurs. Alternatively, the anodes can be made from metals, in which alloying can occur. For reasons having to do with the electrochemical potential of intercalated lithium, metallic anode materials (especially materials containing tin) are regarded as safer than graphite ones; in addition, such metallic anode materials have been investigated in the hope of obtaining reversible charge/discharge capacities greater than those of graphite anodes. However, until now, each of the tin-containing metallic anode formulations tested has been found to be inadequate in some respect.
9 CFR 113.122 - Salmonella Choleraesuis Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Choleraesuis Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.122 Salmonella Choleraesuis Bacterin. Salmonella Choleraesuis Bacterin shall be prepared from a culture of Salmonella choleraesuis which has been inactivated and is...
9 CFR 113.120 - Salmonella Typhimurium Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Typhimurium Bacterin. 113... REQUIREMENTS Inactivated Bacterial Products § 113.120 Salmonella Typhimurium Bacterin. Salmonella Typhimurium Bacterin shall be prepared from a culture of Salmonella typhimurium which has been inactivated and is...
37 CFR 11.3 - Suspension of rules.
2010-07-01
... Section 11.3 Patents, Trademarks, and Copyrights UNITED STATES PATENT AND TRADEMARK OFFICE, DEPARTMENT OF COMMERCE REPRESENTATION OF OTHERS BEFORE THE UNITED STATES PATENT AND TRADEMARK OFFICE General Provisions General Information § 11.3 Suspension of rules. (a) In an extraordinary situation, when justice requires...
Energy Technology Data Exchange (ETDEWEB)
Chua, Chin Sheng, E-mail: cschua@simtech.a-star.edu.sg [School of Electrical and Electronic Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Singapore Institute of Manufacturing Technology, 71 Nanyang Drive, 638075 (Singapore); Tan, Ooi Kiang; Tse, Man Siu [School of Electrical and Electronic Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Ding, Xingzhao [Singapore Institute of Manufacturing Technology, 71 Nanyang Drive, 638075 (Singapore)
2013-10-01
Tin-doped TiO{sub 2} films are deposited via aerosol assisted chemical vapor deposition using a precursor mixture composing of titanium tetraisopropoxide and tetrabutyl tin. The amount of tin doping in the deposited films is controlled by the volume % concentration ratio of tetrabutyl tin over titanium tetraisopropoxide in the mixed precursor solution. X-ray diffraction analysis results reveal that the as-deposited films are composed of pure anatase TiO{sub 2} phase. Red-shift in the absorbance spectra is observed attributed to the introduction of Sn{sup 4+} band states below the conduction band of TiO{sub 2}. The effect of tin doping on the photocatalytic property of TiO{sub 2} films is studied through the degradation of stearic acid under UV light illumination. It is found that there is a 10% enhancement on the degradation rate of stearic acid for the film with 3.8% tin doping in comparison with pure TiO{sub 2} film. This improvement of photocatalytic performance with tin incorporation could be ascribed to the reduction of electron-hole recombination rate through charge separation and an increased amount of OH radicals which are crucial for the degradation of stearic acid. Further increase in tin doping results in the formation of recombination site and large anatase grains, which leads to a decrease in the degradation rate. - Highlights: ► Deposition of tin-doped TiO{sub 2} film via aerosol assisted chemical vapor deposition ► Deposited anatase films show red-shifted in UV–vis spectrum with tin-dopants. ► Photoactivity improves at low tin concentration but reduces at higher concentration. ► Improvement in photoactivity due to bandgap narrowing from Sn{sup 4+} band states ► Maximum photoactivity achieved occurs for films with 3.8% tin doping.
Multi - pulse tea CO2 laser beam interaction with the TiN thin films
International Nuclear Information System (INIS)
Gakovic, B.; Trtica, M.; Nenadovic, T.; Pavlicevic, B.
1998-01-01
The interaction of various types of energetic beams including a laser beam with the high-hardness coatings is of great fundamental and technological interest. The Nd:YAG, excimer and CO 2 are frequently used laser beams for this purpose. The interaction of a laser beam with low thickness coatings, deposited on austenitic stainless steel, is insufficiently known in the literature. Titanium nitride (TiN) possess the excellent physico-chemical characteristics. For this reason TiN films/coatings are widely used. The purpose of this article is a consideration of the effect of TEA C0 2 laser radiation on the TiN film deposited on austenitic stainless steel substrate (AISI 316). Investigation of TiN morphological changes, after multipulse laser irradiation, shown dependence on laser fluence, number of laser pulses and the laser pulse shape. Subsequently fast heating and cooling during multi-pulse laser bombardment cause the grain growth of TiN layer. Both laser pulses (pulses with tail and tail-free pulses) produced periodical wave like structure on polished substrate material. Periodicity is observed also on AISI 316 protected with TiN layer, but only with laser pulse with tail. (author)
Release path temperatures of shock-compressed tin from dynamic reflectance and radiance measurements
Energy Technology Data Exchange (ETDEWEB)
La Lone, B. M., E-mail: lalonebm@nv.doe.gov; Stevens, G. D.; Turley, W. D. [National Security Technologies, LLC, Special Technologies Laboratory, Santa Barbara, California 93111 (United States); Holtkamp, D. B. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); Iverson, A. J. [National Security Technologies, LLC, Los Alamos Operations, Los Alamos, New Mexico 87544 (United States); Hixson, R. S.; Veeser, L. R. [Los Alamos National Laboratory, Los Alamos, New Mexico 87545 (United States); National Security Technologies, LLC, Los Alamos Operations, Los Alamos, New Mexico 87544 (United States)
2013-08-14
Dynamic reflectance and radiance measurements were conducted for tin samples shock compressed to 35 GPa and released to 15 GPa using high explosives. We determined the reflectance of the tin samples glued to lithium fluoride windows using an integrating sphere with an internal xenon flashlamp as an illumination source. The dynamic reflectance (R) was determined at near normal incidence in four spectral bands with coverage in visible and near-infrared spectra. Uncertainties in R/R{sub 0} are <2%, and uncertainties in absolute reflectance are <5%. In complementary experiments, thermal radiance from the tin/glue/lithium fluoride interface was recorded with similar shock stress and spectral coverage as the reflectance measurements. The two sets of experiments were combined to obtain the temperature history of the tin surface with an uncertainty of <2%. The stress at the interface was determined from photonic Doppler velocimetry and combined with the temperatures to obtain temperature-stress release paths for tin. We discuss the relationship between the experimental release paths and release isentropes that begin on the principal shock Hugoniot.
Assessment of organotin and tin-free antifouling paints contamination in the Korean coastal area.
Lee, Mi-Ri-Nae; Kim, Un-Jung; Lee, In-Seok; Choi, Minkyu; Oh, Jeong-Eun
2015-10-15
Twelve organotins (methyl-, octyl-, butyl-, and phenyl-tin), and eight tin-free antifouling paints and their degradation products were measured in marine sediments from the Korean coastal area, and Busan and Ulsan bays, the largest harbor area in Korea. The total concentration of tin-free antifouling paints was two- to threefold higher than the total concentration of organotins. Principal component analysis was used to identify sites with relatively high levels of contamination in the inner bay area of Busan and Ulsan bays, which were separated from the coastal area. In Busan and Ulsan bays, chlorothalonil and DMSA were more dominant than in the coastal area. However, Sea-Nine 211 and total diurons, including their degradation products, were generally dominant in the Korean coastal area. The concentrations of tin and tin-free compounds were significantly different between the east and west coasts. Copyright © 2015 Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Kim, You Sun; Kim, Tae Young [Korea Atomic Research Institue, Seoul (Korea, Republic of)
1969-03-15
In 1968 total 94,660 mc of radioactive iodocompound were prepared and distributed to the urers. In order to obtain an effective liver scanning {sup 113m}Incolloidal of even partical size from a {sup 113}Sn-{sup 113m}In cow, the eluate(pH; 1.5) was examined by a radio paper partition chromatography. It was found that the eluate was composed of two components, ionic from and colloidal form. The ionid from could be eliminated by cation exchange resine and the eluate from the ion exchange resine was of even particle size to give an excellent liver scanning results. Labelling of {sup 113m}In to human serum albumine was attempted.
Qin, Ping; Li, Xingxing; Gao, Biao; Fu, Jijiang; Xia, Lu; Zhang, Xuming; Huo, Kaifu; Shen, Wenli; Chu, Paul K
2018-05-10
Titanium nitride (TiN) is an attractive electrode material in fast charging/discharging supercapacitors because of its excellent conductivity. However, the low capacitance and mechanical brittleness of TiN restricts its further application in flexible supercapacitors with high energy density. Thus, it is still a challenge to rationally design TiN electrodes with both high electrochemical and mechanical properties. Herein, the hierarchical TiN nanoparticles-assembled nanopillars (H-TiN NPs) array as binder free electrodes were obtained by nitriding of hierarchical titanium dioxide (TiO2) nanopillars, which was produced by a simple hydrothermal treatment of anodic TiO2 nanotubes (NTs) array in water. The porous TiN nanoparticles connected to each other to form ordered nanopillar arrays, effectively providing larger specific surface area and more active sites for charge storage. The H-TiN NPs delivered a high volumetric capacitance of 120 F cm-3 at 0.83 A cm-3, which is better than that of TiN NTs arrays (69 F cm-3 at 0.83 A cm-3). After assembling into all-solid-state devices, the H-TiN NPs based supercapacitors exhibited outstanding volumetric capacitance of 5.9 F cm-3 at 0.02 A cm-3 and a high energy density of 0.53 mW h cm-3. Our results reveal a new strategy to optimize the supercapacitive performance of metal nitrides.
9 CFR 113.317 - Parvovirus Vaccine (Canine).
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Parvovirus Vaccine (Canine). 113.317... Virus Vaccines § 113.317 Parvovirus Vaccine (Canine). Parvovirus Vaccine recommended for use in dogs... from each dog shall be individually tested for neutralizing antibody against canine parvovirus to...
Anomalous growth of whisker-like bismuth-tin extrusions from tin-enriched tin-Bi deposits
International Nuclear Information System (INIS)
Hu, C.-C.; Tsai, Y.-D.; Lin, C.-C.; Lee, G.-L.; Chen, S.-W.; Lee, T.-C.; Wen, T.-C.
2009-01-01
This article shows the first finding that the anomalous growth of Bi-Sn extrusions from tin-enriched alloys (Sn-xBi with x between 20 and 10 wt.%) can be induced by post-plating annealing in N 2 between 145 and 260 deg. C for 10 min although metal whiskers were commonly formed on the surface of pure metals or alloys of the enriched component. From SEM observations, very similar to Sn whiskers, Bi-Sn extrusions vary in size, shape, length, and diameter with changing the annealing temperature, which are highly important in regarding the potential for failure of electronic products. Annealing resulting in thermal expansion of Sn grains is believed to squeeze the Bi-Sn alloys with relatively low melting points to form whisker-like extrusions although the exact mechanism is unclear
Courey, Karim; Wright, Clara; Asfour, Shihab; Onar, Arzu; Bayliss, Jon; Ludwig, Larry
2009-01-01
In this experiment, an empirical model to quantify the probability of occurrence of an electrical short circuit from tin whiskers as a function of voltage was developed. This empirical model can be used to improve existing risk simulation models. FIB and TEM images of a tin whisker confirm the rare polycrystalline structure on one of the three whiskers studied. FIB cross-section of the card guides verified that the tin finish was bright tin.
Moessbauer study of the lattice dynamics of tin atoms in antimony
International Nuclear Information System (INIS)
Sitek, J.
1975-01-01
The Moessbauer effect probability f was investigated for tin impurity atoms in the SnSb solution (the impurity varied from 3 at% to 15 at%). The absolute value of the Moessbauer effect probability was determined from Moessbauer absorption spectra by the area method using a calibration absorber of a β-tin foil with known f. (Z.S.)
Fast, versatile x-ray fluorescence method for measuring tin in impregnated wood
DEFF Research Database (Denmark)
Drabæk, I.; Christensen, Leif Højslet
1985-01-01
The present paper describes an energy-dispersive x-ray fluorescence method for measuring tin in bis(tri-n-butyl)tin-oxide impregnated wood. The proposed method is of the backscatter/fundamental parameter type. Its versatility, precision, and accuracy is demonstrated by analyses of eleven samples...
Synthesis and electrochemical properties of tin oxide-based composite by rheological technique
International Nuclear Information System (INIS)
He Zeqiang; Li Xinhai; Xiong Lizhi; Wu Xianming; Xiao Zhuobing; Ma Mingyou
2005-01-01
Novel rheological technique was developed to synthesize tin oxide-based composites. The microstructure, morphology, and electrochemical performance of the materials were investigated by X-ray diffraction, scanning electron microscopy and electrochemical methods. The particles of tin oxide-based materials form an inactive matrix. The average size of the particles is about 150 nm. The material delivers a charge capacity of more than 570 mAh g -1 . The capacity loss per cycle is about 0.15% after being cycled 30 times. The good electrochemical performance indicates that this kind of tin oxide-based material is promising anode for lithium-ion battery
Tin Whisker Electrical Short Circuit Characteristics. Part 2
Courey, Karim J.; Asfour, Shihab S.; Onar, Arzu; Bayliss, Jon A.; Ludwig, Lawrence L.; Wright, Maria C.
2009-01-01
Existing risk simulations make the assumption that when a free tin whisker has bridged two adjacent exposed electrical conductors, the result is an electrical short circuit. This conservative assumption is made because shorting is a random event that has an unknown probability associated with it. Note however that due to contact resistance electrical shorts may not occur at lower voltage levels. In our first article we developed an empirical probability model for tin whisker shorting. In this paper, we develop a more comprehensive empirical model using a refined experiment with a larger sample size, in which we studied the effect of varying voltage on the breakdown of the contact resistance which leads to a short circuit. From the resulting data we estimated the probability distribution of an electrical short, as a function of voltage. In addition, the unexpected polycrystalline structure seen in the focused ion beam (FIB) cross section in the first experiment was confirmed in this experiment using transmission electron microscopy (TEM). The FIB was also used to cross section two card guides to facilitate the measurement of the grain size of each card guide's tin plating to determine its finish.
9 CFR 113.315 - Feline Rhinotracheitis Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Feline Rhinotracheitis Vaccine. 113.315 Section 113.315 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... Inspection Service and observed each day for 14 days post-challenge. The rectal temperature of each animal...
9 CFR 113.67 - Erysipelothrix Rhusiopathiae Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Erysipelothrix Rhusiopathiae Vaccine. 113.67 Section 113.67 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the controls by a high body...
19 CFR 113.33 - Corporations as principals.
2010-04-01
... president, treasurer, or secretary of the corporation. The officer's signature shall be prima facie evidence... 19 Customs Duties 1 2010-04-01 2010-04-01 false Corporations as principals. 113.33 Section 113.33 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE...
9 CFR 113.101 - Leptospira Pomona Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Pomona Bacterin. 113.101... Inactivated Bacterial Products § 113.101 Leptospira Pomona Bacterin. Leptospira Pomona Bacterin shall be produced from a culture of Leptospira pomona which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.103 - Leptospira Canicola Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Canicola Bacterin. 113.103... Inactivated Bacterial Products § 113.103 Leptospira Canicola Bacterin. Leptospira Canicola Bacterin shall be produced from a culture of Leptospira canicola which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.105 - Leptospira Hardjo Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Hardjo Bacterin. 113.105... Inactivated Bacterial Products § 113.105 Leptospira Hardjo Bacterin. Leptospira Hardjo Bacterin shall be produced from a culture of Leptospira hardjo which has been inactivated and is nontoxic. Each serial of...
9 CFR 113.65 - Brucella Abortus Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Brucella Abortus Vaccine. 113.65... Bacterial Vaccines § 113.65 Brucella Abortus Vaccine. Brucella Abortus Vaccine shall be prepared as a desiccated live culture bacterial vaccine from smooth colonial forms of the Brucella abortus organism...
9 CFR 113.123 - Salmonella Dublin Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Salmonella Dublin Bacterin. 113.123... Inactivated Bacterial Products § 113.123 Salmonella Dublin Bacterin. Salmonella Dublin Bacterin shall be prepared from a culture of Salmonella dublin which has been inactivated and is nontoxic. Each serial of...
49 CFR 199.113 - Employee assistance program.
2010-10-01
... TESTING Drug Testing § 199.113 Employee assistance program. (a) Each operator shall provide an employee assistance program (EAP) for its employees and supervisory personnel who will determine whether an employee... 49 Transportation 3 2010-10-01 2010-10-01 false Employee assistance program. 199.113 Section 199...
Vanadocene reactions with mixed acylates of silicon, germanium and tin
International Nuclear Information System (INIS)
Latyaeva, V.N.; Lineva, A.N.; Zimina, S.V.; Gordetsov, A.S.; Dergunov, Yu.I.
1981-01-01
Vanadocene interaction with di-and tri-alkyl (aryl)-derivatives of silicon, tin and germanium is studied. Dibutyltin dibenzoate under mild conditions (20 deg C, toluene) oxidates vanadocene to [CpV(OCOC 6 H 5 ) 2 ] 2 , at that, the splitting off of one Cp group in the form of cyclopentadiene and formation of the products of tin-organic fragment disproportionation (tributyltin benzoate, dibutyltin, metallic tin) take place. Tributyltin benzoate oxidates vanadocene at the mole ratio 2:1 and during prolong heating (120 deg C) in the absence of the solvent, [CpV(OCOC 6 H 5 ) 2 ] 2 and hexabutyldistannate are the products of the reaction. Acetates R 3 SnOCOCH 3 react in the similar way. The reactivity of mono- and diacylates of germanium and silicon decreases in the series of derivatives Sn>Ge>Si [ru
Cyclic voltammetric study of tin hexacyanoferrate for aqueous battery applications
Directory of Open Access Journals (Sweden)
Denys Gromadskyi
2016-09-01
Full Text Available A hybrid composite containing 65 mass % of tin hexacyanoferrate mixed with 35 mass % of carbon nanotubes has been synthesized and its electrochemical behavior as a negative electrode in alkali metal-ion batteries has been studied in 1 mol L-1 aqueous solution of sodium sulfate. The specific capacity of pure tin hexacyanoferrate is 58 mAh g-1, whereas the specific capacity normalized per total electrode mass of the composite studied reaches 34 mAh g-1. The estimated maximal specific power of an aqueous alkali-metal ion battery with a tin hexacyanoferrate electrode is ca. 3.6 kW kg-1 being comparable to characteristics of industrial electric double-layer capacitors. The maximal specific energy accumulated by this battery may reach 25.6 Wh kg-1 at least three times exceeding the specific energy for supercapacitors.
Recovery of antimony-125 from tin-124 irradiated by neutrons
International Nuclear Information System (INIS)
Baluev, A.V.; Mityakhina, V.S.; Krasnikov, L.V.; Galkin, B.Ya.; Besnosyuk, V.I.
2003-01-01
Separation of 125 Sb from tin using highly basic, medium-basic, and weakly basic ion-exchangers was studied. The best results were obtained for AN-31 weakly basic anion exchanger. The yield of 125 Sb was 95 -98 % of the initial activity, the yield of tin, 98 ± 0.5% of the initial amount. The separation coefficient is 10 6 -10 7 for one cycle. A procedure based on ion exchange was developed. Extraction procedures of separation of 125 Sb from tin were studied. Isoamyl alcohol, ethyl acetate, and di-n-butyl ether were used as extracting agents. The most efficient extracting agent is di-n-butyl ether. Carrier-free radiochemically pure sample of 125 Sb was produced. More than 20 mCi of the target product was recovered. The extraction recovery procedure of 125 Sb has been developed. (author)
Technical problems associated with the production of technetium Tc 99m tin(II) pyrophosphate kits
International Nuclear Information System (INIS)
Kowalsky, R.J.; Dalton, D.R.
1981-01-01
The amount of tin(II) required for adequate reduction, complexation, and stability of technetium Tc 99m pertechnetate in radiopharmaceutical kits, and methods of preventing the loss of tin(II) during formulation of these lyophilized kits are investigated. Tin(II) loss from stannous chloride solutions was studied under several conditions, including room air versus nitrogen atmospheres, during vial filling in a laminar-flow hood with samples frozen on dry ice versus samples at room temperature, during lyophilization, and during storage under refrigerated, ambient, and elevated temperatures. Various amounts of stannous chloride, ranging from 5 to 1000 microgram/ml, were used in formulating sodium pertechnetate Tc 99m kits containing 100 mCi technetium Tc 99m and 0.4 microgram total technetium. Samples were removed at various times; hydrolyzed technetium, pertechnetate, and technetium Tc 99m pyrophosphate were isolated on instant thin-layer chromatography-silica gel and quantified with a scintillation counter. The time necessary to deoxygenate distilled water by nitrogen purging was measured. Several sources of stannous chloride were assayed for tin(II) content. Tin(II) loss occurs rapidly in solution (15% in one hour) unless continuously protected with nitrogen, and during vial filling in a laminar-flow hood unless frozen with dry ice. No substantial loss of tin(II) was detected during lyophilization or during storage of lyophilized product at any of the three temperatures. A minimum of 400 microgram tin(II) was required to provide 90% technetium Tc 99m pyrophosphate at six hours after preparation. Adequate deoxygenation of small quantities (450 ml) of water was accomplished in less than one hour. Some stannous chloride salts were highly oxidized in the dry state, and only high-purity elemental tin wire gave acceptable yields of tin
A Study on Liver Scan using 113mIn Colloid
International Nuclear Information System (INIS)
Koh, Chang Soon; Rhee, Chong Hoen; Chang, Kochang; Hong, Chang Gi
1969-01-01
There have been reported numberous cases of liver scanning in use of 198 Au colloid by many investigators, however, one in use of 113m In colloid has not been reported as yet in this country. The dose of 113 mIn for high diagnostic value in examination of each organ was determined and the diagnostic interpretability of liver scanning with the use of 113m In was carefully evaluated in comparison with the results of the liver scanning by the conventionally applied radioisotope. The comparative study of both figures of liver scanning with the use of 113m In colloid and 198 Au colloid delivered following results:1) The liver uptake rate and clearance into peripheral blood were accentuated more in case of 113m In colloid than in case of 198 Au colloid. 2) The interpretability of space occupying lesion in liver scanning with 113m In was also superior to one with 198 Au. 3) The figure of liver scanning with 113m In colloid corresponds not always to the figure with 198 Au. This difference can be explained by difference of phagocytic ability of reticuloendothelial system within liver. 4) In the liver scanning with 113m In colloid, the spleen is also visualized even in normal examine. 5) In the cases of disturbed liver function, uptake is more decreased in use of 113m In colloid than in 198 Au, in the spleen, however, the way is contrary. 6) With use of 113m In colloid, the time required for scanning could be shortened in comparison with 198 Au. 7) The filtration of 113m In colloid for scanning prior to human administration gives an expectation for better scanning figure.
Concentrations of /sup 113m/Cd in the marine environment
Energy Technology Data Exchange (ETDEWEB)
Noshkin, V.E.; Wong, K.M.; Eagle, R.J.; Anglin, D.L.
1980-09-18
Reports on the detection of /sup 113m/Cd in any type of environmental sample have been rare. The 113 mass chain yield is small relative to other longer-lived fission products, such as /sup 90/Sr and /sup 137/Cs, produced from uranium, plutonium and thorium fissions. Also, only a small fraction of the 113 chain yield decays to /sup 113m/Cd. Salter estimated that the /sup 113m/Cd//sup 90/Sr activity quotient in thermonuclear fission should be 0.003. He stated that this ratio is in good agreement with data from a few samples measured in the northern hemisphere prior to 1962 which have no /sup 109/Cd. This, to our knowledge, was the first report of the detection of fission-produced /sup 113m/Cd in the environment. Salter also calculated that 0.062 MCi of /sup 113m/Cd and 0.25 MCi of /sup 109/Cd were produced by activation during the atmospheric detonation of the 1.4-megaton Starfish device on 9 July 1962 over Johnston Atoll. As both /sup 109/Cd and /sup 113m/Cd are produced during neutron activation of stable cadmium, and /sup 109/Cd is not a fission product, the last part of Salter's statement is significant. The absence of /sup 109/Cd in samples collected before 1962 indicates that all nuclear testing before this time, which included all tests conducted at Enewetak and Bikini Atolls in the Marshall Islands, could have generated /sup 113m/Cd only as a fission product. It is therefore important to recognize that /sup 113m/Cd could be present in other environments contaminated with fission product wastes discharged to the aquatic environment from other nuclear facilities. /sup 113m/Cd has a half life of 14.6 +- 0.1 y and decays predominantly by beta-particle emission. We present here a preliminary report of /sup 113m/Cd concentrations measured in sediment and tissue samples of marine organisms collected around different atolls in the Marshall Islands.
Sangami, G; Dharmaraj, N
2012-11-01
Nanocrystalline, tin(IV) oxide (SnO(2)) particles has been prepared by thermal decomposition of tin oxalate precursor obtained from the reactions of tin(IV) chloride and sodium oxalate using eggshell membrane (ESM). The as-prepared SnO(2) nanoparticles were characterized by thermal studies, transmission electron microscopy (TEM), powder X-ray diffraction (XRD), Raman, FT-IR and UV-visible studies and used as a photocatalyst for the degradation of rhodamine-B (Rh-B) dye. The size of the prepared nanoparticles was in the range of 5-12nm as identified from the TEM images. Powder XRD data revealed the presence of a tetragonal, rutile crystalline phase of the tin(IV) oxide nanoparticles. Thermal analysis showed that the decomposition of tin oxalate precursor to yield the titled tin(IV) oxide nanoparticles was completed below 500°C. The extent of degradation of Rh-B in the presence of SnO(2) monitored by absorption spectral measurements demonstrated that 94.48% of the selected dye was degraded upon irradiation with UV light for 60 min. Copyright © 2012 Elsevier B.V. All rights reserved.
Preparation of tin -heparin complex to be applied for myocardial infarct diagnosis
International Nuclear Information System (INIS)
Badi, J. M.; Al-Azzawi, H. A.; Resen, H. M.; Abed, I. G.; Owiad, H.; Manji, A. N.
2012-12-01
Tin-heparin complex has been prepared (liquid form) to be labeled with technetium-99 can be applied for diagnosis of myocardial infarcts vascular diseases and deep vein thrombosis. The preparation contents are 0.1mg tin chloride dehydrate and 1250 1.U of heparin. The results of the pH effect on the labeling yield indicated that high percentage of labeling yield (96.1%) was obtained in the optimal pH (5.50). The obtained results showed that the quantity of reducing agent (tin chloride dehydrate) and chelating agent (heparin) has no effect on the labeling yield. Results of radio analytical studies by paper chromatography technique wear confirmed by data obtained by Gel chromatography column scanning techniques. These techniques showed the high labeling yield of the tin-heparin complex. The persistence of high labeling yield for 8 hours is a good indication for its stability and efficiency for radio diagnosis examination in nuclear medicine centers. (Author)
9 CFR 113.329 - Newcastle Disease Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Newcastle Disease Vaccine. 113.329 Section 113.329 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF.... Challenge virus shall be provided or approved by Animal and Plant Health Inspection Service. (4) If at least...
9 CFR 113.106 - Clostridium Chauvoei Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Chauvoei Bacterin. 113.106 Section 113.106 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF... Animal and Plant Health Inspection Service, shall be used for challenge 14 to 15 days following the last...
9 CFR 113.107 - Clostridium Haemolyticum Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Clostridium Haemolyticum Bacterin. 113.107 Section 113.107 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT... challenge 14 to 15 days following the last injection of the product. Each of eight vaccinates and each of...
9 CFR 113.306 - Canine Distemper Vaccine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Canine Distemper Vaccine. 113.306... Virus Vaccines § 113.306 Canine Distemper Vaccine. Canine Distemper Vaccine shall be prepared from virus... distemper virus, each of five canine distemper susceptible ferrets shall be injected with a sample of the...
9 CFR 113.302 - Distemper Vaccine-Mink.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Distemper Vaccine-Mink. 113.302... Virus Vaccines § 113.302 Distemper Vaccine—Mink. Distemper Vaccine—Mink shall be prepared from virus... follows: (1) To detect virulent canine distemper virus, each of two distemper susceptible mink or ferrets...
X-ray radiometric separation of low-grade tin ores
Energy Technology Data Exchange (ETDEWEB)
Kotler, N.I.; Neverov, A.D.; Konovalov, V.M.; Mironov, I.I.; Zakharov, S.N.
1984-10-01
The investigations on evaluation of X-ray radiometric separation of off-grade tin ores of one of the deposits are carried out. The experiments have been performed at loboratory and pilot-commerical plants. /sup 241/Am has been used as a radiation source. In the course of facility commercial the ore has been separated by means of a device comprising a separator and gate separatin device. The results of X-ray radiometric separation have shown its high productive efficiency. Concentrates with higher tin content at high extraction from ores are obtained.
X-ray radiometric separation of low-grade tin ores
International Nuclear Information System (INIS)
Kotler, N.I.; Neverov, A.D.; Konovalov, V.M.; Mironov, I.I.; Zakharov, S.N.
1984-01-01
The investigations on evaluation of X-ray radiometric separation of off-grade tin ores of one of the deposits are carried out. The experiments have been performed at loboratory and pilot-commerical plants. 241 Am has been used as a radiation source. In the course of facility commercial the ore has been separated by means of a device comprising a separator and gate separatin device. The results of X-ray radiometric separation have shown its high productive efficiency. Concentrates with higher tin content at high extraction from ores are obtained
Electrolytic preparation of sup(99m)Tc human serum albumin using tin electrodes
International Nuclear Information System (INIS)
Narasimhan, D.V.S.; Mani, R.S.
1975-01-01
A method for labelling human serum albumin [HSA] with sup(99m)Tc using electrolytically generated Sn/II/ ions has been developed. The procedure uses Sn electrodes for electrolysis and gives high labelling yields. The amount of Sn released into the final product was found to be much less than the reported toxic levels. A ready-to-use kit for obtaining sterile sup(99m)Tc HSA is described. Tin metal wires sealed in aluminium were irradiated in a CIRUS reactor at a neutron flux of 7.5x10 12 n cm -2 sec -1 for one month. The 113 Sn produced in the wire was used for tracer studies with the electrolitically labelled HSA. sup(99m)Tc in the form sodium pertechnetate in 0.9% NaCl was obtained by methyl ethyl ketone extraction from alkaline solutions of neutron irradiated 99 Mo [specific activity 50-200 mCi/g] in the solvent extraction generator developed at Isotope Division, BARC. Radiochemical purity analysis of sup(99m)Tc labelled HSA prepared by the above procedure was carried out by ascending paper chromatography on Whatman No.1 paper, and 85% methanol and 0.9% sodium chloride as solvents. (F.Gy.)
Tin- and Lead-Based Perovskite Solar Cells under Scrutiny: An Environmental Perspective
DEFF Research Database (Denmark)
Serrano-Luján, Lucía; Espinosa Martinez, Nieves; Larsen-Olsen, Thue Trofod
2015-01-01
The effect of substituting lead with tin in perovskite-based solar cells (PSCs) has shows that lead is preferred over tin by a lower cumulative energy demand. The results, which also include end-of-life management, show that a recycling scenario that carefully handles emission of lead enables use...
The relationship between critical current and microstructure of internal tin wire
International Nuclear Information System (INIS)
Dietderich, D.R.; Hassenzahl, W.V.; Morris, J.W. Jr.
1986-01-01
Prior work on internal tin wire has shown that an increase in critical current results when the Nb 3 Sn reaction temperatures (650-730 0 C) are preceded by low temperature diffusion heat treatments that distribute the tin. These heat treatments produce a more uniform tin distribution through the niobium filament array before substantial Nb 3 Sn formation has occurred. Heat treatments as long as 19 days have been proposed as the optimal heat treatment for the conductor. However, it is possible to substantially reduce the low temperature heat treatment time while retaining the same high critical current. The success of shortened heat treatments may be interpreted on the basis of the Cu-Sn reaction, diffusion kinetics and the Nb 3 Sn growth kinetics
Isotope Dilution - Thermal Ionisation Mass Spectrometric Analysis for Tin in a Fly Ash Material
International Nuclear Information System (INIS)
Hernandez, C.; Fernandez, M.; Quejido, A. L.
2006-01-01
Isotope dilution-thermal ionisation mass spectrometry (ID-TIMS) analysis has been applied to the determination of tin in a fly ash sample supplied by the EC Joint Research Centre (Ispra, Italy). The proposed procedure includes the silica gel/phosphoric acid technique for tin thermal ionisation activation and a strict heating protocol for isotope ratio measurements. Instrumental mass discrimination factor has been previously determined measuring a natural tin standard solution. Spike solutions has been prepared from 112Sn-enriched metal and quantified by reverse isotope dilution analysis. Two sample aliquots were spiked and tin was extracted with 4,5 M HCI during 25 min ultrasound esposure time. Due to the complex matrix of this fly ash material, a two-steps purification stage using ion-exchange chromatography was required prior TIMS analysis. Obtained results for the two sample-spike blends (10,10 + - 0,55 y 10,50 + - 0,64 imolg-1) are comprarable, both value and uncertainty. Also a good reproducibility is observed between measurements. The proposed ID-TIMS procedure, as a primary method and due to the lack of fly ash reference material certified for tin content, can be used to validate more routine methodologies applied to tin determination in this kind of materials. (Author) 75 refs
DEFF Research Database (Denmark)
Xu, Junyuan; Li, Qingfeng; Christensen, Erik
2012-01-01
Proton exchange membrane water electrolysers operating at typically 80 °C or at further elevated temperatures suffer from insufficient catalyst activity and durability. In this work, antimony doped tin oxide nanoparticles were synthesized and further doped with an inorganic proton conducting phase...... based on tin pyrophosphates as the catalyst support. The materials showed an overall conductivity of 0.57 S cm−1 at 130 °C under the water vapor atmosphere with a contribution of the proton conduction. Using this composite support, iridium oxide nanoparticle catalysts were prepared and characterized...
Electronegativity-dependent tin etching from thin films
Energy Technology Data Exchange (ETDEWEB)
Pachecka, M., E-mail: m.pachecka@utwente.nl; Sturm, J. M.; Kruijs, R. W. E. van de; Lee, C. J.; Bijkerk, F. [Industrial Focus Group XUV Optics, MESA+ Institute for Nanotechnology, University of Twente, Drienerlolaan 5, Enschede (Netherlands)
2016-07-15
The influence of a thin film substrate material on the etching of a thin layer of deposited tin (Sn) by hydrogen radicals was studied. The amount of remaining Sn was quantified for materials that cover a range of electronegativities. We show that, for metals, etching depends on the relative electronegativity of the surface material and Sn. Tin is chemically etched from surfaces with an electronegativity smaller than Sn, while incomplete Sn etching is observed for materials with an electronegativity larger than Sn. Furthermore, the amount of remaining Sn increases as the electronegativity of the surface material increases. We speculate, that, due to Fermi level differences in the material’s electronic structure, the energy of the two conduction bands shift such that the availability of electrons for binding with hydrogen is significantly reduced.
