WorldWideScience

Sample records for timing variation ttv

  1. EXTRACTING PLANET MASS AND ECCENTRICITY FROM TTV DATA

    International Nuclear Information System (INIS)

    Lithwick, Yoram; Xie Jiwei; Wu Yanqin

    2012-01-01

    Most planet pairs in the Kepler data that have measured transit time variations (TTVs) are near first-order mean-motion resonances. We derive analytical formulae for their TTV signals. We separate planet eccentricity into free and forced parts, where the forced part is purely due to the planets' proximity to resonance. This separation yields simple analytical formulae. The phase of the TTV depends sensitively on the presence of free eccentricity: if the free eccentricity vanishes, the TTV will be in phase with the longitude of conjunctions. This effect is easily detectable in current TTV data. The amplitude of the TTV depends on planet mass and free eccentricity, and it determines planet mass uniquely only when the free eccentricity is sufficiently small. We analyze the TTV signals of six short-period Kepler pairs. We find that three of these pairs (Kepler 18, 24, 25) have a TTV phase consistent with zero. The other three (Kepler 23, 28, 32) have small TTV phases, but ones that are distinctly non-zero. We deduce that the free eccentricities of the planets are small, ∼< 0.01, but not always vanishing. Furthermore, as a consequence of this, we deduce that the true masses of the planets are fairly accurately determined by the TTV amplitudes, within a factor of ∼< 2. The smallness of the free eccentricities suggests that the planets have experienced substantial dissipation. This is consistent with the hypothesis that the observed pile-up of Kepler pairs near mean-motion resonances is caused by resonant repulsion. But the fact that some of the planets have non-vanishing free eccentricity suggests that after resonant repulsion occurred there was a subsequent phase in the planets' evolution when their eccentricities were modestly excited, perhaps by interplanetary interactions.

  2. Transit timing observations from Kepler. V. Transit timing variation candidates in the first sixteen months from polynomial models

    DEFF Research Database (Denmark)

    Ford, E.B.; Ragozzine, D.; Holman, M.J.

    2012-01-01

    Transit timing variations provide a powerful tool for confirming and characterizing transiting planets, as well as detecting non-transiting planets. We report the results of an updated transit timing variation (TTV) analysis for 1481 planet candidates based on transit times measured during...... that several of these planet candidates could be confirmed and perhaps characterized with more detailed TTV analyses using publicly available Kepler observations. For many others, Kepler has observed a long-term TTV trend, but an extended Kepler mission will be required to characterize the system via TTVs. We...

  3. TRANSIT TIMING OBSERVATIONS FROM KEPLER. V. TRANSIT TIMING VARIATION CANDIDATES IN THE FIRST SIXTEEN MONTHS FROM POLYNOMIAL MODELS

    Energy Technology Data Exchange (ETDEWEB)

    Ford, Eric B. [Astronomy Department, University of Florida, 211 Bryant Space Sciences Center, Gainesville, FL 32111 (United States); Ragozzine, Darin; Holman, Matthew J. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Rowe, Jason F.; Barclay, Thomas; Borucki, William J.; Bryson, Stephen T.; Caldwell, Douglas A.; Kinemuchi, Karen; Koch, David G.; Lissauer, Jack J.; Still, Martin; Tenenbaum, Peter [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Steffen, Jason H. [Fermilab Center for Particle Astrophysics, P.O. Box 500, MS 127, Batavia, IL 60510 (United States); Batalha, Natalie M. [Department of Physics and Astronomy, San Jose State University, San Jose, CA 95192 (United States); Fabrycky, Daniel C. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Gautier, Thomas N. [Jet Propulsion Laboratory/California Institute of Technology, Pasadena, CA 91109 (United States); Ibrahim, Khadeejah A.; Uddin, Kamal [Orbital Sciences Corporation/NASA Ames Research Center, Moffett Field, CA 94035 (United States); Kjeldsen, Hans, E-mail: eford@astro.ufl.edu [Department of Physics and Astronomy, Aarhus University, DK-8000 Aarhus C (Denmark); and others

    2012-09-10

    Transit timing variations provide a powerful tool for confirming and characterizing transiting planets, as well as detecting non-transiting planets. We report the results of an updated transit timing variation (TTV) analysis for 1481 planet candidates based on transit times measured during the first sixteen months of Kepler observations. We present 39 strong TTV candidates based on long-term trends (2.8% of suitable data sets). We present another 136 weaker TTV candidates (9.8% of suitable data sets) based on the excess scatter of TTV measurements about a linear ephemeris. We anticipate that several of these planet candidates could be confirmed and perhaps characterized with more detailed TTV analyses using publicly available Kepler observations. For many others, Kepler has observed a long-term TTV trend, but an extended Kepler mission will be required to characterize the system via TTVs. We find that the occurrence rate of planet candidates that show TTVs is significantly increased ({approx}68%) for planet candidates transiting stars with multiple transiting planet candidates when compared to planet candidates transiting stars with a single transiting planet candidate.

  4. TTV as A Risk Factor in Hemodialysis Process

    International Nuclear Information System (INIS)

    Ibrahim, I.M.

    2010-01-01

    The association of TTV (transfusion transmitted virus) with both cryptogenic chronic liver diseases and post-transfusion hepatitis has been reported. Hemodialysis patients are at high risk for viral hepatitis due to blood born viral agents. The few data available concerning TTV infection among hemodialysis patients shows a high prevalence. This study was conducted on one hundred patients with end-stage renal disease (ESRD). They were attending the hemodialysis (HD) unit of Naser institute for performing hemodialysis for the first time (as a control group) and the same patients after recurrent HD for at least six months of regular HD (as a HD patient group). Patients and controls were subjected to the following laboratory investigations; 1) TTV DNA detection by PCR. 2) HBs Ag by ELISA technique. 3) HCV Ab by ELISA technique. 4) Liver enzymes include ALT, AST and γGT. The study was done to detect TTV DNA by PCR in hemodialysis patients and to evaluate its clinical impacts, taking into account co-infection with other hepatitis viruses. The results of this work are:- 1- TTV is remarkably prevalent in HD patients. The prevalence of TTV infection in HD Egyptian patients was 45% and 9% in healthy volunteer from the same geographical area. 2- HCV was found to have highly significant association with HD patients while there was no association between HD patients and HBs Ag. 3- TTV infection was not found to be more prevalent in HD patients infected with HCV. 4- Abnormal liver enzymes were uncommon in HD patients infected with TTV alone, in contrast to patients with known hepatotropic viruses such as HCV. 5- TTV did not play a role in liver injury, but it might aggravate liver diseases caused by HCV.

  5. TTV and HPV co-infection in cervical smears of patients with cervical lesions

    Directory of Open Access Journals (Sweden)

    Tachezy Ruth

    2009-07-01

    Full Text Available Abstract Background The female lower genital tract is a gateway for pathogens entering the host through the mucous membrane. One of the prevalent human viruses is Torque teno virus (TTV. The major reported routes of TTV transmission are fecal-oral and parenteral. Furthermore, other modes of transmission, e.g. sexual contact, are suggested. To investigate the sexual route of TTV transmission, cervical smears of healthy women and those with cervical lesions were screened for the presence of TTV DNA. Methods TTV DNA was studied in cervical smears of 95 patients with cervical lesions and 55 healthy women. Paired serum samples were available from 55 and 42 women, respectively. All healthy women had normal cytology while 44 patients had histologically confirmed low-grade lesion (LGL and 51 high-grade lesion (HGL. TTV DNA was detected with primers specific for the non-coding region. In 40 paired cervical smears and serum samples, the phylogenetic group of TTV isolates was determined. The presence of HPV DNA in cervical smears was detected by means of PCR with MY09/11 primers. Results The prevalence of TTV DNA in cervical smears of healthy women was 52.7% and was comparable with that in paired serum samples (50%. Symptomatic women had significantly higher prevalence of TTV DNA in cervical smears (74.7% than healthy controls. The TTV DNA prevalence in patient serum samples was 51%. The phylogenetic groups of TTV serum isolates were concordant with those of TTV from cervical smears of the same subjects. In cervical smears, a wider variety of TTV isolates was found. The viral loads in cervical smears were 10 to 1000 times as high as in sera. The HPV-positive study subjects had significantly higher TTV DNA prevalence than HPV negatives. The prevalence of TTV was not associated with disease severity. Conclusion High prevalence of TTV in cervical smears suggests that sexual transmission is another mode of expansion of TTV infection among the population. The

  6. TRANSIT TIMING VARIATIONS FOR INCLINED AND RETROGRADE EXOPLANETARY SYSTEMS

    International Nuclear Information System (INIS)

    Payne, Matthew J.; Ford, Eric B.; Veras, Dimitri

    2010-01-01

    We perform numerical calculations of the expected transit timing variations (TTVs) induced on a hot-Jupiter by an Earth-mass perturber. Motivated by the recent discoveries of retrograde transiting planets, we concentrate on an investigation of the effect of varying relative planetary inclinations, up to and including completely retrograde systems. We find that planets in low-order (e.g., 2:1) mean-motion resonances (MMRs) retain approximately constant TTV amplitudes for 0 deg. 170 deg. Systems in higher order MMRs (e.g., 5:1) increase in TTV amplitude as inclinations increase toward 45 deg., becoming approximately constant for 45 deg. 135 deg. Planets away from resonance slowly decrease in TTV amplitude as inclinations increase from 0 deg. to 180 deg., whereas planets adjacent to resonances can exhibit a huge range of variability in TTV amplitude as a function of both eccentricity and inclination. For highly retrograde systems (135 deg. < i ≤ 180 deg.), TTV signals will be undetectable across almost the entirety of parameter space, with the exceptions occurring when the perturber has high eccentricity or is very close to an MMR. This high inclination decrease in TTV amplitude (on and away from resonance) is important for the analysis of the known retrograde and multi-planet transiting systems, as inclination effects need to be considered if TTVs are to be used to exclude the presence of any putative planetary companions: absence of evidence is not evidence of absence.

  7. PREVALENCE OF ''TTV'' IN PATIENTS WITH CHRONIC VIRAL HEPATITIS ''B'' AND ''C''

    International Nuclear Information System (INIS)

    NOSSEIR, N.M.; MANSOUR, H.H.; FAHMY, N.M.

    2007-01-01

    Transfusion transmitted virus (TTV) is an enveloped single strand virus discovered in serum of patients with post-transfusion hepatitis of unknown etiology in Japan and designated as TT virus (TTV). To investigate the frequency of TTV infection in patients with viral hepatitis B or C, 25 Egyptian patients with hepatitis C virus (HCV) aged 8-40 years and 25 patients with B virus (HBV) aged 8-57 years were tested. Detection of TTV-DNA was performed by semi-nested polymerase chain reaction (PCR) using TTV-specific primers. Serum levels of transaminases were tested. The prevalence of TTV in patients with chronic viral hepatitis B or C was frequent and the co-infection of TTV with HCV or HBV was accompanied by a high level of transaminases as compared to that of HBV or HCV alone. The present study confirms and extends that infection alone doesn't cause significant liver damage

  8. Detection of TTV-DNA in PBMC using digoxigenin labelled probe by in situ hybridization

    International Nuclear Information System (INIS)

    Liu Yang; Qi Qige

    2002-01-01

    To determine TTV-DNA in PBMC in patients with viral hepatitis, a study of in situ hybridization using digoxigenin labelled probe by PCR method to the TTV ORF1 region was performed on PBMC. Results showed that the detection rate of TTV-DNA using double-stranded probe in TTV-DNA positive group in sera was 58.06 (18/31), and the detection rate of TTV-DNA using double-stranded probe in TTV-DNA negative group in sera was 27.59 (8/29). For TTV-DNA positive group detected by double- stranded probe, then we use negative- stranded probe to detect their replication. The detection rate was 22.2%(4/18). Conclusions: TTV can infect PBMC and replicate in PBMC

  9. The prevalence of transfusion-transmitted virus (TTV) infection in ...

    African Journals Online (AJOL)

    Transfusion-transmitted virus (TTV) is an unenveloped circular single-stranded DNA virus with a diameter of 30 to 32 nm that was first described in 1997 in Japan. TTV was detected in various populations without proven pathology, including blood donors and in patients with chronic hepatitis B virus (HBV) and hepatitis C ...

  10. A search for transit timing variation

    Directory of Open Access Journals (Sweden)

    Kramm U.

    2011-02-01

    Full Text Available Photometric follow-ups of transiting exoplanets (TEPs may lead to discoveries of additional, less massive bodies in extrasolar systems. This is possible by detecting and then analysing variations in transit timing of transiting exoplanets. In 2009 we launched an international observing campaign, the aim of which is to detect and characterise signals of transit timing variation (TTV in selected TEPs. The programme is realised by collecting data from 0.6-2.2-m telescopes spread worldwide at different longitudes. We present our observing strategy and summarise first results for WASP-3b with evidence for a 15 Earth-mass perturber in an outer 2:1 orbital resonance.

  11. Densities and eccentricities of 139 Kepler planets from transit time variations

    Energy Technology Data Exchange (ETDEWEB)

    Hadden, Sam; Lithwick, Yoram [Department of Physics and Astronomy, Northwestern University, Evanston, IL 60208 (United States)

    2014-05-20

    We extract densities and eccentricities of 139 sub-Jovian planets by analyzing transit time variations (TTVs) obtained by the Kepler mission through Quarter 12. We partially circumvent the degeneracies that plague TTV inversion with the help of an analytical formula for the TTV. From the observed TTV phases, we find that most of these planets have eccentricities of the order of a few percent. More precisely, the rms eccentricity is 0.018{sub −0.004}{sup +0.005}, and planets smaller than 2.5 R {sub ⊕} are around twice as eccentric as those bigger than 2.5 R {sub ⊕}. We also find a best-fit density-radius relationship ρ ≈ 3 g cm{sup –3} × (R/3 R {sub ⊕}){sup –2.3} for the 56 planets that likely have small eccentricity and hence small statistical correction to their masses. Many planets larger than 2.5 R {sub ⊕} are less dense than water, implying that their radii are largely set by a massive hydrogen atmosphere.

  12. The prevalence of transfusion-transmitted virus (TTV) infection in ...

    African Journals Online (AJOL)

    Administrator

    2011-06-08

    Jun 8, 2011 ... diameter of 30 to 32 nm that was first described in 1997 in Japan. TTV was detected in ... serum of a Japanese patient with fulminant hepatitis and chronic liver ..... Molecular cloning and characterization of a novel DNA virus ...

  13. Detection and genotyping of torque teno virus (TTV) in healthy blood donors and patients infected with HBV or HCV in Qatar.

    Science.gov (United States)

    AbuOdeh, Raed; Al-Mawlawi, Naema; Al-Qahtani, Ahmed A; Bohol, Marie Fe F; Al-Ahdal, Mohammed N; Hasan, Haydar A; AbuOdeh, Lamees; Nasrallah, Gheyath K

    2015-07-01

    Torque Teno virus (TTV) has been associated with non A-G hepatitis. The goal of this study was to estimate the infection rates and genotypic characteristics of TTV in the State of Qatar. A total of 644 blood samples representing different nationalities: (i) Qatari (118) and (ii) non-Qatari (526) nationals (mostly from Arab and South Eeast Asia countries) were tested for the presence of TTV DNA by nested PCR. The majority (573) of the blood samples belonged to healthy blood donors, whereas 54 and 53 of the blood samples belonged to patients infected with hepatitis B virus (HBV) and hepatitis C virus (HCV), respectively. The results obtained showed that the TTV infection rates in the healthy blood donors, and those infected with HBV or HCV patients were 81.4, 90.75 and 84.9%, respectively. Significant association between TTV viremia and age, or nationality was observed. Sequence analysis of PCR fragments amplified from the 5'-untranslated region (5'-UTR) of all (531) TTV positive samples showed that 65.5% (348/531) of the PCR fragment sequences were classified into main genogroup 3, followed by main genogroups 5 (24%), 2 (5.8%), and 1 (4.7%). Genogroup 4 was not detected among the our studied subjects. Phylogenetic and pairwise analyses using sequences from TTV viremic samples also showed an overall close similarity to the main genogroup 3. In conclusion, there was no significant difference in the rates of TTV detection among Qataris and non-Qataris and several genotypes, mainly genotype 3, were isolated. © 2015 Wiley Periodicals, Inc.

  14. TRANSIT TIMING OBSERVATIONS FROM KEPLER. VIII. CATALOG OF TRANSIT TIMING MEASUREMENTS OF THE FIRST TWELVE QUARTERS

    Energy Technology Data Exchange (ETDEWEB)

    Mazeh, Tsevi; Nachmani, Gil; Holczer, Tomer; Sokol, Gil [School of Physics and Astronomy, Raymond and Beverly Sackler Faculty of Exact Sciences, Tel Aviv University, Tel Aviv 69978 (Israel); Fabrycky, Daniel C. [Department of Astronomy and Astrophysics, University of Chicago, 5640 Ellis Ave., Chicago, IL 60637 (United States); Ford, Eric B.; Ragozzine, Darin [Astronomy Department, University of Florida, Gainesville, FL 32111 (United States); Sanchis-Ojeda, Roberto [Department of Physics and Kavli Institute for Astrophysics and Space Research, Massachusetts Institute of Technology, Cambridge, MA 02139 (United States); Rowe, Jason F.; Lissauer, Jack J. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Zucker, Shay [Department of Geophysical, Atmospheric and Planetary Sciences, Raymond and Beverly Sackler Faculty of Exact Sciences Tel Aviv University, 69978 Tel Aviv (Israel); Agol, Eric [Department of Astronomy, Box 351580, University of Washington, Seattle, WA 98195 (United States); Carter, Joshua A. [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Quintana, Elisa V. [SETI Institute, 189 Bernardo Ave, Suite 100, Mountain View, CA 94043 (United States); Steffen, Jason H. [Fermilab Center for Particle Astrophysics, P.O. Box 500, MS 127, Batavia, IL 60510 (United States); Welsh, William [Astronomy Department, San Diego State University, 5500 Campanile Drive, San Diego, CA 92182 (United States)

    2013-10-01

    Following the works of Ford et al. and Steffen et al. we derived the transit timing of 1960 Kepler objects of interest (KOIs) using the pre-search data conditioning light curves of the first twelve quarters of the Kepler data. For 721 KOIs with large enough signal-to-noise ratios, we obtained also the duration and depth of each transit. The results are presented as a catalog for the community to use. We derived a few statistics of our results that could be used to indicate significant variations. Including systems found by previous works, we have found 130 KOIs that showed highly significant times of transit variations (TTVs) and 13 that had short-period TTV modulations with small amplitudes. We consider two effects that could cause apparent periodic TTV—the finite sampling of the observations and the interference with the stellar activity, stellar spots in particular. We briefly discuss some statistical aspects of our detected TTVs. We show that the TTV period is correlated with the orbital period of the planet and with the TTV amplitude.

  15. The Transiting System GJ1214: High-Precision Defocused Transit Observations and a Search for Evidence of Transit Timing Variation

    DEFF Research Database (Denmark)

    Harpsøe, Kennet Bomann West; Hardis, S.; Hinse, T. C.

    2012-01-01

    Aims: We present 11 high-precision photometric transit observations of the transiting super-Earth planet GJ1214b. Combining these data with observations from other authors, we investigate the ephemeris for possible signs of transit timing variations (TTVs) using a Bayesian approach. Methods......: The observations were obtained using telescope-defocusing techniques, and achieve a high precision with random errors in the photometry as low as 1mmag per point. To investigate the possibility of TTVs in the light curve, we calculate the overall probability of a TTV signal using Bayesian methods. Results...

  16. TRANSIT TIMING OBSERVATIONS FROM KEPLER. VI. POTENTIALLY INTERESTING CANDIDATE SYSTEMS FROM FOURIER-BASED STATISTICAL TESTS

    International Nuclear Information System (INIS)

    Steffen, Jason H.; Ford, Eric B.; Rowe, Jason F.; Borucki, William J.; Bryson, Steve; Caldwell, Douglas A.; Jenkins, Jon M.; Koch, David G.; Sanderfer, Dwight T.; Seader, Shawn; Twicken, Joseph D.; Fabrycky, Daniel C.; Holman, Matthew J.; Welsh, William F.; Batalha, Natalie M.; Ciardi, David R.; Kjeldsen, Hans; Prša, Andrej

    2012-01-01

    We analyze the deviations of transit times from a linear ephemeris for the Kepler Objects of Interest (KOI) through quarter six of science data. We conduct two statistical tests for all KOIs and a related statistical test for all pairs of KOIs in multi-transiting systems. These tests identify several systems which show potentially interesting transit timing variations (TTVs). Strong TTV systems have been valuable for the confirmation of planets and their mass measurements. Many of the systems identified in this study should prove fruitful for detailed TTV studies.

  17. Transit timing observations from Kepler. VI. Potentially interesting candidate systems from fourier-based statistical tests

    DEFF Research Database (Denmark)

    Steffen, J.H.; Ford, E.B.; Rowe, J.F.

    2012-01-01

    We analyze the deviations of transit times from a linear ephemeris for the Kepler Objects of Interest (KOI) through quarter six of science data. We conduct two statistical tests for all KOIs and a related statistical test for all pairs of KOIs in multi-transiting systems. These tests identify...... several systems which show potentially interesting transit timing variations (TTVs). Strong TTV systems have been valuable for the confirmation of planets and their mass measurements. Many of the systems identified in this study should prove fruitful for detailed TTV studies....

  18. Prevalence of anelloviruses (TTV, TTMDV, and TTMV) in healthy blood donors and in patients infected with HBV or HCV in Qatar.

    Science.gov (United States)

    Al-Qahtani, Ahmed A; Alabsi, Enas S; AbuOdeh, Raed; Thalib, Lukman; El Zowalaty, Mohamed E; Nasrallah, Gheyath K

    2016-12-28

    Anelloviruses (TTV, TTMV, and TTMDV) have been associated with non A-G hepatitis. The goal of the current study was to estimate the prevalence of these anelloviruses in Qatar. A total of 607 blood samples (500 healthy donors, and 53 HBV-and 54 HCV-positive patients) representing different nationalities were tested for the presence of TTV, TTMV, and TTMDV DNA by nested PCR. Prevalence rates for the three viruses were high in all studied groups, and exceeding 95% in the HBV group (for TTV and TTMDV). Infection with more than one type of viruses was common and significant in most of the positive patients (p nationality, or gender (p > 0.05) albeit the detection of higher infection rates among females and Qatari subjects. This was the first published study to look at prevalence of Anellowviruses in the Middle East. High prevalence rates of the three viruses in all studied groups was noted. Further studies are needed to explore and compare the different genotypes of these viruses in the region.

  19. Principles of time-of-flight tomography

    International Nuclear Information System (INIS)

    Campagnolo, R.; Garderet, P.; Lecomte, J.L.; Bouvier, A.; Darier, P.; Soussaline, F.

    1983-03-01

    After a short introduction to the physics of time-of-flight positron tomography, the various aspects of this technique are presented. The characteristics including data acquisition and image reconstruction system of a positron tomograph (TTV01) which uses time-of-flight information, are described. The preliminary results obtained with TTV01, such as resolution and sensitivity, as well as phantom images, are presented [fr

  20. Modelling systematics of ground-based transit photometry I. Implications on transit timing variations

    DEFF Research Database (Denmark)

    von Essen, C.; Cellone, S.; Mallonn, M.

    2016-01-01

    introduced a perturbation in the mid-transit times of the hot Jupiter, caused by an Earth-sized planet in a 3:2 mean motion resonance. Analyzing the synthetic light curves produced after certain epochs, we attempt to recover the synthetically added TTV signal by means of usual primary transit fitting...... we attempt to reproduce, by means of physically and empirically motivated relationships, the effects caused by the Earth's atmosphere and the instrumental setup on the synthetic light curves. Therefore, the synthetic data present different photometric quality and transit coverage. In addition, we...

  1. KOI-142, the king of transit variations, is a pair of planets near the 2:1 resonance

    DEFF Research Database (Denmark)

    Nesvorný, David; Kipping, David; Terrell, Dirk

    2013-01-01

    The transit timing variations (TTVs) can be used as a diagnostic of gravitational interactions between planets in a multi-planet system. Many Kepler Objects of Interest (KOIs) exhibit significant TTVs, but KOI-142.01 stands out among them with an unrivaled ≃12 hr TTV amplitude. Here we report...... mass inferred from the transit variations is consistent with the measured transit depth, suggesting a Neptune-class planet (KOI-142b). The orbital period ratio P /P = 2.03 indicates that the two planets are just wide of the 2:1 resonance. The present dynamics of this system, characterized here...

  2. How travellers’ schedule their trips under uncertain travel times

    DEFF Research Database (Denmark)

    Hjorth, Katrine

    Travel times play an important role when people decide where, when and how much to travel. But travel times are not always predictable from the traveller’s point of view: They may vary from day to day due to demand fluctuations, weather conditions, accidents and other unforeseen events that cause...... road capacity to decrease. We refer to this uncertainty as travel time variability (TTV). TTV is likely to affect how travellers schedule their trips, since it affects their probability of arriving late at their destination. We would like to account for TTV in traffic models and cost-benefit analyses......, but in practice there are limits to the kinds of behaviour that can be accommodated in such applications. For that reason, we are not solely interested in explaining travellers’ behaviour, but also in whether this behaviour can be approximated by behavioural models that are simple enough to be applied in traffic...

  3. Transit Timing Variation analysis with Kepler light curves of KOI 227 and Kepler 93b

    Science.gov (United States)

    Dulz, Shannon; Reed, Mike

    2017-01-01

    By searching for transit signals in approximately 150,000 stars, NASA’s Kepler Space telescope found thousands of exoplanets over its primary mission from 2009 to 2013 (Tenenbaum et al. 2014, ApJS, 211, 6). Yet, a detailed follow-up examination of Kepler light curves may contribute more evidence on system dynamics and planetary atmospheres of these objects. Kepler’s continuous observing of these systems over the mission duration produced light curves of sufficient duration to allow for the search for transit timing variations. Transit timing variations over the course of many orbits may indicate a precessing orbit or the existence of a non-transiting third body such as another exoplanet. Flux contributions of the planet just prior to secondary eclipse may provide a measurement of bond albedo from the day-side of the transiting planet. Any asymmetries of the transit shape may indicate thermal asymmetries which can measure upper atmosphere motion of the planet. These two factors can constrain atmospheric models of close orbiting exoplanets. We first establish our procedure with the well-documented TTV system, KOI 227 (Nesvorny et al. 2014, ApJ, 790, 31). Using the test case of KOI 227, we analyze Kepler-93b for TTVs and day-side flux contributions. Kepler-93b is likely a rocky planet with R = 1.50 ± 0.03 Earth Radii and M = 2.59 ± 2.0 Earth Masses (Marcy et al. 2014, ApJS, 210, 20). This research is funded by a NASA EPSCoR grant.

  4. Transiting Exoplanet Monitoring Project (TEMP). IV. Refined System Parameters, Transit Timing Variations, and Orbital Stability of the Transiting Planetary System HAT-P-25

    Science.gov (United States)

    Wang, Xian-Yu; Wang, Songhu; Hinse, Tobias C.; Li, Kai; Wang, Yong-Hao; Laughlin, Gregory; Liu, Hui-Gen; Zhang, Hui; Wu, Zhen-Yu; Zhou, Xu; Zhou, Ji-Lin; Hu, Shao-Ming; Wu, Dong-Hong; Peng, Xi-Yan; Chen, Yuan-Yuan

    2018-06-01

    We present eight new light curves of the transiting extra-solar planet HAT-P-25b obtained from 2013 to 2016 with three telescopes at two observatories. We use the new light curves, along with recent literature material, to estimate the physical and orbital parameters of the transiting planet. Specifically, we determine the mid-transit times (T C ) and update the linear ephemeris, T C[0] = 2456418.80996 ± 0.00025 [BJDTDB] and P = 3.65281572 ± 0.00000095 days. We carry out a search for transit timing variations (TTVs), and find no significant TTV signal at the ΔT = 80 s-level, placing a limit on the possible strength of planet–planet interactions (TTVG). In the course of our analysis, we calculate the upper mass-limits of the potential nearby perturbers. Near the 1:2, 2:1, and 3:1 resonances with HAT-P-25b, perturbers with masses greater than 0.5, 0.3, and 0.5 M ⊕ respectively, can be excluded. Furthermore, based on the analysis of TTVs caused by light travel time effect (LTTE) we also eliminate the possibility that a long-period perturber exists with M p > 3000 MJ within a = 11.2 au of the parent star.

  5. Preferences for travel time variability – A study of Danish car drivers

    DEFF Research Database (Denmark)

    Hjorth, Katrine; Rich, Jeppe

    Travel time variability (TTV) is a measure of the extent of unpredictability in travel times. It is generally accepted that TTV has a negative effect on travellers’ wellbeing and overall utility of travelling, and valuation of variability is an important issue in transport demand modelling...... preferences, to exclude non-traders, and to avoid complicated issues related to scheduled public transport services. The survey uses customised Internet questionnaires, containing a series of questions related to the traveller’s most recent morning trip to work, e.g.: • Travel time experienced on this day......, • Number of stops along the way, their duration, and whether these stops involved restrictions on time of day, • Restrictions regarding departure time from home or arrival time at work, • How often such a trip was made within the last month and the range of experienced travel times, • What the traveller...

  6. Transfusion transmitted virus in screened United Arab Emirates blood donors

    International Nuclear Information System (INIS)

    Alfaresi, Mubarak S.; Alzaabi, Azza S.; Islam, Adeel A.; Elkoush, Abida A.; Elnazer, Ayat M.

    2006-01-01

    To investigate the rate of infection caused by Torque teno virus (TTV) in United Arab Emirates (UAEs) healthy population as a pilot study in detecting TTV DNA in 100 healthy blood donors. We randomly choose a total of 100 healthy blood donors who attended Zayed Military Hospital, Abu Dhabi, UAE from January 20 to May 30, 2005. We carried out a real-time polymerase chain reaction (PCR) test to detect TTV DNA. Real-time for TTV was positive in 75 (75%) donors. Eight (73%) non-UAE donors were TTV positive while 67 (75%) were UAEs. Among these donors, 72 (77%) were males and 3 (50%) were females. Our results demonstrated a high prevalence of TTV in UAE. (author)

  7. Investigating Extra-solar Planetary System Qatar-1 through Transit Observations

    Science.gov (United States)

    Thakur, Parijat; Mannaday, Vineet Kumar; Jiang, Ing-Guey; Sahu, Devendra Kumar; Chand, Swadesh

    2018-04-01

    We report the results of the transit timing variation (TTV) analysis of the extra-solar planet Qatar-1b using thirty eight light curves. Our analysis combines thirty five previously available transit light curves with three new transits observed by us between June 2016 and September 2016 using the 2-m Himalayan Chandra Telescope (HCT) at the Indian Astronomical Observatory (Hanle, India). From these transit data, the physical and orbital parameters of the Qatar-1 system are determined. In addition to this, the ephemeris for the orbital period and mid-transit time are refined to investigate the possible TTV. We find that the null-TTV model provides the better fit to the (O-C) data. This indicates that there is no evidence for TTVs to confirm the presence of additional planets in the Qatar-1 system. The use of the 3.6-m Devasthal Optical Telescope (DOT) operated by the Aryabhatta Research Institute of Observational Sciences (ARIES, Nainital, India) could improve the photometric precision to examine the signature of TTVs in this system with a greater accuracy than in the present work.

  8. 3D quantitative assessment of response to fractionated stereotactic radiotherapy and single-session stereotactic radiosurgery of vestibular schwannoma

    Energy Technology Data Exchange (ETDEWEB)

    Schneider, T. [The Johns Hopkins Hospital School of Medicine, Russell H. Morgan Department of Radiology and Radiological Sciences, Division of Neuroradiology, Baltimore, MD (United States); University Medical Center Hamburg-Eppendorf, Department of Diagnostic and Interventional Neuroradiology, Hamburg (Germany); Chapiro, J. [The Johns Hopkins Hospital School of Medicine, Russell H. Morgan Department of Radiology and Radiological Sciences, Division of Interventional Radiology, Baltimore, MD (United States); Lin, M. [Philips Research North America, Ultrasound Imaging and Interventions (UII), Briarcliff Manor, NY (United States); Geschwind, J.F. [The Johns Hopkins Hospital School of Medicine, Russell H. Morgan Department of Radiology and Radiological Sciences, Division of Interventional Radiology, Baltimore, MD (United States); Yale University School of Medicine, Department of Radiology and Imaging Science, New Haven, CT (United States); Kleinberg, L. [The Johns Hopkins University School of Medicine, Department of Radiation Oncology and Molecular Radiation Sciences, Sidney Kimmel Comprehensive Cancer Center, Baltimore, MD (United States); Rigamonti, D.; Jusue-Torres, I.; Marciscano, A.E. [The Johns Hopkins University School of Medicine, Department of Neurological Surgery, Baltimore, MD (United States); Yousem, D.M. [The Johns Hopkins Hospital School of Medicine, Russell H. Morgan Department of Radiology and Radiological Sciences, Division of Neuroradiology, Baltimore, MD (United States)

    2016-03-15

    To determine clinical outcome of patients with vestibular schwannoma (VS) after treatment with fractionated stereotactic radiotherapy (FSRT) and single-session stereotactic radiosurgery (SRS) by using 3D quantitative response assessment on MRI. This retrospective analysis included 162 patients who underwent radiation therapy for sporadic VS. Measurements on T1-weighted contrast-enhanced MRI (in 2-year post-therapy intervals: 0-2, 2-4, 4-6, 6-8, 8-10, 10-12 years) were taken for total tumour volume (TTV) and enhancing tumour volume (ETV) based on a semi-automated technique. Patients were considered non-responders (NRs) if they required subsequent microsurgical resection or developed radiological progression and tumour-related symptoms. Median follow-up was 4.1 years (range: 0.4-12.0). TTV and ETV decreased for both the FSRT and SRS groups. However, only the FSRT group achieved significant tumour shrinkage (p < 0.015 for TTV, p < 0.005 for ETV over time). The 11 NRs showed proportionally greater TTV (median TTV pre-treatment: 0.61 cm{sup 3}, 8-10 years after: 1.77 cm{sup 3}) and ETV despite radiation therapy compared to responders (median TTV pre-treatment: 1.06 cm{sup 3}; 10-12 years after: 0.81 cm{sup 3}; p = 0.001). 3D quantification of VS showed a significant decrease in TTV and ETV on FSRT-treated patients only. NR had significantly greater TTV and ETV over time. (orig.)