IMPROVEMENT OF FATIGUE STRENGTH OF TIN BABBITT BY REINFORCING WITH NANO ILMENITE
Directory of Open Access Journals (Sweden)
M. V. S. BABU
2017-08-01
Full Text Available Tin Babbitt is an idle journal bearing material, its fatigue strength limits and its usage. To enhance its fatigue strength, in this paper a Tin Babbitt metal matrix is reinforced with nano Ilmenite. The metal matrix nanocomposite was fabricated by using ultrasonic assisted stir casting technique. ASTM standards in statistical planning for fatigue testing were employed in planning the fatigue tests. Fatigue tests were conducted at three stress levels, i.e., 0.9 UTS, 0.7 UTS and 0.5 UTS. Tests were conducted on a rotating-beam type fatigue testing machine. It was observed that the nano Ilmenite reinforcement enhanced the fatigue strength of Tin Babbitt.
An Investigation of the Electrical Short Circuit Characteristics of Tin Whiskers
Courey, Karim J.
2008-01-01
Existing risk simulations make the assumption that when a free tin whisker has bridged two adjacent exposed electrical conductors, the result is an electrical short circuit. This conservative assumption is made because shorting is a random event that has a currently unknown probability associated with it. Due to contact resistance electrical shorts may not occur at lower voltage levels. In this experiment, we study the effect of varying voltage on the breakdown of the contact resistance which leads to a short circuit. From this data we can estimate the probability of an electrical short, as a function of voltage, given that a free tin whisker has bridged two adjacent exposed electrical conductors. Also, three tin whiskers grown from the same Space Shuttle Orbiter card guide used in the aforementioned experiment were cross-sectioned and studied using a focused ion beam (FIB). The rare polycrystalline structure seen in the FIB cross section was confirmed using transmission electron microscopy (TEM). The FIB was also used to cross section two card guides to facilitate the measurement of the grain size to determine that the tin plating on the card guides had a bright finish.
Experimental study on TiN coated racetrack-type ceramic pipe
Wang, Jie; Xu, Yan-Hui; Zhang, Bo; Wei, Wei; Fan, Le; Pei, Xiang-Tao; Hong, Yuan-Zhi; Wang, Yong
2015-11-01
TiN film was coated on the internal surface of a racetrack-type ceramic pipe by three different methods: radio-frequency sputtering, DC sputtering and DC magnetron sputtering. The deposition rates of TiN film under different coating methods were compared. The highest deposition rate was 156 nm/h, which was obtained by magnetron sputtering coating. Based on AFM, SEM and XPS test results, the properties of TiN film, such as film roughness and surface morphology, were analyzed. Furthermore, the deposition rates were studied with two different cathode types, Ti wires and Ti plate. According to the SEM test results, the deposition rate of TiN/Ti film was about 800 nm/h with Ti plate cathode by DC magnetron sputtering. Using Ti plate cathode rather than Ti wire cathode can greatly improve the film deposition rate. Supported by National Nature Science Foundation of China (11075157)
Process for Making a Noble Metal on Tin Oxide Catalyst
Davis, Patricia; Miller, Irvin; Upchurch, Billy
2010-01-01
To produce a noble metal-on-metal oxide catalyst on an inert, high-surface-area support material (that functions as a catalyst at approximately room temperature using chloride-free reagents), for use in a carbon dioxide laser, requires two steps: First, a commercially available, inert, high-surface-area support material (silica spheres) is coated with a thin layer of metal oxide, a monolayer equivalent. Very beneficial results have been obtained using nitric acid as an oxidizing agent because it leaves no residue. It is also helpful if the spheres are first deaerated by boiling in water to allow the entire surface to be coated. A metal, such as tin, is then dissolved in the oxidizing agent/support material mixture to yield, in the case of tin, metastannic acid. Although tin has proven especially beneficial for use in a closed-cycle CO2 laser, in general any metal with two valence states, such as most transition metals and antimony, may be used. The metastannic acid will be adsorbed onto the high-surface-area spheres, coating them. Any excess oxidizing agent is then evaporated, and the resulting metastannic acid-coated spheres are dried and calcined, whereby the metastannic acid becomes tin(IV) oxide. The second step is accomplished by preparing an aqueous mixture of the tin(IV) oxide-coated spheres, and a soluble, chloride-free salt of at least one catalyst metal. The catalyst metal may be selected from the group consisting of platinum, palladium, ruthenium, gold, and rhodium, or other platinum group metals. Extremely beneficial results have been obtained using chloride-free salts of platinum, palladium, or a combination thereof, such as tetraammineplatinum (II) hydroxide ([Pt(NH3)4] (OH)2), or tetraammine palladium nitrate ([Pd(NH3)4](NO3)2).
Gap enhancement in phonon-irradiated superconducting tin films
International Nuclear Information System (INIS)
Miller, N.D.; Rutledge, J.E.
1982-01-01
We have measured the current-voltage (I-V) characteristics of tin-tin tunnel junctions driven out of equilibrium by a flux of near-thermal phonons from a heater. The reduced ambient temperature was T/T/sub c/ = 0.41. The nonequilibrium I-V curves are compared to equilibrium thermal I-V curves at an elevated temperature chosen to match the total number of quasiparticles. The nonequilibrium curves show a smaller current near zero bias and a larger gap than the thermal curves. This is the first experimental evidence of phonon-induced gap enhancement far below T/sub c/. The results are discussed in terms of the coupled kinetic equations of Chang and Scalapino
TDPAC characterization of tin oxides using 181Ta
International Nuclear Information System (INIS)
Moreno, M.S.; Desimoni, J.; Requejo, F.G.; Renteria, M.; Bibiloni, A.G.
1991-01-01
In connection with a general study of the evolution of tin-oxygen thin films, we report here on the hyperfine interactions of 181 Ta substitutionally replacing tin in the isolated phases SnO and SnO 2 . For this purpose, pure SnO pressed powder and a thin SnO 2 film were implanted with 181 Hf. In both cases, unique quadrupole frequencies were found after thermal annealing treatments. The results indicate that the following hyperfine parameters: ν Q =740.6(2.1) MHz, η=0.07(2) and ν Q =971.5(1.9) MHz, η=0.72(1) characterize 181 Ta and SnO and SnO 2 , respectively. (orig.)
Investigations on the indium-113m isotope generators
International Nuclear Information System (INIS)
Oniciu, L.; Veglia, A.
1975-01-01
Methods for the determination of sup(113Sn) in the eluate of an sup(113m)In generator are proposed. The techniques for the chemical and radionuclidic purity analysis of the eluate are also described: colorimetry, gamma-ray spectrometry, thin-film chromatography, and electrophoretic separation were used. Two generators of different origins were studied. The presence of the isotopes sup(113)Sn, sup(125)Sb, sup(125m)Te, and the elements Zr, Si and Fe were detected in the eluate. Recommendations for the use of these isotope cows are made. (G.Gy.)
13 CFR 113.3-3 - Structural accommodations for handicapped clients.
2010-01-01
... handicapped clients. 113.3-3 Section 113.3-3 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... ADMINISTRATOR General Provisions § 113.3-3 Structural accommodations for handicapped clients. (a) Existing... by handicapped clients. Where structural changes are necessary to make the recipient's goods or...
Moessbauer and NMR study of novel Tin(IV)-lactames
Energy Technology Data Exchange (ETDEWEB)
Kuzmann, Erno; Szalay, Roland; Homonnay, Zoltan, E-mail: homonnay@ludens.elte.hu; Nagy, Sandor [Eoetvoes Lorand University, Institute of Chemistry (Hungary)
2012-03-15
N-tributylstannylated 2-pyrrolidinone was reacted with tributyltin triflate in different molar ratios and the complex formation monitored using {sup 1}H-NMR, {sup 13}C-NMR and {sup 119}Sn Moessbauer spectroscopy. Comparing the carbon NMR and tin Moessbauer results, a reaction scheme is suggested for the complexation which assumes the formation of a simultaneously O- and N-tributylstannylated pyrrolidinone cation. The formation of the only O-stannylated pyrrolidinone is also assumed to account for the non-constant Moessbauer parameters of the two tin environments in the distannylated pyrrolidinone cation when the ratio of tributyltin triflate is increased in the reaction.
Comparative Analysis of Data Structures for Storing Massive Tins in a Dbms
Kumar, K.; Ledoux, H.; Stoter, J.
2016-06-01
Point cloud data are an important source for 3D geoinformation. Modern day 3D data acquisition and processing techniques such as airborne laser scanning and multi-beam echosounding generate billions of 3D points for simply an area of few square kilometers. With the size of the point clouds exceeding the billion mark for even a small area, there is a need for their efficient storage and management. These point clouds are sometimes associated with attributes and constraints as well. Storing billions of 3D points is currently possible which is confirmed by the initial implementations in Oracle Spatial SDO PC and the PostgreSQL Point Cloud extension. But to be able to analyse and extract useful information from point clouds, we need more than just points i.e. we require the surface defined by these points in space. There are different ways to represent surfaces in GIS including grids, TINs, boundary representations, etc. In this study, we investigate the database solutions for the storage and management of massive TINs. The classical (face and edge based) and compact (star based) data structures are discussed at length with reference to their structure, advantages and limitations in handling massive triangulations and are compared with the current solution of PostGIS Simple Feature. The main test dataset is the TIN generated from third national elevation model of the Netherlands (AHN3) with a point density of over 10 points/m2. PostgreSQL/PostGIS DBMS is used for storing the generated TIN. The data structures are tested with the generated TIN models to account for their geometry, topology, storage, indexing, and loading time in a database. Our study is useful in identifying what are the limitations of the existing data structures for storing massive TINs and what is required to optimise these structures for managing massive triangulations in a database.
21 CFR 189.301 - Tin-coated lead foil capsules for wine bottles.
2010-04-01
... 21 Food and Drugs 3 2010-04-01 2009-04-01 true Tin-coated lead foil capsules for wine bottles. 189... SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION (CONTINUED) SUBSTANCES PROHIBITED FROM USE IN HUMAN FOOD... lead foil capsules for wine bottles. (a) Tin-coated lead foil is composed of a lead foil coated on one...
Tin( ii ) ketoacidoximates: synthesis, X-ray structures and processing to tin( ii ) oxide
Khanderi, Jayaprakash
2015-10-21
Tin(ii) ketoacidoximates of the type [HONCRCOO]Sn (R = Me 1, CHPh 2) and (MeONCMeCOO)Sn] NH·2HO 3 were synthesized by reacting pyruvate- and hydroxyl- or methoxylamine RONH (R = H, Me) with tin(ii) chloride dihydrate SnCl·2HO. The single crystal X-ray structure reveals that the geometry at the Sn atom is trigonal bipyramidal in 1, 2 and trigonal pyramidal in 3. Inter- or intramolecular hydrogen bonding is observed in 1-3. Thermogravimetric (TG) analysis shows that the decomposition of 1-3 to SnO occurs at ca. 160 °C. The evolved gas analysis during TG indicates complete loss of the oximato ligand in one step for 1 whereas a small organic residue is additionally removed at temperatures >400 °C for 2. Above 140 °C, [HONC(Me)COO]Sn (1) decomposes in air to spherical SnO particles of size 10-500 nm. Spin coating of 1 on Si or a glass substrate followed by heating at 200 °C results in a uniform film of SnO. The band gap of the produced SnO film and nanomaterial was determined by diffuse reflectance spectroscopy to be in the range of 3.0-3.3 eV. X-ray photoelectron spectroscopy indicates surface oxidation of the SnO film to SnO in ambient atmosphere.
48 CFR 18.113 - Interagency acquisitions under the Economy Act.
2010-10-01
... 48 Federal Acquisition Regulations System 1 2010-10-01 2010-10-01 false Interagency acquisitions under the Economy Act. 18.113 Section 18.113 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACTING METHODS AND CONTRACT TYPES EMERGENCY ACQUISITIONS Available Acquisition Flexibilities 18.113 Interagency acquisitions under...
40 CFR 63.113 - Process vent provisions-reference control technology.
2010-07-01
... § 63.113 Process vent provisions—reference control technology. (a) The owner or operator of a Group 1... 40 Protection of Environment 9 2010-07-01 2010-07-01 false Process vent provisions-reference control technology. 63.113 Section 63.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY...
9 CFR 113.64 - General requirements for live bacterial vaccines.
2010-01-01
... bacterial vaccines. 113.64 Section 113.64 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Live Bacterial Vaccines § 113.64 General requirements for live bacterial vaccines... bacterial vaccine shall meet the requirements in this section. (a) Purity test. Final container samples of...
Cho, Young-Sang; Hong, Jeong-Jin; Yang, Seung-Man; Choi, Chul-Jin
2010-08-01
Stable dispersion of colloidal indium tin oxide nanoparticles was prepared by using indium tin oxide nanopowder, organic solvent, and suitable dispersants through attrition process. Various comminution parameters during the attrition step were studied to optimize the process for the stable dispersion of indium tin oxide sol. The transparent and conductive films were fabricated on glass substrate using the indium tin oxide sol by spin coating process. To obtain antireflective function, partially hydrolyzed alkyl silicate was deposited as over-coat layer on the pre-fabricated indium tin oxide film by spin coating technique. This double-layered structure of the nanostructured film was characterized by measuring the surface resistance and reflectance spectrum in the visible wavelength region. The final film structure was enough to satisfy the TCO regulations for EMI shielding purposes.
Determination of tin, chromium, cadmium and lead in canned fruits from the Czech market
Directory of Open Access Journals (Sweden)
Pavel Diviš
2017-01-01
Full Text Available The global production of metal cans is more than 300 billion cans. Benefits of metal packaging consist mainly from the great strenght, excellent barrier properties and good thermal conductivity. The main problem of used metal packaging are the corrosion processes. The corrosion of metal container causes dissolution of tin which is used as a protective layer of the steel shell of the can and other metallic elements used in the manufacture of cans. In this work 31 samples of canned fruit was analysed and the concentration of tin, chromium, cadmium and lead was determined in fruit and in syrup using ICP-OES and ICP-MS techniques. The results showed no difference between the concentration of analysed elements in fruit and in syrup. In none of the analyzed samples the permitted maximum concentration of tin 200 mg.kg-1 was exceeded. Maximum concentration of tin was measured in canned grepfruit (59.8 ±1.9 mg.kg-1. The age of cans had no significant effect on the concentration of tin in canned fruit. The concentration of tin in fruit packaged in cans with protective layer of lacquer was significantly lower than the concentration of tin in fruit packaged in cans without protective layer of lacquer. Concentration of chromium, cadmium and lead in the analysed samples was very low at the natural levels of occurrence of these metals in fruit and it was impossible to determine unequivocally that the measured concentrations of these metals in canned fruit originate from the corrosion of can. The corrosion of the tinplate was studied using scanning electron microscopy with an energy dispersive spectrometer. By analyzing the SEM pictures and EDS spectra, critical areas of tin plate corrosion were observed. Based on the measured results it can be concluded that the consumption of fresh canned fruit is not a major problem for the inhabitants of the Czech Republic in terms of intake of potentially hazardous metals.
International Nuclear Information System (INIS)
Shi, Xingling; Xu, Lingli; Le, Thi Bang; Zhou, Guanghong; Zheng, Chuanbo; Tsuru, Kanji; Ishikawa, Kunio
2016-01-01
Dental implants made of pure titanium suffer from abrasion and scratch during routine oral hygiene procedures. This results in an irreversible surface damage, facilitates bacteria adhesion and increases risk of peri-implantitis. To overcome these problems, titanium nitride (TiN) coating was introduced to increase surface hardness of pure titanium. However, the osteoconductivity of TiN is considered to be similar or superior to that of titanium and its alloys and therefore surface modification is necessary. In this study, TiN coating prepared through gas nitriding was partially oxidized by hydrothermal (HT) treatment and ozone (O 3 ) treatment in pure water to improve its osteoconductivity. The effects of HT treatment and O 3 treatment on surface properties of TiN were investigated and the osteoconductivity after undergoing treatment was assessed in vitro using osteoblast evaluation. The results showed that the critical temperature for HT treatment was 100 °C since higher temperatures would impair the hardness of TiN coating. By contrast, O 3 treatment was more effective in oxidizing TiN surfaces, improving its wettability while preserving its morphology and hardness. Osteoblast attachment, proliferation, alkaline phosphatase (ALP) expression and mineralization were improved on oxidized specimens, especially on O 3 treated specimens, compared with untreated ones. These effects seemed to be consequences of partial oxidation, as well as improved hydrophilicity and surface decontamination. Finally, it was concluded that, partially oxidized TiN is a promising coating to be used for dental implant. - Highlights: • TiN coating surface was oxidized by hydrothermal or ozone treatment while preserving its hardness. • Improved wettability, decontamination and interstitial N promoted osteoblast responses. • Partial oxidation makes TiN a promising coating for dental implant with good osteoconductivity.
Energy Technology Data Exchange (ETDEWEB)
Shi, Xingling [School of Material Science and Engineering, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Department of Biomaterials, Faculty of Dental Science, Kyushu University, Fukuoka 812-8582 (Japan); Jiangsu Provincial Key Laboratory for Interventional Medical Devices, Huaiyin Institute of Technology, Huaian 223003 (China); Xu, Lingli, E-mail: linly311@163.com [School of Material Science and Engineering, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Le, Thi Bang [Department of Mechanical Engineering, University of Malaya, 50603 Kuala Lumpur (Malaysia); Zhou, Guanghong [Jiangsu Provincial Key Laboratory for Interventional Medical Devices, Huaiyin Institute of Technology, Huaian 223003 (China); Zheng, Chuanbo, E-mail: zjust316@163.com [School of Material Science and Engineering, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Tsuru, Kanji; Ishikawa, Kunio [Department of Biomaterials, Faculty of Dental Science, Kyushu University, Fukuoka 812-8582 (Japan)
2016-02-01
Dental implants made of pure titanium suffer from abrasion and scratch during routine oral hygiene procedures. This results in an irreversible surface damage, facilitates bacteria adhesion and increases risk of peri-implantitis. To overcome these problems, titanium nitride (TiN) coating was introduced to increase surface hardness of pure titanium. However, the osteoconductivity of TiN is considered to be similar or superior to that of titanium and its alloys and therefore surface modification is necessary. In this study, TiN coating prepared through gas nitriding was partially oxidized by hydrothermal (HT) treatment and ozone (O{sub 3}) treatment in pure water to improve its osteoconductivity. The effects of HT treatment and O{sub 3} treatment on surface properties of TiN were investigated and the osteoconductivity after undergoing treatment was assessed in vitro using osteoblast evaluation. The results showed that the critical temperature for HT treatment was 100 °C since higher temperatures would impair the hardness of TiN coating. By contrast, O{sub 3} treatment was more effective in oxidizing TiN surfaces, improving its wettability while preserving its morphology and hardness. Osteoblast attachment, proliferation, alkaline phosphatase (ALP) expression and mineralization were improved on oxidized specimens, especially on O{sub 3} treated specimens, compared with untreated ones. These effects seemed to be consequences of partial oxidation, as well as improved hydrophilicity and surface decontamination. Finally, it was concluded that, partially oxidized TiN is a promising coating to be used for dental implant. - Highlights: • TiN coating surface was oxidized by hydrothermal or ozone treatment while preserving its hardness. • Improved wettability, decontamination and interstitial N promoted osteoblast responses. • Partial oxidation makes TiN a promising coating for dental implant with good osteoconductivity.
Obtainment of SnO2 for utilization of sensors by coprecipitation of tin salts
International Nuclear Information System (INIS)
Masetto, S.R.; Longo, E.
1990-01-01
Niobia doped tin dioxide was prepared by precipitation of tin dioxide II and IV using ammonium hydroxide. The powders were characterized by X-ray diffraction, particle size distribution and infra-red spectroscopy. (author) [pt
Atomic-layer chemical-vapor-deposition of TiN thin films on Si(100) and Si(111)
Kim, Y S; Kim, Y D; Kim, W M
2000-01-01
An atomic-layer chemical vapor deposition (AL-CVD) system was used to deposit TiN thin films on Si(100) and Si(111) substrates by cyclic exposures of TiCl sub 4 and NH sub 3. The growth rate was measured by using the number of deposition cycles, and the physical properties were compared with those of TiN films grown by using conventional deposition methods. To investigate the growth mechanism, we suggest a growth model for TiN n order to calculate the growth rate per cycle with a Cerius program. The results of the calculation with the model were compared with the experimental values for the TiN film deposited using the AL-CVD method. The stoichiometry of the TiN film was examined by using Auger electron spectroscopy, and the chlorine and the oxygen impurities were examined. The x-ray diffraction and the transmission electron microscopy results for the TiN film exhibited a strong (200) peak and a randomly oriented columnar microstructure. The electrical resistivity was found to decrease with increasing deposit...
The effect of tin sulfide quantum dots size on photocatalytic and photovoltaic performance
Energy Technology Data Exchange (ETDEWEB)
Cheraghizade, Mohsen [Young Researchers and Elite Club, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Jamali-Sheini, Farid, E-mail: faridjamali@iauahvaz.ac.ir [Advanced Surface Engineering and Nano Materials Research Center, Department of Physics, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Yousefi, Ramin [Department of Physics, Masjed-Soleiman Branch, Islamic Azad University (I.A.U), Masjed-Soleiman (Iran, Islamic Republic of); Niknia, Farhad [Young Researchers and Elite Club, Ahvaz Branch, Islamic Azad University, Ahvaz (Iran, Islamic Republic of); Mahmoudian, Mohammad Reza [Department of Chemistry, Shahid Sherafat, University of Farhangian, 15916, Tehran (Iran, Islamic Republic of); Sookhakian, Mehran [Centre for Ionic Liquids, Department of Chemistry, Faculty of Science, University of Malaya, Kuala Lumpur 50603 (Malaysia)
2017-07-01
In the current study, tin sulfide Quantum Dots (QDs) was successfully synthesized through sonochemical synthesis method by applying sonication times of 10, 15, and 20 min. Structural studies showed an orthorhombic phase of SnS and Sn{sub 2}S{sub 3}, and hexagonal phase of SnS{sub 2}. The particle size of tin sulfide QDs prepared through sonication time of 20 min was smaller than other QDs. According to TEM images, an increase in sonication time resulted in smaller spherical shaped particles. According to the results of Raman studies, five Raman bands and a shift towards the lower frequencies were observed by enhancing the sonication time. Based on the outcomes of photocatalytic activity, higher this property was observed for tin sulfide QDs, which are prepared through longer sonication time. Solar cell devices manufactured using tin sulfide QDs have a greater performance for the samples with more sonication time. Considering the obtained outcomes, the sonication time seems probable to be a factor affecting synthesis process of SnS QDs as well as its optical and electrical, photocatalytic, and photovoltaic conversion features. - Highlights: • Tin sulfide quantum dots (QDs) synthesized using a sonication method. • The sonication time was selected as a synthesis parameter. • The photocatalytic and photovoltaic performance were depended on synthesis parameter.
The effect of tin sulfide quantum dots size on photocatalytic and photovoltaic performance
International Nuclear Information System (INIS)
Cheraghizade, Mohsen; Jamali-Sheini, Farid; Yousefi, Ramin; Niknia, Farhad; Mahmoudian, Mohammad Reza; Sookhakian, Mehran
2017-01-01
In the current study, tin sulfide Quantum Dots (QDs) was successfully synthesized through sonochemical synthesis method by applying sonication times of 10, 15, and 20 min. Structural studies showed an orthorhombic phase of SnS and Sn_2S_3, and hexagonal phase of SnS_2. The particle size of tin sulfide QDs prepared through sonication time of 20 min was smaller than other QDs. According to TEM images, an increase in sonication time resulted in smaller spherical shaped particles. According to the results of Raman studies, five Raman bands and a shift towards the lower frequencies were observed by enhancing the sonication time. Based on the outcomes of photocatalytic activity, higher this property was observed for tin sulfide QDs, which are prepared through longer sonication time. Solar cell devices manufactured using tin sulfide QDs have a greater performance for the samples with more sonication time. Considering the obtained outcomes, the sonication time seems probable to be a factor affecting synthesis process of SnS QDs as well as its optical and electrical, photocatalytic, and photovoltaic conversion features. - Highlights: • Tin sulfide quantum dots (QDs) synthesized using a sonication method. • The sonication time was selected as a synthesis parameter. • The photocatalytic and photovoltaic performance were depended on synthesis parameter.
32 CFR Appendix A to Part 113 - Certificate of Compliance
2010-07-01
... 113 National Defense Department of Defense OFFICE OF THE SECRETARY OF DEFENSE PERSONNEL, MILITARY AND CIVILIAN INDEBTEDNESS PROCEDURES OF MILITARY PERSONNEL Pt. 113, App. A Appendix A to Part 113—Certificate... consumer credit transaction to which this form refers. (If the unpaid balance has been adjusted as a...
46 CFR 113.35-9 - Mechanical engine order telegraph systems.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Mechanical engine order telegraph systems. 113.35-9 Section 113.35-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) ELECTRICAL ENGINEERING COMMUNICATION AND ALARM SYSTEMS AND EQUIPMENT Engine Order Telegraph Systems § 113.35-9 Mechanical engine order...
27 CFR 40.113 - Change in location to another region.
2010-04-01
... another region. 40.113 Section 40.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND... Products Changes in Location of Factory § 40.113 Change in location to another region. Whenever a manufacturer of tobacco products intends to remove his factory to another region, the manufacturer shall...
Courey, Karim J.; Asfour, Shihab S.; Onar, Arzu; Bayliss, Jon A.; Ludwig, Larry L.; Wright, Maria C.
2009-01-01
To comply with lead-free legislation, many manufacturers have converted from tin-lead to pure tin finishes of electronic components. However, pure tin finishes have a greater propensity to grow tin whiskers than tin-lead finishes. Since tin whiskers present an electrical short circuit hazard in electronic components, simulations have been developed to quantify the risk of said short circuits occurring. Existing risk simulations make the assumption that when a free tin whisker has bridged two adjacent exposed electrical conductors, the result is an electrical short circuit. This conservative assumption is made because shorting is a random event that had an unknown probability associated with it. Note however that due to contact resistance electrical shorts may not occur at lower voltage levels. In our first article we developed an empirical probability model for tin whisker shorting. In this paper, we develop a more comprehensive empirical model using a refined experiment with a larger sample size, in which we studied the effect of varying voltage on the breakdown of the contact resistance which leads to a short circuit. From the resulting data we estimated the probability distribution of an electrical short, as a function of voltage. In addition, the unexpected polycrystalline structure seen in the focused ion beam (FIB) cross section in the first experiment was confirmed in this experiment using transmission electron microscopy (TEM). The FIB was also used to cross section two card guides to facilitate the measurement of the grain size of each card guide's tin plating to determine its finish.
International Nuclear Information System (INIS)
Shi, Xingling; Xu, Lingli; Munar, Melvin L.; Ishikawa, Kunio
2015-01-01
Dental implant made of pure titanium (Ti) is prone to scratch and abrasion during routine oral hygiene procedures. This results an increase in surface roughness and therefore, facilitates the adhesion of bacteria. In severe cases, this could lead to peri-implantitis. To overcome this problem, surface modification of Ti is necessary to improve its abrasion resistance. Besides, a strong implant–gingiva interface should also be guaranteed to prevent the adhesion of bacteria. In this study, titanium nitride (TiN) coating was first prepared with gas nitriding to increase surface hardness of pure the substrate. Then, the TiN was hydrothermally treated in CaCl 2 solution in order to improve its soft tissue biocompatibility. The effect of hydrothermal treatment temperature on surface properties of TiN was investigated and its biocompatibility was assessed in vitro using NIH3T3 fibroblast cell. It was determined that 120 °C was the critical temperature for the hydrothermal treatment condition. Treatment below 120 °C could incorporate Ca into TiN surface, oxidize TiN surface partially and then improve the wettability while preserving its morphology and hardness. Fibroblast cell attachment and proliferation were improved and cell spreading was enhanced on hydrothermally treated specimens compared with untreated ones. Improved wettability, Ca incorporation and negative surface due to interstitial N were believed to be the main reasons. Hydrothermal treatment is expected to make TiN a promising dental implant coating with excellent abrasion resistance and good soft tissue affinity. - Highlights: • Ca was incorporated into TiN surface while not sacrificing its hardness. • Interstitial N due to oxidation promoted Ca adsorption and cell adhesion. • Hydrothermal treatment makes TiN a promising coating for dental implant
Energy Technology Data Exchange (ETDEWEB)
Shi, Xingling, E-mail: shixingling1985@hotmail.com [School of Material Science and Engineering, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Department of Biomaterials, Faculty of Dental Science, Kyushu University, Fukuoka 812-8582 (Japan); Jiangsu Provincial Key Laboratory for Interventional Medical Devices, Huaiyin Institute of Technology, Huaian 223003 (China); Xu, Lingli [School of Material Science and Engineering, Jiangsu University of Science and Technology, Zhenjiang 212003 (China); Munar, Melvin L.; Ishikawa, Kunio [Department of Biomaterials, Faculty of Dental Science, Kyushu University, Fukuoka 812-8582 (Japan)
2015-04-01
Dental implant made of pure titanium (Ti) is prone to scratch and abrasion during routine oral hygiene procedures. This results an increase in surface roughness and therefore, facilitates the adhesion of bacteria. In severe cases, this could lead to peri-implantitis. To overcome this problem, surface modification of Ti is necessary to improve its abrasion resistance. Besides, a strong implant–gingiva interface should also be guaranteed to prevent the adhesion of bacteria. In this study, titanium nitride (TiN) coating was first prepared with gas nitriding to increase surface hardness of pure the substrate. Then, the TiN was hydrothermally treated in CaCl{sub 2} solution in order to improve its soft tissue biocompatibility. The effect of hydrothermal treatment temperature on surface properties of TiN was investigated and its biocompatibility was assessed in vitro using NIH3T3 fibroblast cell. It was determined that 120 °C was the critical temperature for the hydrothermal treatment condition. Treatment below 120 °C could incorporate Ca into TiN surface, oxidize TiN surface partially and then improve the wettability while preserving its morphology and hardness. Fibroblast cell attachment and proliferation were improved and cell spreading was enhanced on hydrothermally treated specimens compared with untreated ones. Improved wettability, Ca incorporation and negative surface due to interstitial N were believed to be the main reasons. Hydrothermal treatment is expected to make TiN a promising dental implant coating with excellent abrasion resistance and good soft tissue affinity. - Highlights: • Ca was incorporated into TiN surface while not sacrificing its hardness. • Interstitial N due to oxidation promoted Ca adsorption and cell adhesion. • Hydrothermal treatment makes TiN a promising coating for dental implant.
9 CFR 113.300 - General requirements for live virus vaccines.
2010-01-01
... vaccines. 113.300 Section 113.300 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... REQUIREMENTS Live Virus Vaccines § 113.300 General requirements for live virus vaccines. When prescribed in an applicable Standard Requirement or in the filed Outline of Production, a live virus vaccine shall meet the...
13 CFR 113.520 - Job classification and structure.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Job classification and structure. 113.520 Section 113.520 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION... males or for females; (b) Maintain or establish separate lines of progression, seniority lists, career...
In-Situ Growth and Characterization of Indium Tin Oxide Nanocrystal Rods
Directory of Open Access Journals (Sweden)
Yan Shen
2017-11-01
Full Text Available Indium tin oxide (ITO nanocrystal rods were synthesized in-situ by a vapor-liquid-solid (VLS method and electron beam evaporation technique. When the electron-beam gun bombarded indium oxide (In2O3 and tin oxide (SnO2 mixed sources, indium and tin droplets appeared and acted as catalysts. The nanocrystal rods were in-situ grown on the basis of the metal catalyst point. The nanorods have a single crystal structure. Its structure was confirmed by X-ray diffraction (XRD and transmission electron microscopy (TEM. The surface morphology was analyzed by scanning electron microscopy (SEM. During the evaporation, a chemical process was happened and an In2O3 and SnO2 solid solution was formed. The percentage of doped tin oxide was calculated by Vegard’s law to be 3.18%, which was in agreement with the mixture ratio of the experimental data. The single crystal rod had good semiconductor switch property and its threshold voltage of single rod was approximately 2.5 V which can be used as a micro switch device. The transmission rate of crystalline nanorods ITO film was over 90% in visible band and it was up to 95% in the blue green band as a result of the oxygen vacancy recombination luminescence.
9 CFR 113.69 - Pasteurella Multocida Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Multocida Vaccine, Bovine. 113.69 Section 113.69 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Animal and Plant Health Inspection Service. (4) A satisfactory challenge shall be evidenced in the...
21 CFR 211.113 - Control of microbiological contamination.
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Control of microbiological contamination. 211.113 Section 211.113 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL CURRENT GOOD MANUFACTURING PRACTICE FOR FINISHED PHARMACEUTICALS Production and...
Classical and quantum chaotic scattering in a muffin tin potential
International Nuclear Information System (INIS)
Brandis, S.
1995-05-01
In this paper, we study the classical mechanics, the quantum mechanics and the semi-classical approximation of the 2-dimensional scattering from a muffin tin potential. The classical dynamical system for Coulombic muffin tins is proven to be chaotic by explicit construction of the exponentially increasing number of periodic orbits. These are all shown to be completely unstable (hyperbolic). By methods of the thermodynamic formalism we can determine the Hausdorff dimension, escape rate and Kolmogorov-Sinai-entropy of the system. An extended KKR-method is developed to determine the quantum mechanical S-matrix. We compare a few integrable scattering examples with the results of the muffin tin scattering. Characteristic features of the spectrum of eigenphases turn out to be the level repulsion and long range rigidity as compared to a completely random spectrum. In the semiclassical analysis we can rederive the regularized Gutzwiller trace formula directly from the exact KKR-determinant to prove that no further terms contribute in the case of the muffin tin potential. The periodic orbit sum allows to draw some qualitative conclusions about the effects of classical chaos on the quantum mechanics. In the context of scaling systems the theory of almost periodic functions is discussed as a possible mathematical foundation for the semiclassical periodic orbit sums. Some results that can be obtained from this analysis are developed in the context of autocorrelation functions and distribution functions for chaotic scattering systems. (orig.)
International Nuclear Information System (INIS)
Bianco de Salas, G.N.; Arciprete, J.A.; Mitta, A.E.A.
1978-05-01
The preparation of 113 Sn/sup(113m)In generators is described as well as its installation in cell. The chemical and radiochemical controls and the conditions to concentrate the eluate, if necessary, are described in detail. Production and exportation figures are given. (author) [es
International Nuclear Information System (INIS)
Koroesi, Laszlo; Papp, Szilvia; Dekany, Imre
2011-01-01
Indium tin oxide (ITO) thin films with well-controlled layer thickness were produced by dip-coating method. The ITO was synthesized by a sol-gel technique involving the use of aqueous InCl 3 , SnCl 4 and NH 3 solutions. To obtain stable sols for thin film preparation, as-prepared Sn-doped indium hydroxide was dialyzed, aged, and dispersed in ethanol. Polyvinylpyrrolidone (PVP) was applied to enhance the stability of the resulting ethanolic sols. The transparent, conductive ITO films on glass substrates were characterized by X-ray diffraction, scanning electron microscopy and UV-Vis spectroscopy. The ITO layer thickness increased linearly during the dipping cycles, which permits excellent controllability of the film thickness in the range ∼ 40-1160 nm. After calcination at 550 o C, the initial indium tin hydroxide films were transformed completely to nanocrystalline ITO with cubic and rhombohedral structure. The effects of PVP on the optical, morphological and electrical properties of ITO are discussed.
9 CFR 113.68 - Pasteurella Haemolytica Vaccine, Bovine.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Pasteurella Haemolytica Vaccine, Bovine. 113.68 Section 113.68 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE... Service. (4) A satisfactory challenge shall be evidenced in the controls by progression of clinical signs...
9 CFR 113.409 - Tuberculin-PPD Bovis, Intradermic.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Tuberculin-PPD Bovis, Intradermic. 113... REQUIREMENTS Diagnostics and Reagents § 113.409 Tuberculin—PPD Bovis, Intradermic. Tuberculin—PPD Bovis... completed product from each serial shall be subjected to a comparison specificity test using a Reference PPD...
9 CFR 113.206 - Wart Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Wart Vaccine, Killed Virus. 113.206... AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.206 Wart Vaccine, Killed Virus. Wart Vaccine, Killed Virus, shall be prepared...
40 CFR 600.113-78 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-78... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-78 Fuel economy calculations. The...
40 CFR 600.113-88 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-88... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-88 Fuel economy calculations. The...
40 CFR 600.113-93 - Fuel economy calculations.
2010-07-01
... 40 Protection of Environment 29 2010-07-01 2010-07-01 false Fuel economy calculations. 600.113-93... FUEL ECONOMY AND CARBON-RELATED EXHAUST EMISSIONS OF MOTOR VEHICLES Fuel Economy Regulations for 1978 and Later Model Year Automobiles-Test Procedures § 600.113-93 Fuel economy calculations. The...
Effect of gas ratio on tribological properties of sputter deposited TiN coatings
Energy Technology Data Exchange (ETDEWEB)
Chavda, Mahesh R., E-mail: maheshchavda1990@gmail.com [Department of Mechanical Engineering, Dr. Jivraj Mehta Institute of Technology, Mogar-388340 (India); Chauhan, Kamlesh V.; Rawal, Sushant K., E-mail: sushantrawal.me@charusat.ac.in [CHAMOS Matrusanstha Department of Mechanical Engineering, Chandubhai S. Patel Institute of Technology, Charotar University of Science and Technology (CHARUSAT), Changa-388421 (India)
2016-05-06
Titanium nitride (TiN) coatings were deposited on Si, corning glass, pins of mild steel (MS, ϕ3mm), aluminium (Al, ϕ4mm) and brass (ϕ6mm) substratesby DC magnetron sputtering. The argon and nitrogen (Ar:N{sub 2})gas ratio was precisely controlled by Mass Flow Controller (MFC) and was varied systematically at diffract values of 10:10,12:08, 16:04 and 18:02sccm. The structural properties of TiN coatings were characterized by X-ray diffraction (XRD) and its surface topography was studied using field emission scanning electron microscopy (FE-SEM). The tribological properties of TiN coatings were investigated using pin-on-disc tribometer.
Determination of trace amounts of tin in geological materials by atomic absorption spectrometry
Welsch, E.P.; Chao, T.T.
1976-01-01
An atomic absorption method is described for the determination of traces of tin in rocks, soils, and stream sediments. A dried mixture of the sample and ammonium iodide is heated to volatilize tin tetraiodide -which is then dissolved in 5 % hydrochloric acid, extracted into TOPO-MIBK, and aspirated into a nitrous oxide-acetylene flame. The limit of determination is 2 p.p.m. tin and the relative standard deviation ranges from 2 to 14 %. Up to 20 % iron and 1000 p.p.m. Cu, Pb, Zn, Mn, Hg, Mo, V, or W in the sample do not interfere. As many as 50 samples can be easily analyzed per man-day. ?? 1976.
Sputtered tin oxide and titanium oxide thin films as alternative transparent conductive oxides
Energy Technology Data Exchange (ETDEWEB)
Boltz, Janika
2011-12-12
Alternative transparent conductive oxides to tin doped indium oxide have been investigated. In this work, antimony doped tin oxide and niobium doped titanium oxide have been studied with the aim to prepare transparent and conductive films. Antimony doped tin oxide and niobium doped titanium oxide belong to different groups of oxides; tin oxide is a soft oxide, while titanium oxide is a hard oxide. Both oxides are isolating materials, in case the stoichiometry is SnO{sub 2} and TiO{sub 2}. In order to achieve transparent and conductive films free carriers have to be generated by oxygen vacancies, by metal ions at interstitial positions in the crystal lattice or by cation doping with Sb or Nb, respectively. Antimony doped tin oxide and niobium doped titanium oxide films have been prepared by reactive direct current magnetron sputtering (dc MS) from metallic targets. The process parameters and the doping concentration in the films have been varied. The films have been electrically, optically and structurally analysed in order to analyse the influence of the process parameters and the doping concentration on the film properties. Post-deposition treatments of the films have been performed in order to improve the film properties. For the deposition of transparent and conductive tin oxide, the dominant parameter during the deposition is the oxygen content in the sputtering gas. The Sb incorporation as doping atoms has a minor influence on the electrical, optical and structural properties. Within a narrow oxygen content in the sputtering gas highly transparent and conductive tin oxide films have been prepared. In this study, the lowest resistivity in the as deposited state is 2.9 m{omega} cm for undoped tin oxide without any postdeposition treatment. The minimum resistivity is related to a transition to crystalline films with the stoichiometry of SnO{sub 2}. At higher oxygen content the films turn out to have a higher resistivity due to an oxygen excess. After post
Acid-catalyzed kinetics of indium tin oxide etching
Energy Technology Data Exchange (ETDEWEB)
Choi, Jae-Hyeok; Kim, Seong-Oh; Hilton, Diana L. [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Centre for Biomimetic Sensor Science, Nanyang Technological University, 50 Nanyang Drive, 637553 (Singapore); Cho, Nam-Joon, E-mail: njcho@ntu.edu.sg [School of Materials Science and Engineering, Nanyang Technological University, 50 Nanyang Avenue, 639798 (Singapore); Centre for Biomimetic Sensor Science, Nanyang Technological University, 50 Nanyang Drive, 637553 (Singapore); School of Chemical and Biomedical Engineering, Nanyang Technological University, 62 Nanyang Drive, 637459 (Singapore)
2014-08-28
We report the kinetic characterization of indium tin oxide (ITO) film etching by chemical treatment in acidic and basic electrolytes. It was observed that film etching increased under more acidic conditions, whereas basic conditions led to minimal etching on the time scale of the experiments. Quartz crystal microbalance was employed in order to track the reaction kinetics as a function of the concentration of hydrochloric acid and accordingly solution pH. Contact angle measurements and atomic force microscopy experiments determined that acid treatment increases surface hydrophilicity and porosity. X-ray photoelectron spectroscopy experiments identified that film etching is primarily caused by dissolution of indium species. A kinetic model was developed to explain the acid-catalyzed dissolution of ITO surfaces, and showed a logarithmic relationship between the rate of dissolution and the concentration of undisassociated hydrochloric acid molecules. Taken together, the findings presented in this work verify the acid-catalyzed kinetics of ITO film dissolution by chemical treatment, and support that the corresponding chemical reactions should be accounted for in ITO film processing applications. - Highlights: • Acidic conditions promoted indium tin oxide (ITO) film etching via dissolution. • Logarithm of the dissolution rate depended linearly on the solution pH. • Acid treatment increased ITO surface hydrophilicity and porosity. • ITO film etching led to preferential dissolution of indium species over tin species.
Pougnet, Frédérique; Schäfer, Jörg; Dutruch, Lionel; Garnier, Cédric; Tessier, Erwan; Dang, Duc Huy; Lanceleur, Laurent; Mullot, Jean-Ulrich; Lenoble, Véronique; Blanc, Gérard
2014-05-01
Concentrations of inorganic tin (Sn(inorg)), tributyltin (TBT) and its degradation products dibutyltin (DBT) and monobutyltin (MBT) were measured in surface sediments and in two cores from the Toulon Bay, hosting the major French military harbour. Anticipating planned dredging, the aim of the present work is to map and evaluate for the first time the recent and historic contamination of these sediments by inorganic and organic Sn species derived from antifouling paints used for various naval domains including military, trade, tourism and leisure. Tin and butyl-Sn concentrations in the bay varied strongly (4 orders of magnitude), depending on the site, showing maximum values near the shipyards. The concentrations of total Sn (1.3-112 μg g(-1)), TBT (product Sn(inorgBT) is by far the dominant species after 10-12 half-life periods and (c) using recent data to reliably assess former TBT contamination requires the use of a modified butyl-Sn degradation index BDI(mod). Resuspension of extremely contaminated subsurface sediments by the scheduled dredging will probably result in mobilization of important amounts of butyl-Sn species.
9 CFR 113.209 - Rabies Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Killed Virus. 113.209... Killed Virus Vaccines § 113.209 Rabies Vaccine, Killed Virus. Rabies Vaccine (Killed Virus) shall be prepared from virus-bearing cell cultures or nerve tissues obtained from animals that have developed rabies...
9 CFR 202.113 - Rule 13: Written hearing.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Rule 13: Written hearing. 202.113 Section 202.113 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS ADMINISTRATION... waiver of the right to file such evidence. (g) Extension of time for depositions. If any party timely...
13 CFR 113.455 - Textbooks and curricular material.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Textbooks and curricular material. 113.455 Section 113.455 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES OF FEDERAL GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Se...
Recovery of Tin and Nitric Acid from Spent Solder Stripping Solutions
International Nuclear Information System (INIS)
Ahn, Jae-Woo; Ryu, Seong-Hyung; Kim, Tae-young
2015-01-01
Spent solder-stripping solutions containing tin, copper, iron, and lead in nitric acid solution, are by-products of the manufacture of printed-circuit boards. The recovery of these metals and the nitric acid, for re-use has economic and environmental benefits. In the spent solder-stripping solution, a systematic method to determine a suitable process for recovery of valuable metals and nitric acid was developed. Initially, more than 90% of the tin was successfully recovered as high-purity SnO 2 by thermal precipitation at 80 ℃ for 3 hours. About 94% of the nitric acid was regenerated effectively from the spent solutions by diffusion dialysis, after which there remained copper, iron, and lead in solution. Leakage of tin through the anion-exchange membrane was the lowest (0.026%), whereas Pb-leakage was highest (4.26%). The concentration of the regenerated nitric acid was about 5.1 N.
Thermally evaporated mechanically hard tin oxide thin films for opto-electronic apllications
Energy Technology Data Exchange (ETDEWEB)
Tripathy, Sumanta K.; Rajeswari, V. P. [Centre for Nano Science and Technology, GVP College of Engineering (Autonomous), Visakhapatnam- 530048 (India)
2014-01-28
Tungsten doped tin oxide (WTO) and Molybdenum doped tin oxide (MoTO) thin film were deposited on corn glass by thermal evaporation method. The films were annealed at 350°C for one hour. Structural analysis using Xray diffraction data shows both the films are polycrystalline in nature with monoclinic structure of tin oxide, Sn{sub 3}O{sub 4}, corresponding to JCPDS card number 01-078-6064. SEM photograph showed that both the films have spherical grains with size in the range of 20–30 nm. Compositional analysis was carried out using EDS which reveals the presence of Sn, O and the dopant Mo/W only thereby indicating the absence of any secondary phase in the films. The films are found to contain nearly 6 wt% of Mo, 8 wt% of W as dopants respectively. The transmission pattern for both the films in the spectral range 200 – 2000 nm shows that W doping gives a transparency of nearly 80% from 380 nm onwards while Mo doping has less transparency of 39% at 380nm. Film hardness measurement using Triboscope shows a film hardness of about 9–10 GPa for both the films. It indicates that W or M doping in tin oxide provides the films the added advantage of withstanding the mechanical wear and tear due to environmental fluctuations By optimizing the optical and electrical properties, W/Mo doped tin oxide films may be explored as window layers in opto-electronic applications such as solar cells.
Thermally evaporated mechanically hard tin oxide thin films for opto-electronic apllications
International Nuclear Information System (INIS)
Tripathy, Sumanta K.; Rajeswari, V. P.
2014-01-01
Tungsten doped tin oxide (WTO) and Molybdenum doped tin oxide (MoTO) thin film were deposited on corn glass by thermal evaporation method. The films were annealed at 350°C for one hour. Structural analysis using Xray diffraction data shows both the films are polycrystalline in nature with monoclinic structure of tin oxide, Sn 3 O 4 , corresponding to JCPDS card number 01-078-6064. SEM photograph showed that both the films have spherical grains with size in the range of 20–30 nm. Compositional analysis was carried out using EDS which reveals the presence of Sn, O and the dopant Mo/W only thereby indicating the absence of any secondary phase in the films. The films are found to contain nearly 6 wt% of Mo, 8 wt% of W as dopants respectively. The transmission pattern for both the films in the spectral range 200 – 2000 nm shows that W doping gives a transparency of nearly 80% from 380 nm onwards while Mo doping has less transparency of 39% at 380nm. Film hardness measurement using Triboscope shows a film hardness of about 9–10 GPa for both the films. It indicates that W or M doping in tin oxide provides the films the added advantage of withstanding the mechanical wear and tear due to environmental fluctuations By optimizing the optical and electrical properties, W/Mo doped tin oxide films may be explored as window layers in opto-electronic applications such as solar cells
2010-04-01
... THE TREASURY LIQUORS CONSIGNMENT SALES Scope of Regulations § 11.3 Application. (a) General. The regulations in this part apply to transactions between industry members and trade buyers. (b) Transactions...
COMPARATIVE ANALYSIS OF DATA STRUCTURES FOR STORING MASSIVE TINS IN A DBMS
Directory of Open Access Journals (Sweden)
K. Kumar
2016-06-01
Full Text Available Point cloud data are an important source for 3D geoinformation. Modern day 3D data acquisition and processing techniques such as airborne laser scanning and multi-beam echosounding generate billions of 3D points for simply an area of few square kilometers. With the size of the point clouds exceeding the billion mark for even a small area, there is a need for their efficient storage and management. These point clouds are sometimes associated with attributes and constraints as well. Storing billions of 3D points is currently possible which is confirmed by the initial implementations in Oracle Spatial SDO PC and the PostgreSQL Point Cloud extension. But to be able to analyse and extract useful information from point clouds, we need more than just points i.e. we require the surface defined by these points in space. There are different ways to represent surfaces in GIS including grids, TINs, boundary representations, etc. In this study, we investigate the database solutions for the storage and management of massive TINs. The classical (face and edge based and compact (star based data structures are discussed at length with reference to their structure, advantages and limitations in handling massive triangulations and are compared with the current solution of PostGIS Simple Feature. The main test dataset is the TIN generated from third national elevation model of the Netherlands (AHN3 with a point density of over 10 points/m2. PostgreSQL/PostGIS DBMS is used for storing the generated TIN. The data structures are tested with the generated TIN models to account for their geometry, topology, storage, indexing, and loading time in a database. Our study is useful in identifying what are the limitations of the existing data structures for storing massive TINs and what is required to optimise these structures for managing massive triangulations in a database.
9 CFR 113.312 - Rabies Vaccine, Live Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Rabies Vaccine, Live Virus. 113.312... Virus Vaccines § 113.312 Rabies Vaccine, Live Virus. Rabies Vaccine shall be prepared from virus-bearing... administration. (iii) Observe all animals for signs of rabies until scheduled time to sacrifice. If animals show...
9 CFR 113.38 - Guinea pig safety test.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Guinea pig safety test. 113.38 Section... Standard Procedures § 113.38 Guinea pig safety test. The guinea pig safety test provided in this section... be injected either intramuscularly or subcutaneously into each of two guinea pigs and the animals...
Stress analysis and microstructure of PVD monolayer TiN and multilayer TiN/(Ti,Al)N coatings
Carvalho, NJM; Zoestbergen, E; Kooi, BJ; De Hosson, JTM
2003-01-01
Two PVD titanium nitride based coatings; monolayer TiN and multilayer resulting from the stacking of TiN and (Ti,Al)N layers were evaluated with respect to their stress state and microstructure. The TiN was deposited by triode evaporation ion plating, whereas the TiN/(Ti,AI)N was deposited using a
Sundoyo, Hadi; Hamsal, Mohammad
2013-01-01
PT. Timah Industri (PT TI) is a subsidiary of PT. Timah (Persero) Tbk which exploit comparative advantage of its parent company as the second largest tin producer in the world. With these advantages PT TI entered the downstream PVC stabilizer tin base. Starting from the difficulty of selling their products and then raised the question in inventory management. PT TI should immediately take strategic steps to save the tin chemical business continues to lose money from time to time. From the res...
Chaos in a coulombic muffin-tin potential
International Nuclear Information System (INIS)
Brandis, S.
1994-04-01
We study the two-dimensional classical scattering dynamics by a Muffin-Tin potential with 3 Coulomb singularities. A complete symbolic dynamics for the periodic orbits is derivd. The classical trajectories are shown to be hyperbolic everywhere in phase space and to carry no conjugate points. (orig.)
Defects in TiN and HfN studied by helium thermal desorption spectrometry
International Nuclear Information System (INIS)
Hoondert, W.H.B.; Thijsse, B.J.; Beuckel, A. van den
1994-01-01
Point defects in sub-stoichiometric TiN 1-x and HfN 1-x were investigated by helium thermal desorption spectrometry (300-1800K) following He + ion implantation at energies up to 3000eV. It was found that the low energy spectra are dominated by helium dissociating from the structural vacancies on the nitrogen sublattice; the activation energy for dissociation is 2.2eV for TiN. Above a few hundred electron volts the ions begin to produce several other types of defects, from which helium dissociates with activation energies in the range 2.6-4.0eV. The identity of these defects is discussed. The results for the two nitrides were similar in many respects. The most significant difference observed is that in TiN low energy He + ions generate damage on the N sublattice of a type that is not observed for HfN. Activation energies for HfN are found to be consistently 0.7eV lower than for TiN. ((orig.))
Modification of structure and properties of tin – fullerite films irradiated by boron ions
International Nuclear Information System (INIS)
Baran, L.V.
2013-01-01
By methods of raster electronic, atomic force and electronic force microscopy and X-ray diffraction the research of change of structure, phase composition and local electronic properties of the tin - fullerite films, subjected to implantation by B + ions (E = 80 keV, F = 5×10 17 ions/cm 2 ) are submitted. It is established, that as a result of boron ion implantation of two-layered tin - fullerite films, tin and fullerite interfusion on sues, that is the solid-phase interaction and as a result of which forms the heterophase with heterogeneous local electric properties. (authors)
A facile way to control phase of tin selenide flakes by chemical vapor deposition
Wang, Zhigang; Pang, Fei
2018-06-01
Although two-dimensional (2D) tin selenides are attracting intense attentions, studies on its phase transition are still relatively few. Here we report a facile way to control the phase growth of tin selenide flakes on mica and SiO2/Si by only adjusting nominal Sn:Se ratio, which refers to the amount of loaded SnO2 and Se precursors. High normal Sn:Se ratio induced SnSe flakes, conversely SnSe2 flakes formed. It could be used as a practical guide to selectively synthesize pure phase of single crystalline 2D layered chalcogenide materials similar to tin selenides.
2011-09-21
... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-860 (Second Review)] Tin- and Chromium... Concerning the Antidumping Duty Order on Tin- and Chromium-Coated Steel Sheet From Japan AGENCY: United.... 1675(c)(5)) to determine whether revocation of the antidumping duty order on tin- and chromium-coated...
Mössbauer and NMR study of novel Tin(IV)-lactames
International Nuclear Information System (INIS)
Kuzmann, Erno; Szalay, Roland; Homonnay, Zoltan; Nagy, Sandor
2012-01-01
N-tributylstannylated 2-pyrrolidinone was reacted with tributyltin triflate in different molar ratios and the complex formation monitored using 1 H-NMR, 13 C-NMR and 119 Sn Mössbauer spectroscopy. Comparing the carbon NMR and tin Mössbauer results, a reaction scheme is suggested for the complexation which assumes the formation of a simultaneously O- and N-tributylstannylated pyrrolidinone cation. The formation of the only O-stannylated pyrrolidinone is also assumed to account for the non-constant Mössbauer parameters of the two tin environments in the distannylated pyrrolidinone cation when the ratio of tributyltin triflate is increased in the reaction.
Magnetoelectric Effect in Gallium Arsenide-Nickel-Tin-Nickel Multilayer Structures
Filippov, D. A.; Tikhonov, A. A.; Laletin, V. M.; Firsova, T. O.; Manicheva, I. N.
2018-02-01
Experimental data have been presented for the magnetoelectric effect in nickel-tin-nickel multilayer structures grown on a GaAs substrate by cathodic electrodeposition. The method of fabricating these structures has been described, and the frequency dependence of the effect has been demonstrated. It has been shown that tin used as an intermediate layer reduces mechanical stresses due to the phase mismatch at the Ni-GaAs interface and, thus, makes it possible to grow good structures with a 70-μm-thick Ni layer. The grown structures offer good adhesion between layers and a high Q factor.
49 CFR 215.113 - Defective plain bearing wedge.
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Defective plain bearing wedge. 215.113 Section 215... Suspension System § 215.113 Defective plain bearing wedge. A railroad may not place or continue in service a car, if a plain bearing wedge on that car is— (a) Missing; (b) Cracked; (c) Broken; or (d) Not located...
19 CFR 113.55 - Cancellation of export bonds.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Cancellation of export bonds. 113.55 Section 113... export bonds. (a) Manner of cancellation. A bond to assure exportation as defined in § 101.1 of this... shall be signed by a revenue officer of the foreign country to which the merchandise is exported, unless...
Tribaloy alloy reinforced tin-bronze composite coating for journal bearing applications
International Nuclear Information System (INIS)
Gao, F.; Liu, R.; Wu, X.J.
2011-01-01
This article presents an experimental study of the tribological behavior of a tin/bronze-based composite coating. The improved-ductility Tribaloy alloy (T-401) particles are selected as the reinforcement. This coating is made on the bushing of planet journals used in aerospace engines, deposited with the high velocity oxygen fuel (HVOF) thermal spray technique. The tribological properties such as friction and wear resistance of the coated bushing are investigated under the WAMsc3 Sliding Contact Test, along with the leaded tin/bronze bushing tested for comparison. The testing results show that the bushing coated with the composite exhibits superior tribological properties to the leaded tin/bronze bushing in that the former runs longer before the friction coefficient reaches 0.5 and also leads a to lower wear rate than the latter. The experimental results and wear mechanisms of these two bushings are discussed with the assistance of worn surface analyses using scanning electron microscopy (SEM).
The electrochemical deposition of tin-nickel alloys and the corrosion properties of the coating
DEFF Research Database (Denmark)
Jellesen, Morten Stendahl; Møller, Per
2005-01-01
The electrodeposition of tin/nickel (65/35 wt%) is a unique coating process because of the deposition of an intermetallic phase of nickel and tin, which cannot be formed by any pyrometallurgical process. From thermodynamic calculations it can be shown that intermetallic phases can be formed throu...
Evaluation on the characteristics of tin-silver-bismuth solder
Xia, Z.; Shi, Y.; Chen, Z.
2002-02-01
Tin-silver-bismuth solder is characterized by its lower melting point, good wetting behavior, and good mechanical property for which it is expected to be a new lead-free solder to replace tin-lead solder. In this article, Sn-3.33Ag-4.83Bi solder was investigated concerning its physical, spreading, and mechanical properties under specific conditions. Cooling curves and DSC results showed that it was close to eutectic composition (m.p. 210° 212 °C). Coefficiency of thermal expansion (CTE) of this solder, between that of PCBs and copper substrates, was beneficial to alleviate the thermal mismatch of the substrates. It was also a good electrical and thermal conductor. Using a rosin-based, mildly activated (RMA) flux, a spreading test indicated that SnAgBi solder paste had good solderability. Meanwhile, the solder had high tensile strength and fracture energy. Its fracture mechanism was a mixture of ductile and brittle fracture morphology. The metallographic and EDAX analyses indicated that it was composed of a tin-based solid solution and some intermetallic compound (IMC) that could strengthen the substrate. However, these large needle-like IMCs would cut the substrate and this resulted in the decreasing of the toughness of the solder.
First-principles analysis of structural and opto-electronic properties of indium tin oxide
Tripathi, Madhvendra Nath; Shida, Kazuhito; Sahara, Ryoji; Mizuseki, Hiroshi; Kawazoe, Yoshiyuki
2012-05-01
Density functional theory (DFT) and DFT + U (DFT with on-site Coulomb repulsion corrections) calculations have been carried out to study the structural and opto-electronic properties of indium tin oxide (ITO) for both the oxidized and reduced environment conditions. Some of the results obtained by DFT calculations differ from the experimental observations, such as uncertain indication for the site preference of tin atom to replace indium atom at b-site or d-site, underestimation of local inward relaxation in the first oxygen polyhedra around tin atom, and also the improper estimation of electronic density of states and hence resulting in an inappropriate optical spectra of ITO. These discrepancies of theoretical outcomes with experimental observations in ITO arise mainly due to the underestimation of the cationic 4d levels within standard DFT calculations. Henceforth, the inclusion of on-site corrections within DFT + U framework significantly modifies the theoretical results in better agreement to the experimental observations. Within this framework, our calculations show that the indium b-site is preferential site over d-site for tin atom substitution in indium oxide under both the oxidized and reduced conditions. Moreover, the calculated average inward relaxation value of 0.16 Å around tin atom is in good agreement with the experimental value of 0.18 Å. Furthermore, DFT + U significantly modify the electronic structure and consequently induce modifications in the calculated optical spectra of ITO.
9 CFR 113.6 - Animal and Plant Health Inspection Service testing.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Animal and Plant Health Inspection Service testing. 113.6 Section 113.6 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Applicability § 113.6 Animal and Plant Health Inspection Service testing. A...
Tailoring the structural and optical properties of TiN thin films by Ag ion implantation
Energy Technology Data Exchange (ETDEWEB)
Popović, M., E-mail: majap@vinca.rs; Novaković, M.; Rakočević, Z.; Bibić, N.
2016-12-15
Highlights: • Changes in structural and optical properties of TiN films induced by Ag ions. • The formation of Ag metallic clusters inside of TiN layers was observed. • The SPR of Ag particles was confirmed by a broad band in the spectra. • As the Ag ions fluence increases the n also increase and k values decrease. • With increasing ion fluence the TiN film becomes more metallic. - Abstract: Titanium nitride (TiN) thin films thickness of ∼260 nm prepared by dc reactive sputtering were irradiated with 200 keV silver (Ag) ions to the fluences ranging from 5 × 10{sup 15} ions/cm{sup 2} to 20 × 10{sup 15} ions/cm{sup 2}. After implantation TiN layers were annealed 2 h at 700 °C in a vacuum. Ion irradiation-induced microstructural changes were examined by using Rutherford backscattering spectrometry, X-ray diffraction and transmission electron microscopy, while the surface topography was observed using atomic force microscopy. Spectroscopic ellipsometry was employed to get insights on the optical and electronic properties of TiN films with respect to their microstructure. The results showed that the irradiations lead to deformation of the lattice, increasing disorder and formation of new Ag phase. The optical results demonstrate the contribution of surface plasmon resonace (SPR) of Ag particles. SPR position shifted in the range of 354.3–476.9 nm when Ag ion fluence varied from 5 × 10{sup 15} ions/cm{sup 2} to 20 × 10{sup 15} ions/cm{sup 2}. Shift in peak wavelength shows dependence on Ag particles concentration, suggesting that interaction between Ag particles dominate the surface plasmon resonance effect. Presence of Ag as second metal in the layer leads to overall decrease of optical resistivity of TiN.
Stress-Strain Analysis in TiN Nanocoating Deposited on Polymer with respect to Au Nanointerlayer
Directory of Open Access Journals (Sweden)
Magdalena Kopernik
2014-01-01
Full Text Available The multiscale analysis in the authors’ finite element code confirmed possibility of fracture, because of not sufficiently high level of compressive residual stress in the TiN deposited by physical deposition method and varied mechanical properties of the thin film and substrate. The residual stress cannot be identified by X-ray technique for amorphous polymer and layer with domains of crystalline TiN. It is assumed that the buffer biocompatible thin film of Au in the TiN/Bionate II material system will alter the evolution of residual stress and, therefore, will allow to determine the residual stress in profilometry studies, and helps to improve toughness of the connection between TiN and Bionate II. The introduction of Au nanocoating in the material system results in bending of the sample and a compressive residual stress in the TiN coating. Results of finite element simulation show improvement of connection between the polymer and TiN, and an increase of compressive residual stress in the coating by introduction of Au nanointerlayer results in reduction of stress and strain in the substrate (close to the boundary between substrate and coating.
Recovery Of Valuable Metals In Tin-Based Anodic Slimes By Carbothermic Reaction
Directory of Open Access Journals (Sweden)
Han Chulwoong
2015-06-01
Full Text Available This study investigated the recovery of anodic slimes by carbothermic reaction in the temperature range of 973~1,273K and amount of carbon as a function of time. Tin anodic slime samples were collected from the bottom of the electrolytic cells during the electro-refining of tin. The anodic slimes are consisted of high concentrated tin, silver, copper and lead oxides. The kinetics of reduction were determined by means of the weight-loss measurement technique. In order to understand in detail of carbothermic reaction, thermodynamic calculation was carried out and compared with experiments. From thermodynamic calculation and experiment, it was confirmed that Sn-based anodic slime could be reduced by controlling temperature and amount of carbon. However, any tendency between the reduction temperature and carbon content for the reduction reaction was not observed.
Superconducting tin core fiber
International Nuclear Information System (INIS)
Homa, Daniel; Liang, Yongxuan; Hill, Cary; Kaur, Gurbinder; Pickrell, Gary
2015-01-01
In this study, we demonstrated superconductivity in a fiber with a tin core and fused silica cladding. The fibers were fabricated via a modified melt-draw technique and maintained core diameters ranging from 50-300 microns and overall diameters of 125-800 microns. Superconductivity of this fiber design was validated via the traditional four-probe test method in a bath of liquid helium at temperatures on the order of 3.8 K. The synthesis route and fiber design are perquisites to ongoing research dedicated all-fiber optoelectronics and the relationships between superconductivity and the material structures, as well as corresponding fabrication techniques. (orig.)
Mac, Kathy; Wu, Xiao Juan; Mai, Jun; Howlin, Kenneth; Suranyi, Michael; Yong, Jim; Makris, Angela
2017-06-01
IgG4 disease is rare. However, IgG4 tubulointerstitial nephritis (TIN) is the most common renal manifestation. IgG4 disease is usually associated with elevated serum IgG4 levels and other organ involvement, low-density renal lesions on enhanced CT imaging and immune activation. The incidence of IgG4-TIN may be underestimated, as staining for IgG4 is not routine. This study sought to describe the prevalence of previously undiagnosed IgG4-TIN. Due to the complexity of the diagnosis, we only attempt to look at IgG4-positive plasma cell TIN as a potential indication for IgG4 renal disease. A retrospective review of native renal biopsies performed between 2002 and 2012 with a primary diagnosis of TIN was selected. Samples for which interstitial nephritis was secondary to a glomerular disease were excluded. The tissues were stained for IgG4 and scored by two blinded observers. Demographic and follow-up details were collected. This study was approved by the local ethics committee. 82 cases of interstitial nephritis from a total of 1238 renal biopsies (2002-2012) were available after staining for further assessment. 12 samples demonstrated staining consistent with the criteria for IgG4-positive plasma cell TIN, of which 3 had mildly positive staining, 7 moderately positive staining and 2 had markedly positive staining. There were no statistically significant differences in the baseline characteristics between the positive and negative staining groups. A number of cases of IgG4-positive plasma cell TIN were observed histologically that had been previously diagnosed as non-specific chronic TIN. IgG4-positive plasma cell TIN made up 1% of all renal biopsies performed over 10 years and 13% of all biopsies demonstrating TIN not related to glomerular disease. IgG4 staining should be considered routinely in biopsies demonstrating primary TIN. Published by the BMJ Publishing Group Limited. For permission to use (where not already granted under a licence) please go to http://www.bmj.com/company/products-services/rights-and-licensing/.
Directory of Open Access Journals (Sweden)
Szwachta G.
2016-06-01
Full Text Available High-quality titanium nitride thin films have been grown on a cube-textured copper surface via pulsed laser deposition. The growth of TiN thin films has been very sensitive to pre-treatment procedure and substrate temperature. It is difficult to grow heteroexpitaxial TiN films directly on copper tape due to large differences in lattice constants, thermal expansion coefficients of the two materials as well as polycrystalline structure of substrate. The X-Ray diffraction measurement revealed presence of high peaks belonged to TiN(200 and TiN(111 thin films, depending on used etcher of copper surface. The electron diffraction patterns of TiN(200/Cu films confirmed the single-crystal nature of the films with cube-on-cube epitaxy. The high-resolution microscopy on our films revealed sharp interfaces between copper and titanium nitride with no presence of interfacial reaction.