  9. Variational derivation of a time-dependent Hartree-Fock Hamiltonian

    International Nuclear Information System (INIS)

    Lichtner, P.C.; Griffin, J.J.; Schultheis, H.; Schultheis, R.; Volkov, A.B.

    1979-01-01

    The variational derivation of the time-dependent Hartree-Fock equation is reviewed. When norm-violating variations are included, a unique time-dependent Hartree-Fock Hamiltonian, which differs from that customarily used in time-dependent Hartree-Fock analyses, is implied. This variationally ''true'' Hartree-Fock Hamiltonian has the same expectation value as the exact Hamiltonian, equal to the average energy of the system. Since this quantity remains constant under time-dependent Hartree-Fock time evolution, we suggest the label ''constant '' for this form of time-dependent Hartree-Fock theory

  10. Detection of TT Virus Among Thalassaemic Children With Chronic Viral Hepatitis B and C Receiving Irradiated and Non Irradiated RBCs

    International Nuclear Information System (INIS)

    El-Maghraby, D.F.; EL-Shafie, A.I.; El-Sayed, S.A.; Alkady, M.M.

    2010-01-01

    TTV was first identified in the serum of a patient with post transfusion hepatitis of unknown etiology in 1997.As a consequence of the high prevalence of TTV in blood donors, thalassemia patients frequently acquire various genotypes of this virus through therapeutic blood transfusions.TTV as a cause of chronic hepatitis has not yet determined . Ten healthy and twenty-eight poly-transfused thalassemia children were evolved in this study where ten patients were receiving irradiated RBCs and eighteen receiving non irradiated ones.TTV was detected in serum samples by semi-nested polymerase chain reaction (PCR) using TTV-specific primer. Transaminases levels, hepatitis B and C virus markers were interpreted for possible association with TTV infection. As a result, TTV was found in 50% of thalassemia patients and in 20 % of the controls. Among thalassemia patients, isolated HBsAG, isolated HCV-AB, HBsAG and TTV-DNA and HCV-AB and TTV-DNA distributions were: 6 (21.43%) ,8 ( 28.57%) , 4 ( 14.29%) and 10 (35.7%) respectively. Regarding thalassemia patients receiving irradiated RBCs, the frequency of viral infections were 8(80%), 2(20%) and 0% for TTV co-infections, isolated HBV and isolated HCV, respectively. On the other hand, the prevalence of viral infections among patients receiving non irradiated RBCs were 6(33.3%), 4(22.2%) and 8(44.5%) for TTV co-infection, isolated HBV and isolated HCV, respectively. These data may give evidence that radiation raises the levels of blood safety especially regarding HCV. Furthermore, liver transaminase levels were significantly higher in all patients versus the controls, meanwhile, transaminase values were not different in HBsAG-positive subjects as compared with subjects who had both HBsAG and TTV-DNA positive. Also, there was no significant difference between isolated HCV infection and HCV and TTV co-infection. So, no convincing evidence was found to support TTV involvement in the D. F. EL-MAGHRABY, et al. / J. Rad. Res. Appl. Sci

  11. Presence and significance of TT virus in Danish patients on maintenance hemodialysis

    DEFF Research Database (Denmark)

    Boysen, T.; Christensen, J. K.; Madsen, C. D.

    2003-01-01

    -positive patients were significantly older than TTV-negative patients (p = 0.011). No relations were found between TTV infection and elevated levels of alanine aminotransferase (ALT) or CRP or hypo-response to EPO treatment. The mean hemoglobin concentration was 11.24 +/- 1.48 g/dl. Patients with a high TTV viral...... load had a lower level of hemoglobin (10.86 +/- 1.47 g/dl) than the others (p = 0.01). This trend suggested a positive relation between TTV infection and the number of blood transfusions. A restriction fragment length polymorphism assay suggested that patients were infected with different TTV strains......Objectives: To determine the prevalence of TT virus (TTV) in a population of Danish hemodialysis patients and evaluate possible relations between TTV infection and elevated levels of C-reactive protein (CRP) and hypo-response to treatment with erythropoietin (EPO). Material and Methods: Patients...

  12. Presence and significance of TT virus in Danish patients on maintenance hemodialysis

    DEFF Research Database (Denmark)

    Boysen, Trine; Christensen, Jens K; Madsen, Chris D

    2003-01-01

    OBJECTIVES: To determine the prevalence of TT virus (TTV) in a population of Danish hemodialysis patients and evaluate possible relations between TTV infection and elevated levels of C-reactive protein (CRP) and hypo-response to treatment with erythropoietin (EPO). MATERIAL AND METHODS: Patients......-positive patients were significantly older than TTV-negative patients (p = 0.011). No relations were found between TTV infection and elevated levels of alanine aminotransferase (ALT) or CRP or hypo-response to EPO treatment. The mean hemoglobin concentration was 11.24 +/- 1.48 g/dl. Patients with a high TTV viral...... load had a lower level of hemoglobin (10.86 +/- 1.47 g/dl) than the others (p = 0.01). This trend suggested a positive relation between TTV infection and the number of blood transfusions. A restriction fragment length polymorphism assay suggested that patients were infected with different TTV strains...

  13. Prevalence and genetic diversity of torque teno virus in patients with systemic lupus erythematosus in a reference service in Mato Grosso do Sul.

    Science.gov (United States)

    Costa, Márcio Reis da; Costa, Izaias Pereira da; Devalle, Sylvie; Castro, Ana Rita Coimbra Motta de; Freitas, Solange Zacalusni

    2012-01-01

    Recent studies on the torque teno virus (TTV), genus Anellovirus, have allowed formulating the hypothesis that TTV may trigger autoimmune rheumatic diseases or have some pathogenic role in them. To determine the frequency of TTV infection in patients with systemic lupus erythematosus (SLE), the genetic diversity of TTV, the correlation between TTV infection and SLE clinical manifestations, and SLE clinical course and serological profile. Serum samples were obtained from 46 SLE patients treated at the University-Affiliated Hospital of Campo Grande (NHU/FAMED/UFMS), Brazil. For controls, serum samples were obtained from 46 healthy volunteer blood donors. Viral DNA was extracted from samples using the QIAamp DNA Blood Mini Kit (QIAGEN, Hilden, Germany) and amplified using nested PCR. Positivity for TTV was found in 17 (37%) of SLE patients and in only seven (15.2%) of the controls (z test, P = 0.03). There was no correlation between TTV infection, SLE clinical manifestations, SLE clinical course, and the serological profile of the patients evaluated. Further studies on the presence of TTV in SLE patients are required.

  14. Short communication: Detection of human Torque teno virus in the milk of water buffaloes (Bubalus bubalis).

    Science.gov (United States)

    Roperto, S; Paciello, O; Paolini, F; Pagnini, U; Palma, E; Di Palo, R; Russo, V; Roperto, F; Venuti, A

    2009-12-01

    Forty-four raw milk and 15 serum samples from 44 healthy water buffaloes reared in Caserta, southern Italy, the most important region in Europe for buffalo breeding, were examined to evaluate the presence of Torque teno viruses (TTV) using molecular tools. Furthermore, 8 pooled pasteurized milk samples (from dairy factories having excellent sanitary conditions) and 6 Mozzarella cheese samples were also tested. Four of the cheese samples were commercial Mozzarella cheese; the remaining 2 were prepared with TTV-containing milk. Human TTV were detected and confirmed by sequencing in 7 samples of milk (approximately 16%). No TTV were found in serum, pooled pasteurized milk, or Mozzarella cheese samples. The samples of Mozzarella cheese prepared with TTV-containing milk did not show any presence of TTV, which provides evidence that standard methodological procedures to prepare Mozzarella cheese seem to affect viral structure, making this food fit for human consumption. The 7 TTV species from water buffaloes were identified as genotypes corresponding to the tth31 (3 cases), sle 1981, sle 2031, and NLC030 (2 cases each) human isolates. Although cross-species infection may occur, detection of TTV DNA in milk but not in serum led us to believe that its presence could be due to human contamination rather than a true infection. Finally, the mode of transmission of TTV has not been determined. Contaminated of the food chain with TTV may be a potential risk for human health, representing one of the multiple routes of infection.

  15. Biological variation in tPA-induced plasma clot lysis time.

    Science.gov (United States)

    Talens, Simone; Malfliet, Joyce J M C; Rudež, Goran; Spronk, Henri M H; Janssen, Nicole A H; Meijer, Piet; Kluft, Cornelis; de Maat, Moniek P M; Rijken, Dingeman C

    2012-10-01

    Hypofibrinolysis is a risk factor for venous and arterial thrombosis, and can be assessed by using a turbidimetric tPA-induced clot lysis time (CLT) assay. Biological variation in clot lysis time may affect the interpretation and usefulness of CLT as a risk factor for thrombosis. Sufficient information about assay variation and biological variation in CLT is not yet available. Thus, this study aimed to determine the analytical, within-subject and between-subject variation in CLT. We collected blood samples from 40 healthy individuals throughout a period of one year (average 11.8 visits) and determined the CLT of each plasma sample in duplicate. The mean (± SD) CLT was 83.8 (± 11.1) minutes. The coefficients of variation for total variation, analytical variation, within-subject variation and between-subject variation were 13.4%, 2.6%, 8.2% and 10.2%, respectively. One measurement can estimate the CLT that does not deviate more than 20% from its true value. The contribution of analytical variation to the within-subject variation was 5.0%, the index of individuality was 0.84 and the reference change value was 23.8%. The CLT was longer in the morning compared to the afternoon and was slightly longer in older individuals (> 40 years) compared to younger (≤40 years) individuals. There was no seasonal variation in CLT and no association with air pollution. CLT correlated weakly with fibrinogen, C-reactive protein, prothrombin time and thrombin generation. This study provides insight into the biological variation of CLT, which can be used in future studies testing CLT as a potential risk factor for thrombosis.

  16. Aspectos patológicos, imunológicos e propriedades moleculares do TT vírus Pathological and immunological aspects and molecular properties of TT virus

    Directory of Open Access Journals (Sweden)

    Maria Angelica Ehara Watanabe

    2005-08-01

    Full Text Available O TT vírus (TTV foi primeiramente descrito no Japão, em 1997, por T. Nishizawa, no soro de pacientes com hepatite, pós-transfusão, não-A-G. Tem sido intensivamente investigado, desde então, como uma possível adição à lista dos vírus indutores de hepatite. O TTV é um vírus DNA não-envelopado, de fita simples. Uma considerável variabilidade genética tem sido demonstrada por parte do TTV, o que tem levado pesquisadores a agrupar isolados do vírus em inúmeros genótipos e subtipos. No entanto a significância clínica da infecção por TTV permanece desconhecida. Ele é freqüentemente detectado em fluidos corporais e seu componente mais bem elucidado atualmente é o genoma. Conhecimentos relacionados ao TTV têm aumentado constantemente, porém vários aspectos fundamentais permanecem obscuros. Esta revisão apresenta algumas das propriedades moleculares do TT vírus.TT virus (TTV was first reported in Japan in 1997 by T. Nishizawa in sera from non-A to non-G post-transfusion hepatitis patients. It has been intensively investigated, ever since, as a possible addition to the list of hepatitis-inducing viruses. The TTV is an unenveloped, single-stranded DNA virus. Considerable genetic variability of TTV has been demonstrated and has led investigators to group its isolates into numerous genotypes and subtypes. However, the clinical significance of TTV infection remains unknown. It is frequently detected in the serum and in other body fluids of humans. The component of TTV currently best understood is its genome. Knowledge related to TTV has increased rapidly, but many fundamental aspects remain unclear. This review shows some of the molecular properties of TT virus.

  17. Torque teno virus infection in male commercial sex workers in Surakarta Indonesia

    Science.gov (United States)

    Prasetyo, Afiono Agung; Luvi, Sabrina Damara; Hartono, Sari, Yulia

    2017-02-01

    The molecular epidemiology data of torque teno virus (TTV) in Indonesia is very rare. This study evaluated the prevalence of TTV in male commercial sex workers, as one of the high risk community for blood borne viruses pathogens in Surakarta, Indonesia. All blood samples collected from male commercial sex workers in Surakarta in 2009-2013 were tested by nested polymerase chain reaction (PCR). The amplified PCR products were molecularly cloned and subjected to sequence analysis. TTV DNA was detected in 80.9% (72/89) samples. Furthermore, the molecular characterization revealed that the most prevalent was genogroup 3, followed by genogroup 2 and l, respectively. TTV was detected in male commercial sex workers in Surakarta with high infection rate. Further investigation about TTV circulation in Indonesian population is needed in order to provide additional information about the genetic variability and TTV epidemiology in Indonesia, especially in the high risk communities.

  18. Molecular characterization of Torque teno virus and SEN virus co-infection with HIV in patients from Southern Iran

    Directory of Open Access Journals (Sweden)

    Aliyar Pirouzi

    2014-06-01

    Full Text Available Introduction Torque teno virus (TTV and SEN virus are circular single-stranded DNA viruses that cause blood-borne infections. The SEN virus (SEN-V was originally detected in the serum of an injection drug user infected with human immunodeficiency virus (HIV. Recently TTV was discovered as a potential causative agent of non-A-E hepatitis. The aim of this study was to investigate the prevalence of the SEN-V-D/H and TTV in HIV patients and healthy blood donors in Iran. Methods One hundred and fifty HIV patients with a mean age of 50.46 ± 18.46 years and 150 healthy blood donors with a mean age of 48.16 ± 13.73 years were included in this study. TTV and SEN-V were detected by the PCR and were quantitatively assayed by competitive PCR (nested and semi-nested PCR. Restriction fragment length polymorphisms (RFLPs were used to determine the heterogeneity of TTV. Results TTV and SEN-V were detected 96 (64% and 84 (56% of 150 HIV patients respectively. These rates were 34% (n=51 and 37.33% (n=56 in healthy blood donors (significant, p<0.05. PCR detected SEN-V/TTV DNA from 32 of the healthy blood donors (21.33%, while 65 (43.33% of HIV patients were positive for SEN-V/TTV DNA. Of 150 HIV patients, 32.66% and 23.33% were positive for SEN-V-H and SEN-V-D, respectively and 18.66% (n=28 were co-infected with SEN-V-D/H. Conclusions The prevalence of SEN-VD/H and TTV is higher in HIV patients than in healthy blood donors in Southern Iran. Our results suggest that TTV and SEN-V might play a role in the development of liver disease in patients with immunodeficiency diseases.

  19. Interstitial nephritis of slaughtered pigs in the State of Mato Grosso, Brazil

    Directory of Open Access Journals (Sweden)

    João X. Oliveira Filho

    2012-04-01

    Full Text Available This study evaluated histological lesions in kidney samples from pigs with nephritis in two slaughterhouses in the State of Mato Grosso, Brazil. Four hundred samples were subjected to histology, anti-porcine circovirus type 2 (PCV2 immunohistochemistry (IHC, anti-Leptospira sp. immunofluorescence (IF, and polymerase chain reaction (PCR for PCV2, porcine parvovirus (PPV, and Torque teno virus type 1 and 2 (TTV1, TTV2 detection. Histological lesions were found in 81% of the samples, and mononuclear interstitial nephritis was the most frequent lesion (77.50%. A follicular pattern was observed in 40.97% of the interstitial nephritis lesions. PCV2, PPV, TTV1, and TTV2 were identified in the kidneys by PCR in 27.25%, 28.50%, 94%, and 87.5% of the samples, respectively. Leptospira sp. was not detected through IF. Infection by PCV2 (PCR and the presence of histological lesions (P=0.008 and giant cells (P=0.0016 were significantly associated. An association was observed between the TTV2-TTV1 co-infection (P<0.0001 and the risk for pathogenesis. These findings indicated that PCV2, PPV, TTV1, and TTV2 were widely distributed among pigs in the local farms and that the presence of these agents should be considered in the differential diagnosis of kidneys with interstitial nephritis in pigs.

  20. Timing Variations in Two Balkan Percussion Performances

    Directory of Open Access Journals (Sweden)

    Daniel Goldberg

    2016-01-01

    Full Text Available Many songs and dance pieces from the Balkan Peninsula employ aksak meter, in which two categorically different durations, long and short, coexist in the sequence of beats that performers emphasize and listeners move to. This paper analyzes the durations of aksak beats and measures in two recorded percussion performances that use a particular aksak beat sequence, long-short-short. The results suggest that the timing of beats varies in conjunction with factors including melodic grouping and interaction among members of a performing ensemble and audience. Timing variation linked to melodic groups occurs on a solo recording of a Macedonian Romani folk song. The performer, Muzafer Bizlim, taps an ostinato while singing, and the timing of his taps seems to mark some local and large-scale group boundaries. Melodic organization also seems relevant to the timing of beats and measures on a recording of Bulgarian percussionist Mitko Popov playing the tŭpan, a double-headed bass drum, in a small folk music ensemble. In Popov’s performance, however, timing differences might be related to characteristics of the ensemble dynamic, such as the coordination of multiple musical participants. These interpretations generate possibilities for future study of timing variations in relation to rhythm and meter.

  1. Torque Teno Virus Load-Inverse Association With Antibody-Mediated Rejection After Kidney Transplantation.

    Science.gov (United States)

    Schiemann, Martin; Puchhammer-Stöckl, Elisabeth; Eskandary, Farsad; Kohlbeck, Philip; Rasoul-Rockenschaub, Susanne; Heilos, Andreas; Kozakowski, Nicolas; Görzer, Irene; Kikić, Željko; Herkner, Harald; Böhmig, Georg A; Bond, Gregor

    2017-02-01

    Antibody-mediated rejection (AMR) represents one of the cardinal causes of late allograft loss after kidney transplantation, and there is great need for noninvasive tools improving early diagnosis of this rejection type. One promising strategy might be the quantification of peripheral blood DNA levels of the highly prevalent and apathogenic Torque Teno virus (TTV), which might mirror the overall level of immunosuppression and thus help determine the risk of alloimmune response. To assess the association between TTV load in the peripheral blood and AMR, 715 kidney transplant recipients (median, 6.3 years posttransplantation) were subjected to a systematical cross-sectional AMR screening and, in parallel, TTV quantification. Eighty-six of these recipients had donor-specific antibodies and underwent protocol biopsy, AMR-positive patients (n = 46) showed only 25% of the TTV levels measured in patients without AMR (P = 0.003). In a generalized linear model, higher TTV levels were associated with a decreased risk for AMR after adjustment for potential confounders (risk ratio 0.94 per TTV log level; 95% confidence interval 0.90-0.99; P = 0.02). Future studies will have to clarify whether longitudinal assessment of TTV load might predict AMR risk and help guide the type and intensity of immunosuppression to prevent antibody-mediated graft injury.

  2. Time variation of fundamental couplings and dynamical dark energy

    International Nuclear Information System (INIS)

    Dent, Thomas; Stern, Steffen; Wetterich, Christof

    2009-01-01

    Scalar field dynamics may give rise to a nonzero cosmological variation of fundamental constants. Within different scenarios based on the unification of gauge couplings, the various claimed observations and bounds may be combined in order to trace or restrict the time history of the couplings and masses. If the scalar field is responsible for a dynamical dark energy or quintessence, cosmological information becomes available for its time evolution. Combining this information with the time variation of couplings, one can determine the interaction strength between the scalar and atoms, which may be observed by tests of the Weak Equivalence Principle. We compute bounds on the present rate of coupling variation from experiments testing the differential accelerations for bodies with equal mass and different composition and compare the sensitivity of various methods. In particular, we discuss two specific models of scalar evolution: crossover quintessence and growing neutrino models

  3. Modelling the quiet-time geomagnetic daily variations using observatory data

    OpenAIRE

    Hamilton, Brian; Macmillan, Susan

    2008-01-01

    We present on-going work towards building a global model of the quiet-time geomagnetic daily variation using bservatory data. We select hourly mean data during June 2006 (solar minimum). We fit Fourier series in time, with a fundamental period of 24 hours, to the data at each observatory. We then use global spherical harmonic expansions to separate the daily variation signal, as characterised by the Fourier coefficients in time, into external and induced internal contributions. The mode...

  4. Transfusion transmitted virus prevalence rate in IDU patients: a cross sectional study

    Directory of Open Access Journals (Sweden)

    Soudbakhsh AR, Nami MA, Hadjiabdolbaghi M, Kazemi B

    2008-07-01

    Full Text Available "nBackground: Transfusion-Transmitted Virus (TTV is a nonenveloped, single-stranded and circular DNA virus belongs to circuviridae family genus Anellovirus, discovered by Nishizawa in 1997. As the usage of common syringes is the known and most common route of the virus transmission, and because of increasing population of Injection drug users (IDU we decided to study infection rate in IDU population of our Society. "nMethods: In a cross-sectional study at Infectious ward of Imam Khomeini hospital, 60 IDU patients were studied. Blood samples were dispatched to lab in citrated test tube for Genome Virus isolation operation, using boiling method, then PCR assay performed based on their available primers. Patient's information gathered by interview and questionnaire methods."n "nResults: All of our 60 patients were men and their age average was 35.30(SD±9.68 years old. 26(43.3% patients had positive TTV PCR and 24(92.30% of them had prison history. 23(88.50% of these 26 patients had positive HCV Ab, 17(65.40% had positive HIV Ab and 8(30.80% had positive HBS Ag. Of 60 study patients 48(80% had HCV Ab+, 43(71.70% HIV Ab+, 26(43% TTV PCR and 43(26.70% had HBS Ag+ Of 26 patients who had TTV, 34.60% of them had no contemporary sickness and 11.50% of them displayed clear sign of hepatitis (fever, abdominal pain, nausea, vomiting, RUQ tenderness and Icter. 34.60% of them had LFT more than Upper limit normal (45u/l. Time average of injection in 26 TTV patient was 9 years (SD±7.16 and the patient's age average was 36.35%(SD±9.2. "nConclusions: One of the most important route of TTV infection is use of common syringes, TTV infection transmission chance is less than HIV and HCV infection and is more than HBV. In regard to high prevalence of TTV infection in IDU population and because there is no comprehensive information about pathogenesis of this virus in addition to another way of transmission of the virus, the fecal-oral way, we must make

  5. Transit Timing Observations from Kepler: II. Confirmation of Two Multiplanet Systems via a Non-parametric Correlation Analysis

    Energy Technology Data Exchange (ETDEWEB)

    Ford, Eric B.; /Florida U.; Fabrycky, Daniel C.; /Lick Observ.; Steffen, Jason H.; /Fermilab; Carter, Joshua A.; /Harvard-Smithsonian Ctr. Astrophys.; Fressin, Francois; /Harvard-Smithsonian Ctr. Astrophys.; Holman, Matthew J.; /Harvard-Smithsonian Ctr. Astrophys.; Lissauer, Jack J.; /NASA, Ames; Moorhead, Althea V.; /Florida U.; Morehead, Robert C.; /Florida U.; Ragozzine, Darin; /Harvard-Smithsonian Ctr. Astrophys.; Rowe, Jason F.; /NASA, Ames /SETI Inst., Mtn. View /San Diego State U., Astron. Dept.

    2012-01-01

    We present a new method for confirming transiting planets based on the combination of transit timing variations (TTVs) and dynamical stability. Correlated TTVs provide evidence that the pair of bodies are in the same physical system. Orbital stability provides upper limits for the masses of the transiting companions that are in the planetary regime. This paper describes a non-parametric technique for quantifying the statistical significance of TTVs based on the correlation of two TTV data sets. We apply this method to an analysis of the transit timing variations of two stars with multiple transiting planet candidates identified by Kepler. We confirm four transiting planets in two multiple planet systems based on their TTVs and the constraints imposed by dynamical stability. An additional three candidates in these same systems are not confirmed as planets, but are likely to be validated as real planets once further observations and analyses are possible. If all were confirmed, these systems would be near 4:6:9 and 2:4:6:9 period commensurabilities. Our results demonstrate that TTVs provide a powerful tool for confirming transiting planets, including low-mass planets and planets around faint stars for which Doppler follow-up is not practical with existing facilities. Continued Kepler observations will dramatically improve the constraints on the planet masses and orbits and provide sensitivity for detecting additional non-transiting planets. If Kepler observations were extended to eight years, then a similar analysis could likely confirm systems with multiple closely spaced, small transiting planets in or near the habitable zone of solar-type stars.

  6. Búsqueda de exoplanetas: ?`Cuán confiables son las observaciones obtenidas mediante telescopios terrestres?

    Science.gov (United States)

    von Essen, C.; Páez, R. I.; Schmitt, J. H. M. M.

    The main goal of this work is to present a model that generates synthetic light curves of primary transits, comparable to real observations, to study transit timing variations (TTV). Considering that we can observe the sky from different virtual observatories, we simulated observations of primary transits caused by a hot-Jupiter. We artificially added a perturbation caused by an Earth-like exoplanet in a 3:2 mean motion resonance. These simulations would allow to analyze the degree of distorsion that the light curves admit, in order to recover back the induced signal by the exoplanet. FULL TEXT IN SPANISH

  7. A human torque teno virus encodes a microRNA that inhibits interferon signaling.

    Directory of Open Access Journals (Sweden)

    Rodney P Kincaid

    Full Text Available Torque teno viruses (TTVs are a group of viruses with small, circular DNA genomes. Members of this family are thought to ubiquitously infect humans, although causal disease associations are currently lacking. At present, there is no understanding of how infection with this diverse group of viruses is so prevalent. Using a combined computational and synthetic approach, we predict and identify miRNA-coding regions in diverse human TTVs and provide evidence for TTV miRNA production in vivo. The TTV miRNAs are transcribed by RNA polymerase II, processed by Drosha and Dicer, and are active in RISC. A TTV mutant defective for miRNA production replicates as well as wild type virus genome; demonstrating that the TTV miRNA is dispensable for genome replication in a cell culture model. We demonstrate that a recombinant TTV genome is capable of expressing an exogenous miRNA, indicating the potential utility of TTV as a small RNA vector. Gene expression profiling of host cells identifies N-myc (and STAT interactor (NMI as a target of a TTV miRNA. NMI transcripts are directly regulated through a binding site in the 3'UTR. SiRNA knockdown of NMI contributes to a decreased response to interferon signaling. Consistent with this, we show that a TTV miRNA mediates a decreased response to IFN and increased cellular proliferation in the presence of IFN. Thus, we add Annelloviridae to the growing list of virus families that encode miRNAs, and suggest that miRNA-mediated immune evasion can contribute to the pervasiveness associated with some of these viruses.

  8. Effects of hydration and physical therapy on tracheal transport velocity

    International Nuclear Information System (INIS)

    Chopra, S.K.; Taplin, G.V.; Simmons, D.H.; Coulson, A.; Elam, D.

    1976-01-01

    A new tracer method for quantitative measurements of tracheal transport velocity (TTV) in mm/min in dogs has been described recently. Using the same technique, the effects of dehydration, hydration, postural drainage and physical therapy on TTV were studied. There was a significant (p < 0.05) reduction in TTV following dehydration and these values reverted to normal with hydration in all ten dogs. Tracheal transport velocity increased on the average of 39.7 percent with a mean change of 7.7 mm/min (p < 0.01) following postural drainage in seven dogs. On the other hand, TTV increased on the average of 51 percent with a mean change of 8.2 mm/min (p <0.01) following chest percussion in six dogs. Postural drainage and chest percussion each increased TTV significantly beyond the base-line values. However, hydration only restored TTV to base-line values when applied to dogs in the hydropenic state. These therapeutic measures have been used empirically in the past. The present study gives objective evidence of their beneficial effects in dogs and suggests that such treatments may have a definite scientific basis for clinical application in chronic obstructive airways disease

  9. Time-Dependent Variations of Accretion Disk

    Directory of Open Access Journals (Sweden)

    Hye-Weon Na

    1987-06-01

    Full Text Available In dward nova we assume the primary star as a white dwarf and the secondary as the late type star which filled Roche lobe. Mass flow from the secondary star leads to the formation of thin accretion disk around the white dwarf. We use the α parameter as viscosity to maintain the disk form and propose that the outburst in dwarf nova cause the steep increase of source term. With these assumptions we solve the basic equations of stellar structure using Newton-Raphson method. We show the physical parameters like temperature, density, pressure, opacity, surface density, height and flux to the radius of disk. Changing the value of α, we compare several parameters when mass flow rate is constant with those of when luminosity of disk is brightest. At the same time, we obtain time-dependent variations of luminosity and mass of disk. We propose the suitable range of α is 0.15-0.18 to the difference of luminosity. We compare several parameters of disk with those of the normal late type stars which have the same molecular weight of disk is lower. Maybe the outburst in dwarf nova is due to the variation of the α value instead of increment of mass flow from the secondary star.

  10. Torque Teno Virus in HIV-infected transgender in Surakarta, Indonesia

    Science.gov (United States)

    Hartono; Agung Prasetyo, Afiono; Fanani, Mohammad

    2018-05-01

    Torque Teno Virus (TTV) is a circular single-stranded DNA virus that may co-infected with human immunodeficiency virus (HIV), especially in the high-risk community e.g. the transgender performing high-riskbehavior. TTV shows an increased viremia in HIV patients and maybe influence the HIV clinical progression. Blood samples collected from transgender performing high-riskbehavior in Surakarta were tested by serological and molecular assays to detect the presence of HIV infection. The blood samples with HIV positive status were then tested by a nested polymerase chain reaction (PCR) to detect the presentation of TTV DNA. The amplified PCR products were molecularly cloned and subjected to sequence analysis. TTV DNA was detected in 40.0% HIV-positive samples. The molecular characterization revealed that the most prevalent was genogroup 3, followed by genogroup 2 and 1, respectively. TTV was detected in HIV-infected transgender performing high-riskbehavior in Surakarta with high infection rate.

  11. Deterministic Chaos in Radon Time Variation

    International Nuclear Information System (INIS)

    Planinic, J.; Vukovic, B.; Radolic, V.; Faj, Z.; Stanic, D.

    2003-01-01

    Radon concentrations were continuously measured outdoors, in living room and basement in 10-minute intervals for a month. The radon time series were analyzed by comparing algorithms to extract phase-space dynamical information. The application of fractal methods enabled to explore the chaotic nature of radon in the atmosphere. The computed fractal dimensions, such as Hurst exponent (H) from the rescaled range analysis, Lyapunov exponent (λ ) and attractor dimension, provided estimates of the degree of chaotic behavior. The obtained low values of the Hurst exponent (0< H<0.5) indicated anti-persistent behavior (non random changes) of the time series, but the positive values of the λ pointed out the grate sensitivity on initial conditions and appearing deterministic chaos by radon time variations. The calculated fractal dimensions of attractors indicated more influencing (meteorological) parameters on radon in the atmosphere. (author)

  12. Radon time variations and deterministic chaos

    Energy Technology Data Exchange (ETDEWEB)

    Planinic, J. E-mail: planinic@pedos.hr; Vukovic, B.; Radolic, V

    2004-07-01

    Radon concentrations were continuously measured outdoors, in the living room and in the basement at 10 min intervals for a month. Radon time series were analyzed by comparing algorithms to extract phase space dynamical information. The application of fractal methods enabled exploration of the chaotic nature of radon in atmosphere. The computed fractal dimensions, such as the Hurst exponent (H) from the rescaled range analysis, Lyapunov exponent ({lambda}) and attractor dimension, provided estimates of the degree of chaotic behavior. The obtained low values of the Hurst exponent (0time series, but the positive values of {lambda} pointed out the grate sensitivity on initial conditions and the deterministic chaos that appeared due to radon time variations. The calculated fractal dimensions of attractors indicated more influencing (meteorological) parameters on radon in the atmosphere.

  13. Radon time variations and deterministic chaos

    International Nuclear Information System (INIS)

    Planinic, J.; Vukovic, B.; Radolic, V.