XRF measurements of tin, copper and zinc in antifouling paints coated on leisure boats
International Nuclear Information System (INIS)
Ytreberg, Erik; Bighiu, Maria Alexandra; Lundgren, Lennart; Eklund, Britta
2016-01-01
Tributyltin (TBT) and other organotin compounds have been restricted for use on leisure boats since 1989 in the EU. Nonetheless, release of TBT is observed from leisure boats during hull maintenance work, such as pressure hosing. In this work, we used a handheld X-ray Fluorescence analyser (XRF) calibrated for antifouling paint matrixes to measure tin, copper and zinc in antifouling paints coated on leisure boats in Sweden. Our results show that over 10% of the leisure boats (n = 686) contain >400 μg/cm 2 of tin in their antifouling coatings. For comparison, one layer (40 μm dry film) of a TBT-paint equals ≈ 800 μg Sn/cm 2 . To our knowledge, tin has never been used in other forms than organotin (OT) in antifouling paints. Thus, even though the XRF analysis does not provide any information on the speciation of tin, the high concentrations indicate that these leisure boats still have OT coatings present on their hull. On several leisure boats we performed additional XRF measurements by progressively scraping off the top coatings and analysing each underlying layer. The XRF data show that when tin is detected, it is most likely present in coatings close to the hull with several layers of other coatings on top. Thus, leaching of OT compounds from the hull into the water is presumed to be negligible. The risk for environmental impacts arises during maintenance work such as scraping, blasting and high pressure hosing activities. The data also show that many boat owners apply excessive paint layers when following paint manufacturers recommendations. Moreover, high loads of copper were detected even on boats sailing in freshwater, despite the more than 20 year old ban, which poses an environmental risk that has not been addressed until now. - Highlights: • A new XRF application for analysing metals in antifouling paints has been used. • Almost 700 leisure boats were analysed for tin, copper and zinc. • Over 10% of the leisure boats contained high, >400
Deposition Rate and Energy Enhancements of TiN Thin-Film in a Magnetized Sheet Plasma Source
Hamdi Muhyuddin D. Barra; Henry J. Ramos
2011-01-01
Titanium nitride (TiN) has been synthesized using the sheet plasma negative ion source (SPNIS). The parameters used for its effective synthesis has been determined from previous experiments and studies. In this study, further enhancement of the deposition rate of TiN synthesis and advancement of the SPNIS operation is presented. This is primarily achieved by the addition of Sm-Co permanent magnets and a modification of the configuration in the TiN deposition process. The ...
40 CFR 745.113 - Certification and acknowledgment of disclosure.
2010-07-01
... disclosure. 745.113 Section 745.113 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED... may produce permanent neurological damage, including learning disabilities, reduced intelligence... required by § 745.110(a); or (ii) Waived the opportunity. (6) When one or more agents are involved in the...
Directory of Open Access Journals (Sweden)
Carina eMoeller
2014-12-01
Full Text Available Tillering is a core constituent of plant architecture, and influences light interception to affect plant performance. Near-isogenic lines (NILs varying for a tiller inhibition (tin gene were investigated for tillering dynamics, organ size distribution, leaf area, light interception, red : far-red ratio, and chlorophyll content. Tillering ceased earlier in the tin lines to reduce the frequencies of later primary and secondary tillers, and demonstrated the genetically lower tillering plasticity of tin compared to free-tillering NILs. The distribution of organ sizes along shoots varied between NILs. In tin lines, internode elongation commenced at a lower phytomer, the peduncles were shorter, the flag leaves were larger, and the longest leaf blades were observed at higher phytomers. Total leaf area was reduced in tin lines. The tiller economy (ratio of seed-bearing shoots to numbers of shoots produced was 10% greater in the tin lines (0.73-0.76 compared to the free-tillering sisters (0.62-0.63. At maximum tiller number, the red: far-red ratio (light quality stimulus that is thought to induce the cessation of tillering at the plant-base was 0.18-0.22 in tin lines and 0.09-0.11 in free-tillering lines at levels of photosynthetic active radiation of 49-53% and 30-33%, respectively. The tin lines intercepted less radiation compared to their free-tillering sisters once genotypic differences in tiller numbers had established, and maintained green leaf area in the lower canopy later into the season. Greater light extinction coefficients (k in tin lines prior to, but reduced k after, spike emergence indicated that differences in light interception between NILs cannot be explained by leaf area alone but that geometric and optical canopy properties contributed. The characterisation of specifically-developed NILs is refining the development of a physiology-based model for tillering to enhance understanding of the value of architectural traits for use in cereal
International Nuclear Information System (INIS)
Balaes, A.M.E.
1984-01-01
The method of analysis is applicable to samples with tin and zinc contents from 15μg/g upwards. Samples with widely ranging concentrations of the analytes are diluted with river sand. The matrix variations are compensated for by the use of briquettes containing coarse river sand, a styrene copolymer binder, and an internal standard. Tungsten is used as the internal standard for zinc, and antimony for tin. Calibration graphs for zinc and tin are obtained by the use of a reference material for tin and of zinc oxide for zinc. The precision of the analysis for each element does not exeed 0,040 relative standard deviation. The agreement between the analysis and the accepted international values and recommended values for in-house reference materials is better than 3 per cent over the concentration range 50μg/g to 16 per cent. The lower limits of detection are 2μg/g for tin and 3μg/g for zinc. The overall time required for the analysis of 10 samples, one control sample, and five calibration standards is approximately 3 hours
Zhou, L.; Chao, T.T.; Meier, A.L.
1984-01-01
An electrothermal atomic-absorption spectrophotometric method is described for the determination of total tin in geological materials, with use of a tungsten-impregnated graphite furnace. The sample is decomposed by fusion with lithium metaborate and the melt is dissolved in 10% hydrochloric acid. Tin is then extracted into trioctylphosphine oxide-methyl isobutyl ketone prior to atomization. Impregnation of the furnace with a sodium tungstate solution increases the sensitivity of the determination and improves the precision of the results. The limits of determination are 0.5-20 ppm of tin in the sample. Higher tin values can be determined by dilution of the extract. Replicate analyses of eighteen geological reference samples with diverse matrices gave relative standard deviations ranging from 2.0 to 10.8% with an average of 4.6%. Average tin values for reference samples were in general agreement with, but more precise than, those reported by others. Apparent recoveries of tin added to various samples ranged from 95 to 111% with an average of 102%. ?? 1984.
Towards 100Sn: Studies on neutron-deficient even isotopes of tin
International Nuclear Information System (INIS)
Rathke, G.E.
1987-02-01
Neutron-deficient 108,106,104 Sn isotopes were produced by heavy ion induced fusion reactions using high-intensity 59 Ni beams from the UNILAC of the GSI. Their decay properties were studied by techniques of gamma and conversion electron spectroscopy employing the mass separator on-line to the UNILAC. Earlier information on the 108 Sn → 108 In and 106 Sn → 106 In decays was complemented and improved in the course of this work. The new nucleus 104 Sn and its decay to excited states in 104 In was identified and studied for the first time. These investigations yield the following results: the mass of 104 Sn and of nuclei linked to it by alpha decay or proton radioactivity, 108 Te, 112 Xe and 109 I, 113 Cs, respectively were determined from the measured Q EC value of 104 Sn and the known mass value of 104 In. These are nuclei very close or beyond the proton drip line. In addition, information on the quenching of the fast Gamow-Teller beta decay of the even neutron-deficient tin isotopes was obtained. This complements investigations on the N = 50 isotones 94 Ru and 96 Pd, and allows a systematic comparison of these transition strengths for nuclei near the doubly magic 100 Sn. The spreading of the vertical strokeπg 9/2 -1 vg 7/2 , 1 + > configuration over several states, due to residual interactions, and the centroid energies of these magnetic dipole states were determined for the corresponding odd-odd indium isotopes. (orig./HSI)
2011-06-01
... INTERNATIONAL TRADE COMMISSION [Investigation No. 731-TA-860 (Second Review)] Tin- and Chromium... Tin- and Chromium-Coated Steel Sheet from Japan AGENCY: United States International Trade Commission... the antidumping duty order on tin- and chromium-coated steel sheet from Japan would be likely to lead...
9 CFR 113.42 - Detection of lymphocytic choriomeningitis contamination.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Detection of lymphocytic choriomeningitis contamination. 113.42 Section 113.42 Animals and Animal Products ANIMAL AND PLANT HEALTH... contamination. The test for detection of lymphocytic choriomeningitis (LCM) virus provided in this section shall...
A sol-gel method to synthesize indium tin oxide nanoparticles
Institute of Scientific and Technical Information of China (English)
Xiuhua Li; Xiujuan xu; Xin Yin; Chunzhong Li; Jianrong Zhang
2011-01-01
Transparent conductive indium tin oxide (ITO) nanoparticles were synthesized by a novel sol-gel method.Granulated indium and tin were dissolved in HNO3 and partially complexed with citric acid.A sol-gel process was induced when tertiary butyl alcohol was added dropwise to the above solution.ITO nanoparticles with an average crystallite size of 18.5 nm and surface area of 32.6 m2/g were obtained after the gel was heat-treated at 700 C.The ITO nanoparticles showed good sinterability,the starting sintering temperature decreased sharply to 900 C,and the 1400 C sintered pellet had a density of 98.1 % of theoretical density (TD).
Work Function Tuning in Sub-20nm Titanium Nitride (TiN) Metal Gate: Mechanism and Engineering
Hasan, Mehdi
2011-07-01
Scaling of transistors (the building blocks of modern information age) provides faster computation at the expense of excessive power dissipation. Thus to address these challenges, high-k/metal gate stack has been introduced in commercially available microprocessors from 2007. Since then titanium nitride (TiN) metal gate’s work function (Wf) tunability with its thickness (thickness increases, work function increases) is a well known phenomenon. Many hypotheses have been made over the years which include but not limited to: trap charge and metal gate nucleation, nitrogen concentration, microstructure agglomeration and global stress, metal oxide formation, and interfacial oxide thickness. However, clear contradictions exist in these assumptions. Also, nearly all these reports skipped a comprehensive approach to explain this complex paradigm. Therefore, in this work we first show a comprehensive physical investigation using transmission electron microcopy/electron energy loss spectroscopy (TEM/EELS), x-ray diffraction (XRD), x-ray photoelectron spectroscopy (XPS) and secondary ion mass spectroscopy (SIMS) to show replacement of oxygen by nitrogen in the metal/dielectric interface, formation of TiONx, reduction of Ti/N concentration and grain size increment happen with TiN thickness increment and thus may increase the work function. Then, using these finding, we experimentally show 100meV of work function modulation in 10nm TiN Metal-oxide-semiconductor capacitor by using low temperature oxygen annealing. A low thermal budget flow (replicating gate-last) shows similar work function boost up. Also, a work function modulation of 250meV has been possible using oxygen annealing and applying no thermal budget. On the other hand, etch-back of TiN layer can decrease the work function. Thus this study quantifies role of various factors in TiN work function tuning; it also reproduces the thickness varied TiN work function modulation in single thickness TiN thus reducing the
Directory of Open Access Journals (Sweden)
R. Yang
2017-12-01
Full Text Available The optical, elastic anisotropic and thermodynamic properties of TiN in the NaCl (B1 structure are analyzed in detail in the temperature range from 0 to 2000 K and the pressure range from 0 to 20 GPa. From the calculated dielectric constants, a first order isostructural phase transition between 29 and 30 GPa is found for TiN. The absorption spectra exhibit high values ranging from the far infrared region to the ultra-violet one. The anisotropy value of Young's modulus of TiN is smaller than that of c-BN at 0 GPa and the anisotropy of TiN clearly increases with an increase of pressure. The effects of pressure and temperature on the bulk modulus, Grüneisen parameter, Gibbs free energy, and Debye temperature are significant. The Grüneisen parameter of TiN is much larger than that of c-BN. At temperatures below 1000 K, TiN's heat capacity is much larger than that of c-BN.
Directory of Open Access Journals (Sweden)
Staffan Sandin
2017-03-01
Full Text Available The influence of precursor salts in the synthesis of nickel and antimony doped tin oxide (NATO electrodes using thermal decomposition from dissolved chloride salts was investigated. The salts investigated were SnCl4×5H2O, SnCl2×2H2O, SbCl3 and NiCl2×6H2O. It was shown that the use of SnCl4×5H20 in the preparation process leads to a tin loss of more than 85 %. The loss of Sb can be as high as 90 % while no indications of Ni loss was observed. As a consequence, the concentration of Ni in the NATO coating will be much higher than in the precursor solution. This high and uncontrolled loss of precursors during the preparation process will lead to an unpredictable composition in the NATO coating and will have negative economic and environmental effects. It was found that using SnCl2×2H20 instead of SnCl4×5H2O can reduce the tin loss to less than 50 %. This tin loss occurs at higher temperatures than when using SnCl4×5H2O where the tin loss occurs from 56 – 147 °C causing the composition to change both during the drying (80 – 110 °C and calcination (460 -550 °C steps of the preparation process. Electrodes coated with NATO based on the two different tin salts were investigated for morphology, composition, structure, and ozone electrocatalytic properties.
9 CFR 113.207 - Encephalomyelitis Vaccine, Eastern, Western, and Venezuelan, Killed Virus.
2010-01-01
..., Western, and Venezuelan, Killed Virus. 113.207 Section 113.207 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.207 Encephalomyelitis...
Huang, Huaqing; Liu, Feng
2017-05-01
The extremely stringent requirement on material quality has hindered the investigation and potential applications of exotic chiral magnetic effect in Dirac semimetals. Here, we propose that gray tin is a perfect candidate for observing the chiral anomaly effect and Shubnikov-de-Haas (SdH) oscillation at relatively low magnetic field. Based on effective k .p analysis and first-principles calculations, we discover that gray tin becomes a Dirac semimetal under tensile uniaxial strain, in contrast to a topological insulator under compressive uniaxial strain as known before. In this newly found Dirac semimetal state, two Dirac points which are tunable by tensile [001] strains lie in the kz axis and Fermi arcs appear in the (010) surface. Due to the low carrier concentration and high mobility of gray tin, a large chiral anomaly induced negative magnetoresistance and a strong SdH oscillation are anticipated in this half of the strain spectrum. Comparing to other Dirac semimetals, the proposed Dirac semimetal state in the nontoxic elemental gray tin can be more easily manipulated and accurately controlled. We envision that gray tin provides a perfect platform for strain engineering of chiral magnetic effects by sweeping through the strain spectrum from positive to negative and vice versa.
Low-temperature Synthesis of Tin(II) Oxide From Tin(II) ketoacidoximate Precursor
Alshankiti, Buthainah
2015-04-01
Sn (II) oxide finds numerous applications in different fields such as thin film transistors1, solar cells2 and sensors.3 In this study we present the fabrication of tin monoxide SnO by using Sn (II) ketoacid oximate complexes as precursors. Tin (II) ketoacidoximates of the type [HON=CRCOO]2Sn where R= Me 1, R= CH2Ph 2, and [(MeON=CMeCOO)3Sn]- NH4 +.2H2O 3 were synthesized by in situ formation of the ketoacid oximate ligand. The crystal structures were determined via single crystal X- ray diffraction of the complexes 1-3 revealed square planar and square pyramidal coordination environments for the Sn atom. Intramolecular hydrogen bonding is observed in all the complexes. Furthermore, the complexes were characterized by Infrared (IR), Nuclear Magnetic Resonance (NMR) and elemental analysis. From thermogravimetric analysis of 1-3, it was found that the complexes decomposed in the range of 160 – 165 oC. Analysis of the gases evolved during decomposition indicated complete loss of the oximato ligand in one step and the formation of SnO. Spin coating of 1 on silicon or glass substrate show uniform coating of SnO. Band gaps of SnO films were measured and found to be in the range of 3.0 – 3.3 eV by UV-Vis spectroscopy. X-ray photoelectron spectroscopy indicated surface oxidation of the SnO film. Heating 1 above 140 oC in air gives SnO of size ranging from 10 – 500 nm and is spherical in shape. The SnO nanomaterial is characterized by powder X-ray diffraction(XRD), Raman spectroscopy, Scanning Electron Microscopy (SEM), and Transmission Electron Microscopy (TEM).
13 CFR 113.535 - Effect of state or local law or other requirements.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Effect of state or local law or other requirements. 113.535 Section 113.535 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION... obligation to comply with §§ 113.500 through 113.550 is not obviated or alleviated by the existence of any...
A VIRTUAL GLOBE-BASED MULTI-RESOLUTION TIN SURFACE MODELING AND VISUALIZETION METHOD
Directory of Open Access Journals (Sweden)
X. Zheng
2016-06-01
Full Text Available The integration and visualization of geospatial data on a virtual globe play an significant role in understanding and analysis of the Earth surface processes. However, the current virtual globes always sacrifice the accuracy to ensure the efficiency for global data processing and visualization, which devalue their functionality for scientific applications. In this article, we propose a high-accuracy multi-resolution TIN pyramid construction and visualization method for virtual globe. Firstly, we introduce the cartographic principles to formulize the level of detail (LOD generation so that the TIN model in each layer is controlled with a data quality standard. A maximum z-tolerance algorithm is then used to iteratively construct the multi-resolution TIN pyramid. Moreover, the extracted landscape features are incorporated into each-layer TIN, thus preserving the topological structure of terrain surface at different levels. In the proposed framework, a virtual node (VN-based approach is developed to seamlessly partition and discretize each triangulation layer into tiles, which can be organized and stored with a global quad-tree index. Finally, the real time out-of-core spherical terrain rendering is realized on a virtual globe system VirtualWorld1.0. The experimental results showed that the proposed method can achieve an high-fidelity terrain representation, while produce a high quality underlying data that satisfies the demand for scientific analysis.
Crack propagation behavior of TiN coatings by laser thermal shock experiments
International Nuclear Information System (INIS)
Choi, Youngkue; Jeon, Seol; Jeon, Min-seok; Shin, Hyun-Gyoo; Chun, Ho Hwan; Lee, Youn-seoung; Lee, Heesoo
2012-01-01
Highlights: ► The crack propagation behavior of TiN coating after laser thermal shock experiment was observed by using FIB and TEM. ► Intercolumnar cracks between TiN columnar grains were predominant cracking mode after laser thermal shock. ► Cracks were propagated from the coating surface to the substrate at low laser pulse energy and cracks were originated at coating-substrate interface at high laser pulse energy. ► The cracks from the interface spread out transversely through the weak region of the columnar grains by repetitive laser shock. - Abstract: The crack propagation behavior of TiN coatings, deposited onto 304 stainless steel substrates by arc ion plating technique, related to a laser thermal shock experiment has been investigated using focused ion beam (FIB) and transmission electron microscopy (TEM). The ablated regions of TiN coatings by laser ablation system have been investigated under various conditions of pulse energies and number of laser pulses. The intercolumnar cracks were predominant cracking mode following laser thermal shock tests and the cracks initiated at coating surface and propagated in a direction perpendicular to the substrate under low loads conditions. Over and above those cracks, the cracks originated from coating-substrate interface began to appear with increasing laser pulse energy. The cracks from the interface also spread out transversely through the weak region of the columnar grains by repetitive laser shock.
Preparation of sup(99m)Tc-bleomycin with electrogenerated tin(II) ions
Energy Technology Data Exchange (ETDEWEB)
Pihlar, B; Marsel, J; Tasic, D [Ljubljana Univ. (Yugoslavia); Erjavec, M [Institute of Oncology, Ljubljana (Yugoslavia)
1978-01-01
Some parameters influencing the efficiency of labelling bleomycin (BLM) with sup(99m)Tc using tin electrodes for electrolytic production of tin(II) ions were investigated. The results showed clearly the superiority of tin electrodes for labelling BLM with sup(99m)Tc in comparison with Zn electrodes. The alteration of the primary properties of BLM is negligible. The optimal procedure for the labelling of BLM is as follows. Into a vessel (15-20 cm/sup 3/) containing the corresponding amount of BLM in saline, and the desired amount of sup(99m)TcO/sub 4//sup -/ eluate in 0.9% NaCl, 0.5 ml 0.5 M HCl is added and diluted with saline to 10 ml. The electrolysis is performed using tin electrodes with a current density of about 6 mA/cm/sup 2/ for 10 to 20 s with stirring, which is prolonged after electrolysis for a few minutes. After filtration through a 0.22 ..mu..m Millipore filter, the labelled compound can be used for clinical applications. For analytical control of labelled BLM, gel filtration on Sephadex G-25 with UV and radioactivity detection can be recommended. From the results obtained, it has been concluded that gel filtration on Sephadex G-25 can give applicable information about the quality of this radiopharmaceutical.
14 CFR 1221.113 - Use of the NASA Flags.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Use of the NASA Flags. 1221.113 Section 1221.113 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION THE NASA SEAL AND OTHER DEVICES, AND THE CONGRESSIONAL SPACE MEDAL OF HONOR NASA Seal, NASA Insignia, NASA Logotype, NASA Program...
27 CFR 22.113 - Receipt of tax-free alcohol.
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Receipt of tax-free alcohol. 22.113 Section 22.113 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE TREASURY LIQUORS DISTRIBUTION AND USE OF TAX-FREE ALCOHOL Withdrawal and...
2011-09-28
... DEPARTMENT OF COMMERCE International Trade Administration [A-588-854] Certain Tin Mill Products... duty order on certain tin mill products from Japan, pursuant to section 751(c) of the Tariff [[Page... on certain tin mill products from Japan pursuant to section 751(c) of the Act. See Initiation of Five...
International Nuclear Information System (INIS)
Kaplan, T.; Gray, L.J.
1984-01-01
The self-consistent approximation of Kaplan, Leath, Gray, and Diehl is applied to models for substitutional random alloys with muffin-tin potentials. The particular advantage of this approximation is that, in addition to including cluster scattering, the muffin-tin potentials in the alloy can depend on the occupation of the surrounding sites (i.e., environmental disorder is included)
9 CFR 113.55 - Detection of extraneous agents in Master Seed Virus.
2010-01-01
... Master Seed Virus. 113.55 Section 113.55 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Ingredient Requirements § 113.55 Detection of extraneous agents in Master Seed Virus...
Visible Light Photoelectrochemical Properties of N-Doped TiO2 Nanorod Arrays from TiN
Directory of Open Access Journals (Sweden)
Zheng Xie
2013-01-01
Full Text Available N-doped TiO2 nanorod arrays (NRAs were prepared by annealing the TiN nanorod arrays (NRAs which were deposited by using oblique angle deposition (OAD technique. The TiN NRAs were annealed at 330°C for different times (5, 15, 30, 60, and 120 min. The band gaps of annealed TiN NRAs (i.e., N-doped TiO2 NRAs show a significant variance with annealing time, and can be controlled readily by varying annealing time. All of the N-doped TiO2 NRAs exhibit an enhancement in photocurrent intensity in visible light compared with that of pure TiO2 and TiN, and the one annealed for 15 min shows the maximum photocurrent intensity owning to the optimal N dopant concentration. The results show that the N-doped TiO2 NRAs, of which the band gap can be tuned easily, are a very promising material for application in photocatalysis.
Tasmanian tin and tungsten granites - their radiometric characteristics
International Nuclear Information System (INIS)
Yeates, A.N.
1982-01-01
A radiometric survey of Tasmanian granites has shown, with one exception, that tin and tungsten-bearing granites have high radioactivity, largely owing to increased uranium. Many have a high uranium/thorium ratio as well. Radiometric measurements can also delineate different granite types within composite bodies
Fabrication of heterojunction solar cells by improved tin oxide deposition on insulating layer
Feng, Tom; Ghosh, Amal K.
1980-01-01
Highly efficient tin oxide-silicon heterojunction solar cells are prepared by heating a silicon substrate, having an insulating layer thereon, to provide a substrate temperature in the range of about 300.degree. C. to about 400.degree. C. and thereafter spraying the so-heated substrate with a solution of tin tetrachloride in a organic ester boiling below about 250.degree. C. Preferably the insulating layer is naturally grown silicon oxide layer.
RF measurements of a traveling-wave muffin-tin accelerating structure at 90 GHz
International Nuclear Information System (INIS)
Chou, P.J.; Bowden, G.B.; Copeland, M.R.; Menegat, A.; Pritzkau, D.P.; Siemann, R.H.
1997-05-01
A measuring system at the table-top scale was developed for RF measurements of a muffin-tin accelerating structure operating at 32 times the SLAC frequency (2.856 GHz). Both perturbation and non-perturbation methods are employed to characterize the RF properties of a muffin-tin structure. Conventional bead pull measurements are extended to millimeter wavelengths. Design of the measuring system and preliminary results of RF measurements are presented
14 CFR 135.113 - Passenger occupancy of pilot seat.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Passenger occupancy of pilot seat. 135.113... Operations § 135.113 Passenger occupancy of pilot seat. No certificate holder may operate an aircraft type certificated after October 15, 1971, that has a passenger seating configuration, excluding any pilot seat, of...
7 CFR 760.113 - Refunds; joint and several liability.
2010-01-01
... 7 Agriculture 7 2010-01-01 2010-01-01 false Refunds; joint and several liability. 760.113 Section... Agricultural Disaster Assistance Programs § 760.113 Refunds; joint and several liability. (a) In the event that... provided that interest will in all cases run from the date of the original disbursement. (b) All persons...
TinCan: User-Defined P2P Virtual Network Overlays for Ad-hoc Collaboration
Directory of Open Access Journals (Sweden)
Pierre St Juste
2014-10-01
Full Text Available Virtual private networking (VPN has become an increasingly important component of a collaboration environment because it ensures private, authenticated communication among participants, using existing collaboration tools, where users are distributed across multiple institutions and can be mobile. The majority of current VPN solutions are based on a centralized VPN model, where all IP traffic is tunneled through a VPN gateway. Nonetheless, there are several use case scenarios that require a model where end-to-end VPN links are tunneled upon existing Internet infrastructure in a peer-to-peer (P2P fashion, removing the bottleneck of a centralized VPN gateway. We propose a novel virtual network — TinCan — based on peerto-peer private network tunnels. It reuses existing standards and implementations of services for discovery notification (XMPP, reflection (STUN and relaying (TURN, facilitating configuration. In this approach, trust relationships maintained by centralized (or federated services are automatically mapped to TinCan links. In one use scenario, TinCan allows unstructured P2P overlays connecting trusted end-user devices — while only requiring VPN software on user devices and leveraging online social network (OSN infrastructure already widely deployed. This paper describes the architecture and design of TinCan and presents an experimental evaluation of a prototype supporting Windows, Linux, and Android mobile devices. Results quantify the overhead introduced by the network virtualization layer, and the resource requirements imposed on services needed to bootstrap TinCan links.
Lapshina, Elena V [Troitsk, RU; Zhuikov, Boris L [Troitsk, RU; Srivastava, Suresh C [Setauket, NY; Ermolaev, Stanislav V [Obninsk, RU; Togaeva, Natalia R [Obninsk, RU
2012-01-17
The invention provides a method of chemical recovery of no-carrier-added radioactive tin (NCA radiotin) from intermetallide TiSb irradiated with accelerated charged particles. An irradiated sample of TiSb can be dissolved in acidic solutions. Antimony can be removed from the solution by extraction with dibutyl ether. Titanium in the form of peroxide can be separated from tin using chromatography on strong anion-exchange resin. In another embodiment NCA radiotin can be separated from iodide solution containing titanium by extraction with benzene, toluene or chloroform. NCA radiotin can be finally purified from the remaining antimony and other impurities using chromatography on silica gel. NCA tin-117m can be obtained from this process. NCA tin-117m can be used for labeling organic compounds and biological objects to be applied in medicine for imaging and therapy of various diseases.
Electronic Properties of Tin and Bismuth from Angular Correlation of Annihilation Photons
DEFF Research Database (Denmark)
Mogensen, O.E.; Trumpy, Georg
1969-01-01
) deformed bismuth. For both metals, the single-crystal angular-correlation curves lie near to the free-electron parabola. The tin curves show more anisotropy than the bismuth curves. An important result is the clear anisotropy found in the high-momentum part of the curves—the tails—for both metals. Little......A linear slit setup has been used to obtain results of angular-correlation measurements in (a) tin single crystals in three orientations: [001], [100], and [110], (b) bismuth single crystals in four orientations: [111], [100], [1¯10], and [2¯1¯1], (c) solid and liquid tin and bismuth, and (d...... of the liquid-metal curves are smaller and of another form than the tails of polycrystalline curves; no Gaussian with only one adjustable constant factor can give a fit to both tails. No useful method for interpreting liquid-metal angular-correlation curves seems to exist. Two deformed bismuth samples gave...
Production of multifilamentary Nb3Sn composites incorporating a high tin bronze
International Nuclear Information System (INIS)
Petrovich, A.; Zeithlin, B.A.; Walker, M.S.
1977-01-01
The economics and processing methods have been examined for the fabrication of multifilamentary Nb 3 Sn using a high tin bronze reactive matrix. Four conductor configurations utilizing the high tin bronze were compared with a conventional Cu-13 wt % Sn bronze. The most promising of these designs is potentially 40% lower in cost per ampere meter than the conventional composite. Large hydrostatic extrusion facilities, which are required for the high tin processing, are not presently available in this country but can be made by conversion of conventional presses. They exist in Europe. Experiments were conducted to investigate the applicability of hydrostatic extrusion, and billet components were successfully prepared using the hydrostatic extrusion technique. We have concluded that the economics, availability of facilities and initial fabrication results are favorable for this type of conductor and that the next stage in this program of scale up to extrusion and drawing of 2'' to 3'' diameter composite billets should be undertaken
Configuration interaction in charge exchange spectra of tin and xenon
D'Arcy, R.; Morris, O.; Ohashi, H.; Suda, S.; Tanuma, H.; Fujioka, S.; Nishimura, H.; Nishihara, K.; Suzuki, C.; Kato, T.; Koike, F.; O'Sullivan, G.
2011-06-01
Charge-state-specific extreme ultraviolet spectra from both tin ions and xenon ions have been recorded at Tokyo Metropolitan University. The electron cyclotron resonance source spectra were produced from charge exchange collisions between the ions and rare gas target atoms. To identify unknown spectral lines of tin and xenon, atomic structure calculations were performed for Sn14+-Sn17+ and Xe16+-Xe20+ using the Hartree-Fock configuration interaction code of Cowan (1981 The Theory of Atomic Structure and Spectra (Berkeley, CA: University of California Press)). The energies of the capture states involved in the single-electron process that occurs in these slow collisions were estimated using the classical over-barrier model.
113Cd NMR as a Probe of the Active Sites of Metalloenzymes
Armitage, Ian M.; Schoot Uiterkamp, Antonius J.M.; Chlebowski, Jan F.; Coleman, Joseph E.
1978-01-01
113Cd NMR has been used to study the active site metal ion(s) of the 113Cd(II) derivatives of four Zn(II) metalloenzymes, carboxypeptidase A, carbonic anhydrases, alkaline phosphatase, and superoxide dismutase. The resonances of the enzyme-bound 113Cd(II) ions are extremely sensitive to ligand
13 CFR 113.425 - Counseling and use of appraisal and counseling materials.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Counseling and use of appraisal and counseling materials. 113.425 Section 113.425 Business Credit and Assistance SMALL BUSINESS... Activities Prohibited § 113.425 Counseling and use of appraisal and counseling materials. (a) Counseling. A...
Effect of tin doping on oxygen- and carbon-related defects in Czochralski silicon
International Nuclear Information System (INIS)
Chroneos, A.; Londos, C. A.; Sgourou, E. N.
2011-01-01
Experimental and theoretical techniques are used to investigate the impact of tin doping on the formation and the thermal stability of oxygen- and carbon-related defects in electron-irradiated Czochralski silicon. The results verify previous reports that Sn doping reduces the formation of the VO defect and suppresses its conversion to the VO 2 defect. Within experimental accuracy, a small delay in the growth of the VO 2 defect is observed. Regarding carbon-related defects, it is determined that Sn doping leads to a reduction in the formation of the C i O i , C i C s , and C i O i (Si I ) defects although an increase in their thermal stability is observed. The impact of strain induced in the lattice by the larger tin substitutional atoms, as well as their association with intrinsic defects and carbon impurities, can be considered as an explanation to account for the above observations. The density functional theory calculations are used to study the interaction of tin with lattice vacancies and oxygen- and carbon-related clusters. Both experimental and theoretical results demonstrate that tin co-doping is an efficient defect engineering strategy to suppress detrimental effects because of the presence of oxygen- and carbon-related defect clusters in devices.
International Nuclear Information System (INIS)
Bruce A Zeitlin
2005-01-01
An internal tin conductor has been developed using a Mono Element Internal Tin (MEIT) with an integral Nb barrier surrounding the Nb filaments. High current densities of 3000 A/mm2+ at 12 T and 1800 A/mm2 at 15 T have been achieved in conductors as small as 0.152 mm with the use of Nb7.5Ta filaments and Ti in the Sn core. In contrast, conductors with pure Nb and Ti in the Sn achieved 2700 A/mm2 at 12 T. Two internal fins, developed and patented on the project, were introduced into the filament array and reduced the effective filament diameter (Deff) by 38%. Additional fins will further reduce Deff The conductor was produced from 152.4 mm diameter billets to produce wire as small as 0.152 mm. The process promises be scaleable to 304 mm diameter billets yielding wire of 0.304 mm diameter. The MEIT process wire was easy to draw with relatively few breaks. The cost of this conductor in large production quantities based on the cost model presented could meet the 1.5 $/kilo amp meter(KAM) target of the HEP community
Generalized KKR-theory for non-muffin-tin potentials
Molenaar, J.
1989-01-01
The author shows that the secular equation in KKR (Korringa, Kohn and Rostoker) theory retains its separable structure also in the case of non-muffin-tin potentials. This generalisation has been extensively discussed recently. During this discussion, in which the possible necessity of so-called near
McKenna, Keith P.
2018-02-01
First principles calculations are employed to investigate the structure, electronic properties, and oxygen incorporation/diffusion characteristics of the Σ 5 TiN(310) tilt grain boundary with relevance to applications of polycrystalline TiN in microelectronics and protective coatings. We show that the grain boundary does not significantly modify electronic states near the Fermi energy but does induce an upward shift of up to 0.6 eV in a number of deeper occupied bands. We also show that oxygen is preferentially incorporated into the TiN grain boundary (GB) but must overcome relatively high activation energies for further diffusion. These predictions are consistent with the "stuffed barrier model" proposed to explain the good barrier characteristics of TiN. We also show that while the oxidizing power of TiN GBs is not sufficient to reduce HfO2 (a prototypical gate dielectric material), they can act as a scavenger for interstitial oxygen. Altogether, these results provide the much needed atomistic insights into the properties of a model GB in TiN and suggest a number of directions for future investigation.