    2004-01-01

    Radon concentrations were continuously measured outdoors, in the living room and in the basement at 10 min intervals for a month. Radon time series were analyzed by comparing algorithms to extract phase space dynamical information. The application of fractal methods enabled exploration of the chaotic nature of radon in atmosphere. The computed fractal dimensions, such as the Hurst exponent (H) from the rescaled range analysis, Lyapunov exponent (λ) and attractor dimension, provided estimates of the degree of chaotic behavior. The obtained low values of the Hurst exponent (0< H<0.5) indicated anti-persistent behavior (non-random changes) of the time series, but the positive values of λ pointed out the grate sensitivity on initial conditions and the deterministic chaos that appeared due to radon time variations. The calculated fractal dimensions of attractors indicated more influencing (meteorological) parameters on radon in the atmosphere

  14. Variation in Part-Time Work among Pediatric Subspecialties.

    Science.gov (United States)

    Freed, Gary L; Boyer, Debra M; Van, Kenton D; Macy, Michelle L; McCormick, Julie; Leslie, Laurel K

    2018-04-01

    To assess the part-time workforce and average hours worked per week among pediatric subspecialists in the 15 medical subspecialties certified by the American Board of Pediatrics. We examined data from pediatric subspecialists who enrolled in Maintenance of Certification with the American Board of Pediatrics from 2009 to 2015. Data were collected via an online survey. Providers indicated whether they worked full time or part time and estimated the average number of hours worked per week in clinical, research, education, and administrative tasks, excluding time on call. We calculated and compared the range of hours worked by those in full- and part-time positions overall, by demographic characteristics, and by subspecialty. Overall, 9.6% of subspecialists worked part time. There was significant variation in part-time employment rates between subspecialties, ranging from 3.8% among critical care pediatricians to 22.9% among developmental-behavioral pediatricians. Women, American medical graduates, and physicians older than 70 years of age reported higher rates of part-time employment than men, international medical graduates, and younger physicians. There was marked variation in the number of hours worked across subspecialties. Most, but not all, full-time subspecialists reported working at least 40 hours per week. More than one-half of physicians working part time in hematology and oncology, pulmonology, and transplant hepatology reported working at least 40 hours per week. There are unique patterns of part-time employment and hours worked per week among pediatric medical subspecialists that make simple head counts inadequate to determine the effective workforce. Our findings are limited to the 15 American Board of Pediatrics-certified medical subspecialties. Copyright © 2017 Elsevier Inc. All rights reserved.

  15. Continuous radon measurements in schools: time variations and related parameters

    International Nuclear Information System (INIS)

    Giovani, C.; Cappelletto, C.; Garavaglia, M.; Pividore, S.; Villalta, R.

    2004-01-01

    Some results are reported of observations made within a four-year survey, during different seasons and in different conditions of school building use. Natural radon variations (day-night cycles, seasonal and temperature dependent variations etc..) and artificial ones (opening of windows, weekends and vacations, deployment of air conditioning or heating systems. etc.) were investigated as parameters affecting time dependent radon concentrations. (P.A.)

  16. Five Kepler target stars that show multiple transiting exoplanet candidates

    Energy Technology Data Exchange (ETDEWEB)

    Steffen, Jason H.; /Fermilab; Batalha, Natalie M.; /San Jose State U.; Borucki, William J.; /NASA, Ames; Buchhave, Lars A.; /Harvard-Smithsonian Ctr. Astrophys. /Bohr Inst.; Caldwell, Douglas A.; /NASA, Ames /SETI Inst., Mtn. View; Cochran, William D.; /Texas U.; Endl, Michael; /Texas U.; Fabrycky, Daniel C.; /Harvard-Smithsonian Ctr. Astrophys.; Fressin, Francois; /Harvard-Smithsonian Ctr. Astrophys.; Ford, Eric B.; /Florida U.; Fortney, Jonathan J.; /UC, Santa Cruz, Phys. Dept. /NASA, Ames

    2010-06-01

    We present and discuss five candidate exoplanetary systems identified with the Kepler spacecraft. These five systems show transits from multiple exoplanet candidates. Should these objects prove to be planetary in nature, then these five systems open new opportunities for the field of exoplanets and provide new insights into the formation and dynamical evolution of planetary systems. We discuss the methods used to identify multiple transiting objects from the Kepler photometry as well as the false-positive rejection methods that have been applied to these data. One system shows transits from three distinct objects while the remaining four systems show transits from two objects. Three systems have planet candidates that are near mean motion commensurabilities - two near 2:1 and one just outside 5:2. We discuss the implications that multitransiting systems have on the distribution of orbital inclinations in planetary systems, and hence their dynamical histories; as well as their likely masses and chemical compositions. A Monte Carlo study indicates that, with additional data, most of these systems should exhibit detectable transit timing variations (TTV) due to gravitational interactions - though none are apparent in these data. We also discuss new challenges that arise in TTV analyses due to the presence of more than two planets in a system.

  17. Training and evaluation of neural networks for multi-variate time series processing

    DEFF Research Database (Denmark)

    Fog, Torben L.; Larsen, Jan; Hansen, Lars Kai

    1995-01-01

    We study the training and generalization for multi-variate time series processing. It is suggested to used a quasi-maximum likelihood approach rather than the standard sum of squared errors, thus taking dependencies among the errors of the individual time series into account. This may lead...... to improved generalization performance. Further, we extend the optimal brain damage pruning technique to the multi-variate case. A key ingredient is an algebraic expression for the generalization ability of a multi-variate model. The variability of the suggested techniques are successfully demonstrated...

  18. Pattern and Variation in the Timing of Aksak Meter: Commentary on Goldberg

    OpenAIRE

    Rainer Polak

    2016-01-01

    Daniel Goldberg (2015, this issue) explores relations between timing variations, grouping structure, and musical form in the percussive accompaniment of Balkan folk dance music. A chronometric re-analysis of one of the target article’s two audio samples finds a regular metric timing pattern to consistently underlie the variations Goldberg uncovered. Read together, the target article and this commentary demonstrate the complex interplay of a regular timing pattern with several levels of nuance...

  19. Identifying significant temporal variation in time course microarray data without replicates

    Directory of Open Access Journals (Sweden)

    Porter Weston

    2009-03-01

    Full Text Available Abstract Background An important component of time course microarray studies is the identification of genes that demonstrate significant time-dependent variation in their expression levels. Until recently, available methods for performing such significance tests required replicates of individual time points. This paper describes a replicate-free method that was developed as part of a study of the estrous cycle in the rat mammary gland in which no replicate data was collected. Results A temporal test statistic is proposed that is based on the degree to which data are smoothed when fit by a spline function. An algorithm is presented that uses this test statistic together with a false discovery rate method to identify genes whose expression profiles exhibit significant temporal variation. The algorithm is tested on simulated data, and is compared with another recently published replicate-free method. The simulated data consists both of genes with known temporal dependencies, and genes from a null distribution. The proposed algorithm identifies a larger percentage of the time-dependent genes for a given false discovery rate. Use of the algorithm in a study of the estrous cycle in the rat mammary gland resulted in the identification of genes exhibiting distinct circadian variation. These results were confirmed in follow-up laboratory experiments. Conclusion The proposed algorithm provides a new approach for identifying expression profiles with significant temporal variation without relying on replicates. When compared with a recently published algorithm on simulated data, the proposed algorithm appears to identify a larger percentage of time-dependent genes for a given false discovery rate. The development of the algorithm was instrumental in revealing the presence of circadian variation in the virgin rat mammary gland during the estrous cycle.

  20. Time-causal decomposition of geomagnetic time series into secular variation, solar quiet, and disturbance signals

    Science.gov (United States)

    Rigler, E. Joshua

    2017-04-26

    A theoretical basis and prototype numerical algorithm are provided that decompose regular time series of geomagnetic observations into three components: secular variation; solar quiet, and disturbance. Respectively, these three components correspond roughly to slow changes in the Earth’s internal magnetic field, periodic daily variations caused by quasi-stationary (with respect to the sun) electrical current systems in the Earth’s magnetosphere, and episodic perturbations to the geomagnetic baseline that are typically driven by fluctuations in a solar wind that interacts electromagnetically with the Earth’s magnetosphere. In contrast to similar algorithms applied to geomagnetic data in the past, this one addresses the issue of real time data acquisition directly by applying a time-causal, exponential smoother with “seasonal corrections” to the data as soon as they become available.

  1. The influence of quantitative tumor volume measurements on local control in advanced head and neck cancer using concomitant boost accelerated superfractionated irradiation

    Energy Technology Data Exchange (ETDEWEB)

    Johnson, Christopher R; Khandelwal, Shiv R; Schmidt-Ullrich, Rupert K; Ravalese, Joseph; Wazer, David E

    1995-06-15

    Purpose: Current methods to clinically define head and neck tumor bulk are qualitative and imprecise. Although the American Joint Committee on Cancer (AJCC) staging system is important for this purpose, limitations exist. This study will investigate the prognostic value of computed tomography (CT) derived tumor volume measurements in comparison to AJCC stage and other significant variables. Materials and Methods: Seventy-six patients with advanced head and neck squamous cell carcinoma were treated with concomitant boost accelerated superfractionated irradiation. Doses ranged from 68.4-73.8 Gy (median 70.2 Gy). Good quality pretherapy CT scans were available in 51 patients. Total tumor volume (TTV) estimates were derived from these scans using digital integration of primary tumor and metastatic lymphadenopathy. Actuarial and multivariate statistical techniques were applied to analyze local control. Results: Thirty-six-month local control was 63%. TTV ranged from 5-196 cm{sup 3} (median 35 cm{sup 3}) for all cases, 5-142 cm{sup 3} (median 17 cm{sup 3}) for those controlled, and 16-196 cm{sup 3} (median 47 cm{sup 3}) for local failures. There was a significant increase in failures above 35 cm{sup 3}. Univariate analysis found that TTV, T-stage, N-stage, and primary site were each significant prognostic variables. Local control for TTV {<=}35 cm{sup 3} was 92% at 36 months vs. 34% for TTV >35 cm{sup 3} (p = 0.0001). Multivariate analysis, however, found that TTV, primary site, and sex were important as independent variables; T and N stage were not independently significant unless TTV was removed from the model. Conclusions: This study demonstrates the prognostic significance of TTV in advanced carcinoma of the head and neck. This variable appears to be a more predictive than AJCC clinical stage. Quantitative tumor volume measurements may prove to be a useful parameter in future analyses of head and neck cancer.

  2. Feynman’s clock, a new variational principle, and parallel-in-time quantum dynamics

    Science.gov (United States)

    McClean, Jarrod R.; Parkhill, John A.; Aspuru-Guzik, Alán

    2013-01-01

    We introduce a discrete-time variational principle inspired by the quantum clock originally proposed by Feynman and use it to write down quantum evolution as a ground-state eigenvalue problem. The construction allows one to apply ground-state quantum many-body theory to quantum dynamics, extending the reach of many highly developed tools from this fertile research area. Moreover, this formalism naturally leads to an algorithm to parallelize quantum simulation over time. We draw an explicit connection between previously known time-dependent variational principles and the time-embedded variational principle presented. Sample calculations are presented, applying the idea to a hydrogen molecule and the spin degrees of freedom of a model inorganic compound, demonstrating the parallel speedup of our method as well as its flexibility in applying ground-state methodologies. Finally, we take advantage of the unique perspective of this variational principle to examine the error of basis approximations in quantum dynamics. PMID:24062428

  3. No variations in transit times for Qatar-1 b

    Science.gov (United States)

    Maciejewski, G.; Fernández, M.; Aceituno, F. J.; Ohlert, J.; Puchalski, D.; Dimitrov, D.; Seeliger, M.; Kitze, M.; Raetz, St.; Errmann, R.; Gilbert, H.; Pannicke, A.; Schmidt, J.-G.; Neuhäuser, R.

    2015-05-01

    Aims: The transiting hot-Jupiter planet Qatar-1 b exhibits variations in transit times that could be perturbative. A hot Jupiter with a planetary companion on a nearby orbit would constitute an unprecedented planetary configuration, which is important for theories of the formation and evolution of planetary systems. We performed a photometric follow-up campaign to confirm or refute transit timing variations. Methods: We extend the baseline of transit observations by acquiring 18 new transit light curves acquired with 0.6-2.0 m telescopes. These photometric time series, together with data available in the literature, were analyzed in a homogenous way to derive reliable transit parameters and their uncertainties. Results: We show that the dataset of transit times is consistent with a linear ephemeris leaving no hint of any periodic variations with a range of 1 min. We find no compelling evidence of a close-in planetary companion to Qatar-1 b. This finding is in line with a paradigm that hot Jupiters are not components of compact multiplanetary systems. Based on dynamical simulations, we place tighter constraints on the mass of any fictitious nearby planet in the system. Furthermore, new transit light curves allowed us to redetermine system parameters with better precision than reported in previous studies. Our values generally agree with previous determinations. Partly based on (1) data collected with telescopes at the Rozhen National Astronomical Observatory and (2) observations obtained with telescopes of the University Observatory Jena, which is operated by the Astrophysical Institute of the Friedrich-Schiller-University.Tables of light curve data are only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (ftp://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/577/A109

  4. Reducing lumber thickness variation using real-time statistical process control

    Science.gov (United States)

    Thomas M. Young; Brian H. Bond; Jan Wiedenbeck

    2002-01-01

    A technology feasibility study for reducing lumber thickness variation was conducted from April 2001 until March 2002 at two sawmills located in the southern U.S. A real-time statistical process control (SPC) system was developed that featured Wonderware human machine interface technology (HMI) with distributed real-time control charts for all sawing centers and...

  5. Own-wage labor supply elasticities: variation across time and estimation methods

    Directory of Open Access Journals (Sweden)

    Olivier Bargain

    2016-10-01

    Full Text Available Abstract There is a huge variation in the size of labor supply elasticities in the literature, which hampers policy analysis. While recent studies show that preference heterogeneity across countries explains little of this variation, we focus on two other important features: observation period and estimation method. We start with a thorough survey of existing evidence for both Western Europe and the USA, over a long period and from different empirical approaches. Then, our meta-analysis attempts to disentangle the role of time changes and estimation methods. We highlight the key role of time changes, documenting the incredible fall in labor supply elasticities since the 1980s not only for the USA but also in the EU. In contrast, we find no compelling evidence that the choice of estimation method explains variation in elasticity estimates. From our analysis, we derive important guidelines for policy simulations.

  6. Time dependent variational method in quantum mechanics

    International Nuclear Information System (INIS)

    Torres del Castillo, G.F.

    1987-01-01

    Using the fact that the solutions to the time-dependent Schodinger equation can be obtained from a variational principle, by restricting the evolution of the state vector to some surface in the corresponding Hilbert space, approximations to the exact solutions can be obtained, which are determined by equations similar to Hamilton's equations. It is shown that, in order for the approximate evolution to be well defined on a given surface, the imaginary part of the inner product restricted to the surface must be non-singular. (author)

  7. Stability Analysis and Variational Integrator for Real-Time Formation Based on Potential Field

    Directory of Open Access Journals (Sweden)

    Shengqing Yang

    2014-01-01

    Full Text Available This paper investigates a framework of real-time formation of autonomous vehicles by using potential field and variational integrator. Real-time formation requires vehicles to have coordinated motion and efficient computation. Interactions described by potential field can meet the former requirement which results in a nonlinear system. Stability analysis of such nonlinear system is difficult. Our methodology of stability analysis is discussed in error dynamic system. Transformation of coordinates from inertial frame to body frame can help the stability analysis focus on the structure instead of particular coordinates. Then, the Jacobian of reduced system can be calculated. It can be proved that the formation is stable at the equilibrium point of error dynamic system with the effect of damping force. For consideration of calculation, variational integrator is introduced. It is equivalent to solving algebraic equations. Forced Euler-Lagrange equation in discrete expression is used to construct a forced variational integrator for vehicles in potential field and obstacle environment. By applying forced variational integrator on computation of vehicles' motion, real-time formation of vehicles in obstacle environment can be implemented. Algorithm based on forced variational integrator is designed for a leader-follower formation.

  8. Pattern and Variation in the Timing of Aksak Meter: Commentary on Goldberg

    Directory of Open Access Journals (Sweden)

    Rainer Polak

    2016-01-01

    Full Text Available Daniel Goldberg (2015, this issue explores relations between timing variations, grouping structure, and musical form in the percussive accompaniment of Balkan folk dance music. A chronometric re-analysis of one of the target article’s two audio samples finds a regular metric timing pattern to consistently underlie the variations Goldberg uncovered. Read together, the target article and this commentary demonstrate the complex interplay of a regular timing pattern with several levels of nuanced variation to be performed with fluency, flexibility, and accuracy. This might appear commonplace, but here it is observed in the context of an asymmetric rhythmic mode, non-isochronous beat sequence, and asymmetric metric hierarchy. This context evidently does not represent a constraint of any sort in respect to the rhythmic timing performance, which casts doubts on the deep-seated assumption that metric regularity depends on iso-periodicity and vertical symmetry. This assumption is sometimes explicitly and often implicitly taken as universal; this comment suggests that, on the contrary, it might well be culturally biased.

  9. Control of a self guided tracked vehicle for hazardous waste removal using GPS positioning and ultrasonic collision avoidance

    International Nuclear Information System (INIS)

    Roy, B.; Lokhorst, D.; Fung, P.; Rice, P.

    1996-01-01

    In 1994 a large hydraulic telerobotic tracked transport vehicle (TTV) was built for Lockheed Idaho Technologies by a team of companies consisting of RAHCO International of Spokane, Spar Aerospace of Toronto and RSI Research of Victoria. The TTV was developed as a part of the Department of Energy's Buried Waste Integrated Demonstration Program to transport low level transuranic waste in a safe, dust-free manner minimizing the potential spread of airborne contaminants. The TTV was controlled from a remote control station by an operator relying on video and sensor feedback. This paper describes the control system of SGTV, a self guided version of the TTV developed in 1995 to travel autonomously between loading and off-loading points while automatically avoiding obstacles in its path. Self-guidance is divided between a supervisory Mission Planning and Control computer (WC) and an on-board system of five networked computers

  10. New Insights on Planet Formation in WASP-47 from a Simultaneous Analysis of Radial Velocities and Transit Timing Variations

    Science.gov (United States)

    Weiss, Lauren M.; Deck, Katherine M.; Sinukoff, Evan; Petigura, Erik A.; Agol, Eric; Lee, Eve J.; Becker, Juliette C.; Howard, Andrew W.; Isaacson, Howard; Crossfield, Ian J. M.; Fulton, Benjamin J.; Hirsch, Lea; Benneke, Björn

    2017-06-01

    Measuring precise planet masses, densities, and orbital dynamics in individual planetary systems is an important pathway toward understanding planet formation. The WASP-47 system has an unusual architecture that motivates a complex formation theory. The system includes a hot Jupiter (“b”) neighbored by interior (“e”) and exterior (“d”) sub-Neptunes, and a long-period eccentric giant planet (“c”). We simultaneously modeled transit times from the Kepler K2 mission and 118 radial velocities to determine the precise masses, densities, and Keplerian orbital elements of the WASP-47 planets. Combining RVs and TTVs provides a better estimate of the mass of planet d (13.6+/- 2.0 {M}\\oplus ) than that obtained with only RVs (12.75+/- 2.70 {M}\\oplus ) or TTVs (16.1+/- 3.8 {M}\\oplus ). Planets e and d have high densities for their size, consistent with a history of photoevaporation and/or formation in a volatile-poor environment. Through our RV and TTV analysis, we find that the planetary orbits have eccentricities similar to the solar system planets. The WASP-47 system has three similarities to our own solar system: (1) the planetary orbits are nearly circular and coplanar, (2) the planets are not trapped in mean motion resonances, and (3) the planets have diverse compositions. None of the current single-process exoplanet formation theories adequately reproduce these three characteristics of the WASP-47 system (or our solar system). We propose that WASP-47, like the solar system, formed in two stages: first, the giant planets formed in a gas-rich disk and migrated to their present locations, and second, the high-density sub-Neptunes formed in situ in a gas-poor environment.

  11. Variation of explosive force at different times of day

    Directory of Open Access Journals (Sweden)

    R Pereira

    2011-03-01

    Full Text Available AIM: The purpose of this study was to compare the explosive force and electromyographic (EMG activity at three different times of the day. METHODS: Thirty healthy subjects took part in the study, and carried out two maximum isometric voluntary knee extensions to measure explosive force, through contractile impulse (CI and rate of force development (RFD, and myoelectric signals from quadriceps muscles in the following periods: 07:30-09:30, 13:30-15:30 and 19:30-21:30 (called morning, afternoon and night respectively, on three non-consecutive days. RESULTS: The body temperature was lower in the morning than in the afternoon and night periods. The explosive force, evaluated through contractile impulse (CI and rate of force development (RFD, was greater at night than in the morning, without differences in the myoelectric signal. CONCLUSION: The ability to produce explosive force varies throughout different times of the day without variation in muscular recruitment, indicating that peripheral and not neural mechanisms could be responsible for this variation.

  12. Inter-temporal variation in the travel time and travel cost parameters of transport models

    OpenAIRE

    Börjesson, Maria

    2012-01-01

    The parameters for travel time and travel cost are central in travel demand forecasting models. Since valuation of infrastructure investments requires prediction of travel demand for future evaluation years, inter-temporal variation of the travel time and travel cost parameters is a key issue in forecasting. Using two identical stated choice experiments conducted among Swedish drivers with an interval of 13 years, 1994 and 2007, this paper estimates the inter-temporal variation in travel time...

  13. REFINED SYSTEM PARAMETERS AND TTV STUDY OF TRANSITING EXOPLANETARY SYSTEM HAT-P-20

    Energy Technology Data Exchange (ETDEWEB)

    Sun, Leilei; Gu, Shenghong; Wang, Xiaobin; Cao, Dongtao; Wang, Yibo; Xiang, Yue [Yunnan Observatories, Chinese Academy of Sciences, Kunming 650011 (China); Cameron, Andrew Collier [School of Physics and Astronomy, University of St Andrews, North Haugh, St Andrews, Fife KY16 9SS (United Kingdom); Hui, Ho-Keung; Kwok, Chi-Tai [Ho Koon Nature Education cum Astronomical Centre, Sik Sik Yuen, Hong Kong (China); Yeung, Bill; Ng, Eric [Hong Kong Astronomical Society, Hong Kong (China); Horta, Ferran Grau, E-mail: wangxb@ynao.ac.cn [Observatori Ca l’Ou, C/de Dalt 18, Sant Martí Sesgueioles (Spain)

    2017-01-01

    We report new photometric observations of the transiting exoplanetary system HAT-P-20, obtained using CCD cameras at Yunnan Observatories and Ho Koon Nature Education cum Astronomical Centre, China, from 2010 to 2013, and Observatori Ca l’Ou, Sant Marti Sesgueioles, Spain, from 2013 to 2015. The observed data are corrected for systematic errors according to the coarse de-correlation and SYSREM algorithms, so as to enhance the signal of the transit events. In order to consistently model the star spots and transits of this exoplanetary system, we develop a highly efficient tool STMT based on the analytic models of Mandel and Agol and Montalto et al. The physical parameters of HAT-P-20 are refined by homogeneously analyzing our new data, the radial velocity data, and the earlier photometric data in the literature with the Markov chain Monte Carlo technique. New radii and masses of both host star and planet are larger than those in the discovery paper due to the discrepancy of the radius among K-dwarfs between predicted values by standard stellar models and empirical calibration from observations. Through the analysis of all available mid-transit times calculated with the normal model and spotted model, we conclude that the periodic transit timing variations in these transit events revealed by employing the normal model are probably induced by spot crossing events. From the analysis of the distribution of occulted spots by HAT-P-20b, we constrain the misaligned architecture between the planetary orbit and the spin of the host star.

  14. Study of long-time variations of cosmic rays

    International Nuclear Information System (INIS)

    Dergachev, V.A.

    1979-01-01

    Discussed are some problems of the investigation into the cosmic rays intensity in the past via the contents of cosmogenic isotopes in the samples of known age, mainly measuring the activity of radiocarbon in the samples dated by the dendrochronological method. The necessity of production of the multicentury dendrochronological scales with absolute dating for decoding of the information contained in the annual rings during the large time scale is pointed out. The dendrochronologic studies supplemented by the radiocarbon dating would permit to study the variations in radiocarbon content and to determine the factors, which influence this content, during large time intervals. The different factors - the solar activity, the supernovae flares et cetera - influencing the radiocarbon concentration are considered

  15. Controlling spark timing for consecutive cycles to reduce the cyclic variations of SI engines

    International Nuclear Information System (INIS)

    Kaleli, Alirıza; Ceviz, Mehmet Akif; Erenturk, Köksal

    2015-01-01

    Minimization of the cyclic variations is one of the most important design goal for spark-ignited engines. Primary motivation of this study is to reduce the cyclic variations in spark ignition engines by controlling the spark timing for consecutive cycles. A stochastic model was performed between spark timing and in–cylinder maximum pressure by using the system identification techniques. The incylinder maximum pressure of the next cycle was predicted with this model. Minimum variance and generalized minimum variance controllers were designed to regulate the in–cylinder maximum pressure by changing the spark timing for consecutive cycles of the test engine. The produced control algorithms were built in LabView environment and installed to the Field Programmable Gate Arrays (FPGA) chassis. According to the test results, the in–cylinder maximum pressure of the next pressure cycle can be predicted fairly well, and the spark timing can be regulated to keep the in–cylinder maximum pressure in a desired band to reduce the cyclic variations. At fixed spark timing experiments, the COV Pmax and COV imep were 3.764 and 0.677%, whereas they decreased to 3.208 and 0.533% when GMV controller was applied, respectively. - Highlights: • Cycle per cycle spark timing control was carried out. • A stochastic process model was described between P max and the spark timing. • The cyclic variations in P max was decreased by keeping it in a desired band. • Different controllers were used to adjust spark timing signal of the next cycle. • COV Pmax was decreased by about 15% by using GMV controller

  16. Time and space variations of trophosherive carbon dioxide over Japan

    Energy Technology Data Exchange (ETDEWEB)

    Tanaka, M.; Nakazawa, T.; Aoki, S.

    Aircraft measurements of atmospheric CO/sub 2/ concentration over Japan, initiated in January 1979, have been continued to the present. The average seasonal variation of atmospheric CO/sub 2/ showed maximum concentration early in April and early in May, and minimum concentration in mid-August and mid-September for the lower-most and the upper-most layers of the troposphere, respectively. The peak-to-peak amplitudes of the seasonal variation were 14.5, 9.0 and 7.8 ppmv for the lower, middle and upper tropospheres, respectively. The average rate of annual increase of the CO/sub 2/ concentration over the last 6 years was about 1.3 ppmv yr/sup -1/ with considerable variation with time. The vertical profile of the annual mean value of the CO/sub 2/ concentration was almost the same from year to year; the CO/sub 2/ concentrations decreased gradually with height and the concentration difference between the lowest and highest layers of the troposphere was about 2 ppmv. (authors).

  17. Time variations in geomagnetic intensity

    Science.gov (United States)

    Valet, Jean-Pierre

    2003-03-01

    After many years spent by paleomagnetists studying the directional behavior of the Earth's magnetic field at all possible timescales, detailed measurements of field intensity are now needed to document the variations of the entire vector and to analyze the time evolution of the field components. A significant step has been achieved by combining intensity records derived from archeological materials and from lava flows in order to extract the global field changes over the past 12 kyr. A second significant step was due to the emergence of coherent records of relative paleointensity using the remanent magnetization of sediments to retrace the evolution of the dipole field. A third step was the juxtaposition of these signals with those derived from cosmogenic isotopes. Contemporaneous with the acquisition of records, new techniques have been developed to constrain the geomagnetic origin of the signals. Much activity has also been devoted to improving the quality of determinations of absolute paleointensity from volcanic rocks with new materials, proper selection of samples, and investigations of complex changes in magnetization during laboratory experiments. Altogether these developments brought us from a situation where the field changes were restricted to the past 40 kyr to the emergence of a coherent picture of the changes in the geomagnetic dipole moment for at least the past 1 Myr. On longer timescales the field variability and its average behavior is relatively well documented for the past 400 Myr. Section 3 gives a summary of most methods and techniques that are presently used to track the field intensity changes in the past. In each case, current limits and potential promises are discussed. The section 4 describes the field variations measured so far over various timescales covered by the archeomagnetic and the paleomagnetic records. Preference has always been given to composite records and databases in order to extract and discuss major and global geomagnetic

  18. Standardised Resting Time Prior to Blood Sampling and Diurnal Variation Associated with Risk of Patient Misclassification

    DEFF Research Database (Denmark)

    Bøgh Andersen, Ida; Brasen, Claus L.; Christensen, Henry

    2015-01-01

    .9×10-7) and sodium (p = 8.7×10-16). Only TSH and albumin were clinically significantly influenced by diurnal variation. Resting time had no clinically significant effect. CONCLUSIONS: We found no need for resting 15 minutes prior to blood sampling. However, diurnal variation was found to have a significant......BACKGROUND: According to current recommendations, blood samples should be taken in the morning after 15 minutes' resting time. Some components exhibit diurnal variation and in response to pressures to expand opening hours and reduce waiting time, the aims of this study were to investigate...... the impact of resting time prior to blood sampling and diurnal variation on biochemical components, including albumin, thyrotropin (TSH), total calcium and sodium in plasma. METHODS: All patients referred to an outpatient clinic for blood sampling were included in the period Nov 2011 until June 2014 (opening...

  19. Algebraic time-dependent variational approach to dynamical calculations

    International Nuclear Information System (INIS)

    Shi, S.; Rabitz, H.

    1988-01-01

    A set of time-dependent basis states is obtained with a group of unitary transformations generated by a Lie algebra. Applying the time-dependent variational principle to the trial function subspace constructed from the linear combination of the time-dependent basis states gives rise to a set of ''classical'' equations of motion for the group parameters and the expansion coefficients from which the time evolution of the system state can be determined. The formulation is developed for a general Lie algebra as well as for the commonly encountered algebra containing homogeneous polynominal products of the coordinate Q and momentum P operators (or equivalently the boson creation a/sup dagger/ and annihilation a operators) of order 0, 1, and 2. Explicit expressions for the transition amplitudes are derived by virtue of the cannonical transformation properties of the unitary transformation. The applicability of the present formalism in a variety of problems is implied by two illustrative examples: (a) a parametric amplifier; (b) the collinear collision of an atom with a Morse oscillator

  20. Determining Time Variation of Cable Tension Forces in Suspended Bridges Using Time-Frequency Analysis

    Directory of Open Access Journals (Sweden)

    Gannon Stromquist-LeVoir

    2018-01-01

    Full Text Available A feasibility study was conducted to develop a novel method to determine the temporal changes of tensile forces in bridge suspender cables using time-frequency analysis of ambient vibration measurements. An analytical model of the suspender cables was developed to evaluate the power spectral density (PSD function of a cable with consideration of cable flexural stiffness. Discrete-time, short-time Fourier transform (STFT was utilized to analyze the recorded acceleration histories in both time and frequency domains. A mathematical convolution of the analytical PSD function and time-frequency data was completed to evaluate changes in cable tension force over time. The method was implemented using acceleration measurements collected from an in-service steel arch bridge with a suspended deck to calculate the temporal variation in cable forces from the vibration measurements. The observations served as proof of concept that the proposed method may be used for cable fatigue life calculations and bridge weigh-in-motion studies.

  1. Estimating exponential scheduling preferences

    DEFF Research Database (Denmark)

    Hjorth, Katrine; Börjesson, Maria; Engelson, Leonid

    Extended abstract Choice of departure time is a travel choice dimension that transportation planners often need to forecast in appraisal. A traveller may shift departure time in response to changes in expected travel time or travel time variability (TTV) or in response to time-differentiated cong......Extended abstract Choice of departure time is a travel choice dimension that transportation planners often need to forecast in appraisal. A traveller may shift departure time in response to changes in expected travel time or travel time variability (TTV) or in response to time...... from the underlying scheduling preferences (Noland and Small, 1995, Bates et al., 2001, Fosgerau and Karlström, 2010). The scheduling preferences can be formally represented as time-dependent rates of utility derived at different locations. Assuming that the travellers are rational and choose departure......’ departure time choice. The assumption underlying the scheduling approach is that the traveller rationally maximises her total utility obtained during a period of time. The total utility depends on time of departure from the origin and time of arrival to the destination. The total utility is usually assumed...

  2. Time variation of fluorescence lifetime in enhanced cyan fluorescence protein

    International Nuclear Information System (INIS)

    Lee, Soonhyouk; Kim, Soo Yong; Park, Kyoungsook; Jeong, Jinyoung; Chung, Bong Hyun; Kim, Sok Won

    2010-01-01

    The lifetime variations of enhanced cyan fluorescence protein (ECFP) in relatively short integration time bins were studied via time-correlated single photon counting (TCSPC) measurement. We observed that minimum photon counts are necessary for the lifetime estimation to achieve a certain range of variance. The conditions to decrease the variance of lifetime were investigated and the channel width of the measurement of TCSPC data was found to be another important factor for the variance of lifetime. Though the lifetime of ECFP is best fit by a double exponential, a mono exponential fit for the same integration time is more stable. The results may be useful in the analysis of photophysical dynamics for ensemble molecules in short measurement time windows.

  3. Handheld mechanical nociceptive threshold testing in dairy cows - intra-individual variation, inter-observer agreement and variation over time.