Effects of Annealing on TiN Thin Film Growth by DC Magnetron Sputtering
Directory of Open Access Journals (Sweden)
Azadeh Jafari
2014-07-01
Full Text Available We have reviewed the deposition of titanium nitride (TiN thin films on stainless steel substrates by a DC magnetron sputtering method and annealing at different annealing temperatures of 500, 600, and 700°C for 120 min in nitrogen/argon atmospheres. Effects of annealing temperatures on the structural and the optical properties of TiN films were investigated using X-ray diffraction (XRD, atomic force microscope (AFM, field emission scanning electron microscopy (FESEM, and UV-VIS spectrophotometer. Our experimental studies reveal that the annealing temperature appreciably affected the structures, crystallite sizes, and reflection of the films. By increasing the annealing temperature to 700°C crystallinity and reflection of the film increase. These results suggest that annealed TiN films can be good candidate for tokamak first wall due to their structural and optical properties.
Research on hardness and tensile properties of A390 alloy with tin addition
Si, Yi
2018-03-01
The effect of tin content on hardness and tensile properties of A390 alloys has been discussed. The microstructure of the A390 alloy with tin addition has been surveyed by OM and investigated by SEM. Research showed that β-Sn in the alloy precipitation forms were mainly small blocks and thin strips, particles within the Al2Cu network or large blocks consisting of β-Sn and Al2Cu on Al/Si interfaces or α-Al grain boundaries. Spheroidization of the primary and eutectic silicon was improved due to Sn accretion. With the augment of element tin, hardness of casting alloy is much higher than that of alloy after heat treatment. The elongation and ultimate tensile strength (UTS) were increased in Sn addition from 0 to 1%, which is attributed to the multiple action of Sn.
Selectivity of Catalytically Modified Tin Dioxide to CO and NH3 Gas Mixtures
Directory of Open Access Journals (Sweden)
Artem Marikutsa
2015-10-01
Full Text Available This paper is aimed at selectivity investigation of gas sensors, based on chemically modified nanocrystalline tin dioxide in the detection of CO and ammonia mixtures in air. Sol-gel prepared tin dioxide was modified by palladium and ruthenium oxides clusters via an impregnation technique. Sensing behavior to CO, NH3 and their mixtures in air was studied by in situ resistance measurements. Using the appropriate match of operating temperatures, it was shown that the reducing gases mixed in a ppm-level with air could be discriminated by the noble metal oxide-modified SnO2. Introducing palladium oxide provided high CO-sensitivity at 25–50 °C. Tin dioxide modified by ruthenium oxide demonstrated increased sensor signals to ammonia at 150–200 °C, and selectivity to NH3 in presence of higher CO concentrations.
Tin-Assisted Synthesis of ɛ -Ga2O3 by Molecular Beam Epitaxy
Kracht, M.; Karg, A.; Schörmann, J.; Weinhold, M.; Zink, D.; Michel, F.; Rohnke, M.; Schowalter, M.; Gerken, B.; Rosenauer, A.; Klar, P. J.; Janek, J.; Eickhoff, M.
2017-11-01
The synthesis of ɛ -Ga2O3 and β -Ga2O3 by plasma-assisted molecular beam epitaxy on (001 )Al2O3 substrates is studied. The growth window of β -Ga2O3 in the Ga-rich regime, usually limited by the formation of volatile gallium suboxide, is expanded due to the presence of tin during the growth process, which stabilizes the formation of gallium oxides. X-ray diffraction, transmission electron microscopy, time-of-flight secondary-ion mass spectrometry, Raman spectroscopy, and atomic force microscopy are used to analyze the influence of tin on the layer formation. We demonstrate that it allows the synthesis of phase-pure ɛ -Ga2O3 . A growth model based on the oxidation of gallium suboxide by reduction of an intermediate sacrificial tin oxide is suggested.
A Low Temperature Synthetic Route to Nanocrystalline TiN
African Journals Online (AJOL)
NICO
This method may be extended to the synthesis of other metal nitrides. ... direct current magnetron sputtering17, and mechanical mill- ... recent years, autoclaved synthesis of TiN nanomaterials from ... 3.2 XPS Characterization of the Samples.
9 CFR 113.25 - Culture media for detection of bacteria and fungi.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Culture media for detection of bacteria and fungi. 113.25 Section 113.25 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... STANDARD REQUIREMENTS Standard Procedures § 113.25 Culture media for detection of bacteria and fungi. (a...
Beta-delayed proton emitter $^{113}Xe$
Hagberg, E; Jonson, B; Jørgensen, B; Kugler, E; Mowinckel, T
1973-01-01
The ISOLDE facility at the CERN synchrocyclotron has been used for extending the series of beta -delayed proton emitters in xenon to masses lighter than those previously observed (/sup 115,117/Xe). Owing to the rapid decrease of the yields, experiments with solid-state counters were inconclusive, and instead a new and much more sensitive method based on nuclear emulsions was developed. The mass range 111-114 showed one new activity, /sup 113/Xe, with a half-life of 2.8+or-0.2 sec. From measurements of the track lengths for a total of 1130 protons from /sup 113/Xe it was possible to determine the energy spectrum. The results extend the systematics of beta -strength functions in the light xenon isotopes. (19 refs).
International Nuclear Information System (INIS)
Vertes, A.; Suba, M.; Varsanyi-Lakatos, M.; Czako-Nagy, I.; Pchelnikov, A.P.; Losev, V.V.
1982-01-01
Moessbauer measurements on electrodeposited and cast brass containing 1-4 m% tin were carried out using conversion electron detector. It was found that the tin formed phases with copper but not with zinc. The identified phases were β, γ, epsilon and eta and their ratio depended on the tin concentration and on the preparation process of the brass. The corrosion behaviour of the samples was also studied. (author)
19 CFR 113.1 - Authority to require security or execution of bond.
2010-04-01
... 19 Customs Duties 1 2010-04-01 2010-04-01 false Authority to require security or execution of bond. 113.1 Section 113.1 Customs Duties U.S. CUSTOMS AND BORDER PROTECTION, DEPARTMENT OF HOMELAND SECURITY; DEPARTMENT OF THE TREASURY CUSTOMS BONDS General Provisions § 113.1 Authority to require security or...
Variationally-optimized muffin-tin potentials for band calculations
International Nuclear Information System (INIS)
Pant, M.M.
1979-09-01
A method is suggested to determine the best local periodic crystal potential V(r) by minimizing the Hartree-Fock expectation value of the energy. The explicit form of the integral equation for the local exchange potential is obtained for the special case of the Muffin-tin aproximation. (author)
Modification of anomalous deposition of Zn-Ni alloy by using tin additions
Energy Technology Data Exchange (ETDEWEB)
Zhou Zeyang; O`Keefe, T.J. [Missouri Univ., Rolla, MO (United States). Dept. of Metallurgical Engineering
1997-11-25
One of the common examples of anomalous deposition in electrolytic processing is the Zn-Ni alloy coating system. These alloys, in the range 10-15% Ni, are also of commercial interest in electrogalvanizing for protecting steel from corrosion while retaining good formability, weldability and paintability. The primary objective of this research was to obtain a better fundamental understanding of anomalous deposition and to identify ways to modify its influence. Specifically, the effects of tin additions on the composition, structure and surface morphology of Zn-Ni alloy deposits from electrolyte containing 80 g l{sup -1} Zn and 10 g l{sup -1} Ni were studied. Previous work had shown that low concentrations (parts per million) of cations such as antimony and arsenic were very effective in countering the anomalous deposition and increasing the relative nickel content of the deposits. Unfortunately, the morphology and current efficiency were adversely affected by use of these additives. It was found that the addition of tin also appreciably increased the nickel content of the alloy deposit, as well as giving smooth, dense deposits with a current efficiency of about 90%. The surface morphology of the deposits was correlated with the amount of tin added. The limited electrochemical impedance spectroscopy tests conducted showed that the low concentrations of tin did lower the charge transfer resistance of the reaction. Overall, the results were promising but considerably more research is needed to elucidate the basic factors that influence zinc alloy electrocrystallization mechanisms. (orig.) 27 refs.
Tin - an unlikely ally for silicon field effect transistors?
Hussain, Aftab M.; Fahad, Hossain M.; Singh, Nirpendra; Sevilla, Galo T.; Schwingenschlö gl, Udo; Hussain, Muhammad Mustafa
2014-01-01
We explore the effectiveness of tin (Sn), by alloying it with silicon, to use SiSn as a channel material to extend the performance of silicon based complementary metal oxide semiconductors. Our density functional theory based simulation shows
Mlynarczyk, Michael S. J.; Williams-Jones, Anthony E.
2005-12-01
The Inner Arc of the Central Andes, broadly corresponding to the Eastern Cordillera, is the location of a rich Tertiary and Triassic Sn-W-(Ag-base metal) metallogenic province, commonly referred to as the Bolivian tin belt. We propose that the Tertiary metallogeny, which generated most of the tin ores, was a direct consequence of discrete "collisions" between the South American plate and the Nazca slab and sub-slab mantle, during the ongoing Andean orogeny. Evidence supporting this proposal include: (1) the coincidence of the tin province and the Inner Arc in a marked "hump" in the Andean orogen, which may represent tectonic indentation; (2) the symmetry of the tin province with respect to the Bolivian orocline, the axis of which corresponds to the direction of highest compression; (3) the relative symmetry of the magmatism and tin mineralization with respect to this axis; (4) the concurrent timing of mineralization and compressional pulses; (5) the similar host rock geochemistry and ore lead isotope data, testifying to a common crustal reservoir; and (6) the striking similarity of the igneous suites, associated with the ore deposits to those from "typical" collisional orogens. A number of studies have called upon a persistent tin anomaly to explain the metallogeny of the region. We propose, instead, that the latter is better explained by periodic compressional interaction between the Farallon/Nazca oceanic plate and the South American continent. This led to the generation of peraluminous magmas, which during fractional crystallization exsolved the fluids responsible for the voluminous Sn-W mineralization.
Combinatorial study of zinc tin oxide thin-film transistors
McDowell, M. G.; Sanderson, R. J.; Hill, I. G.
2008-01-01
Groups of thin-film transistors using a zinc tin oxide semiconductor layer have been fabricated via a combinatorial rf sputtering technique. The ZnO :SnO2 ratio of the film varies as a function of position on the sample, from pure ZnO to SnO2, allowing for a study of zinc tin oxide transistor performance as a function of channel stoichiometry. The devices were found to have mobilities ranging from 2to12cm2/Vs, with two peaks in mobility in devices at ZnO fractions of 0.80±0.03 and 0.25±0.05, and on/off ratios as high as 107. Transistors composed predominantly of SnO2 were found to exhibit light sensitivity which affected both the on/off ratios and threshold voltages of these devices.
International Nuclear Information System (INIS)
Dubent, S.; Mertens, M.L.A.D.; Saurat, M.
2010-01-01
Tin-zinc alloy electroplated coatings are recognized as a potential alternative to toxic cadmium as corrosion resistant deposits because they combine the barrier protection of tin with the cathodic protection afforded by zinc. The coatings containing 20 wt.% zinc, balance tin, offer excellent corrosion protection for steel and do not form gross voluminous white corrosion products like pure zinc or high zinc alloy deposits. In this study, the effects of variables of the process (i.e. cathodic current density, pH and temperature) on deposit composition have been evaluated using a Hull cell to obtain 20 wt.% zinc alloy coatings. The tin-20 wt.% zinc deposits, produced with electroplating optimized conditions, were characterized by scanning electron microscopy (SEM), energy dispersive X-ray spectrometry (EDS), X-ray fluorescence spectrometry (XRF) and glow discharge optical emission spectrometry (GDOES). On the other hand, the corrosion behaviour of tin-zinc alloy electroplated coatings on steel has been investigated using electrochemical methods in a 3 wt.% NaCl solution and the salt spray test. The performance of the deposits was compared with cadmium and zinc-nickel electrodeposited coatings. The results show that the corrosion resistance of tin-20 wt.% zinc alloy coating is superior to that of cadmium and zinc-12 wt.% nickel coatings. Finally, sliding friction tests were conducted.
Zheng, Xianwei; Xiong, Hanjiang; Gong, Jianya; Yue, Linwei
2017-07-01
Virtual globes play an important role in representing three-dimensional models of the Earth. To extend the functioning of a virtual globe beyond that of a "geobrowser", the accuracy of the geospatial data in the processing and representation should be of special concern for the scientific analysis and evaluation. In this study, we propose a method for the processing of large-scale terrain data for virtual globe visualization and analysis. The proposed method aims to construct a morphologically preserved multi-resolution triangulated irregular network (TIN) pyramid for virtual globes to accurately represent the landscape surface and simultaneously satisfy the demands of applications at different scales. By introducing cartographic principles, the TIN model in each layer is controlled with a data quality standard to formulize its level of detail generation. A point-additive algorithm is used to iteratively construct the multi-resolution TIN pyramid. The extracted landscape features are also incorporated to constrain the TIN structure, thus preserving the basic morphological shapes of the terrain surface at different levels. During the iterative construction process, the TIN in each layer is seamlessly partitioned based on a virtual node structure, and tiled with a global quadtree structure. Finally, an adaptive tessellation approach is adopted to eliminate terrain cracks in the real-time out-of-core spherical terrain rendering. The experiments undertaken in this study confirmed that the proposed method performs well in multi-resolution terrain representation, and produces high-quality underlying data that satisfy the demands of scientific analysis and evaluation.
Depósito de TiN sobre herramientas de corte para uso industrial
Directory of Open Access Journals (Sweden)
Auger, M. A.
2004-04-01
Full Text Available TiN coatings on stainless steel blades for glass fibre cutting have been investigated in this work. The aim was to improve their mechanical properties and increase the tool time life, decreasing in this way the production stops. Reactive magnetron sputtering has been the deposition technique. TiN films chemical composition has been determined by AES (Auger Electron Spectroscopy, RBS (Rutherford Backscattering Spectroscopy and XANES (X-Ray Spectroscopy Near the Absorption Edge, and it has been correlated to the gas mixture composition in the vacuum chamber. Crystalline structure has been determined by X-Ray Diffraction, and the films morphology has been observed by SEM (Scanning Electron Microscopy. The hardness coating has been extracted from nanoindentation measurements, giving a 21.54±1.04 GPa hardness value, typical for TiN in the literature. Factory proofs for coated cutting blades show a 67% lifetime increase.
En este trabajo se han estudiado láminas de TiN crecidas sobre cuchillas de acero inoxidable empleadas en el corte de fibra de vidrio, para mejorar sus propiedades mecánicas y aumentar el tiempo de vida de la herramienta, reduciendo de este modo las paradas de producción. La técnica de depósito utilizada ha sido la de sputtering magnetrón reactivo. La composición química de las capas de TiN ha sido determinada mediante medidas de Espectroscopía Auger, RBS (Rutherford Backscattering Spectroscopy y XANES (X-Ray Spectroscopy Near the Absorption Edge y se ha relacionado con la composición de la mezcla gaseosa presente en la cámara de reacción. La estructura cristalina se ha determinado mediante Difracción de Rayos X, y mediante la técnica de SEM (Scanning Electron Microscopy se ha observado la morfología de las capas. La dureza del recubrimiento se ha calculado a partir de medidas de nanoindentación, obteniéndose un valor de 21.54±1.04 GPa, típico en la literatura para el TiN. Los resultados de la prueba en f
Effect of fabrication conditions on the properties of indium tin oxide powders
International Nuclear Information System (INIS)
Xie Wei
2008-01-01
This paper reports that indium tin oxide (ITO) crystalline powders are prepared by coprecipitation method. Fabrication conditions mainly as sintering temperature and Sn doping content are correlated with the phase, microstructure, infrared emissivity in and powder resistivity of indium tin oxides by means of x-ray diffraction, Fourier transform infrared, and transmission electron microscope. The optimum sintering temperature of 1350°C and Sn doping content 6∼8wt% are determined. The application of ITO in the military camouflage field is proposed. (condensed matter: electronic structure, electrical, magnetic, and optical properties)
Magnetron sputtered TiN thin films toward enhanced performance supercapacitor electrodes
Wei, Binbin
2018-04-09
Supercapacitors as a new type of energy storage devices bridging the gap between conventional capacitors and batteries have aroused widespread concern. Herein, binder-free titanium nitride (TiN) thin film electrodes for supercapacitors prepared by reactive magnetron sputtering technology are reported. The effect of N2 content on the supercapacitor performance is evaluated. A highest specific capacitance of 27.3 mF cm−2 at a current density of 1.0 mA cm−2, together with excellent cycling performance (98.2% capacitance retention after 20,000 cycles at 2.0 mA cm−2) is achieved in a 0.5 M H2SO4 aqueous electrolyte. More importantly, a symmetric supercapacitor device assembled on the basis of TiN thin films can deliver a maximum energy density of 17.6 mWh cm−3 at a current density of 0.2 mA cm−2 and a maximum power density of 10.8 W cm−3 at a current density of 2 mA cm−2 with remarkable cycling stability. As a consequence, TiN thin films demonstrate great potential as promising supercapacitor electrode materials.
Pourbaix Diagrams at Elevated Temperatures A Study of Zinc and Tin
Palazhchenko, Olga
Metals in industrial settings such as power plants are often subjected to high temperature and pressure aqueous environments, where failure to control corrosion compromises worker and environment safety. For instance, zircaloy (1.2-1.7 wt.% Sn) fuel rods are exposed to aqueous 250-310 °C coolant in CANDU reactors. The Pourbaix (EH-pH) diagram is a plot of electrochemical potential versus pH, which shows the domains of various metal species and by inference, corrosion susceptibility. Elevated temperature data for tin +II and tin +IV species were obtained using solid-aqueous phase equilibria with the respective oxides, in a batch vessel with in-situ pH measurement. Solubilities, determined via spectroscopic techniques, were used to calculate equilibrium constants and the Gibbs energies of Sn complexes for E-pH diagram construction. The SnOH3+ and Sn(OH )-5 species were incorporated, for the first time, into the 298.15 K and 358.15 K diagrams, with novel Go values determined at 358.15 K. Key words: Pourbaix diagrams, EH-pH, elevated temperatures, solubility, equilibrium, metal oxides, hydrolysis, redox potential, pH, thermochemical data, tin, zinc, zircaloy, corrosion, passivity.
Magnetron sputtered TiN thin films toward enhanced performance supercapacitor electrodes
Wei, Binbin; Liang, Hanfeng; Zhang, Dongfang; Qi, Zhengbing; Shen, Hao; Wang, Zhoucheng
2018-01-01
Supercapacitors as a new type of energy storage devices bridging the gap between conventional capacitors and batteries have aroused widespread concern. Herein, binder-free titanium nitride (TiN) thin film electrodes for supercapacitors prepared by reactive magnetron sputtering technology are reported. The effect of N2 content on the supercapacitor performance is evaluated. A highest specific capacitance of 27.3 mF cm−2 at a current density of 1.0 mA cm−2, together with excellent cycling performance (98.2% capacitance retention after 20,000 cycles at 2.0 mA cm−2) is achieved in a 0.5 M H2SO4 aqueous electrolyte. More importantly, a symmetric supercapacitor device assembled on the basis of TiN thin films can deliver a maximum energy density of 17.6 mWh cm−3 at a current density of 0.2 mA cm−2 and a maximum power density of 10.8 W cm−3 at a current density of 2 mA cm−2 with remarkable cycling stability. As a consequence, TiN thin films demonstrate great potential as promising supercapacitor electrode materials.
Tin dioxide sol-gel derived films doped with platinum and antimony deposited on porous silicon
Savaniu, C.; Arnautu, A.; Cobianu, C.; Craciun, G.; Flueraru, C.; Zaharescu, M.; Parlog, C.; Paszti, F.; van den Berg, Albert
1999-01-01
SnO2 sol-gel derived thin films doped simultaneously with Pt and Sb are obtained and reported for the first time. The Sn sources were tin(IV) ethoxide or tin(II) ethylhexanoate, while hexachloroplatinic acid (H2PtCl6) and antimony chloride (SbCl3) were used as platinum and antimony sources,
Li, Zhi; Zhang, Jiwei; Shu, Jie; Chen, Jianping; Gong, Chunhong; Guo, Jianhui; Yu, Laigui; Zhang, Jingwei
2018-03-01
One-dimensional carbon nanofibers with highly dispersed tin (Sn) and tin antimonide (SnSb) nanoparticles are prepared by electrospinning in the presence of antimony-doped tin oxide (denoted as ATO) wet gel as the precursor. The effect of ATO dosage on the microstructure and electrochemical properties of the as-fabricated Sn-SnSb/C composite nanofibers is investigated. Results indicate that ATO wet gel as the precursor can effectively improve the dispersion of Sn nanoparticles in carbon fiber and prevent them from segregation during the electrospinning and subsequent calcination processes. The as-prepared Sn-SnSb/C nanofibers as the anode materials for lithium-ion batteries exhibit high reversible capacity and stable cycle performance. Particularly, the electrode made from Sn-SnSb/C composite nanofibers obtained with 0.9 g of ATO gel has a high specific capacity of 779 mAh·g-1 and 378 mAh·g-1 at the current density of 50 mA·g-1 and 5 A·g-1, respectively, and it exhibits a capacity retention of 97% after 1200 cycles under the current density of 1 A·g-1. This is because the carbon nanofibers can form a continuous conductive network to buffer the volume change of the electrodes while Sn and Sn-SnSb nanoparticles uniformly distributed in the carbon nanofibers are free of segregation, thereby contributing to electrochemical performances of the electrodes.
Energy Technology Data Exchange (ETDEWEB)
Al-Hamdi, Abdullah M.; Sillanpää, Mika [Laboratory of Green Chemistry, Lappeenranta University of Technology, Sammonkatu 12, 50130 Mikkeli (Finland); Dutta, Joydeep, E-mail: dutta@squ.edu.om [Chair in Nanotechnology, Water Research Center, Sultan Qaboos University, P.O. Box 17, 123 Al-Khoudh (Oman)
2015-01-05
Highlights: • A sol–gel method used to synthesize tin oxide nanoparticles. • Nanoparticles of tin oxide doped with different iodine concentrations. • Degradation studies carried up with UV–vis, TOC, HPLC and GC instruments. • 1% iodine doped tin dioxide showed maximum photodegradation efficiency. - Abstract: Iodine doped tin oxide (SnO{sub 2}:I) nanoparticles were prepared by sol–gel synthesis and their photocatalytic activities with phenol as a test contaminant were studied. In the presence of the catalysts, phenol degradation under direct sunlight was comparable to what was achieved under laboratory conditions. Photocatalytic oxidation reactions were studied by varying the catalyst loading, light intensity, illumination time, pH of the reactant and phenol concentration. Upon UV irradiation in the presence of SnO{sub 2}:I nanoparticles, phenol degrades very rapidly within 30 min, forming carboxylic acid which turns the solution acidic. Phenol degradation rate with 1% iodine doped SnO{sub 2} nanoparticles is at least an order of magnitude higher compared to the degradation achieved through undoped SnO{sub 2} nanoparticles under similar illumination conditions.
International Nuclear Information System (INIS)
Al-Hamdi, Abdullah M.; Sillanpää, Mika; Dutta, Joydeep
2015-01-01
Highlights: • A sol–gel method used to synthesize tin oxide nanoparticles. • Nanoparticles of tin oxide doped with different iodine concentrations. • Degradation studies carried up with UV–vis, TOC, HPLC and GC instruments. • 1% iodine doped tin dioxide showed maximum photodegradation efficiency. - Abstract: Iodine doped tin oxide (SnO 2 :I) nanoparticles were prepared by sol–gel synthesis and their photocatalytic activities with phenol as a test contaminant were studied. In the presence of the catalysts, phenol degradation under direct sunlight was comparable to what was achieved under laboratory conditions. Photocatalytic oxidation reactions were studied by varying the catalyst loading, light intensity, illumination time, pH of the reactant and phenol concentration. Upon UV irradiation in the presence of SnO 2 :I nanoparticles, phenol degrades very rapidly within 30 min, forming carboxylic acid which turns the solution acidic. Phenol degradation rate with 1% iodine doped SnO 2 nanoparticles is at least an order of magnitude higher compared to the degradation achieved through undoped SnO 2 nanoparticles under similar illumination conditions
Shape-selective Valorization of Biomass-derived Glycolaldehyde using Tin-containing Zeolites
DEFF Research Database (Denmark)
Tolborg, Søren; Meier, Sebastian; Shunmugavel, Saravanamurugan
2016-01-01
sugars while hindering consecutive aldol reactions leading to hexose sugars. High yields of tetrose sugars (74 %) with minor amounts of vinyl glycolic acid (VGA), an α-hydroxyacid, are obtained using Sn-MFI with selectivities towards C4 products reaching 97 %. Tin catalysts having large pores or no pore...... structure (Sn-Beta, Sn-MCM-41, Sn-SBA-15, tin chloride) led to lower selectivities for C4 sugars due to formation of hexose sugars. In the case of Sn-Beta, VGA is the main product (30 %), illustrating differences in selectivity of the Sn sites in the different frameworks. Under optimized conditions, GA can...
Spray deposited gallium doped tin oxide thinfilm for acetone sensor application
Preethi, M. S.; Bharath, S. P.; Bangera, Kasturi V.
2018-04-01
Undoped and gallium doped (1 at.%, 2 at.% and 3 at.%) tin oxide thin films were prepared using spray pyrolysis technique by optimising the deposition conditions such as precursor concentration, substrate temperature and spraying rate. X-ray diffraction analysis revealed formation of tetragonally structured polycrystalline films. The SEM micrographs of Ga doped films showed microstructures. The electrical resistivity of the doped films was found to be more than that of the undoped films. The Ga-doped tin oxide thin films were characterised for gas sensors. 1 at.% Ga doped thin films were found to be better acetone gas sensor, showed 68% sensitivity at 350°C temperature.
13 CFR 113.135 - Designation of responsible employee and adoption of grievance procedures.
2010-01-01
... employee and adoption of grievance procedures. 113.135 Section 113.135 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION NONDISCRIMINATION IN FINANCIAL ASSISTANCE PROGRAMS OF SBA-EFFECTUATION OF POLICIES... Programs or Activities Receiving Federal Financial Assistance Introduction § 113.135 Designation of...
Tank 241-TX-113 rotary mode core sampling and analysis plan
International Nuclear Information System (INIS)
McCain, D.J.
1998-01-01
This sampling and analysis plan (SAP) identities characterization objectives pertaining to sample collection, laboratory analytical evaluation, and reporting requirements for push mode core samples from tank 241-TX-113 (TX-113). The Tank Characterization Technical Sampling Basis document identities Retrieval, Pretreatment and Immobilization as an issue that applies to tank TX-113. As a result, a 150 gram composite of solids shall be made and archived for that program. This tank is not on a Watch List
Leao, Danilo J; Junior, Mario M S; Brandao, Geovani C; Ferreira, Sergio L C
2016-06-01
A method was established to simultaneously determine cadmium, iron and tin in canned-food samples using high-resolution continuum source graphite furnace atomic absorption spectrometry (HR-CS GF AAS). The quantification step has been performed using the primary line (228.802nm) for cadmium and the adjacent secondary lines (228.725nm and 228.668nm) for iron and tin, respectively. The selected chemical modifier was an acid solution that contained a mixture of 0.1% (w/v) Pd and 0.05% (w/v) Mg. The absorbance signals were measured based on the peak area using 3 pixels for cadmium and 5 pixels for iron and tin. Under these conditions, cadmium, iron and tin have been determined in canned-food samples using the external calibration technique based on aqueous standards, where the limits of quantification were 2.10ngg(-1) for cadmium, 1.95mgkg(-1) for iron and 3.00mgkg(-1) for tin, and the characteristic masses were 1.0pg for cadmium, 0.9ng for iron and 1.1ng for tin. The precision was evaluated using two solutions of each metal ion, and the results, which were expressed as the relative standard deviation (RSD%), were 3.4-6.8%. The method accuracy for cadmium and iron was confirmed by analyzing a certified reference material of apple leaves (NIST 1515), which was supplied by NIST. However, for tin, the accuracy was confirmed by comparing the results of the proposed method and another analytical technique (inductively coupled plasma optical emission spectrometry). The proposed procedure was applied to determine cadmium, iron and tin in canned samples of peeled tomato and sardine. Eleven samples were analyzed, and the analyte concentrations were 3.57-62.9ngg(-1), 2.68-31.48mgkg(-1) and 4.06-122.0mgkg(-1) for cadmium, iron and tin, respectively. In all analyzed samples, the cadmium and tin contents were lower than the permissible maximum levels for these metals in canned foods in the Brazilian legislation. Copyright © 2016. Published by Elsevier B.V.
9 CFR 113.215 - Bovine Virus Diarrhea Vaccine, Killed Virus.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Bovine Virus Diarrhea Vaccine, Killed Virus. 113.215 Section 113.215 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD...
Descotes, V.; Bellot, J.-P.; Perrin-Guérin, V.; Witzke, S.; Jardy, A.
2016-07-01
Titanium Nitride (TiN) inclusions are commonly observed in a Maraging steel containing Nitrogen and Titanium and remelted in a VAR furnace. They can be easily detected by optical microscopy. A nucleus is observed next to a large number of TiN inclusions. A TEM analysis was carried out on a biphasic nucleus composed of a calcium sulfide (CaS) and a spinel (MgAl2O4), surrounded by a TiN particle. An orientation relationship between these three phases was revealed, which suggests a heterogeneous germination of the TiN particle on the nucleus by epitaxial growth. Based on this observation, on thermodynamic considerations and on previous work, a model has been developed and coupled to a numerical simulation of the VAR process to study the formation and evolution of a TiN distribution in the VAR ingot. Microsegregation is modeled using the lever rule, while the kinetics of precipitation is mainly driven by the supersaturation of the liquid bath. This model highlights the influence of the melt rate on the final size of TiN particles.
International Nuclear Information System (INIS)
Marchive, Daniel; Treheux, Daniel; Guiraldenq, Pierre
1976-01-01
The ferritic action of tin for a 18-10 stainless steel has been measured by two different methods: the first is based on the diffusion couple method and the graphical representation of compositions in a diagram α/α + γ/γ corresponding to ferrite and austenitic elements of the steel. In the second method, ferrite formation is analyzed in small ingots prepared with different chromium and tin concentrations. Ferrite coefficient of tin, compared to chromium is 0.25 with diffusion couples and this value is in good agreement with the classical method [fr
Nelson, Nya D; Dodson, Lois M; Escudero, Laura; Sukumar, Ann T; Williams, Christopher L; Mihalek, Ivana; Baldan, Alessandro; Baird, Duncan M; Bertuch, Alison A
2018-03-26
TIN2 is central to the shelterin complex, linking the telomeric proteins TRF1 and TRF2 with TPP1/POT1. Mutations in TINF2 , which encodes TIN2, that are found in dyskeratosis congenita (DC) result in very short telomeres and cluster in a region shared by the two TIN2 isoforms, TIN2S (short) and TIN2L (long). Here we show that TIN2L, but not TIN2S, is phosphorylated. TRF2 interacts more with TIN2L than TIN2S, and both the DC-cluster and phosphorylation promote this enhanced interaction. The binding of TIN2L, but not TIN2S, is affected by TRF2-F120, which is also required for TRF2's interaction with end processing factors such as Apollo. Conversely, TRF1 interacts more with TIN2S than with TIN2L. A DC-associated mutation further reduces TIN2L-TRF1, but not TIN2S-TRF1, interaction. Cells overexpressing TIN2L or phosphomimetic-TIN2L are permissive to telomere elongation, whereas cells overexpressing TIN2S or phosphodead-TIN2L are not. Telomere lengths are unchanged in cell lines in which TIN2L expression has been eliminated by CRISPR/Cas9-mediated mutation. These results indicate that TIN2 isoforms are biochemically and functionally distinguishable, and that shelterin composition could be fundamentally altered in patients with TINF2 mutations. Copyright © 2018 Nelson et al.
International Nuclear Information System (INIS)
1990-01-01
The Tex Tin Corporation facility, formerly Gulf Chemical and Metallurgical Corporation, is a proposed National Priorities List site located in Texas City, Galveston County, Texas. Tex Tin previously operated as a primary tin smelter, but currently operates as a copper smelter. Significant concentrations of metals (antimony, arsenic, barium, cadmium, chromium, copper, lead, manganese, mercury, nickel, silver, tin, and zinc) have been detected on-site in surface water, groundwater, and soil. Significant concentrations of metals (arsenic, cadmium, chromium, lead, nickel, and tin) have also been detected in ambient air samples collected off-site. Some remediation activities have occurred on-site including the closure of a 19-million-gallon ferric chloride pond and the removal of approximately 4,000 drums containing radioactive material. The Tex Tin site poses a potential public health concern for on-site workers, residents living in nearby neighborhoods, and possibly for a limited number of residents on private wells located within approximately one mile of the site
Chemical vapor deposition of tin oxide: fundamentals and applications
Mol, A.M.B. van; Chae, Y.; McDaniel, A.H.; Allendorf, M.D.
2006-01-01
Tin oxide thin layers have very beneficial properties such as a high transparency for visible light and electrical conductivity making these coatings suitable for a wide variety of applications, such as solar cells, and low-emissivity coatings for architectural glass windows. Each application
Mechanical Properties of Glass Surfaces Coated with Tin Oxide
DEFF Research Database (Denmark)
Swindlehurst, W. E.; Cantor, B.
1978-01-01
The effect of tin oxide coatings on the coefficient of friction and fracture strength of glass surfaces is studied. Experiments were performed partly on commercially treated glass bottles and partly on laboratory prepared microscope slides. Coatings were applied in the laboratory by decomposition...
Accommodation of tin in tetragonal ZrO{sub 2}
Energy Technology Data Exchange (ETDEWEB)
Bell, B. D. C.; Grimes, R. W.; Wenman, M. R., E-mail: m.wenman@imperial.ac.uk [Department of Materials and Centre for Nuclear Engineering, Imperial College, London SW7 2AZ (United Kingdom); Murphy, S. T. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Burr, P. A. [Department of Materials and Centre for Nuclear Engineering, Imperial College, London SW7 2AZ (United Kingdom); Institute of Materials Engineering, Australian Nuclear Science and Technology Organisation, Menai, New South Wales 2234 (Australia)
2015-02-28
Atomic scale computer simulations using density functional theory were used to investigate the behaviour of tin in the tetragonal phase oxide layer on Zr-based alloys. The Sn{sub Zr}{sup ×} defect was shown to be dominant across most oxygen partial pressures, with Sn{sub Zr}{sup ″} charge compensated by V{sub O}{sup ••} occurring at partial pressures below 10{sup −31 }atm. Insertion of additional positive charge into the system was shown to significantly increase the critical partial pressure at which Sn{sub Zr}{sup ″} is stable. Recently developed low-Sn nuclear fuel cladding alloys have demonstrated an improved corrosion resistance and a delayed transition compared to Sn-containing alloys, such as Zircaloy-4. The interaction between the positive charge and the tin defect is discussed in the context of alloying additions, such as niobium and their influence on corrosion of cladding alloys.
Energy Technology Data Exchange (ETDEWEB)
Wang, Wei; Li, Lingzi; Yeo, Yee-Chia, E-mail: yeo@ieee.org [Department of Electrical and Computer Engineering, National University of Singapore, Singapore 117576 (Singapore); Tok, Eng Soon [Department of Physics, National University of Singapore, Singapore 117551 (Singapore)
2015-06-14
This work demonstrates and describes for the first time an unusual strain-relaxation mechanism by the formation and self-assembly of well-ordered tin wires during the thermal annealing of epitaxial Ge{sub 0.83}Sn{sub 0.17}-on-Ge(001) substrate. Fully strained germanium-tin alloys (Ge{sub 0.83}Sn{sub 0.17}) were epitaxially grown on Ge(001) substrate by molecular beam epitaxy. The morphological and compositional evolution of Ge{sub 0.83}Sn{sub 0.17} during thermal annealing is studied by atomic force microscopy, X-ray diffraction, transmission electron microscopy. Under certain annealing conditions, the Ge{sub 0.83}Sn{sub 0.17} layer decomposes into two stable phases, and well-defined Sn wires that are preferentially oriented along two orthogonal 〈100〉 azimuths are formed. The formation of the Sn wires is related to the annealing temperature and the Ge{sub 0.83}Sn{sub 0.17} thickness, and can be explained by the nucleation of a grain with Sn islands on the outer front, followed by grain boundary migration. The Sn wire formation process is found to be thermally activated, and an activation enthalpy (E{sub c}) of 0.41 eV is extracted. This thermally activated phase transformation, i.e., 2D epitaxial layer to 3D wires, occurs via a mechanism akin to “cellular precipitation.” This synthesis route of Sn wires opens new possibilities for creation of nanoscale patterns at high-throughput without the need for lithography.
Effect of passive film on electrochemical surface treatment for indium tin oxide
International Nuclear Information System (INIS)
Wu, Yung-Fu; Chen, Chi-Hao
2013-01-01
Highlights: ► Oxalic, tartaric, and citric acid baths accompanying with applied voltages were used to treat the ITO surface. ► We investigated the changes in ITO surfaces by examining the potentiodynamic behavior of ITO films. ► AFM analysis showed the formation of a passive layer could assist to planarize surface. ► XPS analysis indicated this passive layer was mainly composed of SnO 2. ► A better planarization was obtained by treating in 3.0 wt.% tartaric acid at 0.5 V due to weak complexation strength. - Abstract: Changes in indium tin oxide (ITO) film surface during electrochemical treatment in oxalic acid, tartaric acid, and citric acid were investigated. Controlling the voltage applied on ITO film allows the formation of a passive layer, effectively protecting the film surface. X-ray photoelectron spectrometry showed that the passive layer composition was predominantly SnO 2 in tartaric acid, while a composite of tin oxide and tin carboxylate in citric or oxalic acid. Even though the passive films on ITO surface generated in these organic acids, the indium or tin could complex with the organic acid anions, enhancing the dissolution of ITO films. The experimental results show that the interaction between the dissolution and passivation could assist to planarize the ITO surface. We found that the optimal treatment at 0.5 V in 3 wt.% tartaric acid could provide the ITO surface with root-mean-squared roughness less than 1.0 nm, due to the weak complexing characteristics of tartaric acid.
Energy Technology Data Exchange (ETDEWEB)
Sethi, Riti; Ahmad, Shabir; Aziz, Anver; Siddiqui, Azher Majid, E-mail: amsiddiqui@jmi.ac.in [Department of Physics, Jamia Millia Islamia, New Delhi-110025 (India)
2015-08-28
Tin oxide (SnO) thin films were synthesized using thermal evaporation technique. Ultra pure metallic tin was deposited on glass substrates using thermal evaporator under high vacuum. The thickness of the tin deposited films was kept at 100nm. Subsequently, the as-deposited tin films were annealed under oxygen environment for a period of 3hrs to obtain tin oxide films. To analyse the suitability of the synthesized tin oxide films as a wide band gap semiconductor, various properties were studied. Structural parameters were studied using XRD and SEM-EDX. The optical properties were studied using UV-Vis Spectrophotometry and the electrical parameters were calculated using the Hall-setup. XRD and SEM confirmed the formation of SnO phase. Uniform texture of the film can be seen through the SEM images. Presence of traces of unoxidised Sn has also been confirmed through the XRD spectra. The band gap calculated was around 3.6eV and the optical transparency around 50%. The higher value of band gap and lower value of optical transparency can be attributed to the presence of unoxidised Sn. The values of resistivity and mobility as measured by the Hall setup were 78Ωcm and 2.92cm{sup 2}/Vs respectively. The reasonable optical and electrical parameters make SnO a suitable candidate for optoelectronic and electronic device applications.
Mechanical properties of TiN films deposited by changed-pressure r.f. sputtering
International Nuclear Information System (INIS)
Kubo, Y.; Hashimoto, M.
1991-01-01
TiN was deposited onto glass, stainless steel and cemented carbide by r.f. magnetron sputtering. The mechanical properties of TiN such as hardness, internal stress and adhesion were assessed by the Vickers microhardness test, the bending method and the modified scratch test. It was found that the operating pressure during sputtering deposition strongly affects these mechanical properties. As the operating pressure is increased beyond 0.6-0.7 Pa, the adhesion of TiN films onto the substrate increases enormously, but the hardness decreases owing to the release of the high compressive stress in the film. Therefore changing the pressure from high to low during deposition could be a good way of optimizing both hardness and adhesion. The effectiveness of this changed-pressure process was experimentally verified by cutting tests using TiN-coated cemented carbide tools. This process will be applicable to any other hard coating materials having high compressive stresses. (orig.)
The Evaluation of Novel Tin Materials for the Removal of Technetium from Groundwater
Energy Technology Data Exchange (ETDEWEB)
Parker, Kent E. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States); Wellman, Dawn M. [Pacific Northwest National Lab. (PNNL), Richland, WA (United States)
2017-06-30
Technetium-99 (99Tc) is present at several U.S. Department of Energy (DOE) facilities, including the Hanford, Oak Ridge, Paducah, Portsmouth, and Savannah River sites. Due to its mobility, persistence, and toxicity in the environment, developing means to immobilize and/or remove technetium from the environment is currently a top priority for DOE. However, there are currently very few approaches that effectively manage the risks of technetium to human health and the environment. The objective of this study is to evaluate novel synthetic materials that could enable direct removal of technetium from groundwater. The following report •assesses the viability of existing methodologies for synthesis of tin (II) apatite for in situ formation and remediation of 99Tc within the subsurface environment •discusses the development of alternative methodologies for production of tin (II) apatite •evaluates nanoporous tin phosphate materials for removal of technetium from groundwater.
Pretreatment of Platinum/Tin Oxide-Catalyst
Hess, Robert V.; Paulin, Patricia A.; Miller, Irvin M.; Schryer, David R.; Sidney, Barry D.; Wood, George M.; Upchurch, Billy T.; Brown, Kenneth G.
1987-01-01
Addition of CO to He pretreatment doubles catalytic activity. In sealed, high-energy, pulsed CO2 laser, CO and O2 form as decomposition products of CO2 in laser discharge zone. Products must be recombined, because oxygen concentration of more than few tenths of percent causes rapid deterioration of power, ending in unstable operation. Promising low-temperature catalyst for combining CO and O2 is platinum on tin oxide. New development increases activity of catalyst so less needed for recombination process.
Energy Technology Data Exchange (ETDEWEB)
Rodriguez Hernandez, B
1972-07-01
The analytical methods are described far the determination of tin in cassiterite ores. The gallein-colorimetric method is described for determining small amounts of tin, covering the 0,01-0,5 per cent range. The sample is decomposed by heating with ammonium iodide, and tin is analyzed colorimetrically by means of it s complex with gallein. The final measure may be brought about either visually or spectrophotometrically at 525 nm. (Author)
Angular distribution of ions and extreme ultraviolet emission in laser-produced tin droplet plasma
Energy Technology Data Exchange (ETDEWEB)
Chen, Hong; Duan, Lian; Lan, Hui [School of Optical and Electronic Information, Huazhong University of Science and Technology, Wuhan 430074 (China); Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); Wang, Xinbing, E-mail: xbwang@hust.edu.cn; Chen, Ziqi; Zuo, Duluo [Wuhan National Laboratory for Optoelectronics, Huazhong University of Science and Technology, Wuhan 430074 (China); Lu, Peixiang [School of Physics, Huazhong University of Science and Technology, Wuhan 430074 (China)
2015-05-21
Angular-resolved ion time-of-flight spectra as well as extreme ultraviolet radiation in laser-produced tin droplet plasma are investigated experimentally and theoretically. Tin droplets with a diameter of 150 μm are irradiated by a pulsed Nd:YAG laser. The ion time-of-flight spectra measured from the plasma formed by laser irradiation of the tin droplets are interpreted in terms of a theoretical elliptical Druyvesteyn distribution to deduce ion density distributions including kinetic temperatures of the plasma. The opacity of the plasma for extreme ultraviolet radiation is calculated based on the deduced ion densities and temperatures, and the angular distribution of extreme ultraviolet radiation is expressed as a function of the opacity using the Beer–Lambert law. Our results show that the calculated angular distribution of extreme ultraviolet radiation is in satisfactory agreement with the experimental data.
Angular distribution of ions and extreme ultraviolet emission in laser-produced tin droplet plasma
International Nuclear Information System (INIS)
Chen, Hong; Duan, Lian; Lan, Hui; Wang, Xinbing; Chen, Ziqi; Zuo, Duluo; Lu, Peixiang
2015-01-01
Angular-resolved ion time-of-flight spectra as well as extreme ultraviolet radiation in laser-produced tin droplet plasma are investigated experimentally and theoretically. Tin droplets with a diameter of 150 μm are irradiated by a pulsed Nd:YAG laser. The ion time-of-flight spectra measured from the plasma formed by laser irradiation of the tin droplets are interpreted in terms of a theoretical elliptical Druyvesteyn distribution to deduce ion density distributions including kinetic temperatures of the plasma. The opacity of the plasma for extreme ultraviolet radiation is calculated based on the deduced ion densities and temperatures, and the angular distribution of extreme ultraviolet radiation is expressed as a function of the opacity using the Beer–Lambert law. Our results show that the calculated angular distribution of extreme ultraviolet radiation is in satisfactory agreement with the experimental data
Amdel on-line analyser at Rooiberg Tin Limited
International Nuclear Information System (INIS)
Owen, T.V.
1987-01-01
An Amdel on line analysis system was installed on the 'A' mine tin flotation plant at Rooiberg in April 1984. The motivation for the installation was made on account of the large variations in the feed grade to the plant and the resulting need for rapid operational adjustments to control concentrate grades thereby maximising the financial returns. An 'on-line' analyser system presented itself as a suitable alternative to the existing control method of smaller laboratory x-ray fluorescence analysers. On the system as installed at Rooiberg, two probes were fitted in each analysis zone, viz a density probe using high energy gamma radiation from a Cesium 127 source and a specific element absorption probe using low energy gamma radiation from a Americium 241 source. The signals as received from the probes are fed to a line receiver unit in the control room where a micro computer is doing the processing and prints out the information as required. Several advantages of this type of installation were gained at Rooiberg Tin Limited
Direct Reaction Experimental Studies with Beams of Radioactive Tin Ions
Energy Technology Data Exchange (ETDEWEB)
Jones, K. L. [University of Tennessee, Knoxville (UTK); Ahn, S.H. [University of Tennessee, Knoxville (UTK); Allmond, James M [ORNL; Ayres, A. [University of Tennessee, Knoxville (UTK); Bardayan, Daniel W [ORNL; Baugher, T. [Michigan State University, East Lansing; Bazin, D. [Michigan State University, National Superconducting Cyclotron Laboratory (NSCL); Beene, James R [ORNL; Berryman, J. S. [Michigan State University, East Lansing; Bey, A. [University of Tennessee, Knoxville (UTK); Bingham, C. R. [University of Tennessee, Knoxville (UTK); Cartegni, L. [University of Tennessee, Knoxville (UTK); Chae, K. Y. [University of Tennessee, Knoxville (UTK)/Sungkyunkwan University, Korea; Cizewski, J. A. [Rutgers University; Gade, A. [Michigan State University, National Superconducting Cyclotron Laboratory (NSCL); Galindo-Uribarri, Alfredo {nmn} [ORNL; Garcia-Ruiz, R.F. [Instituut voor Kernen Stralingsfysica, KU Leuven, B-3001, Leuven, Belgium; Grzywacz, Robert Kazimierz [ORNL; Howard, Meredith E [ORNL; Kozub, R. L. [Tennessee Technological University (TTU); Liang, J Felix [ORNL; Manning, Brett M [ORNL; Matos, M. [Louisiana State University; McDaniel, S. [Michigan State University, East Lansing; Miller, D. [University of Tennessee, Knoxville (UTK); Nesaraja, Caroline D [ORNL; O' Malley, Patrick [Rutgers University; Padgett, S [University of Tennessee, Knoxville (UTK); Padilla-Rodal, Elizabeth [Universidad Nacional Autonoma de Mexico (UNAM); Pain, Steven D [ORNL; Pittman, S. T. [University of Tennessee (UTK) and Oak Ridge National Laboratory (ORNL); Radford, David C [ORNL; Ratkiewicz, Andrew J [ORNL; Schmitt, Kyle [ORNL; Smith, Michael Scott [ORNL; Stracener, Daniel W [ORNL; Stroberg, S. [Michigan State University, East Lansing; Tostevin, Jeffrey A [ORNL; Varner Jr, Robert L [ORNL; Weisshaar, D. [Michigan State University, East Lansing; Wimmer, K. [Michigan State University, National Superconducting Cyclotron Laboratory (NSCL)/Central Michigan University; Winkler, R. [Michigan State University, East Lansing
2015-01-01
The tin chain of isotopes provides a unique region in which to investigate the evolution of single-particle structure, spreading from N = 50 at Sn-100, through 10 stable isotopes and the N = 82 shell closure at Sn-132 out into the r-process path. Direct reactions performed on radioactive ion beams are sensitive spectroscopic tools for studying exotic nuclei. Here we present one experiment knocking out neutrons from tin isotopes that are already neutron deficient and two reactions that add a neutron to neutron-rich Sn-130. Both techniques rely on selective particle identification and the measurement of gamma rays in coincidence with charged ions. We present the goals of the two experiments and the particle identification for the channels of interest. The final results will be presented in future publications.
Preparation of 99mTc- Tin colloid: a freeze-dried kit for liver imaging
International Nuclear Information System (INIS)
Hamada, E.S.; Muramoto, E.; Barbosa, M.R.F. de; Colturato, M.T.; Herrerias, R.
1988-07-01
99m Tc-tin-colloid was formulated as a useful agent for liver imaging. The radiochemical purity and stability of the labeled colloid were determined by paper chromatography and 85% methanol solvent, the labelling efficiency was > 95%. The comparative studies of the biological distribution of 99m Tc-tin-colloid and 99 Tc-Sulphur-colloid were made with Wistar rats. The results of organ distribution were similar in both products; > 90% liver uptake. (author) [pt
On the electrochemical migration mechanism of tin in electronics
DEFF Research Database (Denmark)
Minzari, Daniel; Jellesen, Morten Stendahl; Møller, Per
2011-01-01
Electrochemical migration (ECM) of tin can result in the growth of a metal deposit with a dendritic structure from cathode to anode. In electronics, such growth can lead to short circuit of biased electrodes, potentially leading to intermittent or complete failure of an electronic device...
GEMAS - Tin and Tungsten: possible sources of enriched concentrations in soils in European countries
João Batista, Maria; Filipe, Augusto; Reimann, Clemens
2014-05-01
Tin and tungsten occur related with magmatic differentiation and can be installed in fissures and veins of magmatic rocks or in the neighbor metasediments. Generally, both elements have low chemical mobility in the superficial environment although effectively mobile in detrital media such as stream sediments and deposited in alluvial soils. The most important tin-tungsten deposits in Europe are in Variscides. From the northern Europe, 985 samples and from southern Europe 1123 samples were collected both in agricultural and grazing lands. Analysis were made of Sn , W, pH, TOC, SiO2 from the upper 20 and 10 cm of agricultural and grazing soils, respectively. The present study is part of the GEMAS project a joint project of European geochemical mapping between the EuroGeoSurvey Geochemical Expert Group and EuroMetaux. The results show that in general, at the European (continental) scale natural processes are dominant. It is clear the distinction between NE Europe and SW European tin and tungsten concentrations in soils. Tin geometric mean concentrations in the northern Europe is 0.57 mg kg-1 in agricultural soils and 0.62 mg kg-1 in grazing land; southern Europe 0.91 mg kg-1 in agricultural soils and 0.95 mg kg-1 in grazing land. Tungsten geometric mean concentrations in northern Europe is 0.067 mg kg-1 in agricultural soils and 0.073 mg kg-1 in grazing land and in southern Europe is 0.085 mg kg-1 in agricultural soils and 0.090 mg kg-1 in grazing land. Limit between north and south is the maximum extent of the last glaciation. Grazing land, undisturbed soils for a period of several years, have higher concentrations of Sn and W than agricultural soils which raises the question that if only natural processes are observed. Parent material seems to be the main source of Sn and W to soil. Sn-W rich Variscan granitic intrusions of Central Iberian Zone, Massif Central, Brittany, Cornwall and Bohemia are reflected in soil concentrations. TOC is higher in northern than in
A Simplified Method for Laboratory Preparation of Organ Specific Indium 113m Compounds
Energy Technology Data Exchange (ETDEWEB)
Adatepe, M H; Potchen, E James [Washington University School of Medicine, St. Louis (United States)
1969-03-15
Generator systems producing short lived nuclides from longer lived parents have distinct clinical advantages. They are more economical, result in a lower radiation dose, and can make short lived scanning readily available even in areas remote from rapid radiopharmaceutical delivery services. The {sup 113}Sn-{sup 113m}In generator has the additional advantage that, as a transition metal, Indium can be readily complexed into organ specific preparations. 113Sn, a reactor produced nuclide with a 118 day half life, is absorbed on a zirconium or silica gel column. the generator is eluded with 5 to 8 ml of 0.05 N HCL solution at pH 1.3-1.4. The daughter nuclide, {sup 113m}In, has a half life of 1.7 hours and emits a 393 Kev monoenergetic gamma ray. Previous methods for labeling organ specific complexes with {sup 113m}In required terminal autoclaving before injection. With the recent introduction of sterile, apyrogenic {sup 113}Sn-{sup 113m}In generators, we have developed a simplified technique for the laboratory preparation of Indium labeled compounds. This method eliminates autoclaving and titration enabling us to pre-prepare organ specific complexes for blood pool, liver, spleen, brain, kidney and lung scanning.
7 CFR 1221.113 - Financial statements.
2010-01-01
... Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING... INFORMATION ORDER Sorghum Promotion, Research, and Information Order Sorghum Promotion, Research, and Information Board § 1221.113 Financial statements. (a) As requested by the Secretary, the Board shall prepare...
Study of tin amalgam mirrors by {sup 119}Sn Mössbauer spectroscopy and other analytical methods
Energy Technology Data Exchange (ETDEWEB)
Lerf, A. [Bavarian Academy of Sciences, Walther Meißner Institute (Germany); Wagner, F. E., E-mail: fwagner@tum.de [Technical University of Munich, Physics Department E15 (Germany); Herrera, L. K. [Universidad Nacional de Colombia. Dpto. de Ingeniería Mecánica y Mecatrónica (Colombia); Justo, A.; Mu noz-Páez, A.; Pérez-Rodríguez, J. L. [University of Sevilla-CSIC, ICMSE (Spain)
2016-12-15
From the beginning of the 16 {sup th} until the end of the 19 {sup th} century the most widely used mirrors consisted of a pane of glass backed with a reflecting layer of tin-mercury amalgam. They were made by sliding the glass pane over a tin foil covered with liquid mercury. After removal of the superfluous mercury, tin amalgam formed slowly at ambient temperature and yielded a reflecting layer adhering to the surface of the glass. Such mirrors often deteriorate in the course of time by oxidation of the tin in the amalgam to stannous or stannic oxide. {sup 119}Sn Mössbauer spectroscopy, scanning electron microscopy, micro-XRF and X-ray diffraction have been used to study this deterioration process. The studied specimens were a modern mirror made for the reconstruction of the Green Vault in Dresden in the early 2000s, two rather well preserved German mirrors from the 17 {sup th} and 19 {sup th} centuries and several strongly deteriorated specimens of Baroque mirrors from the south of Spain. The modern mirror consists mainly of a Sn{sub 0.9}Hg{sub 0.1} amalgam with only 2 % of SnO{sub 2}. The older German mirrors showed more pronounced oxidation, containing 12 and 15 % of SnO{sub 2}, which did not noticeably impair their reflectivity. In the samples from the Spanish mirrors at best a few percent of metallic phase was left. The majority of the tin had oxidised to SnO{sub 2}, but between 8 and 20 % of the tin was present as SnO. X-ray diffraction yielded similar results and micro-XRF mapping using synchrotron radiation for excitation gave information on the distribution of Sn and Hg in the reflecting layer of the mirrors.
Iwata, Yuji; Nishino, Tsuneyo; Iwano, Megumi; Takayama, Seiji; Koizumi, Nozomu
2012-01-01
Accumulation of unfolded proteins in the endoplasmic reticulum (ER) of eukaryotic cells triggers the transcriptional activation of ER-resident molecular chaperones and folding enzymes to maintain cellular homeostasis. This process is known as the ER stress response or the unfolded protein response. We have identified tunicamycin induced 1 (TIN1), a plant-specific ER stress-inducible Arabidopsis thaliana gene. The TIN1 protein is localized in the ER; however, its molecular function has yet to be clarified. In this study, we performed functional analysis of TIN1 in planta. RT-PCR analysis showed that TIN1 is highly expressed in pollen. Analysis using the β-glucuronidase reporter gene demonstrated that the TIN1 promoter is active throughout pollen development, peaking at the time of flowering and in an ovule of an open flower. Although a T-DNA insertion mutant of TIN1 grows normally under ambient laboratory conditions, abnormal pollen surface morphology was observed under a scanning electron microscope. Based on the current and previous observations, a possible physiological function of TIN1 during pollen development is discussed. © 2012 The Japanese Society for Plant Cell and Molecular Biology.
Metabolic Imaging of Patients with Prostate Cancer Using Hyperpolarized [1-13C]Pyruvate
Nelson, Sarah J.; Kurhanewicz, John; Vigneron, Daniel B.; Larson, Peder E. Z.; Harzstark, Andrea L.; Ferrone, Marcus; van Criekinge, Mark; Chang, Jose W.; Bok, Robert; Park, Ilwoo; Reed, Galen; Carvajal, Lucas; Small, Eric J.; Munster, Pamela; Weinberg, Vivian K.; Ardenkjaer-Larsen, Jan Henrik; Chen, Albert P.; Hurd, Ralph E.; Odegardstuen, Liv-Ingrid; Robb, Fraser J.; Tropp, James; Murray, Jonathan A.
2014-01-01
This first-in-man imaging study evaluated the safety and feasibility of hyperpolarized [1-13C]pyruvate as an agent for noninvasively characterizing alterations in tumor metabolism for patients with prostate cancer. Imaging living systems with hyperpolarized agents can result in more than 10,000-fold enhancement in signal relative to conventional magnetic resonance (MR) imaging. When combined with the rapid acquisition of in vivo 13C MR data, it is possible to evaluate the distribution of agents such as [1-13C]pyruvate and its metabolic products lactate, alanine, and bicarbonate in a matter of seconds. Preclinical studies in cancer models have detected elevated levels of hyperpolarized [1-13C]lactate in tumor, with the ratio of [1-13C]lactate/[1-13C]pyruvate being increased in high-grade tumors and decreased after successful treatment. Translation of this technology into humans was achieved by modifying the instrument that generates the hyperpolarized agent, constructing specialized radio frequency coils to detect 13C nuclei, and developing new pulse sequences to efficiently capture the signal. The study population comprised patients with biopsy-proven prostate cancer, with 31 subjects being injected with hyperpolarized [1-13C]pyruvate. The median time to deliver the agent was 66 s, and uptake was observed about 20 s after injection. No dose-limiting toxicities were observed, and the highest dose (0.43 ml/kg of 230 mM agent) gave the best signal-to-noise ratio for hyperpolarized [1-13C]pyruvate. The results were extremely promising in not only confirming the safety of the agent but also showing elevated [1-13C]lactate/[1-13C]pyruvate in regions of biopsy-proven cancer. These findings will be valuable for noninvasive cancer diagnosis and treatment monitoring in future clinical trials. PMID:23946197
The\tutility\tof\tneuroimaging\tin\tthe\tmanagement\tof\tdementia
Directory of Open Access Journals (Sweden)
Uduak\tE\tWilliams
2015-10-01
Full Text Available Dementia is a syndrome of progressive dysfunction of two or more cognitive\tdomains\tassociated\twith\timpairment\tof\tactivities\tof\tdaily\tliving. An understanding of the pathophysiology of dementia and its early diagnosis\tis\timportant\tin\tthe\tpursuit\tof\tpossible\tdisease\tmodifying\ttherapy for\tdementia.\tNeuroimaging\thas\tgreatly\ttransformed\tthis\tfield\tof\tresearch as its function has changed from a mere tool for diagnosing treatable causes of dementia to an instrument for pre-symptomatic diagnosis of dementia. This\treview\tfocuses\ton\tthe\tdiagnostic\tutility\tof\tneuroimaging\tin the\tmanagement\tof\tprogressive\tdementias.\tStructural\timaging\ttechniques like computerized tomography scan and magnetic resonance imaging highlights the anatomical, structural and volumetric details of the brain; while functional imaging techniques such as positron emission tomography, arterial spin labeling, single photon emission computerized tomography\tand\tblood\toxygen\tlevel-dependent\tfunctional\tmagnetic\tresonance\timaging\tfocuses\ton\tchemistry, circulatory\tstatus\tand\tphysiology\tof\tthe\tdifferent\tbrain\tstructures\tand\tregions.
Joung, Wukchul; Park, Jihye; Pearce, Jonathan V.
2018-06-01
In this work, the liquidus temperature of tin was determined by melting the sample using the pressure-controlled loop heat pipe. Square wave-type pressure steps generated periodic 0.7 °C temperature steps in the isothermal region in the vicinity of the tin sample, and the tin was melted with controllable heat pulses from the generated temperature changes. The melting temperatures at specific melted fractions were measured, and they were extrapolated to the melted fraction of unity to determine the liquidus temperature of tin. To investigate the influence of the impurity distribution on the melting behavior, a molten tin sample was solidified by an outward slow freezing or by quenching to segregate the impurities inside the sample with concentrations increasing outwards or to spread the impurities uniformly, respectively. The measured melting temperatures followed the local solidus temperature variations well in the case of the segregated sample and stayed near the solidus temperature in the quenched sample due to the microscopic melting behavior. The extrapolated melting temperatures of the segregated and quenched samples were 0.95 mK and 0.49 mK higher than the outside-nucleated freezing temperature of tin (with uncertainties of 0.15 mK and 0.16 mK, at approximately 95% level of confidence), respectively. The extrapolated melting temperature of the segregated sample was supposed to be a closer approximation to the liquidus temperature of tin, whereas the quenched sample yielded the possibility of a misleading extrapolation to the solidus temperature. Therefore, the determination of the liquidus temperature could result in different extrapolated melting temperatures depending on the way the impurities were distributed within the sample, which has implications for the contemporary methodology for realizing temperature fixed points of the International Temperature Scale of 1990 (ITS-90).
Electrodeposition of rhenium-tin nanowires
International Nuclear Information System (INIS)
Naor-Pomerantz, Adi; Eliaz, Noam; Gileadi, Eliezer
2011-01-01
Highlights: → Rhenium-tin nanowires were formed electrochemically, without using a template. → The nanowires consisted of a crystalline-Sn-core/amorphous-Re-shell structure. → The effects of bath composition and operating conditions were investigated. → A mechanism is suggested for the formation of the core/shell structure. → The nanowires may be attractive for a variety of applications. - Abstract: Rhenium (Re) is a refractory metal which exhibits an extraordinary combination of properties. Thus, nanowires and other nanostructures of Re-alloys may possess unique properties resulting from both Re chemistry and the nanometer scale, and become attractive for a variety of applications, such as in catalysis, photovoltaic cells, and microelectronics. Rhenium-tin coatings, consisting of nanowires with a core/shell structure, were electrodeposited on copper substrates under galvanostatic or potentiostatic conditions. The effects of bath composition and operating conditions were investigated, and the chemistry and structure of the coatings were studied by a variety of analytical tools. A Re-content as high as 77 at.% or a Faradaic efficiency as high as 46% were attained. Ranges of Sn-to-Re in the plating bath, applied current density and applied potential, within which the nanowires could be formed, were determined. A mechanism was suggested, according to which Sn nanowires were first grown on top of Sn micro-particles, and then the Sn nanowires reduced the perrhenate chemically, thus forming a core made of crystalline Sn-rich phase, and a shell made of amorphous Re-rich phase. The absence of mutual solubility of Re and Sn may be the driving force for this phase separation.
CRC-113 gene expression signature for predicting prognosis in patients with colorectal cancer.
Nguyen, Minh Nam; Choi, Tae Gyu; Nguyen, Dinh Truong; Kim, Jin-Hwan; Jo, Yong Hwa; Shahid, Muhammad; Akter, Salima; Aryal, Saurav Nath; Yoo, Ji Youn; Ahn, Yong-Joo; Cho, Kyoung Min; Lee, Ju-Seog; Choe, Wonchae; Kang, Insug; Ha, Joohun; Kim, Sung Soo
2015-10-13
Colorectal cancer (CRC) is the third leading cause of global cancer mortality. Recent studies have proposed several gene signatures to predict CRC prognosis, but none of those have proven reliable for predicting prognosis in clinical practice yet due to poor reproducibility and molecular heterogeneity. Here, we have established a prognostic signature of 113 probe sets (CRC-113) that include potential biomarkers and reflect the biological and clinical characteristics. Robustness and accuracy were significantly validated in external data sets from 19 centers in five countries. In multivariate analysis, CRC-113 gene signature showed a stronger prognostic value for survival and disease recurrence in CRC patients than current clinicopathological risk factors and molecular alterations. We also demonstrated that the CRC-113 gene signature reflected both genetic and epigenetic molecular heterogeneity in CRC patients. Furthermore, incorporation of the CRC-113 gene signature into a clinical context and molecular markers further refined the selection of the CRC patients who might benefit from postoperative chemotherapy. Conclusively, CRC-113 gene signature provides new possibilities for improving prognostic models and personalized therapeutic strategies.
Directory of Open Access Journals (Sweden)
Koo B.-R.
2017-06-01
Full Text Available We fabricated double-laminated antimony tin oxide/Ag nanowire electrodes by spin-coating and electrospraying. Compared to pure Ag nanowire electrodes and single-laminated antimony tin oxide/Ag nanowire electrodes, the double-laminated antimony tin oxide/Ag nanowire electrodes had superior transparent conducting electrode performances with sheet resistance ~19.8 Ω/□ and optical transmittance ~81.9%; this was due to uniform distribution of the connected Ag nanowires because of double lamination of the metallic Ag nanowires without Ag aggregation despite subsequent microwave heating at 250°C. They also exhibited excellent and superior long-term chemical and thermal stabilities and adhesion to substrate because double-laminated antimony tin oxide thin films act as the protective layers between Ag nanowires, blocking Ag atoms penetration.
Schmidt, Christian
2018-01-01
The speciation of tin and the solubility of cassiterite in H2O + HCl were determined at temperatures to 600 °C using in situ Raman spectroscopy. In addition, information on the fluid-melt partition of Sn was obtained at 700 °C and indicated a preference of the fluid only at HCl concentrations that are much higher than in fluids exsolved from natural felsic melts. Dissolution of cassiterite generally resulted in formation of Sn(IV) species unless reduced conditions were generated by hydrogen permeation or carbohydrates in the starting material. The prevalent aqueous Sn(IV) species was [SnCl4(H2O)2]0, with additional [SnCl3(H2O)3]+ and [SnCl5(H2O)]-. The only detectable Sn(II) species was very likely [Sn(II)Cl3]-. Cassiterite solubility increased with HCl concentration and was generally high in H2O+HCl fluids, with no strong dependencies on temperature, pressure, or the oxidation state of tin in the fluid. The Sn(IV) concentrations at 500 and 600 °C determined from the integrated ν1[Sn(IV)sbnd Cl] band intensity are in good agreement with literature data on the cassiterite solubility in H2O + HCl at oxygen fugacities along the hematite-magnetite buffer. The combined results from previous experimental studies and this study demonstrate that HCl molality is a crucial parameter for hydrothermal mobilization and transport of tin and for cassiterite precipitation, and that pH, pressure and temperature are less important. Current models on hydrothermal tin deposit formation need to be augmented to include Sn(IV)sbnd Cl complexes as significant tin-transporting species. Irrespective of the oxidation state of tin in the fluid, cassiterite precipitates due to reaction of the hydrothermal fluid with the wall rock (greisen or skarn formation), dilution (mixing with meteoric water) or a decrease in the HCl activity in the aqueous liquid by boiling. A redox reaction is only required for tin transported as Sn(II) to be converted to Sn(IV).
Van Hao, B.; Wolters, Robertus A.M.; Kovalgin, Alexeij Y.