    Science.gov (United States)

    Raundal, Peter M; Andersen, Pia H; Toft, Nils; Forkman, Björn; Munksgaard, Lene; Herskin, Mette S

    2014-11-01

    To examine the use of handheld methodology to assess mechanical nociceptive threshold (MNT) on cows kept loose-housed. Prospective randomized partial cross-over experimental study. A one-factor (test day) design was used to evaluate MNT over time. One hundred and fifteen healthy, loose-housed Danish Holstein cattle. We evaluated intra-individual variation, inter-observer agreement and variation over time of MNT using two handheld devices and two stimulation sites. Mechanical, ramped stimulations were performed with an algometer (6.5 mm diameter steel probe, 0-10.0 kgf) or an electronic von Frey device (plastic tip with diameter 0.8 mm, 0-1000 gf). Each cow received 5-6 consecutive stimulations within a 2 × 5 cm skin area on the dorsal or lateral aspect of the left third metatarsus until an avoidance reaction occurred. We investigated the difference in precision [expressed as coefficient of variation (CV)] between the combinations of devices and stimulation sites. The inter-observer agreement and the difference in MNT between test day 1, 3, 7, 10 and 24 were investigated for selected combinations. Data were analysed in mixed models and Bland-Altman as relevant. The CVs did not differ [range 0.34-0.52 (p = 0.1)]. Difference between observers (95% limits) was 0.2 kgf (2.8) and 4 gf (369) for the algometer and von Frey device, respectively. Mechanical nociceptive threshold increased from 361 on test day one to 495 gf on test day 24 (p < 0.01). All methods showed a high degree of intra-individual variation, and no combination of device and stimulation site showed superior precision. Mean difference between observers was low, and MNT was not consistent over time. Further development of the methods is required before they can be used in research to investigate possible relations between claw lesions and hyperalgesia. © 2014 The Authors Veterinary Anaesthesia and Analgesia published by John Wiley & Sons Ltd on behalf of Association of Veterinary Anaesthetists and the

  4. Developmental stage of strongyle eggs affects the outcome variations of real-time PCR analysis

    DEFF Research Database (Denmark)

    Andersen, Ulla Vestergaard; Haakansson, I. T.; Roust, Tina

    2013-01-01

    extent developmental stages can affect the variation of diagnostic test results. This study investigated the influence of developmental stages of strongyle eggs on the variation real-time polymerase chain reaction (PCR) results. Mixed species strongyle eggs were obtained from the faeces of a naturally...

  5. Clasp/SJ Observation of Time Variations of Lyman-Alpha Emissions in a Solar Active Region

    Science.gov (United States)

    Ishikawa, S.; Kubo, M.; Katsukawa, Y.; Kano, R.; Narukage, N.; Ishikawa, R.; Bando, T.; Winebarger, A.; Kobayashi, K.; Trujillo Bueno, J.; hide

    2016-01-01

    The Chromospheric Lyman-alpha SpectroPolarimeter (CLASP) is a sounding rocket experiment launched on September 3, 2015 to investigate the solar chromosphere, and the slit-jaw (SJ) optical system took Lya images with the high time cadence of 0.6 s. By the CLASP/SJ observation, many time variations in the solar chromosphere with the time scale of region and investigated the short (regions. As the result, we found the regions. On the other hand, the <30 s time variations had no dependency on the temperature of the loop.

  6. Running vacuum in the Universe and the time variation of the fundamental constants of Nature

    Energy Technology Data Exchange (ETDEWEB)

    Fritzsch, Harald [Nanyang Technological University, Institute for Advanced Study, Singapore (Singapore); Universitaet Muenchen, Physik-Department, Munich (Germany); Sola, Joan [Nanyang Technological University, Institute for Advanced Study, Singapore (Singapore); Universitat de Barcelona, Departament de Fisica Quantica i Astrofisica, Barcelona, Catalonia (Spain); Universitat de Barcelona (ICCUB), Institute of Cosmos Sciences, Barcelona, Catalonia (Spain); Nunes, Rafael C. [Universidade Federal de Juiz de Fora, Dept. de Fisica, Juiz de Fora, MG (Brazil)

    2017-03-15

    We compute the time variation of the fundamental constants (such as the ratio of the proton mass to the electron mass, the strong coupling constant, the fine-structure constant and Newton's constant) within the context of the so-called running vacuum models (RVMs) of the cosmic evolution. Recently, compelling evidence has been provided that these models are able to fit the main cosmological data (SNIa+BAO+H(z)+LSS+BBN+CMB) significantly better than the concordance ΛCDM model. Specifically, the vacuum parameters of the RVM (i.e. those responsible for the dynamics of the vacuum energy) prove to be nonzero at a confidence level >or similar 3σ. Here we use such remarkable status of the RVMs to make definite predictions on the cosmic time variation of the fundamental constants. It turns out that the predicted variations are close to the present observational limits. Furthermore, we find that the time evolution of the dark matter particle masses should be crucially involved in the total mass variation of our Universe. A positive measurement of this kind of effects could be interpreted as strong support to the ''micro-macro connection'' (viz. the dynamical feedback between the evolution of the cosmological parameters and the time variation of the fundamental constants of the microscopic world), previously proposed by two of us (HF and JS). (orig.)

  7. An explicit solution for a renewal process with waiting time and its variational principle

    International Nuclear Information System (INIS)

    Lewins, J.D.

    2001-01-01

    The forward and backward equations for the conditional probability density are derived for a reliability system consisting of a single component whose repair is subject to a delay time in providing a spare part but whose mean rate of repair is otherwise constant and whose time to failure is exponentially distributed. Exact solutions are quoted. These equations are then shown to be an adjoint pair that provide stationary conditions for a variational principle, in elementary form, from which all properties of the systems can be predicted with an accuracy greater than that implied by the trial functions or approximations used. A second or specific form of variational principle provides specific estimates to questions at hand. The second or adjoint field in the first elementary principle is the backward Kolmogorov solution and the in the specific form is the importance function, as used in nuclear reactor theory. The solutions are given for long-time and in a recurrence relation form valid for all times so that approximate solutions can be checked. Approximations suitable for variational trial functions are given. Two examples give the effect of a change of delay time for a steady state and an initial transient, respectively

  8. Dynamics of Gaussian Wigner functions derived from a time-dependent variational principle

    Directory of Open Access Journals (Sweden)

    Jens Aage Poulsen

    2017-11-01

    Full Text Available By using a time-dependent variational principle formulated for Wigner phase-space functions, we obtain the optimal time-evolution for two classes of Gaussian Wigner functions, namely those of either thawed real-valued or frozen but complex Gaussians. It is shown that tunneling effects are approximately included in both schemes.

  9. Hybrid model for forecasting time series with trend, seasonal and salendar variation patterns

    Science.gov (United States)

    Suhartono; Rahayu, S. P.; Prastyo, D. D.; Wijayanti, D. G. P.; Juliyanto

    2017-09-01

    Most of the monthly time series data in economics and business in Indonesia and other Moslem countries not only contain trend and seasonal, but also affected by two types of calendar variation effects, i.e. the effect of the number of working days or trading and holiday effects. The purpose of this research is to develop a hybrid model or a combination of several forecasting models to predict time series that contain trend, seasonal and calendar variation patterns. This hybrid model is a combination of classical models (namely time series regression and ARIMA model) and/or modern methods (artificial intelligence method, i.e. Artificial Neural Networks). A simulation study was used to show that the proposed procedure for building the hybrid model could work well for forecasting time series with trend, seasonal and calendar variation patterns. Furthermore, the proposed hybrid model is applied for forecasting real data, i.e. monthly data about inflow and outflow of currency at Bank Indonesia. The results show that the hybrid model tend to provide more accurate forecasts than individual forecasting models. Moreover, this result is also in line with the third results of the M3 competition, i.e. the hybrid model on average provides a more accurate forecast than the individual model.

  10. Variations in automatically recorded rumination time as explained by variations in intake of dietary fractions and milk production, and between-cow variation.

    Science.gov (United States)

    Byskov, M V; Nadeau, E; Johansson, B E O; Nørgaard, P

    2015-06-01

    Individual recording of rumination time (RT) is now possible in commercial dairy herds, through development of a microphone-based sensor, which is able to record RT by the sound of rumination activity. The objectives of this study were to examine the relationship between daily RT and intakes of different dietary fractions, the relationship between RT in minutes per kilogram of dry matter intake (DMI) and milk production, and to examine the variation in RT within and between mid-lactating dairy cows. Data from 3 production trials were used in which a total of 27 different diets were fed. The data contained 761, 290, and 203 daily recordings of RT, milk yield, milk components, DMI, and intake of dietary fractions recorded on 29, 26, and 24 Holstein and Swedish Red cows from trials 1, 2, and 3, respectively. The dietary fractions included forage neutral detergent fiber (NDF), concentrate NDF, crude protein, sugar, starch, and the remaining fraction represented by organic matter--(forage NDF+concentrate NDF+crude protein+sugar+starch). The relationship between the dietary fractions and RT was analyzed in 2 steps. In step 1, the dietary fractions, which were significantly related to RT, were selected and simultaneously checked for multicollinearity between the dietary components; in step 2, a multivariate model, including the effect of repeated measurements, the main effect of the selected dietary fractions from step 1, random effects of cow(trial) and trial, and information on breed, days in milk, and parity was used to analyze the relationship between RT and the selected dietary fractions. Relationships between RT in minutes per kilogram of DMI and milk yield and milk components were analyzed, using the same multivariate model as in step 2. Approximately 32% of the variation in daily RT could be explained by variations in intakes of the dietary fractions, whereas 48% of the total variation in RT was accounted for by individual variations between cows. Intakes of

  11. Time variations of geomagnetic activity indices Kp and Ap: an update

    Directory of Open Access Journals (Sweden)

    G. K. Rangarajan

    1997-10-01

    Full Text Available Kp and Ap indices covering the period 1932 to 1995 are analysed in a fashion similar to that attempted by Bartels for the 1932–1961 epoch to examine the time variations in their characteristics. Modern analysis techniques on the extended data base are used for further insight. The relative frequencies of occurrence of Kp with different magnitudes and the seasonal and solar cycle dependences are seen to be remarkably consistent despite the addition of 35 years of observations. Many of the earlier features seen in the indices and special intervals are shown to be replicated in the present analysis. Time variations in the occurrence of prolonged periods of geomagnetic calm or of enhanced activity are presented and their relation to solar activity highlighted. It is shown that in the declining phase the occurrence frequencies of Kp = 4–5 (consecutively over 4 intervals can be used as a precursor for the maximum sunspot number to be expected in the next cycle. The semi-annual variation in geomagnetic activity is re-examined utilising not only the Ap index but also the occurrence frequencies of Kp index with different magnitudes. Lack of dependence of the amplitude of semi-annual variation on sunspot number is emphasised. Singular spectrum analysis of the mean monthly Ap index shows some distinct periodic components. The temporal evolution of ~44 month, ~21 month and ~16 month oscillations are examined and it is postulated that while QBO and the 16 month oscillations could be attributed to solar wind and IMF oscillations with analogous periodicity, the 44 month variation is associated with a similar periodicity in recurrent high speed stream caused by sector boundary passage. It is reconfirmed that there could have been only one epoch around 1940 when solar wind speed could have exhibited a 1.3-year periodicity comparable to that seen during the post-1986 period.

  12. Time variations of geomagnetic activity indices Kp and Ap: an update

    Directory of Open Access Journals (Sweden)

    G. K. Rangarajan

    Full Text Available Kp and Ap indices covering the period 1932 to 1995 are analysed in a fashion similar to that attempted by Bartels for the 1932–1961 epoch to examine the time variations in their characteristics. Modern analysis techniques on the extended data base are used for further insight. The relative frequencies of occurrence of Kp with different magnitudes and the seasonal and solar cycle dependences are seen to be remarkably consistent despite the addition of 35 years of observations. Many of the earlier features seen in the indices and special intervals are shown to be replicated in the present analysis. Time variations in the occurrence of prolonged periods of geomagnetic calm or of enhanced activity are presented and their relation to solar activity highlighted. It is shown that in the declining phase the occurrence frequencies of Kp = 4–5 (consecutively over 4 intervals can be used as a precursor for the maximum sunspot number to be expected in the next cycle. The semi-annual variation in geomagnetic activity is re-examined utilising not only the Ap index but also the occurrence frequencies of Kp index with different magnitudes. Lack of dependence of the amplitude of semi-annual variation on sunspot number is emphasised. Singular spectrum analysis of the mean monthly Ap index shows some distinct periodic components. The temporal evolution of ~44 month, ~21 month and ~16 month oscillations are examined and it is postulated that while QBO and the 16 month oscillations could be attributed to solar wind and IMF oscillations with analogous periodicity, the 44 month variation is associated with a similar periodicity in recurrent high speed stream caused by sector boundary passage. It is reconfirmed that there could have been only one epoch around 1940 when solar wind speed could have exhibited a 1.3-year periodicity comparable to that seen during the post-1986 period.

  13. Time variations in the mechanical characteristics of local crustal segments according to seismic observations

    Science.gov (United States)

    Kocharyan, G. G.; Gamburtseva, N. G.; Sanina, I. A.; Danilova, T. V.; Nesterkina, M. A.; Gorbunova, E. M.; Ivanchenko, G. N.

    2011-04-01

    The results of the seismic observations made with two different experimental setups are presented. In the first case, the signals produced by underground nuclear explosions at the Semipalatinsk Test Site were measured on a linear profile, which allowed one to definitely outline the areas where the mechanical properties of rocks experienced considerable time variations. In the second case, the waves excited by the open-pit mine blasts recorded at a small-aperture seismic array at the Mikhnevo Geophysical Station (Institute of Geosphere Dynamics, Russian Academy of Sciences) on the East European Platform favored the estimation of variations in the integral characteristics of the seismic path. Measurements in aseismic regions characterized by diverse geological structure and different tectonic conditions revealed similar effects of the strong dependency of seismic parameters on the time of explosions. Here, the variations experienced by the maximum amplitudes of oscillations and irrelevant to seasonal changes or local conditions reached a factor of two. The generic periods of these variations including the distinct annual rhythm are probably the fragments of a lower-frequency process. The obtained results suggest that these variations are due to changes in the stressstrain state of active fault zones, which, in turn, can be associated with the macroscale motion of large blocks triggered by tidal strains, tectonic forces and, possibly, variations in the rate of the Earth's rotation.

  14. Long-term and transient time variation of cosmic ray fluxes detected in Argentina by CARPET cosmic ray detector

    Science.gov (United States)

    De Mendonça, R. R. S.; Raulin, J.-P.; Bertoni, F. C. P.; Echer, E.; Makhmutov, V. S.; Fernandez, G.

    2011-07-01

    We present results obtained at El Leoncito (CASLEO, San Juan, Argentina) with the CARPET charged particles detector installed in April 2006. The observed modulation of the cosmic ray flux is discussed as a function of its time variability and it is related to longer solar activity variations and to shorter variations during solar and geomagnetic transient activity. Short period (few minutes, few hours) cosmic ray modulation events are observed during rain time (precipitation) and significant variations of the atmospheric electric field. Complementary observations of the atmospheric electric field indicate that its time variations play an important role in the detected cosmic ray event.

  15. Time Variations of Observed H α Line Profiles and Precipitation Depths of Nonthermal Electrons in a Solar Flare

    Energy Technology Data Exchange (ETDEWEB)

    Falewicz, Robert; Radziszewski, Krzysztof; Rudawy, Paweł; Berlicki, Arkadiusz, E-mail: falewicz@astro.uni.wroc.pl, E-mail: radziszewski@astro.uni.wroc.pl, E-mail: rudawy@astro.uni.wroc.pl, E-mail: berlicki@astro.uni.wroc.pl [Astronomical Institute, University of Wrocław, 51-622 Wrocław, ul. Kopernika 11 (Poland)

    2017-10-01

    We compare time variations of the H α and X-ray emissions observed during the pre-impulsive and impulsive phases of the C1.1-class solar flare on 2013 June 21 with those of plasma parameters and synthesized X-ray emission from a 1D hydrodynamic numerical model of the flare. The numerical model was calculated assuming that the external energy is delivered to the flaring loop by nonthermal electrons (NTEs). The H α spectra and images were obtained using the Multi-channel Subtractive Double Pass spectrograph with a time resolution of 50 ms. The X-ray fluxes and spectra were recorded by RHESSI . Pre-flare geometric and thermodynamic parameters of the model and the delivered energy were estimated using RHESSI data. The time variations of the X-ray light curves in various energy bands and those of the H α intensities and line profiles were well correlated. The timescales of the observed variations agree with the calculated variations of the plasma parameters in the flaring loop footpoints, reflecting the time variations of the vertical extent of the energy deposition layer. Our result shows that the fast time variations of the H α emission of the flaring kernels can be explained by momentary changes of the deposited energy flux and the variations of the penetration depths of the NTEs.

  16. Handheld mechanical nociceptive threshold testing in dairy cows – intra-individual variation, inter-observer agreement and variation over time

    Science.gov (United States)

    Raundal, Peter M; Andersen, Pia H; Toft, Nils; Forkman, Björn; Munksgaard, Lene; Herskin, Mette S

    2014-01-01

    Objective To examine the use of handheld methodology to assess mechanical nociceptive threshold (MNT) on cows kept loose-housed. Study design Prospective randomized partial cross-over experimental study. A one-factor (test day) design was used to evaluate MNT over time. Animals One hundred and fifteen healthy, loose-housed Danish Holstein cattle. Methods We evaluated intra-individual variation, inter-observer agreement and variation over time of MNT using two handheld devices and two stimulation sites. Mechanical, ramped stimulations were performed with an algometer (6.5 mm diameter steel probe, 0–10.0 kgf) or an electronic von Frey device (plastic tip with diameter 0.8 mm, 0–1000 gf). Each cow received 5–6 consecutive stimulations within a 2 × 5 cm skin area on the dorsal or lateral aspect of the left third metatarsus until an avoidance reaction occurred. We investigated the difference in precision [expressed as coefficient of variation (CV)] between the combinations of devices and stimulation sites. The inter-observer agreement and the difference in MNT between test day 1, 3, 7, 10 and 24 were investigated for selected combinations. Data were analysed in mixed models and Bland-Altman as relevant. Results The CVs did not differ [range 0.34–0.52 (p = 0.1)]. Difference between observers (95% limits) was 0.2 kgf (2.8) and 4 gf (369) for the algometer and von Frey device, respectively. Mechanical nociceptive threshold increased from 361 on test day one to 495 gf on test day 24 (p < 0.01). Conclusion and clinical relevance All methods showed a high degree of intra-individual variation, and no combination of device and stimulation site showed superior precision. Mean difference between observers was low, and MNT was not consistent over time. Further development of the methods is required before they can be used in research to investigate possible relations between claw lesions and hyperalgesia. PMID:24734991

  17. Transiting Exoplanet Monitoring Project (TEMP). II. Refined System Parameters and Transit Timing Analysis of HAT-P-33b

    Science.gov (United States)

    Wang, Yong-Hao; Wang, Songhu; Liu, Hui-Gen; Hinse, Tobias C.; Laughlin, Gregory; Wu, Dong-Hong; Zhang, Xiaojia; Zhou, Xu; Wu, Zhenyu; Zhou, Ji-Lin; Wittenmyer, R. A.; Eastman, Jason; Zhang, Hui; Hori, Yasunori; Narita, Norio; Chen, Yuanyuan; Ma, Jun; Peng, Xiyan; Zhang, Tian-Meng; Zou, Hu; Nie, Jun-Dan; Zhou, Zhi-Min

    2017-08-01

    We present 10 R-band photometric observations of eight different transits of the hot Jupiter HAT-P-33b, which has been targeted by our Transiting Exoplanet Monitoring Project. The data were obtained by two telescopes at the Xinglong Station of National Astronomical Observatories of China (NAOC) from 2013 December through 2016 January, and exhibit photometric scatter of 1.6{--}3.0 {mmag}. After jointly analyzing the previously published photometric data, radial-velocity (RV) measurements, and our new light curves, we revisit the system parameters and orbital ephemeris for the HAT-P-33b system. Our results are consistent with the published values except for the planet to star radius ratio ({R}{{P}}/{R}* ), the ingress/egress duration (τ) and the total duration (T 14), which together indicate a slightly shallower and shorter transit shape. Our results are based on more complete light curves, whereas the previously published work had only one complete transit light curve. No significant anomalies in Transit Timing Variations (TTVs) are found, and we place upper mass limits on potential perturbers, largely supplanting the loose constraints provided by the extant RV data. The TTV limits are stronger near mean-motion resonances, especially for the low-order commensurabilities. We can exclude the existence of a perturber with mass larger than 0.6, 0.3, 0.5, 0.5, and 0.3 {M}\\oplus near the 1:3, 1:2, 2:3, 3:2, and 2:1 resonances, respectively.

  18. Variation in the timing of reproduction of the four-striped field mouse ...

    African Journals Online (AJOL)

    Variation in the timing of reproduction of the four-striped field mouse, Rhabdomys pumilio , in ... Open Access DOWNLOAD FULL TEXT ... We used the four-striped field mouse, Rhabdomys pumilio (Sparrmann, 1784), to test the hypothesis that ...

  19. Towards Uniform Accelerometry Analysis: A Standardization Methodology to Minimize Measurement Bias Due to Systematic Accelerometer Wear-Time Variation

    Directory of Open Access Journals (Sweden)

    Tarun R. Katapally, Nazeem Muhajarine

    2014-06-01

    Full Text Available Accelerometers are predominantly used to objectively measure the entire range of activity intensities – sedentary behaviour (SED, light physical activity (LPA and moderate to vigorous physical activity (MVPA. However, studies consistently report results without accounting for systematic accelerometer wear-time variation (within and between participants, jeopardizing the validity of these results. This study describes the development of a standardization methodology to understand and minimize measurement bias due to wear-time variation. Accelerometry is generally conducted over seven consecutive days, with participants' data being commonly considered 'valid' only if wear-time is at least 10 hours/day. However, even within ‘valid’ data, there could be systematic wear-time variation. To explore this variation, accelerometer data of Smart Cities, Healthy Kids study (www.smartcitieshealthykids.com were analyzed descriptively and with repeated measures multivariate analysis of variance (MANOVA. Subsequently, a standardization method was developed, where case-specific observed wear-time is controlled to an analyst specified time period. Next, case-specific accelerometer data are interpolated to this controlled wear-time to produce standardized variables. To understand discrepancies owing to wear-time variation, all analyses were conducted pre- and post-standardization. Descriptive analyses revealed systematic wear-time variation, both between and within participants. Pre- and post-standardized descriptive analyses of SED, LPA and MVPA revealed a persistent and often significant trend of wear-time’s influence on activity. SED was consistently higher on weekdays before standardization; however, this trend was reversed post-standardization. Even though MVPA was significantly higher on weekdays both pre- and post-standardization, the magnitude of this difference decreased post-standardization. Multivariable analyses with standardized SED, LPA and

  20. Novel crystal timing calibration method based on total variation

    Science.gov (United States)

    Yu, Xingjian; Isobe, Takashi; Watanabe, Mitsuo; Liu, Huafeng

    2016-11-01

    A novel crystal timing calibration method based on total variation (TV), abbreviated as ‘TV merge’, has been developed for a high-resolution positron emission tomography (PET) system. The proposed method was developed for a system with a large number of crystals, it can provide timing calibration at the crystal level. In the proposed method, the timing calibration process was formulated as a linear problem. To robustly optimize the timing resolution, a TV constraint was added to the linear equation. Moreover, to solve the computer memory problem associated with the calculation of the timing calibration factors for systems with a large number of crystals, the merge component was used for obtaining the crystal level timing calibration values. Compared with other conventional methods, the data measured from a standard cylindrical phantom filled with a radioisotope solution was sufficient for performing a high-precision crystal-level timing calibration. In this paper, both simulation and experimental studies were performed to demonstrate the effectiveness and robustness of the TV merge method. We compare the timing resolutions of a 22Na point source, which was located in the field of view (FOV) of the brain PET system, with various calibration techniques. After implementing the TV merge method, the timing resolution improved from 3.34 ns at full width at half maximum (FWHM) to 2.31 ns FWHM.

  1. Oscillation effects and time variation of the supernova neutrino signal

    Science.gov (United States)

    Kneller, James P.; McLaughlin, Gail C.; Brockman, Justin

    2008-02-01

    The neutrinos detected from the next galactic core-collapse supernova will contain valuable information on the internal dynamics of the explosion. One mechanism leading to a temporal evolution of the neutrino signal is the variation of the induced neutrino flavor mixing driven by changes in the density profile. With one and two-dimensional hydrodynamical simulations we identify the behavior and properties of prominent features of the explosion. Using these results we demonstrate the time variation of the neutrino crossing probabilities due to changes in the Mikheyev-Smirnov-Wolfenstein (MSW) neutrino transformations as the star explodes by using the S-matrix—Monte Carlo—approach to neutrino propagation. After adopting spectra for the neutrinos emitted from the proto-neutron star we calculate for a galactic supernova the evolution of the positron spectra within a water Cerenkov detector and find that this signal allows us to probe of a number of explosion features.

  2. Controlling cyclic combustion timing variations using a symbol-statistics predictive approach in an HCCI engine

    International Nuclear Information System (INIS)

    Ghazimirsaied, Ahmad; Koch, Charles Robert

    2012-01-01

    Highlights: ► Misfire reduction in a combustion engine based on chaotic theory methods. ► Chaotic theory analysis of cyclic variation of a HCCI engine near misfire. ► Symbol sequence approach is used to predict ignition timing one cycle-ahead. ► Prediction is combined with feedback control to lower HCCI combustion variation. ► Feedback control extends the HCCI operating range into the misfire region. -- Abstract: Cyclic variation of a Homogeneous Charge Compression Ignition (HCCI) engine near misfire is analyzed using chaotic theory methods and feedback control is used to stabilize high cyclic variations. Variation of consecutive cycles of θ Pmax (the crank angle of maximum cylinder pressure over an engine cycle) for a Primary Reference Fuel engine is analyzed near misfire operation for five test points with similar conditions but different octane numbers. The return map of the time series of θ Pmax at each combustion cycle reveals the deterministic and random portions of the dynamics near misfire for this HCCI engine. A symbol-statistic approach is used to predict θ Pmax one cycle-ahead. Predicted θ Pmax has similar dynamical behavior to the experimental measurements. Based on this cycle ahead prediction, and using fuel octane as the input, feedback control is used to stabilize the instability of θ Pmax variations at this engine condition near misfire.

  3. Storm time variation of radiative cooling of thermosphere by nitric oxide emission

    Science.gov (United States)

    Krishna, M. V. Sunil; Bag, Tikemani; Bharti, Gaurav

    2016-07-01

    The fundamental vibration-rotation band emission (Δν=1, Δ j=0,± 1) by nitric oxide (NO) at 5.3 µm is one of the most important cooling mechanisms in thermosphere. The collisional vibrational excitation of NO(ν=0) by impact with atomic oxygen is the main source of vibrationally excited nitric oxide. The variation of NO density depends on latitude, longitude and season. The present study aims to understand how the radiative flux gets influenced by the severe geomagnetic storm conditions. The variation of Nitric Oxide (NO) radiative flux exiting thermosphere is studied during the superstorm event of 7-12 November, 2004. The observations of TIMED/SABER suggest a strong anti-correlation with the O/N_2 ratio observed by GUVI during the same period. On a global scale the NO radiative flux showed an enhancement during the main phase on 8 November, 2004, whereas maximum depletion in O/N_2 is observed on 10 November, 2004. Both O/N_2 and NO radiative flux were found to propagate equatorward due to the effect of meridional wind resulting from joule and particle heating in polar region. Larger penetrations is observed in western longitude sectors. These observed variations are effectively connected to the variations in neutral densities. In the equatorial sectors, O/N_2 shows enhancement but almost no variation in radiative flux is observed. The possible reasons for the observed variations in NO radiative emission and O/N_2 ratios are discussed in the light of equator ward increase in the densities and prompt penetration.

  4. Simple model of variation of the signature of a space-time metric

    International Nuclear Information System (INIS)

    Konstantinov, M.Yu.

    2004-01-01

    The problem on the changes in the space-time signature metrics is discussed. The simple model, wherein the space-time metrics signature is determined by the nonlinear scalar field, is proposed. It is shown that both classical and quantum description of changes in the metrics signature is possible within the frames of the considered model; the most characteristic peculiarities and variations of the classical and quantum descriptions are also briefly noted [ru

  5. Time Variations of Macrostickies and Extractable Stickies Concentrations in Deinking

    OpenAIRE

    MacNeil, Donald; Miranda Carreño, Rubén; Monte Lara, María Concepción; Blanco Suárez, Ángeles; Sundberg, Anna

    2010-01-01

    The stickies content, both macrostickies and stickies extractable in a solvent, was determined for samples taken at short time intervals from deinking lines, producing deinked pulp for newsprint production. The study was carried out at three mills on different continents, with each having a different source of recycled paper as raw material. The short-term variations in extractable stickies in the incoming raw material were quite extreme, with differences of 100% being seen within hours. Desp...

  6. Time variations of macro and extractable stickies concentrations in deinking

    OpenAIRE

    McNeil, Donald; Miranda Carreño, Rubén; Concepción Lara, María Concepción; Blanco Suárez, Ángeles; Sundberg, Anna

    2010-01-01

    The stickies content, both macrostickies and stickies extractable in a solvent, was determined for samples taken at short time intervals from deinking lines producing deinked pulp for newsprint production. The study was carried out at three mills on different continents, with each having a different source of recycled paper as raw material. The short-term variations in extractable stickies in the incoming raw material were quite extreme, with differences of 100% being seen within hours. Despi...

  7. Time variations of the angular momentum of the sun

    International Nuclear Information System (INIS)

    Schatten, K.H.

    1977-01-01

    Time variations of density models of the Sun are investigated. This is an attempt to estimate the changing moment of inertia of the Sun in order to calculate the internal solar angular velocity based upon Newton's equation of motion. Previous estimates of dI/dt disagree with those based upon central densities in a homologously contracting model. It is shown that the homologously contracting model leads to large errors in dI/dt. Based upon an integration of Sears's solar model, dI/dt=-5.5 x 10 34 gm cm 2 s -1 . This suggests a core angular velocity of /sub thetar-italic/ = (0.15 +- 0.03) x 10 -3 s -1 , corresponding to a period of 0.5 +- 0.1 days, assuming a constant angular velocity with time. The brackets indicate a weighting which is discussed

  8. Variation in aluminium patch test reactivity over time.

    Science.gov (United States)

    Siemund, Ingrid; Mowitz, Martin; Zimerson, Erik; Bruze, Magnus; Hindsén, Monica

    2017-11-01

    Contact allergy to aluminium has been reported more frequently in recent years. It has been pointed out that positive patch test reactions to aluminium may not be reproducible on retesting. To investigate possible variations in patch test reactivity to aluminium over time. Twenty-one adults, who had previously reacted positively to aluminium, were patch tested with equimolar dilution series in pet. of aluminium chloride hexahydrate and aluminium lactate, four times over a period of 8 months. Thirty-six of 84 (43%) serial dilution tests with aluminium chloride hexahydrate and 49 of 84 (58%) serial dilution tests with aluminium lactate gave negative results. The range of reactivity varied between a negative reaction to aluminium chloride hexahydrate at 10% and/or to aluminium lactate at 12%, and a positive reaction to aluminium chloride hexahydrate at 0.1% and/or to aluminium lactate at 0.12%. The highest individual difference in test reactivity noticed was 320-fold when the two most divergent minimal eliciting concentrations were compared. The patch test reactivity to aluminium varies over time. Aluminium-allergic individuals may have false-negative reactions. Therefore, retesting with aluminium should be considered when there is a strong suspicion of aluminium contact allergy. © 2017 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  9. Solvent effects in time-dependent self-consistent field methods. II. Variational formulations and analytical gradients

    International Nuclear Information System (INIS)

    Bjorgaard, J. A.; Velizhanin, K. A.; Tretiak, S.

    2015-01-01

    This study describes variational energy expressions and analytical excited state energy gradients for time-dependent self-consistent field methods with polarizable solvent effects. Linear response, vertical excitation, and state-specific solventmodels are examined. Enforcing a variational ground stateenergy expression in the state-specific model is found to reduce it to the vertical excitation model. Variational excited state energy expressions are then provided for the linear response and vertical excitation models and analytical gradients are formulated. Using semiempiricalmodel chemistry, the variational expressions are verified by numerical and analytical differentiation with respect to a static external electric field. Lastly, analytical gradients are further tested by performing microcanonical excited state molecular dynamics with p-nitroaniline

  10. Temporal and spatial variations of travel-time residuals in central California for Novaya Zemlya events

    International Nuclear Information System (INIS)

    Robinson, R.; Iyer, H.M.

    1976-01-01

    Eight large nuclear explosions in Novaya Zemlya from October 1969 through November 1974 were used to monitor long-term variations in crustal seismic velocity near the San Andreas fault in central California. Relative P-wave travel-time residuals appear to be accurate to approximately +-0.1 sec. Of the over 100 stations used, none show clearly significant temporal variations in residual greater than this amount, corresponding to about a 4 percent change in velocity in the upper crust. Average relative residuals at individual stations show a large spatial variation of about 1.5 sec. These variations reflect both a complex crustal geology and changes in crustal thickness and provide a potentially powerful tool for studying crustal structure

  11. TRANSIT TIMING OBSERVATIONS FROM KEPLER. II. CONFIRMATION OF TWO MULTIPLANET SYSTEMS VIA A NON-PARAMETRIC CORRELATION ANALYSIS

    International Nuclear Information System (INIS)

    Ford, Eric B.; Moorhead, Althea V.; Morehead, Robert C.; Fabrycky, Daniel C.; Steffen, Jason H.; Carter, Joshua A.; Fressin, Francois; Holman, Matthew J.; Ragozzine, Darin; Charbonneau, David; Lissauer, Jack J.; Rowe, Jason F.; Borucki, William J.; Bryson, Stephen T.; Burke, Christopher J.; Caldwell, Douglas A.; Welsh, William F.; Allen, Christopher; Batalha, Natalie M.; Buchhave, Lars A.