2012-01-01
This study reports on the growth and characterization of TiN thib films obtained by atomic layer deposition at 350-425 ◦C. We observe a growth of the continuous layers from the very beginning of the process, i.e. for a thickness of 0.65 nm, which is equivalent to 3 monolayers of TiN. The film growth
Multilayer (TiN, TiAlN) ceramic coatings for nuclear fuel cladding
Energy Technology Data Exchange (ETDEWEB)
Alat, Ece, E-mail: exa179@psu.edu [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Motta, Arthur T. [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Department of Mechanical and Nuclear Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Comstock, Robert J.; Partezana, Jonna M. [Westinghouse Electric Co., Beulah Rd, Pittsburgh, PA 1332 (United States); Wolfe, Douglas E. [Department of Materials Science and Engineering, The Pennsylvania State University, University Park, PA 16802 (United States); Applied Research Laboratory, The Pennsylvania State University, 119 Materials Research Building, University Park, PA 16802 (United States)
2016-09-15
In an attempt to develop an accident-tolerant fuel (ATF) that can delay the deleterious consequences of loss-of-coolant-accidents (LOCA), multilayer coatings were deposited onto ZIRLO{sup ®} coupon substrates by cathodic arc physical vapor deposition (CA-PVD). Coatings were composed of alternating TiN (top) and Ti{sub 1-x}Al{sub x}N (2-layer, 4-layer, 8-layer and 16-layer) layers. The minimum TiN top coating thickness and coating architecture were optimized for good corrosion and oxidation resistance. Corrosion tests were performed in static pure water at 360 °C and 18.7 MPa for up to 90 days. The optimized coatings showed no spallation/delamination and had a maximum of 6 mg/dm{sup 2} weight gain, which is 6 times smaller than that of a control sample of uncoated ZIRLO{sup ®} which showed a weight gain of 40.2 mg/dm{sup 2}. The optimized architecture features a ∼1 μm TiN top layer to prevent boehmite phase formation during corrosion and a TiN/TiAlN 8-layer architecture which provides the best corrosion performance. - Highlights: • The first study on multilayer TiAlN and TiN ceramic coatings on ZIRLO{sup ®} coupons. • Corrosion tests were performed at 360°C and 18.7 MPa for up to 90 days. • Coatings adhered well to the substrate, and showed no spallation/delamination. • Weight gains were six times lower than those of uncoated ZIRLO{sup ®} samples. • Longer and higher temperature corrosion tests will be discussed in a further paper.
Silver aggregates and twofold-coordinated tin centers in phosphate glass: A photoluminescence study
International Nuclear Information System (INIS)
Jimenez, J.A.; Lysenko, S.; Liu, H.; Fachini, E.; Resto, O.; Cabrera, C.R.
2009-01-01
The optical properties of silver species in various oxidation and aggregation states and of tin centers in melt-quenched phosphate glasses have been assessed by optical absorption and photoluminescence (PL) spectroscopy. Glasses containing silver and tin, or either dopant, were studied. Emission and excitation spectra along with time-resolved and temperature-dependent PL measurements were employed in elucidating the different emitting centers observed and investigating on their interactions. In regard to silver, the data suggests the presence of luminescent single Ag + ions, Ag + -Ag + and Ag + -Ag 0 pairs, and nonluminescent Ag nanoparticles (NPs), where Ag + -Ag 0 →Ag + -Ag + energy transfer is indicated. Tin optical centers appear as twofold-coordinated Sn centers displaying PL around 400 nm ascribed to triplet-to-singlet electronic transitions. The optically active silver centers were observed in glasses where 8 mol% of both Ag 2 O and SnO, and 4 mol% of Ag 2 O were added. Heat treatment (HT) of the glass with the high concentration of silver and tin leads to chemical reduction of ionic silver species resulting in a large volume fraction of silver NPs and the vanishing of silver PL features. Further characterization of such heat-treated glass by transmission electron microscopy and X-ray photoelectron spectroscopy appears consistent with silver being present mainly in nonoxidized form after HT. On the other hand, HT of the glass containing only silver results in the quenching of Ag + -Ag 0 pairs emission that is ascribed to nonradiative energy transfer to Ag NPs due to the positioning of the pairs near the surface of NPs during HT. In this context, an important finding is that a faster relaxation was observed for this nanocomposite in relation to a heat-treated glass containing both silver and tin (no silver pairs) as revealed by degenerate four-wave mixing spectroscopy. Such result is attributed to Ag NP→Ag + -Ag 0 plasmon resonance energy transfer. The
Alkaline earth metal doped tin oxide as a novel oxygen storage material
Energy Technology Data Exchange (ETDEWEB)
Dong, Qiang, E-mail: dong@tagen.tohoku.ac.jp [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan); Yin, Shu; Yoshida, Mizuki; Wu, Xiaoyong; Liu, Bin [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan); Miura, Akira; Takei, Takahiro; Kumada, Nobuhiro [Department of Research Interdisciplinary Graduate School of Medicine and Engineering, University of Yamanashi, Miyamae cho-7, Kofu 400-8511 (Japan); Sato, Tsugio [Institute of Multidisciplinary Research for Advanced Materials, Tohoku University, 2-1-1 Katahira, Aoba-ku Sendai 980-8577 (Japan)
2015-09-15
Alkaline earth metal doped tin oxide (SnO{sub 2}) hollow nanospheres with a diameter of 50 nm have been synthesized successfully via a facial solvothermal route in a very simple system composed of only ethanol, acetic acid, SnCl{sub 4}·5H{sub 2}O and A(NO{sub 3}){sub 2}·xH{sub 2}O (A = Mg, Ca, Sr, Ba). The synthesized undoped SnO{sub 2} and A-doped SnO{sub 2} hollow nanospheres were characterized by the oxygen storage capacity (OSC), X-ray diffraction, transmission electron microscopy and the Brunauer–Emmet–Teller (BET) technique. The OSC values of all samples were measured using thermogravimetric-differential thermal analysis. The incorporation of alkaline earth metal ion into tin oxide greatly enhanced the thermal stability and OSC. Especially, Ba-doped SnO{sub 2} hollow nanospheres calcined at 1000 °C for 20 h with a BET surface area of 61 m{sup 2} g{sup −1} exhibited the considerably high OSC of 457 μmol-O g{sup −1} and good thermal stability. Alkaline earth metal doped tin oxide has the potential to be a novel oxygen storage material.
Suzuki, T.; Minoda, H.; Tanishiro, Y.; Yagi, K.
A TED study of Si(113) surfaces was carried out. Reflections from the 3 × 2 reconstruction were seen at room temperature, while half-order reflections were very faint. The surface showed the phase transition between the 3 × 1 and the disordered (rough) structures at about 930°C. The (113) surface structure at room temperature was analyzed using TED intensity. Four kinds of structure models proposed previously, including both the 3 × 1 and the 3 × 2 reconstructed structures, were examined. The R-factors calculated using the energy-optimized atomic coordinates are not sufficiently small. After minimization of the R-factors, Dabrowski's 3 × 2 structure model is most agreeable, while Ranke's 3 × 1 and 3 × 2 structure models are not to be excluded. STM observation showed that the surface is composed of small domains of the 3 × 2 structure.
A Palladium-Tin Modified Microband Electrode Array for Nitrate Determination
Directory of Open Access Journals (Sweden)
Yexiang Fu
2015-09-01
Full Text Available A microband electrode array modified with palladium-tin bimetallic composite has been developed for nitrate determination. The microband electrode array was fabricated by Micro Electro-Mechanical System (MEMS technique. Palladium and tin were electrodeposited successively on the electrode, forming a double-layer structure. The effect of the Pd-Sn composite was investigated and its enhancement of catalytic activity and lifetime was revealed. The Pd-Sn modified electrode showed good linearity (R2 = 0.998 from 1 mg/L to 20 mg/L for nitrate determination with a sensitivity of 398 μA/(mg∙L−1∙cm2. The electrode exhibited a satisfying analytical performance after 60 days of storage, indicating a long lifetime. Good repeatability was also displayed by the Pd-Sn modified electrodes. The results provided an option for nitrate determination in water.
13 CFR 113.110 - Remedial and affirmative action and self-evaluation.
2010-01-01
... Order 12107, 3 CFR, 1978 Comp., p. 264. (c) Self-evaluation. Each recipient education institution shall... and self-evaluation. 113.110 Section 113.110 Business Credit and Assistance SMALL BUSINESS... GOVERNMENT AND SBA ADMINISTRATOR Nondiscrimination on the Basis of Sex in Education Programs or Activities...
Novel antimony doped tin oxide/carbon aerogel as efficient electrocatalytic filtration membrane
Directory of Open Access Journals (Sweden)
Zhimeng Liu
2016-05-01
Full Text Available A facile method was developed to prepare antimony doped tin oxide (Sb-SnO2/carbon aerogel (CA for use as an electrocatalytic filtration membrane. The preparation process included synthesis of a precursor sol, impregnation, and thermal decomposition. The Sb-SnO2, which was tetragonal in phase with an average crystallite size of 10.8 nm, was uniformly distributed on the CA surface and firmly attached via carbon-oxygen-tin chemical bonds. Preliminary filtration tests indicated that the Sb-SnO2/CA membrane had a high rate of total organic carbon removal for aqueous tetracycline owing to its high current efficiency and electrode stability.
Effect of Tin, Copper and Boron on the Hot Ductility of 20CrMnTi Steel between 650 °C and 1100 °C
Peng, Hong-bing; Chen, Wei-qing; Chen, Lie; Guo, Dong
2015-02-01
The hot ductility of 20CrMnTi steel with x% tin, y% copper and z ppm boron (x = 0, 0.02; y = 0, 0.2; z = 0, 60) was investigated. The results show that tin and copper in 20CrMnTi steel are detrimental to its hot ductility while adding boron can eliminate the adverse effect and enhance hot ductility greatly. Tin is found to segregate to the boundaries tested by EPMA in 20CrMnTi steel containing tin and copper and tin-segregation is suppressed by adding boron, moreover, copper was found not to segregate to boundaries, however, fine copper sulfide was found from carbon extraction replicas using TEM. The adverse effect of tin and copper on the hot ductility was due mainly to tin segregation and fine copper sulfide in the steel. The proeutectoid ferrite film precipitating along the austenite grain boundary causes the ductility trough of the three examined steels. Tin and copper in 20CrMnTi steel can retard the occurrence of dynamic recrystallization (DRX) while boron-addition can compensate for that change. The beneficial effect of boron on 20CrMnTi steel containing tin and copper might be ascribed to the fact that boron segregates to grain boundaries, accelerates onset of DRX, retards austenite/ferrite transformation and promotes intragranular nucleation of ferrite.
9 CFR 113.202 - Canine Hepatitis and Canine Adenovirus Type 2 Vaccine, Killed Virus.
2010-01-01
... Type 2 Vaccine, Killed Virus. 113.202 Section 113.202 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION SERVICE, DEPARTMENT OF AGRICULTURE VIRUSES, SERUMS, TOXINS, AND ANALOGOUS PRODUCTS; ORGANISMS AND VECTORS STANDARD REQUIREMENTS Killed Virus Vaccines § 113.202 Canine Hepatitis and Canine...
9 CFR 3.113 - Primary enclosures used to transport marine mammals.
2010-01-01
... marine mammals. 3.113 Section 3.113 Animals and Animal Products ANIMAL AND PLANT HEALTH INSPECTION... the animals, their handlers, or other persons. (d) Marine mammals transported in the same primary... used. Within the primary enclosures used to transport marine mammals, the animals will be maintained on...
Field dependence of T1 for hyperpolarized [1-13C]pyruvate
DEFF Research Database (Denmark)
Chattergoon, N.; Martnez-Santiesteban, F.; Handler, W. B.
2013-01-01
conformation and properties of the dissolution media such as buffer composition, solution pH, temperature and magnetic field. We have measured the magnetic field dependence of the spin–lattice relaxation time of hyperpolarized [1-13C]pyruvate using field-cycled relaxometry. [1-13C]pyruvate was hyperpolarized...
DEFF Research Database (Denmark)
Engberg, Å
1973-01-01
Procedures for the determination of tin in food, which involve a spectrophotometric method (with the quercetin-tin complex) and an atomic-absorption method, are described. The precision of the complete methods and of the individual analytical steps required is evaluated, and the parameters...
International Nuclear Information System (INIS)
Liu Chenyao; Jiao Jiao; Chen Qunxia; Xia Ji; Li Shuoqi; Hu Jingbo; Li Qilong
2010-01-01
A new type of gold nanoparticle attached to a NH 2 + ion implanted-indium tin oxide surface was fabricated without using peculiar binder molecules, such as 3-(aminopropyl)-trimethoxysilane. A NH 2 /indium tin oxide film was obtained by implantation at an energy of 80 keV with a fluence of 5 x 10 15 ions/cm 2 . The gold nanoparticle-modified film was characterized by X-ray photoelectron spectroscopy, scanning electron microscopy and electrochemical techniques and compared with a modified bare indium tin oxide surface and 3-(aminopropyl)-trimethoxysilane linked surface, which exhibited a relatively low electron transfer resistance and high electrocatalytic activity. The results demonstrate that NH 2 + ion implanted-indium tin oxide films can provide an important route to immobilize nanoparticles, which is attractive in developing new biomaterials.
Energy Technology Data Exchange (ETDEWEB)
Premalal, E.V.A., E-mail: vikum777@gmail.com [Graduate School of Science and Technology, Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu (Japan); Dematage, N. [Graduate School of Science and Technology, Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu (Japan); Kaneko, S. [SPD Laboratory Inc, Hi-Cube 3-1-7, Wajiyama, Naka-ku, Hamamatsu (Japan); Konno, A. [Graduate School of Science and Technology, Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu (Japan)
2012-09-01
Fluorine-doped tin oxide (FTO) thin films were prepared, at different substrate temperatures, using dilute precursor solutions of di(n-butyl)tin(iv) diacetate (0.1 M DBTDA) by varying the F{sup -} concentration in the solution. It is noticed that conductivity of FTO film is increasing by increasing the fluorine amount in the solution. Morphology of SEM image reveals that grain size and its distribution are totally affected by the substrate temperature in which conductivity is altered. Among these FTO films, the best film obtained gives an electronic conductivity of 31.85 Multiplication-Sign 10{sup 2} {Omega}{sup -1} cm{sup -1}, sheet resistance of 4.4 {Omega}/{open_square} ({rho} = 3.14 Multiplication-Sign 10{sup -4} {Omega} cm) with over 80% average normal transmittance between the 400 and 800 nm wavelength range. The best FTO film consists of a large distribution of grain sizes from 50 nm to 400 nm range and the optimum conditions used are 0.1 M DBTDA, 0.3 M ammonium fluoride, in a mixture of propan-2-ol and water, at 470 Degree-Sign C substrate temperature. The large distribution of grain sizes can be easily obtained using low DBTDA concentration ({approx} 0.1 M or less) and moderate substrate temperature (470 Degree-Sign C). - Highlights: Black-Right-Pointing-Pointer F-doped SnO{sub 2} (FTO) thin films prepared using di(n-butyl)tin(iv) diacetate (DBTDA). Black-Right-Pointing-Pointer Substrate temperature and DBTDA concentration affect grain size and distribution. Black-Right-Pointing-Pointer Large distribution of grain sizes can optimize the conductivity of FTO film. Black-Right-Pointing-Pointer 0.1 M DBTDA, substrate temperature of 470 Degree-Sign C allows a large grain size distribution.
Effect of TiN Addition on 3Y-TZP Ceramics with Emphasis on Making EDM-Able Bodies
Khosravifar, Mahnoosh; Mirkazemi, Seyyed Mohammad; Taheri, Mahdiar; Golestanifard, Farhad
2018-04-01
In this study, to produce electrically conductive ceramics, rapid hot press (RHP) sintering of 3 mol.% yttria-stabilized tetragonal zirconia polycrystal (3Y-TZP) and 3Y-TZP/TiN composites with TiN amounts of 25, 35, and 45 vol.% was performed at 1300, 1350, and 1400 °C. Interestingly, the toughness and hardness were improved in the presence of TiN up to 35 vol.% and maximum fracture toughness and hardness of 5.40 ± 0.05 MPa m1/2 and 14.50 ± 0.06 GPa, respectively, were obtained. However, the bending strength was decreased which could be attributed to the rather weak interfaces of nitride and oxide phases. Regarding the zirconia matrix, the effect of grain size on fracture toughness of the samples has been studied using x-ray diffraction and field emission scanning electron microscope (FESEM) analysis. It was also found that electrical resistivity decreased to the value of 6.88 × 10-6 Ω m at 45 vol.% of TiN. It seems the TiN grains form a network to impose conductivity on the ZrO2 body; however, below 35 vol.% TiN, due to lack of percolation effect, this conductivity could not be maintained according to FESEM studies. Finally, electrically conductive samples were successfully machined by electrical discharge machining (EDM).
Advanced optical modeling of TiN metal hard mask for scatterometric critical dimension metrology
Ebersbach, Peter; Urbanowicz, Adam M.; Likhachev, Dmitriy; Hartig, Carsten
2017-03-01
The majority of scatterometric production control models assume constant optical properties of the materials and only dimensional parameters are allowed to vary. However, this assumption, especially in case of thin-metal films, negatively impacts model precision and accuracy. In this work we focus on optical modeling of the TiN metal hardmask for scatterometry applications. Since the dielectric function of TiN exhibits thickness dependence, we had to take this fact into account. Moreover, presence of the highly absorbing films influences extracted thicknesses of dielectric layers underneath the metal films. The later phenomenon is often not reflected by goodness of fit. We show that accurate optical modeling of metal is essential to achieve desired scatterometric model quality for automatic process control in microelectronic production. Presented modeling methodology can be applied to other TiN applications such as diffusion barriers and metal gates as well as for other metals used in microelectronic manufacturing for all technology nodes.
Recovery and Purification of Tin from Tailings from the Penouta Sn–Ta–Nb Deposit
Directory of Open Access Journals (Sweden)
Félix Antonio López
2018-01-01
Full Text Available A concentrate obtained from mining tailings containing mainly cassiterite and columbotantalite was reduced for the production of tin metal. The compounds CaCO3, Na2CO3, K2CO3, and borax were used as fluxes in the pyrometallurgical reduction smelting process, and graphite was employed as the reducing agent. The greatest recovery of Sn (>95% was obtained when using CaCO3 as the flux; the purity of Sn was 96%. A slag equivalent to 25% of the mass of the initial concentrate was produced during the recovery of the Sn. This contained 45% Nb2O5 and Ta2O5, adding extra value to the mine tailings. The tin metal ingot was purified by electrorefining involving a tin and H2SO4 electrolyte solution and a 101.9 A/m2 current applied for 148 h. Under these conditions, 90 wt % of the Sn in the ingot was recovered at a purity of 99.97%.
Rare earth elements leaching from Tin slag using Acid Chloride after Alkaline fusion process
International Nuclear Information System (INIS)
Kurnia Trinopiawan; Budi Yuli Ani; June Mellawati; Mohammad Zaki Mubarok
2016-01-01
Tin slag, a waste product from tin smelting process, has a potency to be utilized further by extracting the valuable metals inside, such as rare earth elements(REE). The objective of this study is to determine the optimum leaching condition of REE from tin slag after alkali fusion. Silica structure in slag is causing the direct leaching uneffectively. Therefore, pre-treatment step using alkali fusion is required to break the structure of silica and to increase the porosity of slag. Fusion is conducted in 2 hours at 700°C, with ratio of natrium hydroxide (NaOH) : slag = 2 : 1. Later, frit which is leached by water then leached by chloride acid to dissolve REE. As much as 87,5% of REE is dissolved at 2 M on chloride acid (HCl) concentration, in 40°C temperature, -325 mesh particle size, 15 g/100 ml of S/L, 150 rpm of agitation speed, and 5 minutes of leaching time. (author)
2010-07-01
... (TINs) required for registration of book-entry Series EE savings bonds? 351.68 Section 351.68 Money and... TREASURY BUREAU OF THE PUBLIC DEBT OFFERING OF UNITED STATES SAVINGS BONDS, SERIES EE Book-Entry Series EE Savings Bonds § 351.68 Are taxpayer identification numbers (TINs) required for registration of book-entry...
Scintigraphy of the Placenta With {sup 113m}In
Energy Technology Data Exchange (ETDEWEB)
Lewitus, Z.; Lubin, E.; Rechnic, J.; Laor, J.; Eckerling, E. [Beilinson Medical Centre, University of Tel Aviv School of Medicine (Israel)
1969-05-15
The paper describes the merits of using {sup 113m}In in scintigraphic placental localization. The {sup 113m}In, generated from a commercial {sup 113}Sn cow, eluted with 0.05N HC1, stabilized with gelatin at pH 4.0 and autoclaved in the carrier-free form, becomes bound to the plasma proteins after being injected intravenously and stays in the vascular system long enough to enable scanning of the placental blood pools. The short physical half-life and the decay by isomeric transition reduces the radiation dose compared with other scanning agents. The minimal elimination of the molecule into the bladder during scanning has the advantage over the use of {sup 99m}Tc because it diminishes the possible confusion of activity in this area with a low-lying placenta. The placentography has been found of value in the diagnosis of placenta praevia, twins and hydatidiform mole. (author)
Energy Technology Data Exchange (ETDEWEB)
Mejia, I.S.; Escobar A, L.; Camps, E.; Romero, S. [ININ, 52045 Ocoyoacac, Estado de mexico (Mexico); Muhl, S. [IIM, UNAM, A.P. 364, 01000 Mexico D.F. (Mexico)
2006-07-01
Thin films of titanium nitride (TiN), amorphous carbon (a-C), as well as bilayers of Ti/TiN/a-C were deposited by means of the laser ablation technique. It was investigated the effect that it has the laser fluence used to ablation the targets in the structure and mechanical properties of the TiN deposited films. The TiN obtained films have a preferential orientation in the direction (200). The results show that the hardness of this material is influenced by the laser fluence. It is observed that the hardness is increased in an approximately lineal way with the increment of the fluence up to 19 J/cm{sup 2}. The films of amorphous carbon present hardness of the order of 11.2 GPa. Likewise it was found that the multilayers of Ti/TiN/aC presented a bigger hardness that of its individual components. (Author)
The radiochemical purity of technetium-99m-tin-diethylene-triamino-pentaacetic acid (DTPA) complex
International Nuclear Information System (INIS)
Besnard, M.; Costerousse, O.; Merlin, L.; Coehn, Y.
1975-01-01
The effect on radiochemical purity was studied as a function of the storage period of tin-DTPA solution and of the technetium-complex solution. The quantity of the pertechnetate ions present in the solution is determined by ascending paper chromatography, and an attempt was made to clarify the bond type of technetium by a spectrophotometric method. The tin-DTPA solutions for complexing of the reduced technetium are stable over a period of 8 weeks. The yield of the radiopharmaceutical product is better than 95%. (G.Gy.)
Compton scattering of 145 keV photons from bound electrons of tin and molybdenum
Energy Technology Data Exchange (ETDEWEB)
Ghumman, B S; Acharya, V B; Singh, B [Punjabi Univ., Patiala (India). Dept. of Physics
1981-10-28
Differential cross sections for Compton scattering of 145 keV gamma rays from K-shell electrons of tin and molybdenum are measured at scattering angles in the range 30 to 150/sup 0/. Measurements are made employing NaI(Tl) detectors and a coincidence set up with resolving time approximately equal to 30 ns. The experimental results are compared with the available theoretical data. The total cross section is estimated to be about 0.43 sigmasub(F) for tin and 0.41 sigmasub(F) for molybdenum.
Mathematical Modeling of Tin-Free Chemically-Active Antifouling Paint Behavior
DEFF Research Database (Denmark)
Yebra, Diego Meseguer; Kiil, Søren; Dam-Johansen, Kim
2006-01-01
Mathematical modeling has been used to characterize and validate the working mechanisms of tin-free, chemically-active antifouling (AF) paints. The model-based analysis of performance data from lab-scale rotary experiments has shown significant differences between antifouling technologies...... of Chemical Engineers....
7 CFR 1463.113 - Issuance of payments in event of death.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Issuance of payments in event of death. 1463.113 Section 1463.113 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS 2005-2014 TOBACCO TRANSITION PROGRAM Tobacco Transition Payment Program ...
Study of tin amalgam mirrors by "1"1"9Sn Mössbauer spectroscopy and other analytical methods
International Nuclear Information System (INIS)
Lerf, A.; Wagner, F. E.; Herrera, L. K.; Justo, A.; Mu noz-Páez, A.; Pérez-Rodríguez, J. L.
2016-01-01
From the beginning of the 16 "t"h until the end of the 19 "t"h century the most widely used mirrors consisted of a pane of glass backed with a reflecting layer of tin-mercury amalgam. They were made by sliding the glass pane over a tin foil covered with liquid mercury. After removal of the superfluous mercury, tin amalgam formed slowly at ambient temperature and yielded a reflecting layer adhering to the surface of the glass. Such mirrors often deteriorate in the course of time by oxidation of the tin in the amalgam to stannous or stannic oxide. "1"1"9Sn Mössbauer spectroscopy, scanning electron microscopy, micro-XRF and X-ray diffraction have been used to study this deterioration process. The studied specimens were a modern mirror made for the reconstruction of the Green Vault in Dresden in the early 2000s, two rather well preserved German mirrors from the 17 "t"h and 19 "t"h centuries and several strongly deteriorated specimens of Baroque mirrors from the south of Spain. The modern mirror consists mainly of a Sn_0_._9Hg_0_._1 amalgam with only 2 % of SnO_2. The older German mirrors showed more pronounced oxidation, containing 12 and 15 % of SnO_2, which did not noticeably impair their reflectivity. In the samples from the Spanish mirrors at best a few percent of metallic phase was left. The majority of the tin had oxidised to SnO_2, but between 8 and 20 % of the tin was present as SnO. X-ray diffraction yielded similar results and micro-XRF mapping using synchrotron radiation for excitation gave information on the distribution of Sn and Hg in the reflecting layer of the mirrors.
Kavitha, A.; Kannan, R.; Gunasekhar, K. R.; Rajashabala, S.
2017-10-01
Amorphous titanium nitride (TiN) thin films have been prepared on silicon (Si) and glass substrates by direct-current (DC) reactive magnetron sputtering with a supported discharge (triode). Nitrogen gas (N2) at partial pressure of 0.3 Pa, 0.4 Pa, 0.5 Pa, and 0.6 Pa was used to prepare the TiN thin films, maintaining total pressure of argon and N2 of about 0.7 Pa. The chemical, microstructural, optical, and electrical properties of the TiN thin films were systematically studied. Presence of different phases of Ti with nitrogen (N), oxygen (O2), and carbon (C) elements was revealed by x-ray photoelectron spectroscopy characterization. Increase in the nitrogen pressure from 0.3 Pa to 0.6 Pa reduced the optical bandgap of the TiN thin film from 2.9 eV to 2.7 eV. Photoluminescence study showed that TiN thin film deposited at N2 partial pressure of 0.3 Pa exhibited three shoulder peaks at 330 nm, 335 nm, and 340 nm, which disappeared when the sample was deposited with N2 partial pressure of 0.6 Pa. Increase in the nitrogen content decreased the electrical resistivity of the TiN thin film from 3200 μΩ cm to 1800 μΩ cm. Atomic force microscopy studies of the TiN thin films deposited with N2 partial pressure of 0.6 Pa showed a uniform surface pattern associated with accumulation of fine grains. The results and advantages of this method of preparing TiN thin films are also reported.
International Nuclear Information System (INIS)
Froehlich, G.; Mueller, K.
1983-10-01
Experiments were performed in which water was pressed through a thermally isolated tube into a clyindrical crucible (diameter 5 cm, height 7,5 cm both measured inside) filled with molten tin (600 K). The diameter of the circular water outlet was varied from 0.5 up to 10 mm and the discharge velocity of the water was in the range of 0.05 up to 20 m/s. In the tin melt the water divides into single drops, which emerged on the melt surface, if an interaction between water and tin melt did not occur. The probability for an interaction increased in experiments with higher discharge velocities of the water and smaller diameters of the water outlet. In experiments with discharge velocities ≥ 5 m/s and outlet diameters ≤ 2 mm one or more interactions occured in each case. At these interactions of water drops entrapped in the tin melt (called entrapment interactions) a portion of the melt was ejected from the crucible. The moment of the interaction and the pulse of the force toward the crucible bottom were recorded. (orig.) [de
Directory of Open Access Journals (Sweden)
Sanda Rončević
2012-01-01
Full Text Available Tin content in samples of canned fruits and vegetables was determined by hydride generation inductively coupled plasma atomic emission spectrometry (HG-ICP-OES, and it was compared with results obtained by standard method of flame atomic absorption spectrometry (AAS. Selected tin emission lines intensity was measured in prepared samples after addition of tartaric acid and followed by hydride generation with sodium borohydride solution. The most favorable line at 189.991 nm showed the best detection limit (1.9 μg L−1 and limit of quantification (6.4 μg kg−1. Good linearity and sensitivity were established from time resolved analysis and calibration tests. Analytical accuracy of 98–102% was obtained by recovery study of spiked samples. Method of standard addition was applied for tin determination in samples from fully protected tinplate. Tin presence at low-concentration range was successfully determined. It was shown that tenth times less concentrations of Sn were present in protected cans than in nonprotected or partially protected tinplate.
Nayak, Pradipta K.
2013-05-08
It is demonstrated that soft annealing duration strongly affects the performance of solution-processed amorphous zinc tin oxide thin-film transistors. Prolonged soft annealing times are found to induce two important changes in the device: (i) a decrease in zinc tin oxide film thickness, and (ii) an increase in oxygen vacancy concentration. The devices prepared without soft annealing exhibited inferior transistor performances, in comparison to devices in which the active channel layer (zinc tin oxide) was subjected to soft annealing. The highest saturation field-effect mobility - 5.6 cm2 V-1 s-1 with a drain-to-source on-off current ratio (Ion/Ioff) of 2 × 108 - was achieved in the case of devices with 10-min soft-annealed zinc tin oxide thin films as the channel layer. The findings of this work identify soft annealing as a critical parameter for the processing of chemically derived thin-film transistors, and it correlates device performance to the changes in material structure induced by soft annealing. © 2013 American Chemical Society.
Al-Rafia, S M Ibrahim; Shynkaruk, Olena; McDonald, Sean M; Liew, Sean K; Ferguson, Michael J; McDonald, Robert; Herber, Rolfe H; Rivard, Eric
2013-05-06
(119)Sn Mössbauer spectroscopy was performed on a series of formal Sn(II) dichloride and dihydride adducts bound by either carbon- or phosphorus-based electron pair donors. Upon binding electron-withdrawing metal pentacarbonyl units to the tin centers in LB·SnCl2·M(CO)5 (LB = Lewis base; M = Cr or W), a significant decrease in isomer shift (IS) was noted relative to the unbound Sn(II) complexes, LB·SnCl2, consistent with removal of nonbonding s-electron density from tin upon forming Sn-M linkages (M = Cr and W). Interestingly, when the nature of the Lewis base in the series LB·SnCl2·W(CO)5 was altered, very little change in the IS values was noted, implying that the LB-Sn bonds were constructed with tin-based orbitals of large p-character (as supported by prior theoretical studies). In addition, variable temperature Mössbauer measurements were used to determine the mean displacement of the tin atoms in the solid state, a parameter that can be correlated with the degree of covalent bonding involving tin in these species.
Wei, Qiuning; Wei, Yuan; Liu, Fangfang; Ding, Yalei
2015-10-01
To investigate the method for uncertainty evaluation of determination of tin and its compounds in the air of workplace by flame atomic absorption spectrometry. The national occupational health standards, GBZ/T160.28-2004 and JJF1059-1999, were used to build a mathematical model of determination of tin and its compounds in the air of workplace and to calculate the components of uncertainty. In determination of tin and its compounds in the air of workplace using flame atomic absorption spectrometry, the uncertainty for the concentration of the standard solution, atomic absorption spectrophotometer, sample digestion, parallel determination, least square fitting of the calibration curve, and sample collection was 0.436%, 0.13%, 1.07%, 1.65%, 3.05%, and 2.89%, respectively. The combined uncertainty was 9.3%.The concentration of tin in the test sample was 0.132 mg/m³, and the expanded uncertainty for the measurement was 0.012 mg/m³ (K=2). The dominant uncertainty for determination of tin and its compounds in the air of workplace comes from least squares fitting of the calibration curve and sample collection. Quality control should be improved in the process of calibration curve fitting and sample collection.
13 CFR 113.525 - Fringe benefits.
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Fringe benefits. 113.525 Section... benefits. (a) “Fringe benefits” defined. For purposes of these Title IX regulations, fringe benefits means: Any medical, hospital, accident, life insurance, or retirement benefit, service, policy or plan, any...
A Multi-Phase Equation of State and Strength Model for Tin
International Nuclear Information System (INIS)
Cox, G. A.
2006-01-01
This paper considers a multi-phase equation of state and a multi-phase strength model for tin in the β, γ and liquid phases. At a phase transition there are changes in volume, energy, and properties of a material that should be included in an accurate model. The strength model will also be affected by a solid-solid phase transition. For many materials there is a lack of experimental data for strength at high pressures making the derivation of strength parameters for some phases difficult. In the case of tin there are longitudinal sound speed data on the Hugoniot available that have been used here in conjunction with a multi-phase equation of state to derive strength parameters for the γ phase, a phase which does not exist at room temperature and pressure
Thermodynamic modeling of the formation and stability of small tin clusters and their ions
International Nuclear Information System (INIS)
Kodlaa, A.; Suliman, A.
2005-01-01
Based on the results of previous quantum-chemical study of electronic structure properties for neutral and single positively and negatively charged thin clusters in the size range of N 2-17 atoms, and on the thermodynamic laws, we have studied the thermodynamic properties of tin clusters and their ions. The characteristic amounts (cohesive enthalpy, formation enthalpy, fragmentation enthalpy, entropy and free enthalpy) for the formation and stability of these clusters at different temperatures were calculated. From the results, which are presented and discussed in this work, one can observe the following: The tin clusters Sn N (N=2-17) and their cations Sn + N and anions Sn - N are formed in the gas phase, and this agrees with experimental results. The clusters Sn 3 and Sn 1 0 are the most stable clusters of all. Here we also, find a correspondence with the results of the experimental studies. Our results go beyond that since we have found Sn 1 5 is also specially stable. By this thermodynamic study we could evaluate approximately the formation and stability of small neutral, single positively and negatively charged tin clusters. It has also allowed us to study the effects of the temperature on the formation and stability of these clusters. The importance of such study is not only what mentioned above, but it is also the first thermodynamic study for modeling the formation and stability of small tin clusters. (author)
Luthra, Deepali; Kumar, Sacheen
2018-05-01
Fingerprints are the very important evidence at the crime scene which must be developed clearly with shortest duration of time to solve the case. Metal oxide nanoparticles could be the mean to develop the latent fingerprints. Zinc oxide and Tin Oxide Nanoparticles were prepared by using chemical precipitation technique which were dried and characterized by X-ray diffraction, UV-Visible spectroscopy and FTIR. The size of zinc oxide crystallite was found to be 14.75 nm with minimum reflectance at 360 nm whereas tin oxide have the size of 90 nm and reflectance at minimum level 321 nm. By using these powdered samples on glass, plastic and glossy cardboard, latent fingerprints were developed. Zinc oxide was found to be better candidate than tin oxide for the fingerprint development on all the three types of substrates.