    2012-01-01

    We present a new method for confirming transiting planets based on the combination of transit timing variations (TTVs) and dynamical stability. Correlated TTVs provide evidence that the pair of bodies is in the same physical system. Orbital stability provides upper limits for the masses of the transiting companions that are in the planetary regime. This paper describes a non-parametric technique for quantifying the statistical significance of TTVs based on the correlation of two TTV data sets. We apply this method to an analysis of the TTVs of two stars with multiple transiting planet candidates identified by Kepler. We confirm four transiting planets in two multiple-planet systems based on their TTVs and the constraints imposed by dynamical stability. An additional three candidates in these same systems are not confirmed as planets, but are likely to be validated as real planets once further observations and analyses are possible. If all were confirmed, these systems would be near 4:6:9 and 2:4:6:9 period commensurabilities. Our results demonstrate that TTVs provide a powerful tool for confirming transiting planets, including low-mass planets and planets around faint stars for which Doppler follow-up is not practical with existing facilities. Continued Kepler observations will dramatically improve the constraints on the planet masses and orbits and provide sensitivity for detecting additional non-transiting planets. If Kepler observations were extended to eight years, then a similar analysis could likely confirm systems with multiple closely spaced, small transiting planets in or near the habitable zone of solar-type stars.

  12. TRANSIT TIMING OBSERVATIONS FROM KEPLER. II. CONFIRMATION OF TWO MULTIPLANET SYSTEMS VIA A NON-PARAMETRIC CORRELATION ANALYSIS

    Energy Technology Data Exchange (ETDEWEB)

    Ford, Eric B.; Moorhead, Althea V.; Morehead, Robert C. [Astronomy Department, University of Florida, 211 Bryant Space Sciences Center, Gainesville, FL 32611 (United States); Fabrycky, Daniel C. [UCO/Lick Observatory, University of California, Santa Cruz, CA 95064 (United States); Steffen, Jason H. [Fermilab Center for Particle Astrophysics, P.O. Box 500, MS 127, Batavia, IL 60510 (United States); Carter, Joshua A.; Fressin, Francois; Holman, Matthew J.; Ragozzine, Darin; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, MA 02138 (United States); Lissauer, Jack J.; Rowe, Jason F.; Borucki, William J.; Bryson, Stephen T.; Burke, Christopher J.; Caldwell, Douglas A. [NASA Ames Research Center, Moffett Field, CA 94035 (United States); Welsh, William F. [Astronomy Department, San Diego State University, San Diego, CA 92182-1221 (United States); Allen, Christopher [Orbital Sciences Corporation/NASA Ames Research Center, Moffett Field, CA 94035 (United States); Batalha, Natalie M. [Department of Physics and Astronomy, San Jose State University, San Jose, CA 95192 (United States); Buchhave, Lars A., E-mail: eford@astro.ufl.edu [Niels Bohr Institute, Copenhagen University, DK-2100 Copenhagen (Denmark); Collaboration: Kepler Science Team; and others

    2012-05-10

    We present a new method for confirming transiting planets based on the combination of transit timing variations (TTVs) and dynamical stability. Correlated TTVs provide evidence that the pair of bodies is in the same physical system. Orbital stability provides upper limits for the masses of the transiting companions that are in the planetary regime. This paper describes a non-parametric technique for quantifying the statistical significance of TTVs based on the correlation of two TTV data sets. We apply this method to an analysis of the TTVs of two stars with multiple transiting planet candidates identified by Kepler. We confirm four transiting planets in two multiple-planet systems based on their TTVs and the constraints imposed by dynamical stability. An additional three candidates in these same systems are not confirmed as planets, but are likely to be validated as real planets once further observations and analyses are possible. If all were confirmed, these systems would be near 4:6:9 and 2:4:6:9 period commensurabilities. Our results demonstrate that TTVs provide a powerful tool for confirming transiting planets, including low-mass planets and planets around faint stars for which Doppler follow-up is not practical with existing facilities. Continued Kepler observations will dramatically improve the constraints on the planet masses and orbits and provide sensitivity for detecting additional non-transiting planets. If Kepler observations were extended to eight years, then a similar analysis could likely confirm systems with multiple closely spaced, small transiting planets in or near the habitable zone of solar-type stars.

  13. SYSTEMATIC CENTER-TO-LIMB VARIATION IN MEASURED HELIOSEISMIC TRAVEL TIMES AND ITS EFFECT ON INFERENCES OF SOLAR INTERIOR MERIDIONAL FLOWS

    Energy Technology Data Exchange (ETDEWEB)

    Zhao Junwei; Nagashima, Kaori; Bogart, R. S.; Kosovichev, A. G. [W. W. Hansen Experimental Physics Laboratory, Stanford University, Stanford, CA 94305-4085 (United States); Duvall, T. L. Jr. [Solar Physics Laboratory, NASA Goddard Space Flight Center, Greenbelt, MD 20771 (United States)

    2012-04-10

    We report on a systematic center-to-limb variation in measured helioseismic travel times, which must be taken into account for an accurate determination of solar interior meridional flows. The systematic variation, found in time-distance helioseismology analysis using SDO/HMI and SDO/AIA observations, is different in both travel-time magnitude and variation trend for different observables. It is not clear what causes this systematic effect. Subtracting the longitude-dependent east-west travel times, obtained along the equatorial area, from the latitude-dependent north-south travel times, obtained along the central meridian area, gives remarkably similar results for different observables. We suggest this as an effective procedure for removing the systematic center-to-limb variation. The subsurface meridional flows obtained from inversion of the corrected travel times are approximately 10 m s{sup -1} slower than those obtained without removing the systematic effect. The detected center-to-limb variation may have important implications in the derivation of meridional flows in the deep interior and needs to be better understood.

  14. SYSTEMATIC CENTER-TO-LIMB VARIATION IN MEASURED HELIOSEISMIC TRAVEL TIMES AND ITS EFFECT ON INFERENCES OF SOLAR INTERIOR MERIDIONAL FLOWS

    International Nuclear Information System (INIS)

    Zhao Junwei; Nagashima, Kaori; Bogart, R. S.; Kosovichev, A. G.; Duvall, T. L. Jr.

    2012-01-01

    We report on a systematic center-to-limb variation in measured helioseismic travel times, which must be taken into account for an accurate determination of solar interior meridional flows. The systematic variation, found in time-distance helioseismology analysis using SDO/HMI and SDO/AIA observations, is different in both travel-time magnitude and variation trend for different observables. It is not clear what causes this systematic effect. Subtracting the longitude-dependent east-west travel times, obtained along the equatorial area, from the latitude-dependent north-south travel times, obtained along the central meridian area, gives remarkably similar results for different observables. We suggest this as an effective procedure for removing the systematic center-to-limb variation. The subsurface meridional flows obtained from inversion of the corrected travel times are approximately 10 m s –1 slower than those obtained without removing the systematic effect. The detected center-to-limb variation may have important implications in the derivation of meridional flows in the deep interior and needs to be better understood.

  15. Systematic Center-To-Limb Variation in Measured Helioseismic Travel Times and Its Effect on Inferences of Solar Interior Meridional Flows

    Science.gov (United States)

    Zhao, Junwei; Nagashima, Kaori; Bogart, R. S.; Kosovichev, Alexander; Duvall, T. L., Jr.

    2012-01-01

    We report on a systematic center-to-limb variation in measured helioseismic travel times, which must be taken into account for an accurate determination of solar interior meridional flows. The systematic variation, found in time-distance helioseismology analysis using SDO/HMI and SDO/AIA observations, is different in both travel-time magnitude and variation trend for different observables. It is not clear what causes this systematic effect. Subtracting the longitude-dependent east-west travel times, obtained along the equatorial area, from the latitude-dependent north-south travel times, obtained along the central meridian area, gives remarkably similar results for different observables. We suggest this as an effective procedure for removing the systematic center-to-limb variation. The subsurface meridional flows obtained from inversion of the corrected travel times are approximately 10 m s-1 slower than those obtained without removing the systematic effect. The detected center-to-limb variation may have important implications in the derivation of meridional flows in the deep interior and needs to be better understood.

  16. New constraints on time-dependent variations of fundamental constants using Planck data

    Science.gov (United States)

    Hart, Luke; Chluba, Jens

    2018-02-01

    Observations of the cosmic microwave background (CMB) today allow us to answer detailed questions about the properties of our Universe, targeting both standard and non-standard physics. In this paper, we study the effects of varying fundamental constants (i.e. the fine-structure constant, αEM, and electron rest mass, me) around last scattering using the recombination codes COSMOREC and RECFAST++. We approach the problem in a pedagogical manner, illustrating the importance of various effects on the free electron fraction, Thomson visibility function and CMB power spectra, highlighting various degeneracies. We demonstrate that the simpler RECFAST++ treatment (based on a three-level atom approach) can be used to accurately represent the full computation of COSMOREC. We also include explicit time-dependent variations using a phenomenological power-law description. We reproduce previous Planck 2013 results in our analysis. Assuming constant variations relative to the standard values, we find the improved constraints αEM/αEM, 0 = 0.9993 ± 0.0025 (CMB only) and me/me, 0 = 1.0039 ± 0.0074 (including BAO) using Planck 2015 data. For a redshift-dependent variation, αEM(z) = αEM(z0) [(1 + z)/1100]p with αEM(z0) ≡ αEM, 0 at z0 = 1100, we obtain p = 0.0008 ± 0.0025. Allowing simultaneous variations of αEM(z0) and p yields αEM(z0)/αEM, 0 = 0.9998 ± 0.0036 and p = 0.0006 ± 0.0036. We also discuss combined limits on αEM and me. Our analysis shows that existing data are not only sensitive to the value of the fundamental constants around recombination but also its first time derivative. This suggests that a wider class of varying fundamental constant models can be probed using the CMB.

  17. Benchmarking the stochastic time-dependent variational approach for excitation dynamics in molecular aggregates

    Energy Technology Data Exchange (ETDEWEB)

    Chorošajev, Vladimir [Department of Theoretical Physics, Faculty of Physics, Vilnius University, Sauletekio 9-III, 10222 Vilnius (Lithuania); Gelzinis, Andrius; Valkunas, Leonas [Department of Theoretical Physics, Faculty of Physics, Vilnius University, Sauletekio 9-III, 10222 Vilnius (Lithuania); Department of Molecular Compound Physics, Center for Physical Sciences and Technology, Sauletekio 3, 10222 Vilnius (Lithuania); Abramavicius, Darius, E-mail: darius.abramavicius@ff.vu.lt [Department of Theoretical Physics, Faculty of Physics, Vilnius University, Sauletekio 9-III, 10222 Vilnius (Lithuania)

    2016-12-20

    Highlights: • The Davydov ansatze can be used for finite temperature simulations with an extension. • The accuracy is high if the system is strongly coupled to the environmental phonons. • The approach can simulate time-resolved fluorescence spectra. - Abstract: Time dependent variational approach is a convenient method to characterize the excitation dynamics in molecular aggregates for different strengths of system-bath interaction a, which does not require any additional perturbative schemes. Until recently, however, this method was only applicable in zero temperature case. It has become possible to extend this method for finite temperatures with the introduction of stochastic time dependent variational approach. Here we present a comparison between this approach and the exact hierarchical equations of motion approach for describing excitation dynamics in a broad range of temperatures. We calculate electronic population evolution, absorption and auxiliary time resolved fluorescence spectra in different regimes and find that the stochastic approach shows excellent agreement with the exact approach when the system-bath coupling is sufficiently large and temperatures are high. The differences between the two methods are larger, when temperatures are lower or the system-bath coupling is small.

  18. Variation in computer time with geometry prescription in monte carlo code KENO-IV

    International Nuclear Information System (INIS)

    Gopalakrishnan, C.R.

    1988-01-01

    In most studies, the Monte Carlo criticality code KENO-IV has been compared with other Monte Carlo codes, but evaluation of its performance with different box descriptions has not been done so far. In Monte Carlo computations, any fractional savings of computing time is highly desirable. Variation in computation time with box description in KENO for two different fast reactor fuel subassemblies of FBTR and PFBR is studied. The K eff of an infinite array of fuel subassemblies is calculated by modelling the subassemblies in two different ways (i) multi-region, (ii) multi-box. In addition to these two cases, excess reactivity calculations of FBTR are also performed in two ways to study this effect in a complex geometry. It is observed that the K eff values calculated by multi-region and multi-box models agree very well. However the increase in computation time from the multi-box to the multi-region is considerable, while the difference in computer storage requirements for the two models is negligible. This variation in computing time arises from the way the neutron is tracked in the two cases. (author)

  19. Dynamics of the sub-Ohmic spin-boson model: A time-dependent variational study

    International Nuclear Information System (INIS)

    Wu Ning; Duan Liwei; Zhao Yang; Li Xin

    2013-01-01

    The Dirac-Frenkel time-dependent variation is employed to probe the dynamics of the zero temperature sub-Ohmic spin-boson model with strong friction utilizing the Davydov D 1 ansatz. It is shown that initial conditions of the phonon bath have considerable influence on the dynamics. Counterintuitively, even in the very strong coupling regime, quantum coherence features still manage to survive under the polarized bath initial condition, while such features are absent under the factorized bath initial condition. In addition, a coherent-incoherent transition is found at a critical coupling strength α≈ 0.1 for s= 0.25 under the factorized bath initial condition. We quantify how faithfully our ansatz follows the Schrödinger equation, finding that the time-dependent variational approach is robust for strong dissipation and deep sub-Ohmic baths (s≪ 1).

  20. Study of time variation of terrestrial gamma radiation due to depth distribution of soil moisture content

    International Nuclear Information System (INIS)

    Yoshioka, Katsuhiro

    1994-01-01

    An empirical equation was deduced from studies of time variations of terrestrial gamma exposure rate and soil moisture content with depth distribution in the surface layer. It was definitely suggested that the variation of terrestrial gamma exposure rate is most strongly influenced by the change of soil moisture content at 5 cm depth. The seasonal variation with a relative maximum in early autumn and a relative minimum in early spring was clearly obtained in the consequence of long time measurements of terrestrial gamma exposure rate and degree of soil dryness. The diurnal change and phase difference due to the effect of depth were also obtained in the dynamic characteristics of soil moisture content at 3 different depths. From the comparison between measured terrestrial gamma exposure rate and that evaluated from soil moisture content using the empirical equation, it was seen that seasonal variations of the both agreed fairly well as a whole. (author)

  1. Co-gradient variation in growth rate and development time of a broadly distributed butterfly.

    Directory of Open Access Journals (Sweden)

    Madeleine Barton

    Full Text Available Widespread species often show geographic variation in thermally-sensitive traits, providing insight into how species respond to shifts in temperature through time. Such patterns may arise from phenotypic plasticity, genetic adaptation, or their interaction. In some cases, the effects of genotype and temperature may act together to reduce, or to exacerbate, phenotypic variation in fitness-related traits across varying thermal environments. We find evidence for such interactions in life-history traits of Heteronympha merope, a butterfly distributed across a broad latitudinal gradient in south-eastern Australia. We show that body size in this butterfly is negatively related to developmental temperature in the laboratory, in accordance with the temperature-size rule, but not in the field, despite very strong temperature gradients. A common garden experiment on larval thermal responses, spanning the environmental extremes of H. merope's distribution, revealed that butterflies from low latitude (warmer climate populations have relatively fast intrinsic growth and development rates compared to those from cooler climates. These synergistic effects of genotype and temperature across the landscape (co-gradient variation are likely to accentuate phenotypic variation in these traits, and this interaction must be accounted for when predicting how H. merope will respond to temperature change through time. These results highlight the importance of understanding how variation in life-history traits may arise in response to environmental change. Without this knowledge, we may fail to detect whether organisms are tracking environmental change, and if they are, whether it is by plasticity, adaptation or both.

  2. Temporal variation in bat-fruit interactions: Foraging strategies influence network structure over time

    Science.gov (United States)

    Zapata-Mesa, Natalya; Montoya-Bustamante, Sebastián; Murillo-García, Oscar E.

    2017-11-01

    Mutualistic interactions, such as seed dispersal, are important for the maintenance of structure and stability of tropical communities. However, there is a lack of information about spatial and temporal variation in plant-animal interaction networks. Thus, our goal was to assess the effect of bat's foraging strategies on temporal variation in the structure and robustness of bat-fruit networks in both a dry and a rain tropical forest. We evaluated monthly variation in bat-fruit networks by using seven structure metrics: network size, average path length, nestedness, modularity, complementary specialization, normalized degree and betweenness centrality. Seed dispersal networks showed variations in size, species composition and modularity; did not present nested structures and their complementary specialization was high compared to other studies. Both networks presented short path lengths, and a constantly high robustness, despite their monthly variations. Sedentary bat species were recorded during all the study periods and occupied more central positions than nomadic species. We conclude that foraging strategies are important structuring factors that affect the dynamic of networks by determining the functional roles of frugivorous bats over time; thus sedentary bats are more important than nomadic species for the maintenance of the network structure, and their conservation is a must.

  3. On time variation of fundamental constants in superstring theories

    International Nuclear Information System (INIS)

    Maeda, K.I.

    1988-01-01

    Assuming the action from the string theory and taking into account the dynamical freedom of a dilaton and its coupling to matter fluid, the authors show that fundamental 'constants' in string theories are independent of the 'radius' of the internal space. Since the scalar related to the 'constants' is coupled to the 4-dimensional gravity and matter fluid in the same way as in the Jordan-Brans Dicke theory with ω = -1, it must be massive and can get a mass easily through some symmetry breaking mechanism (e.g. the SUSY breaking due to a gluino condensation). Consequently, time variation of fundamental constants is too small to be observed

  4. Human leukocyte antigen-e alleles are associated with hepatitis c virus, torque teno virus, and toxoplasma co-infections but are not associated with hepatitis b virus, hepatitis d virus, and GB virus c co-infections in human immunodeficiency virus patients

    Directory of Open Access Journals (Sweden)

    Afiono Agung Prasetyo

    2016-01-01

    Full Text Available Context: Data regarding the distribution of Human Leukocyte Antigen (HLA-E alleles and their association with blood-borne pathogen infections/co-infections are limited for many populations, including Indonesia. Aims: The aim of this study was to analyze the association between HLA-E allelic variants and infection with blood-borne pathogens such as hepatitis B virus (HBV, hepatitis C virus (HCV, hepatitis D virus (HDV, torque teno virus (TTV, GB virus C (GBV-C, and Toxoplasma gondii (T. gondii in Indonesian Javanese human immunodeficiency virus (HIV patients. Settings and Design: A total of 320 anti-HIV-positive blood samples were analyzed for HBV, HCV, HDV, TTV, GBV-C, and T. gondii infection status and its association with HLA-E allelic variants. Materials and Methods: Nucleic acid was extracted from plasma samples and used for the molecular detection of HBV DNA, HCV RNA, HDV RNA, TTV DNA, and GBV-C RNA, whereas hepatitis B surface antigen, anti-HCV, immunoglobulin M and G (IgM and IgG anti-T. gondii were detected through serological testing. The blood samples were genotyped for HLA-E loci using a sequence-specific primer-polymerase chain reaction. Statistical Analysis Used: Either the Chi-square or Fisher′s exact test was performed to analyze the frequency of HLA-E alleles and blood-borne pathogen infections in the population. Odds ratios (ORs were calculated to measure the association between the antibodies found and the participants′ possible risk behaviors. A logistic regression analysis was used to assess the associations. Results: HLA-EFNx010101/0101 was associated with HCV/TTV co-infection (adjusted OR [aOR]: 3.5; 95% confidence interval [CI]: 1.156-10.734; P = 0.027 and IgM/IgG anti-Toxo positivity (aOR: 27.0; 95% CI: 3.626-200.472; P = 0.001. HLA-EFNx010103/0103 was associated with TTV co-infection (aOR: 2.7; 95% CI: 1.509-4.796; P = 0.001. Conclusions: HLA-E alleles in Indonesian Javanese HIV patients were found to be associated

  5. Time series of low-degree geopotential coefficients from SLR data: estimation of Earth's figure axis and LOD variations

    Science.gov (United States)

    Luceri, V.; Sciarretta, C.; Bianco, G.

    2012-12-01

    The redistribution of the mass within the earth system induces changes in the Earth's gravity field. In particular, the second-degree geopotential coefficients reflect the behaviour of the Earth's inertia tensor of order 2, describing the main mass variations of our planet impacting the EOPs. Thanks to the long record of accurate and continuous laser ranging observations to Lageos and other geodetic satellites, SLR is the only current space technique capable to monitor the long time variability of the Earth's gravity field with adequate accuracy. Time series of low-degree geopotential coefficients are estimated with our analysis of SLR data (spanning more than 25 years) from several geodetic satellites in order to detect trends and periodic variations related to tidal effects and atmospheric/oceanic mass variations. This study is focused on the variations of the second-degree Stokes coefficients related to the Earth's principal figure axis and oblateness: C21, S21 and C20. On the other hand, surface mass load variations induce excitations in the EOPs that are proportional to the same second-degree coefficients. The time series of direct estimates of low degree geopotential and those derived from the EOP excitation functions are compared and presented together with their time and frequency analysis.

  6. Limits On Undetected Planets in the Six Transiting Planets Kepler-11 System

    Science.gov (United States)

    Lissauer, Jack

    2017-01-01

    The Kepler-11 has five inner planets ranging from approx. 2 - 1 times as massive Earth in a tightly-packed configuration, with orbital periods between 10 and 47 days. A sixth planet, Kepler-11 g, with a period of118 days, is also observed. The spacing between planets Kepler-11 f and Kepler-11 g is wide enough to allow room for a planet to orbit stably between them. We compare six and seven planet fits to measured transit timing variations (TTVs) of the six known planets. We find that in most cases an additional planet between Kepler-11 f and Kepler-11 g degrades rather than enhances the fit to the TTV data, and where the fit is improved, the improvement provides no significant evidence of a planet between Kepler-11 f and Kepler-11 g. This implies that any planet in this region must be low in mass. We also provide constraints on undiscovered planets orbiting exterior to Kepler-11 g. representations will be described.

  7. The K2-138 System: A Near-resonant Chain of Five Sub-Neptune Planets Discovered by Citizen Scientists

    DEFF Research Database (Denmark)

    Christiansen, Jessie L.; Crossfield, Ian J. M.; Barentsen, Geert

    2018-01-01

    K2-138 is a moderately bright (V = 12.2, K = 10.3) main-sequence K star observed in Campaign 12 of the NASA K2 mission. It hosts five small (1.6-3.3 R⊕) transiting planets in a compact architecture. The periods of the five planets are 2.35, 3.56, 5.40, 8.26, and 12.76 days, forming an unbroken...... chain of near 3:2 resonances. Although we do not detect the predicted 2-5 minute transit timing variations (TTVs) with the K2 timing precision, they may be observable by higher-cadence observations with, for example, Spitzer or CHEOPS. The planets are amenable to mass measurement by precision radial...... velocity measurements, and therefore K2-138 could represent a new benchmark system for comparing radial velocity and TTV masses. K2-138 is the first exoplanet discovery by citizen scientists participating in the Exoplanet Explorers project on the Zooniverse platform....

  8. Age-related differences in the neural correlates of trial-to-trial variations of reaction time

    Directory of Open Access Journals (Sweden)

    Nancy E. Adleman

    2016-06-01

    Full Text Available Intra-subject variation in reaction time (ISVRT is a developmentally-important phenomenon that decreases from childhood through young adulthood in parallel with the development of executive functions and networks. Prior work has shown a significant association between trial-by-trial variations in reaction time (RT and trial-by-trial variations in brain activity as measured by the blood-oxygenated level-dependent (BOLD response in functional magnetic resonance imaging (fMRI studies. It remains unclear, however, whether such “RT-BOLD” relationships vary with age. Here, we determined whether such trial-by-trial relationships vary with age in a cross-sectional design. We observed an association between age and RT-BOLD relationships in 11 clusters located in visual/occipital regions, frontal and parietal association cortex, precentral/postcentral gyrus, and thalamus. Some of these relationships were negative, reflecting increased BOLD associated with decreased RT, manifesting around the time of stimulus presentation and positive several seconds later. Critically for present purposes, all RT-BOLD relationships increased with age. Thus, RT-BOLD relationships may reflect robust, measurable changes in the brain-behavior relationship across development.

  9. Is there a time trend in medical practice variations?: a review of the literature and an critical analysis of theoretical approaches.

    NARCIS (Netherlands)

    Groenewegen, P.P.; Westert, G.P.

    2004-01-01

    The aim of this study was to review the research evidence for a decreasing time trend in medical practice variation and to contribute to our theoretical understanding of trends in medical practice variations. We searched Pubmed for articles reporting on time trends in medical practice variations.

  10. SU-E-T-326: The Oxygen Saturation (SO2) and Breath-Holding Time Variation Applied Active Breathing Control (ABC)

    Energy Technology Data Exchange (ETDEWEB)

    Gong, G; Yin, Y [Shandong Cancer Hospital, Jinan, Shandong (China)

    2014-06-01

    Purpose: To study the oxygen saturation (SO2) and breath-holding time variation applied active breathing control (ABC) in radiotherapy of tumor. Methods: 24 volunteers were involved in our trials, and they all did breath-holding motion assisted by ELEKTA Active Breathing Coordinator 2.0 for 10 times respectively. And the patient monitor was used to observe the oxygen saturation (SO2) variation. The variation of SO2, and length of breath-holding time and the time for recovering to the initial value of SO2 were recorded and analyzed. Results: (1) The volunteers were divided into two groups according to the SO2 variation in breath-holding: A group, 14 cases whose SO2 reduction were more than 2% (initial value was 97% to 99%, while termination value was 91% to 96%); B group, 10 cases were less than 2% in breath-holding without inhaling oxygen. (2) The interfraction breath holding time varied from 8 to 20s for A group compared to the first breath-holding time, and for B group varied from 4 to 14s. (3) The breathing holding time of B group prolonged mean 8s, compared to A group. (4) The time for restoring to the initial value of SO2 was from 10s to 30s. And the breath-holding time shortened obviously for patients whose SO2 did not recover to normal. Conclusion: It is very obvious that the SO2 reduction in breath-holding associated with ABC for partial people. It is necessary to check the SO2 variation in breath training, and enough time should be given to recover SO2.

  11. Fusion-Expressed CTB Improves Both Systemic and Mucosal T-Cell Responses Elicited by an Intranasal DNA Priming/Intramuscular Recombinant Vaccinia Boosting Regimen

    Directory of Open Access Journals (Sweden)

    Sugan Qiu

    2014-01-01

    Full Text Available Previous study showed that CTB (Cholera toxin subunit B can be used as a genetic adjuvant to enhance the systemic immune responses. To further investigate whether it can also be used as a genetic adjuvant to improve mucosal immune responses, we constructed DNA and recombinant Tiantan vaccinia (rTTV vaccines expressing OVA-CTB fusion antigen. Female C57BL/6 mice were immunized with an intranasal DNA priming/intramuscular rTTV boosting regimen. OVA specific T-cell responses were measured by IFN-γ ELISPOT and specific antibody responses were determined by ELISA. Compared to the nonadjuvant group (pSV-OVA intranasal priming/rTTV-OVA intramuscular boosting, pSV-OVA-CTB intranasal priming/rTTV-OVA-CTB intramuscular boosting group significantly improved the magnitudes of T-cell responses at spleen (1562±567 SFCs/106 splenocytes versus 330±182 SFCs/106 splenocytes, P<0.01, mesenteric LN (96±83 SFCs/106 lymphocytes versus 1±2 SFCs/106 lymphocytes, P<0.05, draining LNs of respiratory tract (109±60 SFCs/106 lymphocytes versus 2±2 SFCs/106 lymphocytes, P<0.01 and female genital tract (89±48 SFCs/106 lymphocytes versus 23±21 SFCs/106 lymphocytes, P<0.01. These results collectively demonstrated that fusion-expressed CTB could act as a potent adjuvant to improve both systemic and mucosal T-cell responses.

  12. Modeling of electron time variations in the radiation belts

    International Nuclear Information System (INIS)

    Chan, K.W.; Teague, M.J.; Schofield, N.J.; Vette, J.I.

    1979-01-01

    A review of the temporal variation in the trapped electron population of the inner and outer radiation zones is presented. Techniques presently used for modeling these zones are discussed and their deficiencies identified. An intermediate region is indicated between the zones in which the present modeling techniques are inadequate due to the magnitude and frequency of magnetic storms. Future trends are examined, and it is suggested that modeling of individual magnetic storms may be required in certain L bands. An analysis of seven magnetic storms is presented, establishing the independence of the depletion time of the storm flux and the storm magnitude. Provisional correlation between the storm magnitude and the Dst index is demonstrated

  13. Temperature and time variations during osteotomies performed with different piezosurgical devices: an in vitro study.

    Science.gov (United States)

    Delgado-Ruiz, R A; Sacks, D; Palermo, A; Calvo-Guirado, J L; Perez-Albacete, C; Romanos, G E

    2016-09-01

    The aim of this experimental in vitro study was to evaluate the effects of the piezoelectric device in temperature and time variations in standardized osteotomies performed with similar tip inserts in bovine bone blocks. Two different piezosurgical devices were used the OE-F15(®) (Osada Inc., Los Angeles, California, USA) and the Surgybone(®) (Silfradent Inc., Sofia, Forli Cesena, Italy). Serrated inserts with similar geometry were coupled with each device (ST94 insert/test A and P0700 insert/test B). Osteotomies 10 mm long and 3 mm deep were performed in bone blocks resembling type II (dense) and type IV (soft) bone densities with and without irrigation. Thermal changes and time variations were recorded. The effects of bone density, irrigation, and device on temperature changes and time necessary to accomplish the osteotomies were analyzed. Thermal analysis showed significant higher temperatures during piezosurgery osteotomies in hard bone without irrigation (P  0.05). Time analysis showed that the mean time values necessary to perform osteotomies were shorter in soft bone than in dense bone (P piezosurgery osteotomies in dense bone without irrigation; the time to perform the osteotomy with piezosurgery is shorter in soft bone compared to hard bone; and the piezosurgical device have a minimal influence in the temperature and time variations when a similar tip design is used during piezosurgery osteotomies. © 2015 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.

  14. A Discrete-Time Model for Daily S&P500 Returns and Realized Variations: Jumps and Leverage Effects

    DEFF Research Database (Denmark)

    Bollerslev, Tim; Kretschmer, Uta; Pigorsch, Christian

    We develop an empirically highly accurate discrete-time daily stochastic volatility model that explicitly distinguishes between the jump and continuoustime components of price movements using nonparametric realized variation and Bipower variation measures constructed from high-frequency intraday...... dependencies inherent in the high-frequency intraday data....

  15. Removing tidal-period variations from time-series data using low-pass digital filters

    Science.gov (United States)

    Walters, Roy A.; Heston, Cynthia

    1982-01-01

    Several low-pass, digital filters are examined for their ability to remove tidal Period Variations from a time-series of water surface elevation for San Francisco Bay. The most efficient filter is the one which is applied to the Fourier coefficients of the transformed data, and the filtered data recovered through an inverse transform. The ability of the filters to remove the tidal components increased in the following order: 1) cosine-Lanczos filter, 2) cosine-Lanczos squared filter; 3) Godin filter; and 4) a transform fitter. The Godin fitter is not sufficiently sharp to prevent severe attenuation of 2–3 day variations in surface elevation resulting from weather events.

  16. TIME VARIATION OF AV AND RV FOR TYPE Ia SUPERNOVAE BEHIND INTERSTELLAR DUST

    Science.gov (United States)

    Huang, Xiaosheng; Biederman, M.; Herger, B.; Aldering, G. S.

    2014-01-01

    TIME VARIATION OF AV AND RV FOR TYPE Ia SUPERNOVAE BEHIND NON-UNIFORM INTERSTELLAR DUST ABSTRACT We investigate the time variation of the visual extinction, AV, and the total-to-selective extinction ratio, RV, resulting from interstellar dust in front of an expanding photospheric disk of a type Ia supernova (SN Ia). We simulate interstellar dust clouds according to a power law power spectrum and produce extinction maps that either follow a pseudo-Gaussian distribution or a lognormal distribution. The RV maps are produced through a correlation between AV and RV. With maps of AV and RV generated in each case (pseudo-Gaussian and lognormal), we then compute the effective AV and RV for a SN as its photospheric disk expands behind the dust screen. We find for a small percentage of SNe the AV and RV values can vary by a large factor from day to day in the first 40 days after explosion.

  17. Fast solution of Cahn–Hilliard variational inequalities using implicit time discretization and finite elements

    KAUST Repository

    Bosch, Jessica; Stoll, Martin; Benner, Peter

    2014-01-01

    We consider the efficient solution of the Cahn-Hilliard variational inequality using an implicit time discretization, which is formulated as an optimal control problem with pointwise constraints on the control. By applying a semi-smooth Newton

  18. Time-variations of the regional evapotranspiration rate from GRACE satellite gravimetry

    OpenAIRE

    Ramillien , Guillaume; Frappart , Frédéric; Güntner , Andreas; Ngo-Duc , Thanh; Cazenave , Anny; Laval , Katia

    2006-01-01

    International audience; Since its launch in March 2002, the GRACE mission is measuring the global time variations of the Earth's gravity field with a current resolution of ~500 km. Especially over the continents, these measurements represent the integrated land water mass including surface waters (lakes, wetlands and rivers), soil moisture, groundwater and snow cover. In this study, we use the GRACE land water solutions computed by Ramillien et al. (2005a) through an iterative inversion of mo...

  19. Variation of CRE with exponents of time and number of fractions

    International Nuclear Information System (INIS)

    Supe, S.J.; Rao, S.M.; Sawant, S.G.; Bisht, J.S.

    1976-01-01

    The concept of NSD has been modified into TDF's by Orton and Ellis and CRE's by Kirk et al. It was aimed to study the variability of these new concepts on the exponents of time and number of fractions. It was found that TDF has larger variation with the exponents compared to that of CRE. The use of CRE and NSD for solving the treatment scheduling problems or for intercomparison of various regimes has been simplified by providing readymade estimation of CRE for various doses/fraction with increasing number of fractions. As there is increasing evidence for the change of exponents J and H, nomograms are presented to determine the CRE for various values of J and H. The variation of decay correction factors with the exponent H is also evaluated and is presented. This will help various radiotherapists to use CRE and the decay correction factors consistent with their clinical findings. (orig.) [de

  20. Variations of extreme rainfall in space and time

    DEFF Research Database (Denmark)

    Gregersen, Ida Bülow; Madsen, H.; Rosbjerg, Dan

    2012-01-01

    variation, whereas annual variations are related to changes in the average Danish summer precipitation, the average Danish summer temperature and the East Atlantic pattern. The spatio-temporal Poisson regression model was found to be a helpful tool when comparing the internal importance of these variables......In the ongoing climate change discussion, methods for identification of variability governed by climate change are important tools. The magnitude of variables that can describe this variability should be compared with magnitudes of variables describing variability in a stationary setting....... This study focuses on variations of extreme rainfall events, observed at 70 different locations in Denmark over a period of 31 years. The aim is to identify and compare variables, both spatially and temporally, which can explain different parts of the variability in this data set. Assuming that the number...

  1. Time dependency of local cerebral blood flow measurements caused by regional variations in tissue transit time

    International Nuclear Information System (INIS)

    Lear, J.L.; Kasliwal, R.; Feyerabend, A.

    1990-01-01

    Calculated values of local cerebral blood flow (LCBF) using the diffusible tracer model are assumed to be independent of time as long as experiments are brief enough to prevent tissue saturation. This paper investigates the effects of CTT variation on LCBF measurements. Using double-label quantitative digital autoradiography, we compared iodoantipyrine (IAP)-based LCBF measurements obtained with tracer infusions of different lengths of time. Lightly anesthetized rats were given simultaneous ramp infusions of C-14 IAP (45 seconds) and I-123 IAP (15 seconds) and immediately sacrificed. Two autoradiograms of each brain section, one representing I-123 and the other representing C-14, were produced, digitized, and converted into images of LCBF based on the 15- and 45-second infusion periods. The LCBF image pairs were compared on a pixel-by-pixel basis

  2. Measurement of time series variation of thermal diffusivity of magnetic fluid under magnetic field by forced Rayleigh scattering method

    Energy Technology Data Exchange (ETDEWEB)

    Motozawa, Masaaki, E-mail: motozawa.masaaki@shizuoka.ac.jp [Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu-shi, Shizuoka 432-8561 (Japan); Muraoka, Takashi [Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu-shi, Shizuoka 432-8561 (Japan); Motosuke, Masahiro, E-mail: mot@rs.tus.ac.jp [Tokyo University of Science, 6-3-1 Niijuku, Katsushika-ku, Tokyo 125-8585 (Japan); Fukuta, Mitsuhiro, E-mail: fukuta.mitsuhiro@shizuoka.ac.jp [Shizuoka University, 3-5-1 Johoku, Naka-ku, Hamamatsu-shi, Shizuoka 432-8561 (Japan)

    2017-04-15

    It can be expected that the thermal diffusivity of a magnetic fluid varies from time to time after applying a magnetic field because of the growth of the inner structure of a magnetic fluid such as chain-like clusters. In this study, time series variation of the thermal diffusivity of a magnetic fluid caused by applying a magnetic field was investigated experimentally. For the measurement of time series variation of thermal diffusivity, we attempted to apply the forced Rayleigh scattering method (FRSM), which has high temporal and high spatial resolution. We set up an optical system for the FRSM and measured the thermal diffusivity. A magnetic field was applied to a magnetic fluid in parallel and perpendicular to the heat flux direction, and the magnetic field intensity was 70 mT. The FRSM was successfully applied to measurement of the time series variation of the magnetic fluid from applying a magnetic field. The results show that a characteristic configuration in the time series variation of the thermal diffusivity of magnetic fluid was obtained in the case of applying a magnetic field parallel to the heat flux direction. In contrast, in the case of applying a magnetic field perpendicular to the heat flux, the thermal diffusivity of the magnetic fluid hardly changed during measurement. - Highlights: • Thermal diffusivity was measured by forced Rayleigh scattering method (FRSM). • FRSM has high temporal and high spatial resolutions for measurement. • We attempted to apply FRSM to magnetic fluid (MF). • Time series variation of thermal diffusivity of MF was successfully measured by FRSM. • Anisotropic thermal diffusivity of magnetic fluid was also successfully confirmed.

  3. Frequency variations of gravity waves interacting with a time-varying tide

    Energy Technology Data Exchange (ETDEWEB)

    Huang, C.M.; Zhang, S.D.; Yi, F.; Huang, K.M.; Gan, Q.; Gong, Y. [Wuhan Univ., Hubei (China). School of Electronic Information; Ministry of Education, Wuhan, Hubei (China). Key Lab. of Geospace Environment and Geodesy; State Observatory for Atmospheric Remote Sensing, Wuhan, Hubei (China); Zhang, Y.H. [Nanjing Univ. of Information Science and Technology (China). College of Hydrometeorolgy

    2013-11-01

    Using a nonlinear, 2-D time-dependent numerical model, we simulate the propagation of gravity waves (GWs) in a time-varying tide. Our simulations show that when aGW packet propagates in a time-varying tidal-wind environment, not only its intrinsic frequency but also its ground-based frequency would change significantly. The tidal horizontal-wind acceleration dominates the GW frequency variation. Positive (negative) accelerations induce frequency increases (decreases) with time. More interestingly, tidal-wind acceleration near the critical layers always causes the GW frequency to increase, which may partially explain the observations that high-frequency GW components are more dominant in the middle and upper atmosphere than in the lower atmosphere. The combination of the increased ground-based frequency of propagating GWs in a time-varying tidal-wind field and the transient nature of the critical layer induced by a time-varying tidal zonal wind creates favorable conditions for GWs to penetrate their originally expected critical layers. Consequently, GWs have an impact on the background atmosphere at much higher altitudes than expected, which indicates that the dynamical effects of tidal-GW interactions are more complicated than usually taken into account by GW parameterizations in global models.

  4. Beach morphological variations over micro-time scales

    Digital Repository Service at National Institute of Oceanography (India)

    Murty, C.S.; Veerayya, M.; Sastry, J.S.; Varadachari, V.V.R.

    formation, variations in the profiles show anomalous behaviour. The differences in grain-size distribution of the sediments of these 2 beaches are attributed to the available wave energies at these 2 locations...

  5. Boundedness and almost Periodicity in Time of Solutions of Evolutionary Variational Inequalities

    Science.gov (United States)

    Pankov, A. A.

    1983-04-01

    In this paper existence theorems are obtained for the solutions of abstract parabolic variational inequalities, which are bounded with respect to time (in the Stepanov and L^\\infty norms). The regularity and almost periodicity properties of such solutions are studied. Theorems are also established concerning their solvability in spaces of Besicovitch almost periodic functions. The majority of the results are obtained without any compactness assumptions. Bibliography: 30 titles.

  6. Case studies of the storm time variation of the polar cusp

    International Nuclear Information System (INIS)

    Meng, C.

    1983-01-01

    The latitudinal variations of the polar cusp region were examined during three intense geomagnetic storms. The variations were compared with the intensity of storm time ring current inferred from the Dst index, with the magnitude of the north-south component B/sub z/ of the interplanetary magnetic field and with substorm activity. The common feature is that the rapid equatorward shift occurred during the increase of the ring current growth and during the southward turning of the interplanetary magnetic field orientation. The equatorwardmost latitude of the cusp was reached before the peak of the ring current intensity, by a few to several hours, coinciding with the occurrence of the largest magnitude of the southward interplanetary magnetic field component. However, details of the polar cusp latitudinal movement differ from storm to storm. During the three storms studied, the poleward recovery commenced at the peak magnitude of the negative IMF B/sub z/ component, but the recovery proceeded without a clear relation to variations of the interplanetary B/sub z/ component, to the ring current intensity, or to the substorm activity. The lowest cusp latitude observed was at approx.61.7 0 , and the magnitude of this shift seems to be related to the magnitudes of -B/sub z/. It is further observed that the approximate rates of the cusp macroscopic equatorward and poleward movements are about 3 0 and 1.5 0 per hour, respectively

  7. Variations with time and age of the excess cancer risk among A-bomb survivors

    International Nuclear Information System (INIS)

    Pierce, D.A.; Vaeth, M.; Preston, D.L.

    1990-08-01

    This report has two aims: 1) to describe and analyze the age/time patterns of excess cancer risk in the atomic bomb survivor cohort followed up by RERF, and 2) to describe statistical methods which are used in RERF's analyses of data on mortality and morbidity in the cohort. In contrast to previous analyses of the cohort cancer mortality data, substantial use is made of Japanese national cancer rates for the purpose of investigation of the age/time variations in excess risk. This analysis considers mortality from all cancers except leukemia as a group. Primary attention is given to description in terms of the age-specific excess relative risk, but the importance of appropriate descriptions of the absolute excess risk is also emphasized. When models for the excess risk allow variation with age and time, both constant relative and absolute excess risk models provide very similar fits to the data. Previous reports have indicated that for a given age-at-exposure and sex, the excess age-specific relative risk is remarkably constant throughout the current follow-up period. Statistical analysis here indicates that for those less than about 35 years of age at exposure there is no departure from this pattern, beyond ordinary sampling variation. For those over about 35 years of age-at-exposure, there is modest evidence of an increasing trend in the excess relative risk, which could be plausibly attributed to effects related to minimal latent period. Some brief consideration is given to modeling the absolute excess risk as the product of an age-at-exposure and time-since-exposure effect. Interpretation of these results, particularly in regard to projections beyond the current follow-up, is discussed. (author)

  8. Nonlinear Variation of Parameters Formula for Impulsive Differential Equations with Initial Time Difference and Application

    Directory of Open Access Journals (Sweden)

    Peiguang Wang

    2014-01-01

    Full Text Available This paper establishes variation of parameters formula for impulsive differential equations with initial time difference. As an application, one of the results is used to investigate stability properties of solutions.

  9. Short-time variations of the ground water level

    International Nuclear Information System (INIS)

    Nilsson, Lars Y.

    1977-09-01

    Investigations have demonstrated that the ground water level of aquifers in the Swedish bedrock shows shorttime variations without changing their water content. The ground water level is among other things affected by regular tidal movements occuring in the ''solid'' crust of the earth variations in the atmospheric pressure strong earthquakes occuring in different parts of the world These effects proves that the system of fissures in the bedrock are not stable and that the ground water flow is influenced by both water- and airfilled fissures

  10. Study on the Variation of Groundwater Level under Time-varying Recharge

    Science.gov (United States)

    Wu, Ming-Chang; Hsieh, Ping-Cheng

    2017-04-01

    The slopes of the suburbs come to important areas by focusing on the work of soil and water conservation in recent years. The water table inside the aquifer is affected by rainfall, geology and topography, which will result in the change of groundwater discharge and water level. Currently, the way to obtain water table information is to set up the observation wells; however, owing to that the cost of equipment and the wells excavated is too expensive, we develop a mathematical model instead, which might help us to simulate the groundwater level variation. In this study, we will discuss the groundwater level change in a sloping unconfined aquifer with impermeable bottom under time-varying rainfall events. Referring to Child (1971), we employ the Boussinesq equation as the governing equation, and apply the General Integral Transforms Method (GITM) to analyzing the groundwater level after linearizing the Boussinesq equation. After comparing the solution with Verhoest & Troch (2000) and Bansal & Das (2010), we get satisfactory results. To sum up, we have presented an alternative approach to solve the linearized Boussinesq equation for the response of groundwater level in a sloping unconfined aquifer. The present analytical results combine the effect of bottom slope and the time-varying recharge pattern on the water table fluctuations. Owing to the limitation and difficulty of measuring the groundwater level directly, we develop such a mathematical model that we can predict or simulate the variation of groundwater level affected by any rainfall events in advance.

  11. Period variations in pulsating X-ray sources. I. Accretion flow parameters and neutron star structure from timing observations

    International Nuclear Information System (INIS)

    Lamb, F.K.; Pines, D.; Shaham, J.

    1978-01-01

    We show that valuable information about both accretion flows and neutron star structure can be obtained from X-ray timing observations of period variations in pulsating sources. Such variations can result from variations in the accretion flow, or from internal torque variations, associated with oscillations of the fluid core or the unpinning of vortices in the inner crust. We develop a statistical description of torque variations in terms of noise processes, indicate how the applicability of such a description may be tested observationally, and show how it may be used to determine from observation both the properties of accretion flows and the internal structure of neutron stars, including the relative inertial moments of the crust and superfluid neutron core, the crust-core coupling time, and the frequencies of any low-frequency internal collective modes. Particular attention is paid to the physical origin of spin-down episodes; it is shown that usyc episodes may result either from external torque reversals or from internal torque variations.With the aid of the statistical description, the response of the star to torque fluctuations is calculated for three stellar models: (i) a completely rigid star; (ii) a two-component star; and (iii) a two-component star with a finite-frequency internal mode, such as the Tkachenko mode of a rotating neutron superfluid. Our calculations show that fluctuating torques could account for the period the period variations and spin-down episodes observed in Her X-1 and Cen X-3, including the large spin-down event observed in the latter source during 1972 September-October. The torque noise strengths inferred from current timing observations using the simple two-component models are shown to be consistent with those to be expected from fluctuations in accretion flows onto magnetic neutron stars

  12. Observed variations in U.S. frost timing linked to atmospheric circulation patterns.

    Science.gov (United States)

    Strong, Courtenay; McCabe, Gregory J

    2017-05-23

    Several studies document lengthening of the frost-free season within the conterminous United States (U.S.) over the past century, and report trends in spring and fall frost timing that could stem from hemispheric warming. In the absence of warming, theory and case studies link anomalous frost timing to atmospheric circulation anomalies. However, recent efforts to relate a century of observed changes in U.S. frost timing to various atmospheric circulations yielded only modest correlations, leaving the relative importance of circulation and warming unclear. Here, we objectively partition the U.S. into four regions and uncover atmospheric circulations that account for 25-48% of spring and fall-frost timing. These circulations appear responsive to historical warming, and they consistently account for more frost timing variability than hemispheric or regional temperature indices. Reliable projections of future variations in growing season length depend on the fidelity of these circulation patterns in global climate models.

  13. Result Variation and Efficiency Kinetics in Real-Time PCR

    Directory of Open Access Journals (Sweden)

    Reza Shahsiah

    2010-10-01

    Full Text Available Fluorescent monitoring of DNA amplification is the basis of real-time PCR. Absolute quantification can be achieved using a standard curve method. The standard curve is constructed by amplifying known amounts of standards under identical conditions to that of the samples.The objective of the current study is to propose a mathematical model to assess the acceptability of PCR resulys.Four commercial standards for HCV-RNA (hepatitis C virus RNA along with 6 patient samples were measured by real-time PCR, using two different RT-PCR reagents. The standard deviation of regression (Sy,x was calculated for each group of standard and compared by F-Test. The efficiency kinetics was computed by logistic regression, c2 goodness of fit test was preformed to assess the appropriateness of the efficiency curves.Calculated efficiencies were not significantly different from the value predicted by logistic regression model. Reactions with more variation showed less stable efficiency curves, with wider range of amplification efficiencies.Amplification efficiency kinetics can be computed by fitting a logistic regression curve to the gathered fluorescent data of each reaction. This model can be employed to assess the acceptability of PCR results calculated by standard curve method.

  14. Cross-Sectional Distribution of GARCH Coefficients across S&P 500 Constituents: Time-Variation over the Period 2000-2012

    OpenAIRE

    David Ardia; Lennart F. Hoogerheide

    2013-01-01

    We investigate the time-variation of the cross-sectional distribution of asymmetric GARCH model parameters over the S&P 500 constituents for the period 2000-2012. We find the following results. First, the unconditional variances in the GARCH model obviously show major time-variation, with a high level after the dot-com bubble and the highest peak in the latest financial crisis. Second, in these more volatile periods it is especially the persistence of deviations of volatility from is uncondit...

  15. Derivation of an adiabatic time-dependent Hartree-Fock formalism from a variational principle

    International Nuclear Information System (INIS)

    Brink, D.M.; Giannoni, M.J.; Veneroni, M.

    1975-10-01

    A derivation of the adiabatic time-dependent Hartree-Fock formalism is given, which is based on a variational principle analogous to Hamilton's principle in classical mechanics. The method leads to a Hamiltonian for collective motion which separates into a potential and a kinetic energy and gives mass and potential parameters in terms of the nucleon-nucleon interaction. The adiabatic approximation assumes slow motion but not small amplitudes and can therefore describe anharmonic effects. The RPA is a limiting case where both amplitudes and velocities are small. The variational approach provides a consistent way of extracting coordinated and momenta from the density matrix and of obtaining equations of motion when particular trial forms for this density matrix are chosen. One such choice leads to Thouless-Valatin formula. An other choice leads to irrotational hydrodynamics [fr

  16. Variational Symplectic Integrator for Long-Time Simulations of the Guiding-Center Motion of Charged Particles in General Magnetic Fields

    International Nuclear Information System (INIS)

    Qin Hong; Guan Xiaoyin

    2008-01-01

    A variational symplectic integrator for the guiding-center motion of charged particles in general magnetic fields is developed for long-time simulation studies of magnetized plasmas. Instead of discretizing the differential equations of the guiding-center motion, the action of the guiding-center motion is discretized and minimized to obtain the iteration rules for advancing the dynamics. The variational symplectic integrator conserves exactly a discrete Lagrangian symplectic structure, and has better numerical properties over long integration time, compared with standard integrators, such as the standard and variable time-step fourth order Runge-Kutta methods

  17. Variational Symplectic Integrator for Long-Time Simulations of the Guiding-Center Motion of Charged Particles in General Magnetic Fields

    International Nuclear Information System (INIS)

    Qin, H.; Guan, X.

    2008-01-01

    A variational symplectic integrator for the guiding-center motion of charged particles in general magnetic fields is developed for long-time simulation studies of magnetized plasmas. Instead of discretizing the differential equations of the guiding-center motion, the action of the guiding-center motion is discretized and minimized to obtain the iteration rules for advancing the dynamics. The variational symplectic integrator conserves exactly a discrete Lagrangian symplectic structure, and has better numerical properties over long integration time, compared with standard integrators, such as the standard and variable time-step fourth order Runge-Kutta methods.

  18. Molecular characterization of a new monopartite dsRNA mycovirus from mycorrhizal Thelephora terrestris (Ehrh.) and its detection in soil oribatid mites (Acari: Oribatida)

    Energy Technology Data Exchange (ETDEWEB)

    Petrzik, Karel, E-mail: petrzik@umbr.cas.cz [Department of Plant Virology, Institute of Plant Molecular Biology, Biology Centre of the Czech Academy of Sciences, Branišovská 31, 370 05 České Budějovice (Czech Republic); Sarkisova, Tatiana [Department of Plant Virology, Institute of Plant Molecular Biology, Biology Centre of the Czech Academy of Sciences, Branišovská 31, 370 05 České Budějovice (Czech Republic); Starý, Josef [Institute of Soil Biology, Biology Centre of the Czech Academy of Sciences, Na Sádkách 7, 370 05 České Budějovice (Czech Republic); Koloniuk, Igor [Department of Plant Virology, Institute of Plant Molecular Biology, Biology Centre of the Czech Academy of Sciences, Branišovská 31, 370 05 České Budějovice (Czech Republic); and others

    2016-02-15

    A novel dsRNA virus was identified in the mycorrhizal fungus Thelephora terrestris (Ehrh.) and sequenced. This virus, named Thelephora terrestris virus 1 (TtV1), contains two reading frames in different frames but with the possibility that ORF2 could be translated as a fusion polyprotein after ribosomal -1 frameshifting. Picornavirus 2A-like motif, nudix hydrolase, phytoreovirus S7, and RdRp domains were found in a unique arrangement on the polyprotein. A new genus named Phlegivirus and containing TtV1, PgLV1, RfV1 and LeV is therefore proposed. Twenty species of oribatid mites were identified in soil material in the vicinity of T. terrestris. TtV1 was detected in large amounts in Steganacarus (Tropacarus) carinatus (C.L. Koch, 1841) and in much smaller amounts in Nothrus silvestris (Nicolet). This is the first description of mycovirus presence in oribatid mites. - Highlights: • A novel dsRNA virus was identified in the mycorrhizal fungus Thelephora terrestris. • A new virus genus Phlegivirus is proposed. • The mycovirus was firstly detected in oribatid mites.

  19. Molecular characterization of a new monopartite dsRNA mycovirus from mycorrhizal Thelephora terrestris (Ehrh.) and its detection in soil oribatid mites (Acari: Oribatida)

    International Nuclear Information System (INIS)

    Petrzik, Karel; Sarkisova, Tatiana; Starý, Josef; Koloniuk, Igor

    2016-01-01

    A novel dsRNA virus was identified in the mycorrhizal fungus Thelephora terrestris (Ehrh.) and sequenced. This virus, named Thelephora terrestris virus 1 (TtV1), contains two reading frames in different frames but with the possibility that ORF2 could be translated as a fusion polyprotein after ribosomal -1 frameshifting. Picornavirus 2A-like motif, nudix hydrolase, phytoreovirus S7, and RdRp domains were found in a unique arrangement on the polyprotein. A new genus named Phlegivirus and containing TtV1, PgLV1, RfV1 and LeV is therefore proposed. Twenty species of oribatid mites were identified in soil material in the vicinity of T. terrestris. TtV1 was detected in large amounts in Steganacarus (Tropacarus) carinatus (C.L. Koch, 1841) and in much smaller amounts in Nothrus silvestris (Nicolet). This is the first description of mycovirus presence in oribatid mites. - Highlights: • A novel dsRNA virus was identified in the mycorrhizal fungus Thelephora terrestris. • A new virus genus Phlegivirus is proposed. • The mycovirus was firstly detected in oribatid mites.

  20. Variation in timing of ossification affects inferred heterochrony of cranial bones in Lissamphibia.

    Science.gov (United States)

    Sheil, Christopher A; Jorgensen, Michael; Tulenko, Frank; Harrington, Sean

    2014-09-01

    The evolutionary origin of Lissamphibia likely involved heterochrony, as demonstrated by the biphasic lifestyles of most extant orders, differences between Anura (with tadpole-to-froglet metamorphosis) and Urodela (which lack strongly defined metamorphosis), and the appearance of direct development among separate lineages of frogs. Patterns in the timing of appearance of skeletal elements (i.e., ossification sequence data) represent a possible source of information for understanding the origin of Lissamphibia, and with the advent of analytical methods to directly optimize these data onto known phylogenies, there has been a renewed interest in assessing the role of changes in these developmental events. However, little attention has been given to the potential impact of variation in ossification sequence data--this is particularly surprising given that different criteria for collecting these data have been employed. Herein, new and previously published ossification data are compiled and all pairs of data for same-species comparisons are selected. Analyses are run to assess the impact of using data that were collected by different methodologies: (1) wild- versus lab-raised animals; (2) different criteria for recognizing timing of ossification; and (3) randomly selecting ossification sequences for species from which multiple studies have been published, but for which the data were collected by different criteria. Parsimov-based genetic inference is utilized to map ossification sequence data onto an existing phylogeny to reconstruct ancestral sequences of ossification and infer instances of heterochrony. All analyses succeeded in optimizing sequence data on internal nodes and instances of heterochrony were identified. However, among all analyses little congruence was found in reconstructed ancestral sequences or among inferred instances of heterochrony. These results indicate a high degree of variation in timing of ossification, and suggest a cautionary note about use

  1. Measuring Chemotherapy Appointment Duration and Variation Using Real-Time Location Systems.

    Science.gov (United States)

    Barysauskas, Constance M; Hudgins, Gina; Gill, Katie Kupferberg; Camuso, Kristen M; Bagley, Janet; Rozanski, Sheila; Kadish, Sarah

    Clinical schedules drive resource utilization, cost, and patient wait time. Accurate appointment duration allocation ensures appropriate staffing ratios to daily caseloads and maximizes scarce resources. Dana-Farber Cancer Institute (DFCI) infusion appointment duration is adjusted by regimen using a consensus method of experts including pharmacists, nurses, and administrators. Using real-time location system (RTLS), we examined the accuracy of observed appointment duration compared with the scheduled duration. Appointment duration was calculated using RTLS at DFCI between August 1, 2013, and September 30, 2013. Duration was defined as the total time a patient occupied an infusion chair. The top 10 administered infusion regimens were investigated (n = 805). Median observed appointment durations were statistically different than the scheduled durations. Appointment durations were shorter than scheduled 98% (C), 95% (I), and 75% (F) of the time and longer than scheduled 77% (A) and 76% (G) of the time. Fifty-six percent of the longer than scheduled (A) appointments were at least 30 minute longer. RTLS provides reliable and unbiased data to improve schedule accuracy. Replacing consensus with system-based data may improve clinic flow, relieve staff stress, and increase patient satisfaction. Further investigation is warranted to elucidate factors that impact variation in appointment duration.

  2. Effects of detector–source distance and detector bias voltage variations on time resolution of general purpose plastic scintillation detectors

    International Nuclear Information System (INIS)

    Ermis, E.E.; Celiktas, C.

    2012-01-01

    Effects of source-detector distance and the detector bias voltage variations on time resolution of a general purpose plastic scintillation detector such as BC400 were investigated. 133 Ba and 207 Bi calibration sources with and without collimator were used in the present work. Optimum source-detector distance and bias voltage values were determined for the best time resolution by using leading edge timing method. Effect of the collimator usage on time resolution was also investigated. - Highlights: ► Effect of the source-detector distance on time spectra was investigated. ► Effect of the detector bias voltage variations on time spectra was examined. ► Optimum detector–source distance was determined for the best time resolution. ► Optimum detector bias voltage was determined for the best time resolution. ► 133 Ba and 207 Bi radioisotopes were used.

  3. Time Variations of the Radial Velocity of H2O Masers in the Semi-Regular Variable R Crt

    Science.gov (United States)

    Sudou, Hiroshi; Shiga, Motoki; Omodaka, Toshihiro; Nakai, Chihiro; Ueda, Kazuki; Takaba, Hiroshi

    2017-12-01

    H2O maser emission {at 22 GHz} in the circumstellar envelope is one of the good tracers of detailed physics and inematics in the mass loss process of asymptotic giant branch stars. Long-term monitoring of an H2O maser spectrum with high time resolution enables us to clarify acceleration processes of the expanding shell in the stellar atmosphere. We monitored the H2O maser emission of the semi-regular variable R Crt with the Kagoshima 6-m telescope, and obtained a large data set of over 180 maser spectra over a period of 1.3 years with an observational span of a few days. Using an automatic peak detection method based on least-squares fitting, we exhaustively detected peaks as significant velocity components with the radial velocity on a 0.1 km s^{-1} scale. This analysis result shows that the radial velocity of red-shifted and blue-shifted components exhibits a change between acceleration and deceleration on the time scale of a few hundred days. These velocity variations are likely to correlate with intensity variations, in particular during flaring state of H2O masers. It seems reasonable to consider that the velocity variation of the maser source is caused by shock propagation in the envelope due to stellar pulsation.However, it is difficult to explain the relationship between the velocity variation and the intensity variation only from shock propagation effects. We found that a time delay of the integrated maser intensity with respect to the optical light curve is about 150 days.

  4. OBSERVATIONS OF THE WASP-2 SYSTEM BY THE APOSTLE PROGRAM

    Energy Technology Data Exchange (ETDEWEB)

    Becker, Andrew C.; Kundurthy, Praveen; Agol, Eric; Barnes, Rory; Williams, Benjamin F.; Rose, Amy E. [Astronomy Department, University of Washington, Seattle, WA 98195 (United States)

    2013-02-10

    We present transit observations of the WASP-2 exoplanet system by the Apache Point Survey of Transit Lightcurves of Exoplanets (APOSTLE) program. Model fitting to these data allows us to improve measurements of the hot-Jupiter exoplanet WASP-2b and its orbital parameters by a factor of {approx}2 over prior studies; we do not find evidence for transit depth variations. We do find reduced {chi}{sup 2} values greater than 1.0 in the observed minus computed transit times. A sinusoidal fit to the residuals yields a timing semi-amplitude of 32 s and a period of 389 days. However, random rearrangements of the data provide similar quality fits, and we cannot with certainty ascribe the timing variations to mutual exoplanet interactions. This inconclusive result is consistent with the lack of incontrovertible transit timing variations (TTVs) observed in other hot-Jupiter systems. This outcome emphasizes that unique recognition of TTVs requires dense sampling of the libration cycle (e.g., continuous observations from space-based platforms). However, even in systems observed with the Kepler spacecraft, there is a noted lack of transiting companions and TTVs in hot-Jupiter systems. This result is more meaningful, and indicates that hot-Jupiter systems, while they are easily observable from the ground, do not appear to be currently configured in a manner favorable to the detection of TTVs. The future of ground-based TTV studies may reside in resolving secular trends, and/or implementation at extreme quality observing sites to minimize atmospheric red noise.

  5. Divorce risk factors and their variation over time in Spain

    Directory of Open Access Journals (Sweden)

    Fabrizio Bernardi

    2011-05-01

    Full Text Available The aim of this article is to analyse the determinants of marriage dissolution in Spain and their variation over time for women married between 1949 and 2006. Data are drawn from the Survey of Fertility, Family and Values of 2006. The article analyses the transition from first marriage to marital dissolution for couples who married in two eras: one prior to the Divorce Law of 1981, during which social and legal barriers to dissolution were many, and one in the period after the law was introduced, during which barriers to marriage dissolution were far fewer. Analyses are conducted using a continuous time event history model. The results indicate some similarities between Spain and other countries, such as the positive relationship between the typical features of unconventional families and marital dissolution, but also some specific differences, such as an increase in the importance of premarital pregnancy and/or not having children. It is also important to stress the declining importance of socio-economic variables, such as education and the labour market situation of women.

  6. Excitation of Earth Rotation Variations "Observed" by Time-Variable Gravity

    Science.gov (United States)

    Chao, Ben F.; Cox, C. M.

    2005-01-01

    Time variable gravity measurements have been made over the past two decades using the space geodetic technique of satellite laser ranging, and more recently by the GRACE satellite mission with improved spatial resolutions. The degree-2 harmonic components of the time-variable gravity contain important information about the Earth s length-of-day and polar motion excitation functions, in a way independent to the traditional "direct" Earth rotation measurements made by, for example, the very-long-baseline interferometry and GPS. In particular, the (degree=2, order= 1) components give the mass term of the polar motion excitation; the (2,O) component, under certain mass conservation conditions, gives the mass term of the length-of-day excitation. Combining these with yet another independent source of angular momentum estimation calculated from global geophysical fluid models (for example the atmospheric angular momentum, in both mass and motion terms), in principle can lead to new insights into the dynamics, particularly the role or the lack thereof of the cores, in the excitation processes of the Earth rotation variations.

  7. Time dependent variation of carrying capacity of prestressed precast beam

    Science.gov (United States)

    Le, Tuan D.; Konečný, Petr; Matečková, Pavlína

    2018-04-01

    The article deals with the evaluation of the precast concrete element time dependent carrying capacity. The variation of the resistance is inherited property of laboratory as well as in-situ members. Thus the specification of highest, yet possible, laboratory sample resistance is important with respect to evaluation of laboratory experiments based on the test machine loading capabilities. The ultimate capacity is evaluated through the bending moment resistance of a simply supported prestressed concrete beam. The probabilistic assessment is applied. Scatter of random variables of compressive strength of concrete and effective height of the cross section is considered. Monte Carlo simulation technique is used to investigate the performance of the cross section of the beam with changes of tendons’ positions and compressive strength of concrete.