Physical properties of pyrolytically sprayed tin-doped indium oxide coatings
Haitjema, H.; Elich, J.J.P.
1991-01-01
The optical and electrical properties of tin-doped indium oxide coatings obviously depend on a number of production parameters. This dependence has been studied to obtain a more general insight into the relationships between the various coating properties. The coatings have been produced by spray
Elaboration and test of the method of separation of alkaline metals ions with tin phosphate
International Nuclear Information System (INIS)
Smirnov, G.I.; Chernyak, A.S.; Kostromina, O.N.; Kachur, N.Ya.; Shpeyzer, B.G.
1986-01-01
Present work is devoted to elaboration and test of the method of separation of alkaline metals ions with tin phosphate. Thus, the isotherms of sorption of lithium, sodium, potassium, rubidium and cesium ions with amorphous tin phosphate depending on their concentration, ph of solution, sorbent quantity are obtained. The parameters of extraction of potassium microquantities from sodium salts are defined. Ultra pure sodium chloride, sodium iodide, sodium sulphate, sodium nitrate, sodium nitrite, sodium phosphate are synthesized.
36 CFR 11.3 - Power to revoke.
2010-07-01
... AND PARKSCAPE SYMBOLS § 11.3 Power to revoke. Permission granted under this part by the Director may... injurious to their integrity or inconsistent with the purposes of the National Park Service in the fields of...
Colorimetric properties of TiN coating implanted by aluminum
Energy Technology Data Exchange (ETDEWEB)
Zhou, Q.G. [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China)]. E-mail: zhouqg99@mails.tsinghua.edu.cn; Bai, X.D. [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Xue, X.Y. [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Ling, Y.H. [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Chen, X.W. [Department of Materials Science and Engineering, Tsinghua University, Beijing 100084 (China); Xu, J. [Beijing Great Wall Ti-Gold Corporation, Beijing 100095 (China); Wang, D.R. [Beijing Great Wall Ti-Gold Corporation, Beijing 100095 (China)
2005-04-05
TiN coating was prepared by cathodic arc deposition and implanted aluminum using a metal vacuum vapor arc ion source with doses ranging from 5 x 10{sup 16} to 2 x 10{sup 17} ions/cm{sup 2}. The purpose of this work was to determine the dependence of the colorimetric properties of TiN films on the implanting conditions, especially by the aluminum ion implantation. The colorimetry of coatings was evaluated quantitatively in terms of CIE L * a * b *. The color coordinate values L *, a *, and b * provide a numerical representation of the color of the surface. With the dose increasing, the surface color has no obvious change but the surface turns brighter, and a * as well as b * values all decline. The X-ray diffraction patterns showed that the aluminum implantation induced a slight shift of diffraction peaks. X-ray photoemission spectroscopy was employed to analyze the surface valence states. The oxygen in surface top layer does not decrease a * and b * values, it partially combined with nitrogen.
Self-assembly surface modified indium-tin oxide anodes for single-layer light-emitting diodes
Morgado, J; Charas, A; Matos, M; Alcacer, L; Cacialli, F
2003-01-01
We study the effect of indium-tin oxide surface modification by self assembling of highly polar molecules on the performance of single-layer light-emitting diodes (LEDs) fabricated with polyfluorene blends and aluminium cathodes. We find that the efficiency and light-output of such LEDs is comparable to, and sometimes better than, the values obtained for LEDs incorporating a hole injection layer of poly(3,4-ethylene dioxythiophene) doped with polystyrene sulphonic acid. This effect is attributed to the dipole-induced work function modification of indium-tin oxide.
Post-deposition annealing effects in RF reactive magnetron sputtered indium tin oxide thin films
Energy Technology Data Exchange (ETDEWEB)
Martinez, M A; Herrero, J; Gutierrez, M T [Inst. de Energias Renovables (CIEMAT), Madrid (Spain)
1992-05-01
Indium tin oxide films have been grown by RF reactive magnetron sputtering. The influence of the deposition parameters on the properties of the films has been investigated and optimized, obtaining a value for the figure of merit of 6700 ({Omega} cm){sup -1}. As-grown indium tin oxide films were annealed in vacuum and O{sub 2} atmosphere. After these heat treatments the electro-optical properties were improved, with values for the resistivity of 1.9x10{sup -4} {Omega} cm and the figure of merit of 26700 ({Omega} cm){sup -1}. (orig.).
Self-assembly surface modified indium-tin oxide anodes for single-layer light-emitting diodes
International Nuclear Information System (INIS)
Morgado, Jorge; Barbagallo, Nunzio; Charas, Ana; Matos, Manuel; Alcacer, Luis; Cacialli, Franco
2003-01-01
We study the effect of indium-tin oxide surface modification by self assembling of highly polar molecules on the performance of single-layer light-emitting diodes (LEDs) fabricated with polyfluorene blends and aluminium cathodes. We find that the efficiency and light-output of such LEDs is comparable to, and sometimes better than, the values obtained for LEDs incorporating a hole injection layer of poly(3,4-ethylene dioxythiophene) doped with polystyrene sulphonic acid. This effect is attributed to the dipole-induced work function modification of indium-tin oxide
International Nuclear Information System (INIS)
Romanini, S.J.
1982-01-01
The geochemical and petroLogical characteristics of the Massangana Granitoid Complex, situated in the Rondonia Federal Territory, Brazil, aiming to discriminate the tin mineralized granitic rocks from the no mineralized ones. The collected samples consists of examples in tin mineralized and sterile phases. The elements traces were determined by x-ray fluorescence analysis, emission spectrography, molecular absorption spectrophotometry and atomic absorption spectrophotometry. The complex edifying evolved in four sucessive episodes called Massangana Phase, Bom Jardim Phase, Sao domingos Phase and Taboca Phase ordered stratigraphycally in this sequence. (author/M.C.K.) [pt
Energy Technology Data Exchange (ETDEWEB)
Jiang Xianjuan [Department of Chemistry, University of Science and Technology of China, Hefei, Anhui 230026 (China); Gan Wuer, E-mail: wgan@ustc.edu.cn [Department of Chemistry, University of Science and Technology of China, Hefei, Anhui 230026 (China); Wan Lingzhong; Deng Yun; Yang Qinghua; He Youzhao [Department of Chemistry, University of Science and Technology of China, Hefei, Anhui 230026 (China)
2010-12-15
An electrochemical hydride generation system with polyaniline-modified lead cathode was developed for tin determination by coupling with atomic fluorescence spectrometry. The tin fluorescence signal intensity was improved evidently as the polyaniline membrane could facilitate the transformation process from atomic tin to the SnH{sub 4} and prevent the aggradation of Sn atom on Pb electrode surface. The effects of experimental parameters and interferences have been studied. The limit of detection (LOD) was 1.5 ng mL{sup -1} (3{sigma}) and the relative standard deviation (RSD) was 3.3% for 11 consecutive measurements of 50 ng mL{sup -1} Sn(IV) standard solution.
Investigation of TiN thin film oxidation depending on the substrate temperature at vacuum break
Energy Technology Data Exchange (ETDEWEB)
Piallat, Fabien, E-mail: fabien.piallat@gmail.com [STMicroelectronics, 850 rue Jean Monnet, 38920 Crolles (France); CEA, LETI, Campus Minatec, F-38054 Grenoble (France); LTM-CNRS, 17 rue des Martyrs, 38054 Grenoble (France); Gassilloud, Remy [CEA, LETI, Campus Minatec, F-38054 Grenoble (France); Caubet, Pierre [STMicroelectronics, 850 rue Jean Monnet, 38920 Crolles (France); Vallée, Christophe [LTM-CNRS, 17 rue des Martyrs, 38054 Grenoble (France)
2016-09-15
Due to the reduction of the thickness of the layers used in the advanced technology nodes, there is a growing importance of the surface phenomena in the definition of the general properties of the materials. One of the least controlled and understood phenomenon is the oxidation of metals after deposition, at the vacuum break. In this study, the influence of the sample temperature at vacuum break on the oxidation level of TiN deposited by metalorganic chemical vapor deposition is investigated. TiN resistivity appears to be lower for samples which underwent vacuum break at high temperature. Using X-ray photoelectron spectrometry analysis, this change is correlated to the higher oxidation of the TiN layer. Moreover, angle resolved XPS analysis reveals that higher is the temperature at the vacuum break, higher is the surface oxidation of the sample. This surface oxidation is in turn limiting the diffusion of oxygen in the volume of the layer. Additionally, evolution of TiN layers resistivity was monitored in time and it shows that resistivity increases until a plateau is reached after about 10 days, with the lowest temperature at vacuum break resulting in the highest increase, i.e., the resistivity of the sample released to atmosphere at high temperature increased by a factor 1.7 whereas the resistivity of the sample cooled down under vacuum temperature increased by a factor 2.7.
14 CFR 61.113 - Private pilot privileges and limitations: Pilot in command.
2010-01-01
... 14 Aeronautics and Space 2 2010-01-01 2010-01-01 false Private pilot privileges and limitations: Pilot in command. 61.113 Section 61.113 Aeronautics and Space FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF TRANSPORTATION (CONTINUED) AIRMEN CERTIFICATION: PILOTS, FLIGHT INSTRUCTORS, AND GROUND...
47 CFR 74.113 - Supplementary reports with application for renewal of license.
2010-10-01
... renewal of license. 74.113 Section 74.113 Telecommunication FEDERAL COMMUNICATIONS COMMISSION (CONTINUED... covered. (4) Power employed, field intensity measurements and visual and aural observations and the types... respective types of transmissions. (5) Estimated degree of public participation in reception and the results...
Genome Sequence of the Biocontrol Strain Pseudomonas fluorescens F113
Redondo-Nieto, Miguel; Barret, Matthieu; Morrisey, John P.; Germaine, Kieran; Martínez-Granero, Francisco; Barahona, Emma; Navazo, Ana; Sánchez-Contreras, María; Moynihan, Jennifer A.; Giddens, Stephen R.; Coppoolse, Eric R.; Muriel, Candela; Stiekema, Willem J.; Rainey, Paul B.; Dowling, David; O'Gara, Fergal; Martín, Marta
2012-01-01
Pseudomonas fluorescens F113 is a plant growth-promoting rhizobacterium (PGPR) that has biocontrol activity against fungal plant pathogens and is a model for rhizosphere colonization. Here, we present its complete genome sequence, which shows that besides a core genome very similar to those of other strains sequenced within this species, F113 possesses a wide array of genes encoding specialized functions for thriving in the rhizosphere and interacting with eukaryotic organisms. PMID:22328765
Li, Qinghui; Liu, Song; Su, Bomin; Zhao, Hongxia; Fu, Qiang; Dong, Junqing
2013-02-01
A total of nine tin-contained ancient glass beads were characterized by a combination of scanning electron microscopy coupled with energy-dispersive X-ray spectrometry and Raman spectroscopy. These glass beads dated from 1st century BC to 10th century AD were excavated from the Xinjiang and Guangxi provinces of China. Two kinds of tin-based opacifiers/colorants included crystalline cassiterite (SnO(2)) and lead-tin yellow types II were first found in these soda lime glass beads. The tentative chronology of the tin-based opacifiers/colorants used in ancient glasses from China and the West was compared. In addition, several transition metal ions colorants were also found in these beads. The detailed study of the glassy matrices, crystalline inclusions, and the microstructural heterogeneities for these glass beads has revealed some valuable information to trace the possible making technology and provenances. Copyright © 2012 Wiley Periodicals, Inc.
Amphibolites in the Rare Metal- and Tin-bearing Bastar – Malkangiri ...
Indian Academy of Sciences (India)
33
21-10-284/1, Begumpet, Brahmanwadi Lane no. ... Odisha states of India, is well known for primary and secondary commercial deposits of tin .... carried out using the rapid wet chemical methods, essentially after Shapiro and Brannock. (1955).
International Nuclear Information System (INIS)
Balaes, A.M.E.; Jacobs, J.J.; Bray, A.R.; Kendrick, K.
1983-01-01
The method of analysis described is applicable to samples with tin and tungsten contents from 15p.p.m. to 75 per cent. For samples containing tin and tungsten in the range 2000p.p.m. to 75 per cent, the matrix variations are compensated for by the use of briquettes containing coarse river sand, the internal standard, and potassium chloride, the last of which acts as a binder, diluet, and grinding aid. For the samples containing tin and tungsten in the range 15p.p.m. to 2000p.p.m., the potassium chloride is omitted. Zinc and antimony are used as the internal standard for tungsten and tin respectively. Calibration graphs for tin and tungsten are obtained by the use of standard reference materials for cassiterite and scheelite. The precision of the analysis for tin ranges from a relative standard deviation of 0,039 at 50p.p.m. to 0,005 at 75 per cent. The values for tungsten are relatively constant at between 0,015 and 0,008 at concentrations between 50p.p.m. and 50 per cent. The lower limits of detection for tungsten and tin by the high-concentration technique of analysis are 202 and 155p.p.m. respectively, and by the low-concentration technique the corresponding limits are 4 and 2p.p.m. The overall time required for the analysis of ten samples by these techniques is approximately 3 hours. The laboratory method is detailed in an appendix
Synthesis and characterization of single-crystalline zinc tin oxide nanowires
Shi, Jen-Bin; Wu, Po-Feng; Lin, Hsien-Sheng; Lin, Ya-Ting; Lee, Hsuan-Wei; Kao, Chia-Tze; Liao, Wei-Hsiang; Young, San-Lin
2014-05-01
Crystalline zinc tin oxide (ZTO; zinc oxide with heavy tin doping of 33 at.%) nanowires were first synthesized using the electrodeposition and heat treatment method based on an anodic aluminum oxide (AAO) membrane, which has an average diameter of about 60 nm. According to the field emission scanning electron microscopy (FE-SEM) results, the synthesized ZTO nanowires are highly ordered and have high wire packing densities. The length of ZTO nanowires is about 4 μm, and the aspect ratio is around 67. ZTO nanowires with a Zn/(Zn + Sn) atomic ratio of 0.67 (approximately 2/3) were observed from an energy dispersive spectrometer (EDS). X-ray diffraction (XRD) and corresponding selected area electron diffraction (SAED) patterns demonstrated that the ZTO nanowire is hexagonal single-crystalline. The study of ultraviolet/visible/near-infrared (UV/Vis/NIR) absorption showed that the ZTO nanowire is a wide-band semiconductor with a band gap energy of 3.7 eV.
Fiber-Optic Thermal Sensor for TiN Film Crack Monitoring
Directory of Open Access Journals (Sweden)
Hsiang-Chang Hsu
2017-11-01
Full Text Available The study focuses on the thermal and temperature sensitivity behavior of an optical fiber sensor device. In this article, a titanium nitride (TiN-coated fiber Bragg grating (FBG sensor fabricated using an ion beam sputtering system was investigated. The reflection spectra of the FBG sensor were tested using R-soft optical software to simulate the refractive index sensitivity. In these experiments, the temperature sensitivity of the TiN FBG was measured at temperatures ranging from 100 to 500 °C using an optical spectrum analyzer (OSA. The results showed that the temperature sensitivity of the proposed TiN FBG sensor reached 12.8 pm/°C for the temperature range of 100 to 300 °C and 20.8 pm/°C for the temperature range of 300 to 500 °C. Additionally, we found that the produced oxidation at temperatures of 400-500 °C caused a crack, with the crack becoming more and more obvious at higher and higher temperatures.
Ishak Yuarsah; Etik Puji Handayani; Rakhmiati; Yatmin
2017-01-01
The practices of tin mining that remove all soil layers on top of the mineral deposit layers have caused serious environmental problems, i.e. degradation of soil physical and chemical properties and disappearance of vegetation, flora and fauna in ecosystems, which further can change the local microclimate. The tailing area of tin mining have unstable soil structure and low organic matter content, so it is vulnerable to land slides and erosion. The characteristics of the soils in the tailing a...
Directory of Open Access Journals (Sweden)
Karzan A. Omar
2013-11-01
Full Text Available Tin oxide nanoparticles are prepared by electrochemical reduction method using tetrapropylammonium bromide (TPAB and tetrabutylammonium bromide (TBAB as structure directing agent in an organic medium viz. tetrahydrofuran (THF and acetonitrile (ACN in 4:1 ratio by optimizing current density and molar concentration of the ligand. The reduction process takes place under an inert atmosphere of nitrogen over a period of 2 h. Such nanoparticles are prepared by using a simple electrolysis cell in which the sacrificial anode as a commercially available in tin metal sheet and platinum (inert sheet act as a cathode. The parameters such as current density, solvent polarity, distance between electrodes and concentration of stabilizers are used to control the size of nanoparticles. The synthesized tin oxide nanoparticles are characterized by using UV–Visible, FT-IR and SEM–EDS analysis techniques. UV-Visible spectroscopy has revealed the optical band gap to be 4.13, 4.16 and 4.24 ev for (8, 10 and 12 mA/cm2 and the effect of current density on theirs particle size, respectively.
Synthesis, Characterization and Evaluation of Tin-containing Silicates for Biomass Conversion
DEFF Research Database (Denmark)
Tolborg, Søren
at optimized conditions. The effect of alkali was found to transcend to a variety of sugars, solvents and other stannosilicates such as Sn-MCM-41 or Sn-Beta prepared by a post-synthesis methodology. The latter makes it possible to use industrially relevant tin-containing catalysts to achieved high yields......The transition to renewable carbon sources such as biomass will require entirely new catalytic processes and result in completely new products. An entire industry is built up around the chemicals that are available from fossil resources but will be unfeasible to prepare from other carbon sources....... This dissertation describes the preparation and use of several important stannosilicate materials, known to transform carbohydrates into different valuable products. Several aspects of the tin-containing catalysts are investigated and discussed and new insight into the conversion of sugars is provided. The catalyst...
Courey, Karim; Wright, Clara; Asfour, Shihab; Bayliss, Jon; Ludwig, Larry
2008-01-01
Existing risk simulations make the assumption that when a free tin whisker has bridged two adjacent exposed electrical conductors, the result is an electrical short circuit. This conservative assumption is made because shorting is a random event that has a currently unknown probability associated with it. Due to contact resistance, electrical shorts may not occur at lower voltage levels. In this experiment, we study the effect of varying voltage on the breakdown of the contact resistance which leads to a short circuit. From this data, we can estimate the probability of an electrical short, as a function of voltage, given that a free tin whisker has bridged two adjacent exposed electrical conductors. In addition, three tin whiskers grown from the same Space Shuttle Orbiter card guide used in the aforementioned experiment were cross sectioned and studied using a focused ion beam (FIB).
International Nuclear Information System (INIS)
Rie, K.T.; Gebauer, A.; Woehle, J.
1993-01-01
The plasma-assisted chemical vapour deposition of TiN layers on steel substrates was investigated for various process parameters in this work. Optical emission spectroscopy (OES) was used to identify the species in the electrical discharge during the deposition process. The layer properties of the deposited TiN layers were determined by various methods (scanning electron microscopy, energy- and wavelength-dispersive X-ray analysis). The deposited layers have a constant amount of titanium, while the contents of nitrogen and chlorine show a contrary behaviour for different deposition parameters. The hardness of the layers is related among other things to the chlorine content. The OES investigations show that the Ti + and N 2 + emission is related to the layer growth rate. The formation of TiN in a gas phase reaction degrades the quality of the layers, such as their hardness. (orig.)
International Nuclear Information System (INIS)
Khun Khun, Kamalpreet; Mahajan, Aman; Bedi, R.K.
2011-01-01
Tin oxide nanostructures with well defined morphologies have been obtained through an evaporation induced self assembly process. The technique has been employed using an ultrasonic nebulizer for production of aersol and its subsequent deposition onto a heated glass substrate. The precursor used for aersol production was modified by introducing cationic and anionic surfactants namely cetyl trimethyl ammonium bromide and sodium dodecyl sulphate respectively. The effect of surfactants on the structural, electrical and optical properties of self assembled tin oxide nanostructures were investigated by using X-ray diffraction, field emission scanning electroscope microscopy, two probe technique and photoluminiscence studies. The results reveal that high concentration of surfactants in the precursor solution leads to reduction in crystallite size with significant changes in the morphology of tin oxide nanostructures. Photoluminiscence studies of the nanostructures show emissions in the visible region which exhibit marked changes in the intensities upon variation of surfactants in the precursor solutions.
Energy Technology Data Exchange (ETDEWEB)
Khun Khun, Kamalpreet [Material Science Laboratory, Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Mahajan, Aman, E-mail: dramanmahajan@yahoo.co.in [Material Science Laboratory, Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India); Bedi, R.K. [Material Science Laboratory, Department of Physics, Guru Nanak Dev University, Amritsar 143005 (India)
2011-01-15
Tin oxide nanostructures with well defined morphologies have been obtained through an evaporation induced self assembly process. The technique has been employed using an ultrasonic nebulizer for production of aersol and its subsequent deposition onto a heated glass substrate. The precursor used for aersol production was modified by introducing cationic and anionic surfactants namely cetyl trimethyl ammonium bromide and sodium dodecyl sulphate respectively. The effect of surfactants on the structural, electrical and optical properties of self assembled tin oxide nanostructures were investigated by using X-ray diffraction, field emission scanning electroscope microscopy, two probe technique and photoluminiscence studies. The results reveal that high concentration of surfactants in the precursor solution leads to reduction in crystallite size with significant changes in the morphology of tin oxide nanostructures. Photoluminiscence studies of the nanostructures show emissions in the visible region which exhibit marked changes in the intensities upon variation of surfactants in the precursor solutions.
48 CFR 1371.113 - Department of Labor occupational safety and health standards for ship repair.
2010-10-01
... occupational safety and health standards for ship repair. 1371.113 Section 1371.113 Federal Acquisition... CONSTRUCTION AND SHIP REPAIR Provisions and Clauses 1371.113 Department of Labor occupational safety and health standards for ship repair. Insert clause 1352.271-82, Department of Labor Occupational Safety and Health...
Gutiérrez Moreno, José Julio; Nolan, Michael
2017-11-01
Titanium nitride (TiN) is widely used in industry as a protective coating due to its hardness and resistance to corrosion and can spontaneously form a thin oxide layer when it is exposed to air, which could modify the properties of the coating. With limited understanding of the TiO 2 -TiN interfacial system at present, this work aims to describe the structural and electronic properties of oxidized TiN based on a density functional theory (DFT) study of the rutile TiO 2 (110)-TiN(100) interface model system, also including Hubbard +U correction on Ti 3d states. The small lattice mismatch gives a good stability to the TiO 2 -TiN interface after depositing the oxide onto TiN through the formation of interfacial Ti-O bonds. Our DFT+U study shows the presence of Ti 3+ cations in the TiO 2 region, which are preferentially located next to the interface region as well as the rotation of the rutile TiO 2 octahedra in the interface structure. The DFT+U TiO 2 electronic density of states (EDOS) shows localized Ti 3+ defect states forming in the midgap between the top edge of the valence and the bottom of the conduction band. We increase the complexity of our models by the introduction of nonstoichiometric compositions. Although the vacancy formation energies for Ti in TiN (E vac (Ti) ≥ 4.03 eV) or O in the oxide (E vac (O) ≥ 3.40 eV) are quite high relative to perfect TiO 2 -TiN, defects are known to form during the oxide growth and can therefore be present after TiO 2 formation. Our results show that a structure with exchanged O and N can lie 0.82 eV higher in energy than the perfect system, suggesting the stability of structures with interdiffused O and N anions at ambient conditions. The presence of N in TiO 2 introduces N 2p states localized between the top edge of the O 2p valence states and the midgap Ti 3+ 3d states, thus reducing the band gap in the TiO 2 region for the exchanged O/N interface EDOS. The outcomes of these simulations give us a most comprehensive
International Nuclear Information System (INIS)
Srivastava, S.C.; Richards, P.; Meinken, G.E.; Som, P.; Knapp, F.F. Jr.; Butler, T.A.
1982-01-01
Tissue distribution in mice of stannous chloride (pH 2), and of stannous as well as stannic chelates of MDP and DTPA is described. The bone-to-tissue ratios of these compounds are evaluated. High bone uptake of all these compounds point out the high affinity of tin for bone despite the chemically diverse ligands. Whole body autoradiographs of mice injected with tin-117m(IV)-DTPA demonstrate the almost exclusive localization of tin-117m activity in bone. Clarity of bone images in a dog, obtained up to 15 days following the injection of tin-117m(IV)-DTPA is demonstrated
Nakai, K.; Hamada, K.; Satoh, Y.; Yoshiie, T.
2011-01-01
The growth and shrinkage of interstitial clusters on {113} planes were investigated in electron irradiated Czochralski grown silicon (Cz-Si), floating-zone silicon (Fz-Si), and impurity-doped Fz-Si (HT-Fz-Si) using a high voltage electron microscope. In Fz-Si, {113} interstitial clusters were formed only near the beam incident surface after a long incubation period, and shrank on subsequent irradiation from the backside of the specimen. In Cz-Si and HT-Fz-Si, {113} interstitial clusters nucleated uniformly throughout the specimen without incubation, and began to shrink under prolonged irradiation at higher electron beam intensity. At lower beam intensity, however, the {113} interstitial cluster grew stably. These results demonstrate that the {113} interstitial cluster cannot grow without a continuous supply of impurities during electron irradiation. Detailed kinetics of {113} interstitial cluster growth and shrinkage in silicon, including the effects of impurities, are proposed. Then, experimental results are analyzed using rate equations based on these kinetics.
Directory of Open Access Journals (Sweden)
Kuang-Ting Cheng
2018-03-01
Full Text Available P-113, which was originally derived from the human saliva protein histatin 5, is a histidine-rich antimicrobial peptide with the sequence AKRHHGYKRKFH. P-113 is currently undergoing phase II clinical trial as a pharmaceutical agent to fight against fungal infections in HIV patients with oral candidiasis. Previously, we developed a new procedure for the high-yield expression and purification of hG31P, an analogue and antagonist of human CXCL8. Moreover, we have successfully removed lipopolysaccharide (LPS, endotoxin associated with hG31P in the expression with Escherichia coli. In this paper, we have used hG31P as a novel fusion protein for the expression and purification of P-113. The purity of the expressed P-113 is more than 95% and the yield is 4 mg P-113 per liter of E. coli cell culture in Luria-Bertani (LB medium. The antimicrobial activity of the purified P-113 was tested. Furthermore, we used circular dichroism (CD and nuclear magnetic resonance (NMR spectroscopy to study the structural properties of P-113. Our results indicate that using hG31P as a fusion protein to obtain large quantities of P-113 is feasible and is easy to scale up for commercial production. An effective way of producing enough P-113 for future clinical studies is evident in this study.
9 CFR 113.102 - Leptospira Icterohaemorrhagiae Bacterin.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Leptospira Icterohaemorrhagiae... REQUIREMENTS Inactivated Bacterial Products § 113.102 Leptospira Icterohaemorrhagiae Bacterin. Leptospira Icterohaemorrhagiae Bacterin shall be produced from a culture of Leptospira icterohaemorrhagiae which has been...
Surface characterization of sol–gel derived indium tin oxide films on ...
Indian Academy of Sciences (India)
Unknown
, India ... 1. Introduction. Indium tin oxide (ITO) coating on glass is an important item in the field ..... In addition, contamination of carbon from environment cannot be ruled ..... processing of ceramics, glasses and composites (eds) L L. Hench and ...
Measurement of partial coefficients of sputtering of titanium atoms from TiC and TiN coatings
International Nuclear Information System (INIS)
Vychegzhanin, G.A.; Gribanov, Yu.A.; Dikij, N.P.; Zhmurin, P.N.; Letuchij, A.N.; Matyash, P.P.; Sidokur, P.I.; Shono, D.A.
1989-01-01
Method of laser fluorescent spectroscopy was used to measure partial coefficients of sputtering of titanium atoms from TiC and TiN coatings under irradiation by 1 keV hydrogen ions. Irradiation was conducted in a plant with reflective discharge. Investigation of damaged layer in irradiated samples was conducted. The presence of near-the-surface layer enrichment with titanium atoms was revealed both in TiC and TiN samples. 12 refs.; 4 figs
Remediation of acid mine drainage from the Santa Fe tin mine, Bolivia
Calvo, Daniel; Zamora Echenique, Gerardo; Alfonso, Pura; Casado, Jordi; Trujillo, Elvys; Jiménez-Franco, Abigail; Garcia-Valles, Maite
2015-04-01
The Santa Fe mine, department of Oruro, is located in the Andean Tin belt, is exploited for tin, zinc, lead and silver. This in an underground mine mined up to the -108 level. Today it is only mined up to the -50 level. Under this level the table water covers the mine. Water reaches the surface with a very acidic composition, with a high content in potentially toxic elements. This water drains directly to the Santa Fe River and contribute to the pollution present in this river that directly affect to the aquatic communities. In addition, population of this area have problems in the supply of drinking water, so remediation by obtaining cleaning water is a priority for this area. This study presents a neutralization-precipitation treatment with lime to the acid water inside the mine. The ore mineralogy of the Santa Fe mined deposit consists mainly in cassiterite, pyrite, sphalerite, galena, arsenopyrite argentite and sulphosalts. The host mineral is mainly quartz, with a minor content in feldspars and tourmaline. Alteration minerals as alunite, goethite and pumbojarosite are abundant and indicate the occurrence of reactions that lead to the formation of acid mine drainage. The mean pH of water drained from the Santa Fe mine is 2.2 and chemical analyses show high contents in potentially toxic elements: 27-295 ppm Zn, 0.05-0.2 ppm Pb, 0.06-0.09 ppm Cd, 04-0.12 ppm Cu, 113-165 ppm Fe, 4 ppm Mn and 564-664 ppm S. As and Sb were under 0.5 ppm. A settler tank inside the mine was designed by means of seal a selected gallery to clean the mine water. The function of this gallery is to sediment the sludge resulting from the neutralization - precipitation treatment process to obtain a clear water overflow continuously to the outside. The neutralization tests indicate that 0.65g/L of lime and 2ml of flocculant should be added to neutralize water up to pH 6-7. A flow rate of 80 L /s was considered. After a geotechnical study, a chamber located in the mine was selected to locate
Understanding the difference in cohesive energies between alpha and beta tin in DFT calculations
International Nuclear Information System (INIS)
Legrain, Fleur; Manzhos, Sergei
2016-01-01
The transition temperature between the low-temperature alpha phase of tin to beta tin is close to the room temperature (T_α_β = 13"0C), and the difference in cohesive energy of the two phases at 0 K of about ΔE_c_o_h =0.02 eV/atom is at the limit of the accuracy of DFT (density functional theory) with available exchange-correlation functionals. It is however critically important to model the relative phase energies correctly for any reasonable description of phenomena and technologies involving these phases, for example, the performance of tin electrodes in electrochemical batteries. Here, we show that several commonly used and converged DFT setups using the most practical and widely used PBE functional result in ΔE_c_o_h ≈0.04 eV/atom, with different types of basis sets and with different models of core electrons (all-electron or pseudopotentials of different types), which leads to a significant overestimation of T_α_β. We show that this is due to the errors in relative positions of s and p –like bands, which, combined with different populations of these bands in α and β Sn, leads to overstabilization of alpha tin. We show that this error can be effectively corrected by applying a Hubbard +U correction to s –like states, whereby correct cohesive energies of both α and β Sn can be obtained with the same computational scheme. We quantify for the first time the effects of anharmonicity on ΔE_c_o_h and find that it is negligible.
Understanding the difference in cohesive energies between alpha and beta tin in DFT calculations
Energy Technology Data Exchange (ETDEWEB)
Legrain, Fleur; Manzhos, Sergei, E-mail: mpemanzh@nus.edu.sg [Department of Mechanical Engineering, National University of Singapore, 117576 (Singapore)
2016-04-15
The transition temperature between the low-temperature alpha phase of tin to beta tin is close to the room temperature (T{sub αβ} = 13{sup 0}C), and the difference in cohesive energy of the two phases at 0 K of about ΔE{sub coh} =0.02 eV/atom is at the limit of the accuracy of DFT (density functional theory) with available exchange-correlation functionals. It is however critically important to model the relative phase energies correctly for any reasonable description of phenomena and technologies involving these phases, for example, the performance of tin electrodes in electrochemical batteries. Here, we show that several commonly used and converged DFT setups using the most practical and widely used PBE functional result in ΔE{sub coh} ≈0.04 eV/atom, with different types of basis sets and with different models of core electrons (all-electron or pseudopotentials of different types), which leads to a significant overestimation of T{sub αβ}. We show that this is due to the errors in relative positions of s and p –like bands, which, combined with different populations of these bands in α and β Sn, leads to overstabilization of alpha tin. We show that this error can be effectively corrected by applying a Hubbard +U correction to s –like states, whereby correct cohesive energies of both α and β Sn can be obtained with the same computational scheme. We quantify for the first time the effects of anharmonicity on ΔE{sub coh} and find that it is negligible.
Localization of the placenta on gamma chamber with 113m In-lambratene
International Nuclear Information System (INIS)
Shejretova, E.; Blazheva, P.; Kovacheva, S.; Tsanev, Ts.
1977-01-01
The authors describe their experience in applying the radioisotopic method for localization of the placenta on gamma chamber by means of 113m In-lambratene (113m In-cysteamine). This complex is chosen due to its valuable physical characteristics of 113m In as shortliving, with whom lambratene is labelled, with proven irradiation protective properties, with the purpose of lowering irradiation load of the fetus. The authors use unique apparatus, gamma chamber Pho-Gamma HP and conventional scanner during injection of 2 mCi 113m In-lambratene. The authors examined 81 women, 42 of whom were pregnant at 6 to 10 months of gestation and 39 women from the third to the fifth month of gestation because of bleedings, Rh isoimmunization with forthcoming amniocentesis, and state after cesarian section for the first group and impending interruption of pregnancy for the second group. The diagnosis of the placenta localization was supported by cesarian section, delivery and interruption of pregnancy. There was 100% coincidence of the diagnosis. (author)