  8. Menstrual variation of breast volume and T2 relaxation times in cyclical mastalgia

    International Nuclear Information System (INIS)

    Hussain, Zainab; Brooks, Jonathan; Percy, Dave

    2008-01-01

    Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and 1 H Magnetic Resonance Spectroscopy (MRS) to measure T 2 relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T 2 relaxation due to the presence of an increased water content within the breast. T 2 Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T 2 relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T 2 relaxation times of the water and fat in a voxel of breast tissue were obtained using 1 H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p 2 of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T 2 of water or fat between patient and control groups. The average T 2 relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T 2 were not significantly different from normal menstrual variations

  9. Storm Time Variation of Radiative Cooling by Nitric Oxide as Observed by TIMED-SABER and GUVI

    Science.gov (United States)

    Bharti, Gaurav; Sunil Krishna, M. V.; Bag, T.; Jain, Puneet

    2018-02-01

    The variation of O/N2 (reference to N2 column density 1017 cm-2) and nitric oxide radiative emission flux exiting the thermosphere have been studied over the Northern Hemisphere during the superstorm event of 7-12 November 2004. The data have been obtained from Global Ultraviolet Imager (GUVI) and Sounding of the Atmosphere using Broadband Emission Radiometry (SABER) on board the National Aeronautics and Space Administration (NASA)'s Thermosphere, Ionosphere, Mesosphere Energetics and Dynamics (TIMED) satellite. The NO radiative flux is observed to show an anti-correlation with O/N2 on a global scale. Both NO radiative flux and O/N2 ratio show equatorward motion with maximum penetration in western longitude sectors. A local variation of O, O2, and N2 densities have been calculated using NRLMSISE-00 model over a midlatitude location (55°N,180°E). On a local scale, model calculated O/O2 and O/N2 ratios are found to follow the observations made by GUVI. The collisional excitation of NO with atomic oxygen is the most dominant process for the total cooling rate. The SABER-retrieved NO cooling rate (CR) at a local site suggests an enhancement during the storm period with the peak emission rate closely correlated to the progression of the storm. The peak emission altitude of NO CR moves upward during the main phase of the storm. The NO abundance has been calculated by using cooling rate and Nitric Oxide Empirical Model (NOEM) model. Both these suggest a vary large (3-15 times) increase in NO density during the storm, which is required to account the changes in NO radiative flux. A similar kind of enhancement in NO abundance is also noticed in Student Nitric Oxide Explorer observations during intense geomagnetic storms.

  10. Simulation of the Universal-Time Diurnal Variation of the Global Electric Circuit Charging Rate

    Science.gov (United States)

    Mackerras, D.; Darvenzia, M.; Orville, R. E.; Williams, E. R.; Goodman, S. J.

    1999-01-01

    A global lightning model that includes diurnal and annual lightning variation, and total flash density versus latitude for each major land and ocean, has been used as the basis for simulating the global electric circuit charging rate. A particular objective has been to reconcile the difference in amplitude ratios [AR=(max-min)/mean] between global lightning diurnal variation (AR approx. = 0.8) and the diurnal variation of typical atmospheric potential gradient curves (AR approx. = 0.35). A constraint on the simulation is that the annual mean charging current should be about 1000 A. The global lightning model shows that negative ground flashes can contribute, at most, about 10-15% of the required current. For the purpose of the charging rate simulation, it was assumed that each ground flash contributes 5 C to the charging process. It was necessary to assume that all electrified clouds contribute to charging by means other than lightning, that the total flash rate can serve as an indirect indicator of the rate of charge transfer, and that oceanic electrified clouds contribute to charging even though they are relatively inefficient in producing lightning. It was also found necessary to add a diurnally invariant charging current component. By trial and error it was found that charging rate diurnal variation curves in Universal time (UT) could be produced with amplitude ratios and general shapes similar to those of the potential gradient diurnal variation curves measured over ocean and arctic regions during voyages of the Carnegie Institute research vessels.

  11. Time Variations of the Spectral Indices of the Suprathermal Distribution as observed by WIND/STICS

    Science.gov (United States)

    Gruesbeck, J. R.; Christian, E. R.; Lepri, S. T.; Thomas, J.; Zurbuchen, T.; Gloeckler, G.

    2011-12-01

    Suprathermal particle spectra, measured in various regions of the heliosphere and heliosheath by Ulysses, ACE and Voyager, have recently been reported. In many cases long accumulation times had to be used to obtain sufficient statistical accuracy, and corrections were necessary, since only a fraction of phase space was measured. The SupraThermal Ion Composition Spectrometer (STICS), onboard Wind, enables observations of the suprathermal plasma in the solar wind at much higher time resolution. In addition, the STICS samples nearly full three-dimensional phase space, enabling measurements of anisotropies. We present a multi-year investigation of the spectral index of the suprathermal distribution, accumulated over 1 day and less, where we see significant time variation. An average lower bound value of the spectral index is at ~ -5, however, there are time periods during which the observed distributions steepen. We will also present an analysis of time and spatial variations of the suprathermal particle fluxes, observed by STICS and other instruments. In particular, we will compare the observed variability with predictions from a model by Bochsler and Moebius, based on data of the Interstellar Boundary Explorer (IBEX), who postulated that energetic neutral atoms, from outside of the heliosheath, which then penetrate the inner heliosphere and are finally ionized, could be a source of the very suprathermal populations we observe.

  12. SABER (TIMED) and MLS (UARS) Temperature Observations of Mesospheric and Stratospheric QBO and Related Tidal Variations

    Science.gov (United States)

    Huang, Frank T.; Mayr, Hans G.; Reber, Carl A.; Russell, James; Mlynczak, Marty; Mengel, John

    2006-01-01

    More than three years of temperature observations from the SABER (TIMED) and MLS WARS) instruments are analyzed to study the annual and inter-annual variations extending from the stratosphere into the upper mesosphere. The SABER measurements provide data from a wide altitude range (15 to 95 km) for the years 2002 to 2004, while the MLS data were taken in the 16 to 55 km altitude range a decade earlier. Because of the sampling properties of SABER and MLS, the variations with local solar time must be accounted for when estimating the zonal mean variations. An algorithm is thus applied that delineates with Fourier analysis the year-long variations of the migrating tides and zonal mean component. The amplitude of the diurnal tide near the equator shows a strong semiannual periodicity with maxima near equinox, which vary from year to year to indicate the influence from the Quasi-biennial Oscillation (QBO) in the zonal circulation. The zonal mean QBO temperature variations are analyzed over a range of latitudes and altitudes, and the results are presented for latitudes from 48"s to 48"N. New results are obtained for the QBO, especially in the upper stratosphere and mesosphere, and at mid-latitudes. At Equatorial latitudes, the QBO amplitudes show local peaks, albeit small, that occur at different altitudes. From about 20 to 40 km, and within about 15" of the Equator, the amplitudes can approach 3S K for the stratospheric QBO or SQBO. For the mesospheric QBO or MQBO, we find peaks near 70 km, with temperature amplitudes reaching 3.5"K, and near 85 km, the amplitudes approach 2.5OK. Morphologically, the amplitude and phase variations derived from the SABER and MLS measurements are in qualitative agreement. The QBO amplitudes tend to peak at the Equator but then increase again pole-ward of about 15" to 20'. The phase progression with altitude varies more gradually at the Equator than at mid-latitudes. A comparison of the observations with results from the Numerical Spectral

  13. Local Times of Galactic Cosmic Ray Intensity Maximum and Minimum in the Diurnal Variation

    Directory of Open Access Journals (Sweden)

    Su Yeon Oh

    2006-06-01

    Full Text Available The Diurnal variation of galactic cosmic ray (GCR flux intensity observed by the ground Neutron Monitor (NM shows a sinusoidal pattern with the amplitude of 1sim 2 % of daily mean. We carried out a statistical study on tendencies of the local times of GCR intensity daily maximum and minimum. To test the influences of the solar activity and the location (cut-off rigidity on the distribution in the local times of maximum and minimum GCR intensity, we have examined the data of 1996 (solar minimum and 2000 (solar maximum at the low-latitude Haleakala (latitude: 20.72 N, cut-off rigidity: 12.91 GeV and the high-latitude Oulu (latitude: 65.05 N, cut-off rigidity: 0.81 GeV NM stations. The most frequent local times of the GCR intensity daily maximum and minimum come later about 2sim3 hours in the solar activity maximum year 2000 than in the solar activity minimum year 1996. Oulu NM station whose cut-off rigidity is smaller has the most frequent local times of the GCR intensity maximum and minimum later by 2sim3 hours from those of Haleakala station. This feature is more evident at the solar maximum. The phase of the daily variation in GCR is dependent upon the interplanetary magnetic field varying with the solar activity and the cut-off rigidity varying with the geographic latitude.

  14. Time variation of the cosmological redshift in Dicke-Brans-Jordan cosmologies

    International Nuclear Information System (INIS)

    Ruediger, R.

    1982-01-01

    In this paper the time variation z of the cosmological redshift z is discussed for Dicke-Brans-Jordan (DBJ) cosmologies. We determine the general z-z relation in the functional form zH -1 0 = F(z; q 0 , sigma 0 ,xi 0 , ω) for small values of z, where all the symbols have their conventional meanings. For certain combinations of cosmological parameters, which are within the present observational limitations, the DBJ terms in the function F can dominate the general relativistic terms. Furthermore, zH -1 0 can be positive in DBJ cosmologies in contrast to general relativistic cosmologies with q 0 >0

  15. Novel approach for evaluation of air change rate in naturally ventilated occupied spaces based on metabolic CO2 time variation

    DEFF Research Database (Denmark)

    Melikov, Arsen Krikor; Markov, Detelin G.

    2014-01-01

    IAQ in many residential buildings relies on non-organized natural ventilation. Accurate evaluation of air change rate (ACR) in this situation is difficult due to the nature of the phenomenon - intermittent infiltration-exfiltration periods of mass exchange between the room air and the outdoor air...... at low rate. This paper describes a new approach for ACR evaluation in naturally ventilated occupied spaces. Actual metabolic CO2 time variation record in an interval of time is compared with the computed variation of metabolic CO2 for the same time interval under reference conditions: sleeping occupants...

  16. Chernobyl derived activity in sheep: variation within a single flock and with time

    International Nuclear Information System (INIS)

    Walters, B.

    1988-01-01

    The continuous monitoring of the caesium contents of sheep grazing a high fell in Cumbria, UK, is described. The technique of in-vivo monitoring, using portable NaI crystal detectors, is shown to be robust and capable of producing accurate quantitative data. Results are presented from the monitoring of 100 sheep at fortnightly intervals over a period of 13 weeks. The peak average activity (1300 Bq kg -1 ) was reached five weeks after introduction of the sheep to grazing land with up to 2000 Bq kg -1 in herbage. Activity had fallen, on average, to 68% of the peak value after eight weeks. The variation in activity between individual sheep is large and usually symmetrically distributed. The temporal trend of activity in the whole flock is a combination of the many disparate individual trends. The technique has allowed the variation between animals and individual time trends to be followed. (author)

  17. Storm-time variation of radiative cooling by Nitric Oxide as observed by TIMED-SABER and GUVI

    Science.gov (United States)

    Sunil Krishna, M. V.; Bharti, G.; Bag, T.

    2017-12-01

    The variation of O/N2 and nitric oxide radiative emission flux exiting thermosphere have been studied over northern hemisphere during the super-storm event of November 7-12, 2004. The data have been obtained from GUVI and SABER onboard the NASA's TIMED satellite. The NO radiative flux is observed to show an anti-correlation with O/N2 on a global scale. Both NO radiative flux and O/N2 ratio show equatorward motion with maximum penetration in western longitude sectors. A local variation of O, O2 and N2 densities have been calculated by using NRLMSISE-00 model over a mid-latitude location (55oN,180oE). On a local scale, model calculated O/O2 and O/N2 ratios are found to follow the observations made by GUVI. The SABER retrieved NO cooling rate (CR) at a local site suggests an enhancement during the storm period with the peak emission rate closely correlated to the progression of the storm. The peak emission altitude of NO CR moves upward during the main phase of the storm. The NO abundance has been calculated by using cooling rate and NOEM model. Both these suggest huge increase in NO density during the storm which is required to account the changes in NO radiative flux.

  18. Establishing a Set of Macroeconomic Factors Explaining Variation Over Time of Performance in Business Sectors

    Directory of Open Access Journals (Sweden)

    Audrius Dzikevičius

    2016-06-01

    Full Text Available With increasing competitiveness of companies and business sectors in the domestic markets of Lithuania, economic units are frequently confronted with the lack of methods for more detailed analysis of external factors explaining the variation over time of corporate financial indicators. The analysis or forecasting of financial indicators is usually linked with the development of a stock market or undertaken to estimate the probability of bankruptcy. However, there is a lack of studies aimed at identifying links between macroeconomic factors and financial performance indicators and explaining their variation over time. To serve that purpose, the factors of the macroeconomic environment that are most significant for certain economic activities have been identified and analysed to enable explaining the variation over time patterns of corporate financial indicators. The analysis covers economic performance, i.e. financial performance indicators and their links with macroeconomic factors, in 89 business sectors of Lithuania at a three-digit level of NACE 2 ed. The findings of the research indicate that the unemployment level in the country, the volume of export and import and the GDP are the most important macroeconomic factors that can be used to forecast different profitability, financial leverage, liquidity and other financial performance indicators of individual business sectors or companies. The research has not unfolded any significant differences between business sectors therefore the above factors are considered generic macroeconomic factors enabling to explain financial performance indicators of the 89 business sectors. Hence, special attention has to be paid to identifying and analysing specific factors and assessing the causal link. When established, the set of such factors provides a framework for building of a model to forecast business sector financial indicators.

  19. DISCOVERY OF TIME VARIATION OF THE INTENSITY OF MOLECULAR LINES IN IRC+10216 IN THE SUBMILLIMETER AND FAR-INFRARED DOMAINS

    Energy Technology Data Exchange (ETDEWEB)

    Cernicharo, J.; Quintana-Lacaci, G.; Agúndez, M.; Velilla-Prieto, L. [Group of Molecular Astrophysics, ICMM, CSIC, C/Sor Juana Inés de La Cruz N3, E-28049 Madrid (Spain); Teyssier, D.; García-Lario, P. [ESA, ESAC, P.O. Box 78, Villanueva de la Cañada, E-28691 Madrid (Spain); Daniel, F. [Univ. Grenoble Alpes, IPAG, F-38000 Grenoble (France); Decin, L. [Instituut voor Sterrenkunde, Katholieke Universiteit Leuven, Celestijnenlaan 200D, B-3001 Leuven (Belgium); Guélin, M. [Institut de Radioastronomie Millimétrique, 300 rue de la Piscine, F-38406 St-Martin d' Hères (France); Encrenaz, P. [LERMA, Observatoire de Paris, 61 Av. de l' Observatoire, F-75014 Paris (France); De Beck, E. [Department of Earth and Space Sciences, Chalmers University of Technology, Onsala Space Observatory, SE 439 92 Onsala (Sweden); Barlow, M. J. [Department of Physics and Astronomy, University College London, Gower Street, London WC1E 6BT (United Kingdom); Groenewegen, M. A. T. [Koninklijke Sterrenwacht van België, Ringlaan 3, B-1180 Brussels (Belgium); Neufeld, D. [Department of Physics and Astronomy, Johns Hopkins University, 3400 North Charles Street, Baltimore, MD 21218 (United States); Pearson, J. [Jet Propulsion Laboratory, California Institute of Technology, Pasadena, CA 91109 (United States)

    2014-11-20

    We report on the discovery of strong intensity variations in the high rotational lines of abundant molecular species toward the archetypical circumstellar envelope of IRC+10216. The observations have been carried out with the Heterodyne Instrument for the Far-Infrared (HIFI) instrument on board Herschel and with the IRAM30 m telescope. They cover several observing periods spreading over three years. The line intensity variations for molecules produced in the external layers of the envelope most likely result from time variations in the infrared pumping rates. We analyze the main implications this discovery has on the interpretation of molecular line emission in the envelopes of Mira-type stars. Radiative transfer calculations must take into account both the time variability of infrared pumping and the possible variation of the dust and gas temperatures with stellar phase in order to reproduce the observation of molecular lines at different epochs. The effect of gas temperature variations with stellar phase could be particularly important for lines produced in the innermost regions of the envelope. Each layer of the circumstellar envelope sees the stellar light radiation with a different lag time (phase). Our results show that this effect must be included in the models. The submillimeter and far infrared lines of asymptotic giant branch stars can no longer be considered as safe intensity calibrators.

  20. Total variation regularization for a backward time-fractional diffusion problem

    International Nuclear Information System (INIS)

    Wang, Liyan; Liu, Jijun

    2013-01-01

    Consider a two-dimensional backward problem for a time-fractional diffusion process, which can be considered as image de-blurring where the blurring process is assumed to be slow diffusion. In order to avoid the over-smoothing effect for object image with edges and to construct a fast reconstruction scheme, the total variation regularizing term and the data residual error in the frequency domain are coupled to construct the cost functional. The well posedness of this optimization problem is studied. The minimizer is sought approximately using the iteration process for a series of optimization problems with Bregman distance as a penalty term. This iteration reconstruction scheme is essentially a new regularizing scheme with coupling parameter in the cost functional and the iteration stopping times as two regularizing parameters. We give the choice strategy for the regularizing parameters in terms of the noise level of measurement data, which yields the optimal error estimate on the iterative solution. The series optimization problems are solved by alternative iteration with explicit exact solution and therefore the amount of computation is much weakened. Numerical implementations are given to support our theoretical analysis on the convergence rate and to show the significant reconstruction improvements. (paper)

  1. Factors affecting variations in time of the remote effects of depression in the surroundings of Thorez opencast mine

    Energy Technology Data Exchange (ETDEWEB)

    Szilagyi, G.

    1976-01-01

    Dewatering operations have been carried out in Thorez opencast coal mine since 1960 in order to increase the stability of water-bearing strata and to create safe working conditions. Since that time some 0.1 billion cu.m of water have been drained from underground reservoirs, resulting in the formation of a zone of depression 10 to 15 km in radius. Hydrogeological and technical factors affecting the variations in time of the remote effects of depression are analysed. It is found that the decisive influence is the variation in the volume of accumulated water, and to a lesser extent, the effect of the positioning of the drainage system.

  2. Temperature variation in metal ceramic technology analyzed using time domain optical coherence tomography

    Science.gov (United States)

    Sinescu, Cosmin; Topala, Florin I.; Negrutiu, Meda Lavinia; Duma, Virgil-Florin; Podoleanu, Adrian G.

    2014-01-01

    The quality of dental prostheses is essential in providing good quality medical services. The metal ceramic technology applied in dentistry implies ceramic sintering inside the dental oven. Every ceramic material requires a special sintering chart which is recommended by the producer. For a regular dental technician it is very difficult to evaluate if the temperature inside the oven remains the same as it is programmed on the sintering chart. Also, maintaining the calibration in time is an issue for the practitioners. Metal ceramic crowns develop a very accurate pattern for the ceramic layers depending on the temperature variation inside the oven where they are processed. Different patterns were identified in the present study for the samples processed with a variation in temperature of +30 °C to +50 °C, respectively - 30 0°C to -50 °C. The OCT imagistic evaluations performed for the normal samples present a uniform spread of the ceramic granulation inside the ceramic materials. For the samples sintered at a higher temperature an alternation between white and darker areas between the enamel and opaque layers appear. For the samples sintered at a lower temperature a decrease in the ceramic granulation from the enamel towards the opaque layer is concluded. The TD-OCT methods can therefore be used efficiently for the detection of the temperature variation due to the ceramic sintering inside the ceramic oven.

  3. Time variations of fields in superconducting magnets and their effects on accelerators

    Energy Technology Data Exchange (ETDEWEB)

    Herrup, D.A.; Syphers, M.J.; Johnson, D.E.; Johnson, R.P.; Tollestrup, A.V.; Hanft, R.W.; Brown, B.C.; Lamm, M.J.; Kuchnir, M.; McInturff, A.D.

    1988-08-22

    A report on the time dependence of magnetic fields in the superconducting magnets of the Fermilab Tevatron has been published. A field variation of order 1 gauss at the aperture radius is observed. Studies on both full sized Tevatron, dipoles and prototype magnets have been used to elucidate these effects. Explanations based on eddy currents in the coil matrix or on flux creep in the superconducting filaments are explored with these tests. Measurement results and techniques for controlling the effect based on new laboratory tests and the latest accelerator operation are presented. 9 refs., 4 figs.

  4. Time variations of fields in superconducting magnets and their effects on accelerators

    International Nuclear Information System (INIS)

    Herrup, D.A.; Syphers, M.J.; Johnson, D.E.

    1988-01-01

    A report on the time dependence of magnetic fields in the superconducting magnets of the Fermilab Tevatron has been published. A field variation of order 1 gauss at the aperture radius is observed. Studies on both full sized Tevatron, dipoles and prototype magnets have been used to elucidate these effects. Explanations based on eddy currents in the coil matrix or on flux creep in the superconducting filaments are explored with these tests. Measurement results and techniques for controlling the effect based on new laboratory tests and the latest accelerator operation are presented. 9 refs., 4 figs

  5. Interpretation of engine cycle-to-cycle variation by chaotic time series analysis

    Energy Technology Data Exchange (ETDEWEB)

    Daw, C.S.; Kahl, W.K.

    1990-01-01

    In this paper we summarize preliminary results from applying a new mathematical technique -- chaotic time series analysis (CTSA) -- to cylinder pressure data from a spark-ignition (SI) four-stroke engine fueled with both methanol and iso-octane. Our objective is to look for the presence of deterministic chaos'' dynamics in peak pressure variations and to investigate the potential usefulness of CTSA as a diagnostic tool. Our results suggest that sequential peak cylinder pressures exhibit some characteristic features of deterministic chaos and that CTSA can extract previously unrecognized information from such data. 18 refs., 11 figs., 2 tabs.

  6. Long-time observation of annual variation of Taiwan Strait upwelling in summer season

    Science.gov (United States)

    Tang, D. L.; Kawamura, H.; Guan, L.

    The Taiwan Strait is between Taiwan Island and Mainland China, where several upwelling zones are well known for good fishing grounds. Earlier studies in the strait have been conducted on detecting upwelling by ship measurements with short-term cruises, but long-term variations of upwelling in this region are not understood. The present paper examines satellite images for a long-time observation of two major upwelling zones in the Taiwan Strait: Taiwan Bank Upwelling (TBU) and Dongshan Upwelling (DSU). Sea surface temperature (SST) and chlorophyll a (Chl-a) images have been analyzed for summer months (June, July, and August) from 1980 to 2002. Results reveal annual variation of two upwelling zones. These two upwelling zones occur every year characterized with distinct low water temperature and high Chl-a concentrations. During the period from 1989 to 1998, SST is found to be 1.15 °C lower in TBU, and 1.42 °C lower in the DSU than the Taiwan Strait. The size of DSU has been found to be larger during summer of 1989, 1990, 1993 and 1995; TBU has been found to be weak during summer of 1994 and 1997. Ocean color images obtained from CZCS, OCI, and SeaWiFS also show high Chl-a concentrations (0.8-2.5 mg m-3) in two upwelling zones, which coincide with low SST in terms of location, shape, and time. These high Chl-a concentrations in TBU and DSU may be related to upwelling waters that bring nutrients from bottom to surface. The present results also show the potential of using satellite data for monitoring of ocean environment for long time period.

  7. Time variation of the fine structure constant driven by quintessence

    International Nuclear Information System (INIS)

    Anchordoqui, Luis; Goldberg, Haim

    2003-01-01

    There are indications from the study of quasar absorption spectra that the fine structure constant α may have been measurably smaller for redshifts z>2. Analyses of other data ( 149 Sm fission rate for the Oklo natural reactor, variation of 187 Re β-decay rate in meteorite studies, atomic clock measurements) which probe variations of α in the more recent past imply much smaller deviations from its present value. In this work we tie the variation of α to the evolution of the quintessence field proposed by Albrecht and Skordis, and show that agreement with all these data, as well as consistency with Wilkinson Microwave Anisotropy Probe observations, can be achieved for a range of parameters. Some definite predictions follow for upcoming space missions searching for violations of the equivalence principle

  8. Population growth enhances the mean fixation time of neutral mutations and the persistence of neutral variation.

    Science.gov (United States)

    Waxman, D

    2012-06-01

    A fundamental result of population genetics states that a new mutation, at an unlinked neutral locus in a randomly mating diploid population, has a mean time of fixation of ∼4N(e) generations, where N(e) is the effective population size. This result is based on an assumption of fixed population size, which does not universally hold in natural populations. Here, we analyze such neutral fixations in populations of changing size within the framework of the diffusion approximation. General expressions are derived for the mean and variance of the fixation time in changing populations. Some explicit results are given for two cases: (i) the effective population size undergoes a sudden change, representing a sudden population expansion or a sudden bottleneck; (ii) the effective population changes linearly for a limited period of time and then remains constant. Additionally, a lower bound for the mean time of fixation is obtained for an effective population size that increases with time, and this is applied to exponentially growing populations. The results obtained in this work show, among other things, that for populations that increase in size, the mean time of fixation can be enhanced, sometimes substantially so, over 4N(e,0) generations, where N(e,0) is the effective population size at the time the mutation arises. Such an enhancement is associated with (i) an increased probability of neutral polymorphism in a population and (ii) an enhanced persistence of high-frequency neutral variation, which is the variation most likely to be observed.

  9. Variations in the small-scale galactic magnetic field and short time-scale intensity variations of extragalactic radio sources

    International Nuclear Information System (INIS)

    Simonetti, J.H.

    1985-01-01

    Structure functions of the Faraday rotation measures (RMs) of extragalactic radio sources are used to investigate variations in the interstellar magnetic field on length scales of approx.0.01 to 100 pc. Model structure functions derived assuming a power-law power spectrum of irregularities in n/sub e/B, are compared with those observed. The results indicate an outer angular scale for RM variations of approximately less than or equal to 5 0 and evidence for RM variations on scales as small as 1'. Differences in the variance of n/sub e/B fluctuations for various lines of sight through the Galaxy are found. Comparison of pulsar scintillations in right- and left-circular polarizations yield an upper limit to the variations in n/sub e/ on a length scale of approx.10 11 cm. RMs were determined through high-velocity molecular flows in galactic star-formation regions, with the goal of constraining magnetic fields in and near the flows. RMs of 7 extragalactic sources with a approx.20 arcmin wide area seen through Cep A, fall in two groups separated by approx.150 rad m -2 - large given our knowledge of RM variations on small angular scales and possibly a result of the anisotropy of the high-velocity material

  10. CLASP/SJ Observations of Rapid Time Variations in the Ly α Emission in a Solar Active Region

    Energy Technology Data Exchange (ETDEWEB)

    Ishikawa, Shin-nosuke [Institute of Space and Astronautical Science, Japan Aerospace Exploration Agency, 3-1-1 Yoshinodai, Chuo-ku, Sagamihara, Kanagawa 252–5210 (Japan); Kubo, Masahito; Katsukawa, Yukio; Kano, Ryouhei; Narukage, Noriyuki; Ishikawa, Ryohko; Bando, Takamasa [National Astronomical Observatory of Japan, 2-21-1 Osawa, Mitaka, Tokyo 181-8588 (Japan); Winebarger, Amy; Kobayashi, Ken [NASA Marshall Space Flight Center, Huntsville, AL 35812 (United States); Trujillo Bueno, Javier [Instituto de Astrofísica de Canarias, E-38205 La Laguna, Tenerife (Spain); Auchère, Frédéric, E-mail: s.ishikawa@solar.isas.jaxa.jp [Institut d’Astrophysique Spatiale, CNRS/Univ. Paris-Sud 11, Bätiment 121, F-91405 Orsay (France)

    2017-09-10

    The Chromospheric Ly α SpectroPolarimeter (CLASP) is a sounding rocket experiment launched on 2015 September 3 to investigate the solar chromosphere and transition region. The slit-jaw (SJ) optical system captured Ly α images with a high time cadence of 0.6 s. From the CLASP/SJ observations, many variations in the solar chromosphere and transition region emission with a timescale of <1 minute were discovered. In this paper, we focus on the active region within the SJ field of view and investigate the relationship between short (<30 s) temporal variations in the Ly α emission and the coronal structures observed by Solar Dynamics Observatory/Atmospheric Imaging Assembly (AIA). We compare the Ly α temporal variations at the coronal loop footpoints observed in the AIA 211 Å (≈2 MK) and AIA 171 Å (≈0.6 MK) channels with those in the regions with bright Ly α features without a clear association with the coronal loop footpoints. We find more short (<30 s) temporal variations in the Ly α intensity in the footpoint regions. Those variations did not depend on the temperature of the coronal loops. Therefore, the temporal variations in the Ly α intensity at this timescale range could be related to the heating of the coronal structures up to temperatures around the sensitivity peak of 171 Å. No signature was found to support the scenario that these Ly α intensity variations were related to the nanoflares. Waves or jets from the lower layers (lower chromosphere or photosphere) are possible causes for this phenomenon.

  11. Natural time analysis on the ultra-low frequency magnetic field variations prior to the 2016 Kumamoto (Japan) earthquakes

    Science.gov (United States)

    Potirakis, Stelios M.; Schekotov, Alexander; Asano, Tomokazu; Hayakawa, Masashi

    2018-04-01

    On 15 April 2016 a very strong and shallow earthquake (EQ) (MW = 7.0 , depth ∼ 10 km) occurred in Southwest Japan under the city of Kumamoto, while two very strong foreshocks (MW = 6.2 and MW = 6.0) preceded by about one day. The Kumamoto EQs being very catastrophic, have already attracted much attention among the scientific community in a quest for understanding the generation mechanism, as well as for reporting any preseismic anomalies in various observables and assessing the effectivity of the current early warning systems. In the present article we report precursory behavior of the ground-based observed ultra-low frequency (ULF) magnetic field variations before the Kumamoto EQs. By analyzing specific ULF magnetic field characteristics in terms of the recently introduced natural time (NT) analysis method, we identified that ULF magnetic field variations presented critical features from 2 weeks up to 1 month before the Kumamoto EQs. Specifically, the ULF magnetic field characteristics Fh , Fz , Dh and δDep were analyzed. The first two represent variations of the horizontal and vertical components of the geomagnetic field. The third and fourth characteristics correspond to the depression (decrease) and a relative depression of the horizontal magnetic field variations, respectively. The latter depends on the degree of ionospheric disturbance. All of them were found to reach criticality before the Kumamoto EQs; however, in different time periods for each characteristic.

  12. Time-Dependent Variations in Structure of Sheep Wool Irradiated by Electron Beam

    Directory of Open Access Journals (Sweden)

    Zuzana Hanzlíková

    2017-01-01

    Full Text Available Wool scoured in tap water with no special degreasing and containing a balanced humidity responding to usual laboratory conditions was irradiated by accelerated electron beam in the range of 0–350 kGy dose. Time variations of the wool structure were measured using FTIR, Raman, and EPR spectroscopy. The aim was to determine whether preexposure treatment of the wool, as well as postexposure time, affects the properties of the irradiated wool. Reactive products such as S-sulfonate, cystine monoxide, cystine dioxide, cysteic acid, disulphides, and carboxylates displayed a considerable fluctuation in quantity depending on both the absorbed dose and time. Mutual transformations of S-oxidized products into cysteic acid appeared to be faster than those in dry and degreased wool assuming that the present humidity inside the fibres is decisive as an oxygen source. EPR results indicated a longer lifetime for free radicals induced by lower doses compared with the radicals generated by higher ones. The pattern of the conformational composition of the secondary structure (α-helix, β-sheet, random, and residual conformations also showed a large variability depending on absorbed dose as well as postexposure time. The most stable secondary structure was observed in nonirradiated wool but even this showed a small but observable change after a longer time, too.

  13. Variational extension of the time-dependent mean field approach

    International Nuclear Information System (INIS)

    Flocard, H.

    1989-01-01

    We investigate an application of the variational principle of Balian and Veneroni for density operators and observables. Our choice for the trial spaces incorporates correlations in the density operator. It allows one to calculate the expectation values of both one-body and two-body observables. We derive a set of coupled equations which extends the TDHF formalism, and determines the evolution of the partition function, the one-body density and the second cumulant (it corresponds also to a truncation of the quantal counterpart of the BBKGY equations). By restricting further the trial space for the two-body observables, the variational principle generates simpler equations which still include the effects of a selected class of correlations on the evolution of the one-body density

  14. Quantum variational calculus

    CERN Document Server

    Malinowska, Agnieszka B

    2014-01-01

    This Brief puts together two subjects, quantum and variational calculi by considering variational problems involving Hahn quantum operators. The main advantage of its results is that they are able to deal with nondifferentiable (even discontinuous) functions, which are important in applications. Possible applications in economics are discussed. Economists model time as continuous or discrete. Although individual economic decisions are generally made at discrete time intervals, they may well be less than perfectly synchronized in ways discrete models postulate. On the other hand, the usual assumption that economic activity takes place continuously, is nothing else than a convenient abstraction that in many applications is far from reality. The Hahn quantum calculus helps to bridge the gap between the two families of models: continuous and discrete. Quantum Variational Calculus is self-contained and unified in presentation. It provides an opportunity for an introduction to the quantum calculus of variations fo...

  15. Menstrual variation of breast volume and T{sub 2} relaxation times in cyclical mastalgia

    Energy Technology Data Exchange (ETDEWEB)

    Hussain, Zainab [Department of Medical Imaging, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom)], E-mail: zay@liverpool.ac.uk; Brooks, Jonathan [Magnetic Resonance and Image Analysis Research Centre, University of Liverpool, Johnstone Building, Brownlow Hill, P.O. Box 147, Liverpool, Merseyside L69 3GB (United Kingdom); Department of Human Anatomy and Genetics, University of Oxford, Oxford (United Kingdom); Percy, Dave [Centre for Operational Research and Applied Statistics, University of Salford, Salford, Greater Manchester M5 4WT (United Kingdom)

    2008-02-15

    Purpose: Hormonal activity causes breast volume to change during the menstrual cycle. One possible cause of this volume change is thought to be due to water retention or oedema within the tissues. We used magnetic resonance imaging (MRI) to study the variation in breast volume and {sup 1}H Magnetic Resonance Spectroscopy (MRS) to measure T{sub 2} relaxation times which are known to increase with increasing tissue water content. We hypothesised that an increase in breast volume will elevate T{sub 2} relaxation due to the presence of an increased water content within the breast. T{sub 2} Relaxation time and volume were studied in fifteen control subjects and in a cohort of eight patients with cyclical mastalgia in order to determine whether changes in breast volume and T{sub 2} relaxation times differed in controls and patients during menses, ovulation and premenses. Method: Breast volume was determined by the Cavalieri method in combination with point counting techniques on MR images and T{sub 2} relaxation times of the water and fat in a voxel of breast tissue were obtained using {sup 1}H Magnetic Resonance Spectroscopy (MRS). Results: Statistical analysis (ANOVA) demonstrated highly significant differences in breast volume between the three stages of the cycle (p < 0.0005) with breast volume being greatest premenstrually. Patients did not exhibit an increase in volume premenstrually, significantly above controls. T{sub 2} of fat or water did not depend on stage of cycle. T-tests demonstrated no significant differences in T{sub 2} of water or fat between patient and control groups. The average T{sub 2} relaxation time of water was lowest in the patient and control groups during ovulation and highest in the patient group during premenses. Conclusion: We have performed the first combined volumetric and spectroscopic study of women with cyclical mastalgia and demonstrated that the global changes in volumes and T{sub 2} were not significantly different from normal

  16. Parallel algorithm of real-time infrared image restoration based on total variation theory

    Science.gov (United States)

    Zhu, Ran; Li, Miao; Long, Yunli; Zeng, Yaoyuan; An, Wei

    2015-10-01

    Image restoration is a necessary preprocessing step for infrared remote sensing applications. Traditional methods allow us to remove the noise but penalize too much the gradients corresponding to edges. Image restoration techniques based on variational approaches can solve this over-smoothing problem for the merits of their well-defined mathematical modeling of the restore procedure. The total variation (TV) of infrared image is introduced as a L1 regularization term added to the objective energy functional. It converts the restoration process to an optimization problem of functional involving a fidelity term to the image data plus a regularization term. Infrared image restoration technology with TV-L1 model exploits the remote sensing data obtained sufficiently and preserves information at edges caused by clouds. Numerical implementation algorithm is presented in detail. Analysis indicates that the structure of this algorithm can be easily implemented in parallelization. Therefore a parallel implementation of the TV-L1 filter based on multicore architecture with shared memory is proposed for infrared real-time remote sensing systems. Massive computation of image data is performed in parallel by cooperating threads running simultaneously on multiple cores. Several groups of synthetic infrared image data are used to validate the feasibility and effectiveness of the proposed parallel algorithm. Quantitative analysis of measuring the restored image quality compared to input image is presented. Experiment results show that the TV-L1 filter can restore the varying background image reasonably, and that its performance can achieve the requirement of real-time image processing.

  17. Annual and inter-annual variations of 6.5-day-planetary-waves in MLT observed by TIMED/SABER

    Science.gov (United States)

    Huang, Yingying; Li, Huijun; Li, Chongyin; Zhang, Shaodong

    2017-04-01

    Annual and inter-annual variations of 6.5DWs in 20-110 km, 52°S-52°N, 2002-2016 are studied by using v2.0 TIMED/SABER kinetic temperature data. Firstly, global annual variations of 6.5DW's spectral power and amplitudes are obtained. Strong wave amplitudes emerge in 30°S/N-50°S/N, and peaks in altitude separate in stratosphere (40-50 km), mesosphere (80-90 km) and the lower thermosphere (100-110 km), respectively. Their annual variations are similar in both hemispheres, but different in altitude. In 40-50 km, the annual maximums emerge mostly in winters: Dec.-Jan. in the NH and Jul.-Aug. in the SH. In MLT, annual peaks arise twice in each half of year. In 80-90 km, they're mainly in equinoctial seasons and winters: May, Aug.-Sep. and Jan. in the NH and Feb., Nov. and May in the SH. In 100-110 km, they emerge mainly in equinoctial seasons: Apr.-May and Aug.-Sep. in the NH and Feb.-Mar. and Oct.-Nov. in the SH. Then, inter-annual variations of 6.5DW amplitudes during the 14-year period are studied. Frequency spectra of monthly-mean amplitudes show that, main dynamics in long-term variations of 6.5DWs are AO and SAO in both hemispheres. Besides, QBO are visible in both hemispheres and 4-month period signals are noticed in the NH in MLT. Amplitudes of SAO, AO and QBO are obtained by bandpass filter. Their amplitudes are comparable in stratosphere and mesosphere, and QBO signals are weaker than the others in the LT. Vertical variations both of SAO and AO amplitudes are very stable. AO structures have little inter-annual changes, while inter-annual variations of SAO are significant and are related with 6.5DW. It means that annual and inter-annual variations of 6.5DW are mainly controlled by AO and SAO, respectively. Although QBO signals are weaker and their variations are less regular than AO and SAO, their phases seems to relate with inter-annual variations of 6.5DW as well.

  18. Assessment of the Variation Associated with Repeated Measurement of Gastrointestinal Transit Times and Assessment of the Effect of Oral Ranitidine on Gastrointestinal Transit Times Using a Wireless Motility Capsule System in Dogs

    Directory of Open Access Journals (Sweden)

    Jonathan A. Lidbury

    2012-01-01

    Full Text Available This study aimed to evaluate the variation associated with repeated measurement of gastrointestinal (GI transit times and the effect of oral ranitidine on GI transit times in healthy dogs using a wireless motility capsule (WMC system. Eight privately owned healthy adult dogs were enrolled, and one developed diarrhea and was removed from the study. For the first 3 repetitions, each dog was fed a standard meal followed by oral administration of a WMC. For the 4th repetition, each dog was given ranitidine hydrochloride (75 mg PO every 12 hours prior to and during assessment of GI transit times. Mean between-subject coefficients of variation for gastric emptying time (GET, small and large bowel transit time (SLBTT, and total transit time (TTT were 26.9%, 32.3%, and 19.6%, respectively. Mean within-subject coefficients of variation for GET, SLBTT, and TTT were 9.3%, 19.6%, and 15.9%, respectively. Median GET, SLBTT, and TTT without ranitidine were 719, 1,636, and 2,735 minutes, respectively. Median GET, SLBTT, and TTT with ranitidine were 757, 1,227, and 2,083 minutes, respectively. No significant differences in GI transit times were found between any of the 4 repetitions. Under these experimental conditions, no significant effects of oral ranitidine on GI transit times were observed.

  19. Time variation in European carbon pass-through rates in electricity futures prices

    International Nuclear Information System (INIS)

    Huisman, Ronald; Kiliç, Mehtap

    2015-01-01

    The European Union Emissions Trading Scheme is a means to price emission allowances. Electricity market prices should reflect these market prices of emission allowances as they are a cost factor for power producers. The pass-through rate is the fraction of the emission allowance price that is passed through to electricity market prices. It is often measured and presented as an average or a fixed estimate over some time period. However, we expect that the pass-through rates should actually vary over time as electricity supply curves reflect the marginal costs of different producers that differ in emission intensity. We apply a Kalman Filter approach to observe pass-through rates in Germany and U.K. and find strong support for time varying instead of fixed pass-through rates. Although policy makers are interested in the impact of a policy on average, our results indicate that one needs to be careful with the time-frame over which pass-through rates are measured for policy evaluation, as an incorrect chosen evaluation period could cause an under- or overestimation of the pass-through rate. In addition, our model helps to provide policy makers with insight in the development of pass-through rates when market circumstances change with respect to power production. - Highlights: • We analyse the time-variation of the emission pass-through rate in power prices. • We examine historical futures prices for Germany and the U.K. • We test the hypothesis by using the Kalman Filter methodology. • Strong support is found that pass-through rates vary over time. • The chosen time-frame for pass-through rates is important for policy evaluation.

  20. A technique to detect periodic and non-periodic ultra-rapid flux time variations with standard radio-astronomical data

    Science.gov (United States)

    Borra, Ermanno F.; Romney, Jonathan D.; Trottier, Eric

    2018-06-01

    We demonstrate that extremely rapid and weak periodic and non-periodic signals can easily be detected by using the autocorrelation of intensity as a function of time. We use standard radio-astronomical observations that have artificial periodic and non-periodic signals generated by the electronics of terrestrial origin. The autocorrelation detects weak signals that have small amplitudes because it averages over long integration times. Another advantage is that it allows a direct visualization of the shape of the signals, while it is difficult to see the shape with a Fourier transform. Although Fourier transforms can also detect periodic signals, a novelty of this work is that we demonstrate another major advantage of the autocorrelation, that it can detect non-periodic signals while the Fourier transform cannot. Another major novelty of our work is that we use electric fields taken in a standard format with standard instrumentation at a radio observatory and therefore no specialized instrumentation is needed. Because the electric fields are sampled every 15.625 ns, they therefore allow detection of very rapid time variations. Notwithstanding the long integration times, the autocorrelation detects very rapid intensity variations as a function of time. The autocorrelation could also detect messages from Extraterrestrial Intelligence as non-periodic signals.

  1. Individual variation in habituation: behaviour over time toward different stimuli in threespine sticklebacks (Gasterosteus aculeatus)

    Science.gov (United States)

    Bell, Alison M.; Peeke, Harman V.S.

    2014-01-01

    Habituation, or the relatively permanent waning of a response as a result of repeated stimulation, is a form of behavioural plasticity that allows animals to filter out irrelevant stimuli and to focus selectively on important stimuli. Individuals that fail to habituate might be at a disadvantage if they continue to respond to irrelevant stimuli; therefore, habituation can have adaptive significance. In this study we compared rates of behaviour over time toward three different ecologically-relevant stimuli (food, a male intruder and a gravid female) in threespine sticklebacks (Gasterosteus aculeatus). We detected evidence for habituation to the stimuli, and males in this study were especially aggressive toward both male and female conspecifics. Although there were some clear temporal patterns that could be detected by looking at average behaviour, not all individuals behaved in the same ‘average’ way. We detected substantial inter-individual variation in behaviour toward all three stimuli, inter-individual variation in rates of habituation to both male and female conspecifics, but no evidence for correlations between behaviours across stimuli (behavioural syndromes). These results suggest that individual animals vary in rates of habituation, and prompt hypotheses about the causes and consequences of variation in rates of habituation. PMID:25678715

  2. Characterization of indoor aerosol temporal variations for the real-time management of indoor air quality

    Science.gov (United States)

    Ciuzas, Darius; Prasauskas, Tadas; Krugly, Edvinas; Sidaraviciute, Ruta; Jurelionis, Andrius; Seduikyte, Lina; Kauneliene, Violeta; Wierzbicka, Aneta; Martuzevicius, Dainius

    2015-10-01

    The study presents the characterization of dynamic patterns of indoor particulate matter (PM) during various pollution episodes for real-time IAQ management. The variation of PM concentrations was assessed for 20 indoor activities, including cooking related sources, other thermal sources, personal care and household products. The pollution episodes were modelled in full-scale test chamber representing a standard usual living room with the forced ventilation of 0.5 h-1. In most of the pollution episodes, the maximum concentration of particles in exhaust air was reached within a few minutes. The most rapid increase in particle concentration was during thermal source episodes such as candle, cigarette, incense stick burning and cooking related sources, while the slowest decay of concentrations was associated with sources, emitting ultrafine particle precursors, such as furniture polisher spraying, floor wet mopping with detergent etc. Placement of the particle sensors in the ventilation exhaust vs. in the centre of the ceiling yielded comparable results for both measured maximum concentrations and temporal variations, indicating that both locations were suitable for the placement of sensors for the management of IAQ. The obtained data provides information that may be utilized considering measurements of aerosol particles as indicators for the real-time management of IAQ.

  3. Comparative analysis of long-time variations of multicomponent ion ring current according to data of geostationary Gorizont satellite

    International Nuclear Information System (INIS)

    Kovtyukh, A.S.; Panasyuk, M.I.; Vlasova, N.A.; Sosnovets, Eh.N.

    1990-01-01

    Long-time variations of the fluxes of the H + , [N,O] 2+ and [C,N,O] 6 6 + ions with energy E/Q∼60-120 keV/e measured by the GORIZONT (1985-07A) satellite in the geostationary orbit at noon time are analyzed. The results are dsicussed and are compared with current models of the formation of the Earth's ion ring current

  4. Inter-fraction bladder filling variations and time trends for cervical cancer patients assessed with a portable 3-dimensional ultrasound bladder scanner

    International Nuclear Information System (INIS)

    Ahmad, Rozilawati; Hoogeman, Mischa S.; Quint, Sandra; Mens, Jan Willem; Pree, Ilse de; Heijmen, Ben J.M.

    2008-01-01

    Background and Purpose: For cervical cancer patients, bladder filling variations may result in inadequate EBRT target coverage, unless large safety margins are used. For a group of patients who received full bladder instructions, inter-fraction variations and time trends in bladder volume were quantified, and a 3D ultrasound (US) scanner was tested for on-line bladder volume measurements. Methods and materials: For 24 patients, the bladder volume was measured with US at the time of the planning CT scan, and twice weekly during the course of RT. Comparisons of US with planning CT were used to assess the bladder scanner accuracy. Patients were treated in prone on a belly board, EPID images were acquired to correlate set-up errors with bladder filling variations. Results: Measured US and CT bladder volumes were strongly correlated (R = 0.97, slope 1.1 ± 0.1). The population mean bladder volume at planning of 378 ± 209 ml (1 SD) reduced to 109 ± 88 ml (1 SD) in week 6, a reduction by 71% (average reduction 46 ml/week), revealing a large inter-fraction time trend. Intra-patient variation in bladder volume during RT was 168 ml (1 SD) (range 70-266 ml). Rotation around the LR axis was significantly correlated with bladder volume changes. Conclusions: Despite a full bladder instruction, bladder volumes reduced dramatically during treatment, implying large time trends in target position of these patients. The portable US scanner provides a quick and reliable measurement of the bladder volume, which might assist future online treatment adaptation

  5. Preanalytical and analytical variation of surface-enhanced laser desorption-ionization time-of-flight mass spectrometry of human serum

    DEFF Research Database (Denmark)

    Albrethsen, Jakob; Bøgebo, Rikke; Olsen, Jesper

    2006-01-01

    BACKGROUND: Surface-enhanced laser desorption-ionization time-of-flight (SELDI-TOF) mass spectrometry of human serum is a potential diagnostic tool in human diseases. In the present study, the preanalytical and analytical variation of SELDI-TOF mass spectrometry of serum was assessed in healthy...... was 18% (6%-34%, n=4) for 16 peaks, and inter-individual CV was 38% (16%-56%, n=16) for 20 peaks. CONCLUSIONS: The pre-analytical and analytical conditions of SELDI-TOF mass spectrometry of serum have a significant impact on the protein peaks, with the number of peaks low and the assay variation high...

  6. Surface Temperature Variation Prediction Model Using Real-Time Weather Forecasts

    Science.gov (United States)

    Karimi, M.; Vant-Hull, B.; Nazari, R.; Khanbilvardi, R.

    2015-12-01

    Combination of climate change and urbanization are heating up cities and putting the lives of millions of people in danger. More than half of the world's total population resides in cities and urban centers. Cities are experiencing urban Heat Island (UHI) effect. Hotter days are associated with serious health impacts, heart attaches and respiratory and cardiovascular diseases. Densely populated cities like Manhattan, New York can be affected by UHI impact much more than less populated cities. Even though many studies have been focused on the impact of UHI and temperature changes between urban and rural air temperature, not many look at the temperature variations within a city. These studies mostly use remote sensing data or typical measurements collected by local meteorological station networks. Local meteorological measurements only have local coverage and cannot be used to study the impact of UHI in a city and remote sensing data such as MODIS, LANDSAT and ASTER have with very low resolution which cannot be used for the purpose of this study. Therefore, predicting surface temperature in urban cities using weather data can be useful.Three months of Field campaign in Manhattan were used to measure spatial and temporal temperature variations within an urban setting by placing 10 fixed sensors deployed to measure temperature, relative humidity and sunlight. Fixed instrument shelters containing relative humidity, temperature and illumination sensors were mounted on lampposts in ten different locations in Manhattan (Vant-Hull et al, 2014). The shelters were fixed 3-4 meters above the ground for the period of three months from June 23 to September 20th of 2013 making measurements with the interval of 3 minutes. These high resolution temperature measurements and three months of weather data were used to predict temperature variability from weather forecasts. This study shows that the amplitude of spatial and temporal variation in temperature for each day can be predicted

  7. Seasonal variation of residence time in spring and groundwater evaluated by CFCs and numerical simulation in mountainous headwater catchment

    Science.gov (United States)

    Tsujimura, Maki; Watanabe, Yasuto; Ikeda, Koichi; Yano, Shinjiro; Abe, Yutaka

    2016-04-01

    Headwater catchments in mountainous region are the most important recharge area for surface and subsurface waters, additionally time information of the water is principal to understand hydrological processes in the catchments. However, there have been few researches to evaluate variation of residence time of subsurface water in time and space at the mountainous headwaters especially with steep slope. We investigated the temporal variation of the residence time of the spring and groundwater with tracing of hydrological flow processes in mountainous catchments underlain by granite, Yamanashi Prefecture, central Japan. We conducted intensive hydrological monitoring and water sampling of spring, stream and ground waters in high-flow and low-flow seasons from 2008 through 2013 in River Jingu Watershed underlain by granite, with an area of approximately 15 km2 and elevation ranging from 950 m to 2000 m. The CFCs, stable isotopic ratios of oxygen-18 and deuterium, inorganic solute constituent concentrations were determined on all water samples. Also, a numerical simulation was conducted to reproduce of the average residence times of the spring and groundwater. The residence time of the spring water estimated by the CFCs concentration ranged from 10 years to 60 years in space within the watershed, and it was higher (older) during the low flow season and lower (younger) during the high flow season. We tried to reproduce the seasonal change of the residence time in the spring water by numerical simulation, and the calculated residence time of the spring water and discharge of the stream agreed well with the observed values. The groundwater level was higher during the high flow season and the groundwater dominantly flowed through the weathered granite with higher permeability, whereas that was lower during the low flow season and that flowed dominantly through the fresh granite with lower permeability. This caused the seasonal variation of the residence time of the spring

  8. The variation of the density functions on chaotic spheres in chaotic space-like Minkowski space time

    International Nuclear Information System (INIS)

    El-Ahmady, A.E.

    2007-01-01

    In this article we introduce types of chaotic spheres in chaotic space-like Minkowski space time M n+1 . The variations of the density functions under the folding of these chaotic spheres are defined. The foldings restriction imposed on the density function are also discussed. The relations between the folding of geometry and pure chaotic manifolds are deduced. Some theorems concerning these relations are presented

  9. Existence of evolutionary variational solutions via the calculus of variations

    Science.gov (United States)

    Bögelein, Verena; Duzaar, Frank; Marcellini, Paolo

    In this paper we introduce a purely variational approach to time dependent problems, yielding the existence of global parabolic minimizers, that is ∫0T ∫Ω [uṡ∂tφ+f(x,Du)] dx dt⩽∫0T ∫Ω f(x,Du+Dφ) dx dt, whenever T>0 and φ∈C0∞(Ω×(0,T),RN). For the integrand f:Ω×R→[0,∞] we merely assume convexity with respect to the gradient variable and coercivity. These evolutionary variational solutions are obtained as limits of maps depending on space and time minimizing certain convex variational functionals. In the simplest situation, with some growth conditions on f, the method provides the existence of global weak solutions to Cauchy-Dirichlet problems of parabolic systems of the type ∂tu-divDξf(x,Du)=0 in Ω×(0,∞).

  10. Using a "time machine" to test for local adaptation of aquatic microbes to temporal and spatial environmental variation.

    Science.gov (United States)

    Fox, Jeremy W; Harder, Lawrence D

    2015-01-01

    Local adaptation occurs when different environments are dominated by different specialist genotypes, each of which is relatively fit in its local conditions and relatively unfit under other conditions. Analogously, ecological species sorting occurs when different environments are dominated by different competing species, each of which is relatively fit in its local conditions. The simplest theory predicts that spatial, but not temporal, environmental variation selects for local adaptation (or generates species sorting), but this prediction is difficult to test. Although organisms can be reciprocally transplanted among sites, doing so among times seems implausible. Here, we describe a reciprocal transplant experiment testing for local adaptation or species sorting of lake bacteria in response to both temporal and spatial variation in water chemistry. The experiment used a -80°C freezer as a "time machine." Bacterial isolates and water samples were frozen for later use, allowing transplantation of older isolates "forward in time" and newer isolates "backward in time." Surprisingly, local maladaptation predominated over local adaptation in both space and time. Such local maladaptation may indicate that adaptation, or the analogous species sorting process, fails to keep pace with temporal fluctuations in water chemistry. This hypothesis could be tested with more finely resolved temporal data. © 2014 The Author(s). Evolution © 2014 The Society for the Study of Evolution.

  11. The "Nursing Home Compare" measure of urinary/fecal incontinence: cross-sectional variation, stability over time, and the impact of case mix.

    Science.gov (United States)

    Li, Yue; Schnelle, John; Spector, William D; Glance, Laurent G; Mukamel, Dana B

    2010-02-01

    To assess the impact of facility case mix on cross-sectional variations and short-term stability of the "Nursing Home Compare" incontinence quality measure (QM) and to determine whether multivariate risk adjustment can minimize such impacts. Retrospective analyses of the 2005 national minimum data set (MDS) that included approximately 600,000 long-term care residents in over 10,000 facilities in each quarterly sample. Mixed logistic regression was used to construct the risk-adjusted QM (nonshrinkage estimator). Facility-level ordinary least-squares models and adjusted R(2) were used to estimate the impact of case mix on cross-sectional and short-term longitudinal variations of currently published and risk-adjusted QMs. At least 50 percent of the cross-sectional variation and 25 percent of the short-term longitudinal variation of the published QM are explained by facility case mix. In contrast, the cross-sectional and short-term longitudinal variations of the risk-adjusted QM are much less susceptible to case-mix variations (adjusted R(2)case-mix variations across facilities and over time, and therefore it may be biased. This issue can be largely addressed by multivariate risk adjustment using risk factors available in the MDS.

  12. Consideration of the accuracy by variation of respiration in real-time position management respiratory gating system

    International Nuclear Information System (INIS)

    Na, Jun Young; Kang, Tae Young; Beak, Geum Mun; Kwon, Gyeong Tae

    2013-01-01

    Respiratory Gated Radiation Therapy (RGRT) has been carried out using RPM (Real-time Position Management) Respiratory Gating System (version 1.7.5, varian, USA) in Asan Medical Center. This study was to analyze and evaluate the accuracy of Respiratory Gated Radiation Therapy (RGRT) according to variation of respiration. Making variation of respiration using Motion Phantom:QUASAR Programmable Respiratory Motion Phantom (Moudus Medical Device Inc. CANADA) able to adjust respiration pattern randomly was varying period, amplitude and baseline by analyze 50 patient's respiration of lung and liver cancer. One of the variations of respiration is baseline shift gradually downward per 0.01 cm, 0.03 cm, 0.05 cm. The other variation of respiration is baseline shift accidently downward per 0.2 cm, 0.4 cm, 0.6 cm, 0.8 cm. Experiments were performed in the same way that is used RPM Respiratory Gating System (phase gating, usually 30-70% gating) in Asan Medical Center. It was all exposed radiation under one of the conditions of baseline shift gradually downward per 0.01 cm, 0.03 cm, 0.05 cm. Under the other condition of baseline shift accidently downward per 0.2 cm, 0.4 cm, 0.6 cm, 0.8 cm equally radiation was exposed. The variations of baseline shifts didn't accurately reflect on phase gating in RPM Respiratory Gating System. This inexactitude makes serious uncertainty in Respiratory Gated Radiation Therapy. So, Must be stabilized breathing of patient before conducting Respiratory Gated Radiation Therapy. also must be monitored breathing of patient in the middle of treatment. If you observe considerable changes of breathing when conducting Respiratory Gated Radiation Therapy. Stopping treatment immediately and then must be need to recheck treatment site using fluoroscopy. If patient's respiration rechecked using fluoroscopy restabilize, it is possible to restart Respiratory Gated Radiation Therapy

  13. Effects of detector-source distance and detector bias voltage variations on time resolution of general purpose plastic scintillation detectors.

    Science.gov (United States)

    Ermis, E E; Celiktas, C

    2012-12-01

    Effects of source-detector distance and the detector bias voltage variations on time resolution of a general purpose plastic scintillation detector such as BC400 were investigated. (133)Ba and (207)Bi calibration sources with and without collimator were used in the present work. Optimum source-detector distance and bias voltage values were determined for the best time resolution by using leading edge timing method. Effect of the collimator usage on time resolution was also investigated. Copyright © 2012 Elsevier Ltd. All rights reserved.

  14. Gene : CBRC-XTRO-01-2206 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-XTRO-01-2206 Novel UN D UNKNOWN VTP3_TTV1V 1e-11 32% dbj|BAC87052.1| unnamed protein product [Homo sapi...XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLYAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYM...PTHLPPLAPTCPHTCPHWHLHAHTPAPTDTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPHWHLHAHTPAPIGTYMPTHLPPLAPTCPHTCPH ...

  15. Fast solution of Cahn–Hilliard variational inequalities using implicit time discretization and finite elements

    KAUST Repository

    Bosch, Jessica

    2014-04-01

    We consider the efficient solution of the Cahn-Hilliard variational inequality using an implicit time discretization, which is formulated as an optimal control problem with pointwise constraints on the control. By applying a semi-smooth Newton method combined with a Moreau-Yosida regularization technique for handling the control constraints we show superlinear convergence in function space. At the heart of this method lies the solution of large and sparse linear systems for which we propose the use of preconditioned Krylov subspace solvers using an effective Schur complement approximation. Numerical results illustrate the competitiveness of this approach. © 2014 Elsevier Inc.

  16. Insignificant disease among men with intermediate-risk prostate cancer.

    Science.gov (United States)

    Hong, Sung Kyu; Vertosick, Emily; Sjoberg, Daniel D; Scardino, Peter T; Eastham, James A

    2014-12-01

    A paucity of data exists on the insignificant disease potentially suitable for active surveillance (AS) among men with intermediate-risk prostate cancer (PCa). We tried to identify pathologically insignificant disease and its preoperative predictors in men who underwent radical prostatectomy (RP) for intermediate-risk PCa. We analyzed data of 1,630 men who underwent RP for intermediate-risk disease. Total tumor volume (TTV) data were available in 332 men. We examined factors associated with classically defined pathologically insignificant cancer (organ-confined disease with TTV ≤0.5 ml with no Gleason pattern 4 or 5) and pathologically favorable cancer (organ-confined disease with no Gleason pattern 4 or 5) potentially suitable for AS. Decision curve analysis was used to assess clinical utility of a multivariable model including preoperative variables for predicting pathologically unfavorable cancer. In the entire cohort, 221 of 1,630 (13.6 %) total patients had pathologically favorable cancer. Among 332 patients with TTV data available, 26 (7.8 %) had classically defined pathologically insignificant cancer. Between threshold probabilities of 20 and 40 %, decision curve analysis demonstrated that using multivariable model to identify AS candidates would not provide any benefit over simply treating all men who have intermediate-risk disease with RP. Although a minority of patients with intermediate-risk disease may harbor pathologically favorable or insignificant cancer, currently available conventional tools are not sufficiently able to identify those patients.

  17. TESS Follow-up Observing Program (TFOP) Working Group:A Mission-led Effort to Coordinate Community Resources to Confirm TESS Planets

    Science.gov (United States)

    Collins, Karen; Quinn, Samuel N.; Latham, David W.; Christiansen, Jessie; Ciardi, David; Dragomir, Diana; Crossfield, Ian; Seager, Sara

    2018-01-01

    The Transiting Exoplanet Survey Satellite (TESS) will observe most of the sky over a period of two years. Observations will be conducted in 26 sectors of sky coverage and each sector will be observed for ~27 days. Data from each sector is expected to produce hundreds of transiting planet candidates (PCs) per month and thousands over the two year nominal mission. The TFOP Working Group (WG) is a mission-led effort organized to efficiently provide follow-up observations to confirm candidates as planets or reject them as false positives. The primary goal of the TFOP WG is to facilitate achievement of the Level One Science Requirement to measure masses for 50 transiting planets smaller than 4 Earth radii. Secondary goals are to serve any science coming out of TESS and to foster communication and coordination both within the TESS Science Team and with the community at large. The TFOP WG is organized as five Sub Groups (SGs). SG1 will provide seeing-limited imaging to measure blending within a candidate's aperture and time-series photometry to identify false positives and in some cases to improve ephemerides, light curves, and/or transit time variation (TTV) measurements. SG2 will provide reconnaissance spectroscopy to identify astrophysical false positives and to contribute to improved host star parameters. SG3 will provide high-resolution imaging with adaptive optics, speckle imaging, and lucky imaging to detect nearby objects. SG4 will provide precise radial velocities to derive orbits of planet(s) and measure their mass(es) relative to the host star. SG5 will provide space-based photometry to confirm and/or improve the TESS photometric ephemerides, and will also provide improved light curves for transit events or TTV measurements. We describe the TFOP WG observing and planet confirmation process, the five SGs that comprise the TFOP WG, ExoFOP-TESS and other web-based tools being developed to support TFOP WG observers, other advantages of joining the TFOP WG, the TFOP

  18. Time resolved FTIR study of the catalytic CO oxidation under periodic variation of the reactant concentration

    Energy Technology Data Exchange (ETDEWEB)

    Kritzenberger, J; Wokaun, A [Paul Scherrer Inst. (PSI), Villigen (Switzerland)

    1997-06-01

    Oxidation of CO over palladium/zirconia catalyst obtained from an amorphous Pd{sub 25}Zr{sub 75} precursor was investigated by time resolved FTIR spectroscopy. Sine wave shaped modulation of the reactant concentration, i.e. variation of CO or O{sub 2} partial pressure, was used to induce variations of the IR signals of product (CO{sub 2}) and unconverted reactant (CO), which were detected in a multi-pass absorption cell. The phase shift {phi} between external perturbation and variation of the CO{sub 2} signal was examined in dependence on temperature (100{sup o}C{<=}T{<=}350{sup o}C) and modulation frequency (1.39x10{sup -4}Hz{<=}{omega}{<=}6.67x10{sup -2}Hz). From the phase shift values, a simple Eley-Rideal mechanism is excluded, and the rate limiting step of the Langmuir-Hinshelwood mechanism for the CO oxidation may be identified. Adsorption and possible surface movement of CO to the actual reaction site determine the rate of the CO oxidation on the palladium/zirconia catalyst used in our study. The introduction of an external perturbation is a first step towards the application of two-dimensional infrared spectroscopy to heterogeneous catalyzed reactions. (author) 3 figs., 4 refs.

  19. Drift time variations in CdZnTe detectors measured with alpha-particles: Their correlation with the detector’s responses

    Energy Technology Data Exchange (ETDEWEB)

    Bolotnikov A. E.; Butcher, J.; Hamade, M.; Petryk, M.; Bolotnikov, A.; Camarda, G.; Cui, Y.; Hossain, A.; Kim, K.; Yang, G.; and James, R.

    2012-05-14

    Homogeneity of properties related to material crystallinity is a critical parameter for achieving high-performance CdZnTe (CZT) radiation detectors. Unfortunately, this requirement is not always satisfied in today's commercial CZT material due to high concentrations of extended defects, in particular subgrain boundaries, which are believed to be part of the causes hampering the energy resolution and efficiency of CZT detectors. In the past, the effects of subgrain boundaries have been studied in Si, Ge and other semiconductors. It was demonstrated that subgrain boundaries tend to accumulate secondary phases and impurities causing inhomogeneous distributions of trapping centers. It was also demonstrated that subgrain boundaries result in local perturbations of the electric field, which affect the carrier transport and other properties of semiconductor devices. The subgrain boundaries in CZT material likely behave in a similar way, which makes them responsible for variations in the electron drift time and carrier trapping in CZT detectors. In this work, we employed the transient current technique to measure variations in the electron drift time and related the variations to the device performances and subgrain boundaries, whose presence in the crystals were confirmed with white beam X-ray diffraction topography and infrared transmission microscopy.

  20. On the Time Variation of Dust Extinction and Gas Absorption for Type Ia Supernovae Observed Through Non-uniform Interstellar Medium

    Science.gov (United States)

    Huang, Xiaosheng; Aldering, Gregory; Biederman, Moriah; Herger, Brendan

    2018-01-01

    For Type Ia supernovae (SNe Ia) observed through a non-uniform interstellar medium (ISM) in its host galaxy, we investigate whether the non-uniformity can cause observable time variations in dust extinction and in gas absorption due to the expansion of the SN photosphere with time. We show that, owing to the steep spectral index of the ISM density power spectrum, sizable density fluctuation amplitudes at the length scale of typical ISM structures (>~ 10 pc) will translate to much smaller fluctuations on the scales of a SN photosphere. Therefore the typical amplitude of time variation due to non-uniform ISM, of absorption equivalent widths and of extinction, would be small. As a result, we conclude that non-uniform ISM density should not impact cosmology measurements based on SNe Ia. We apply our predictions based on the ISM density power law power spectrum to the observations of two highly reddened SNe Ia, SN 2012cu and SN 2014J.

  1. On the Time Variation of Dust Extinction and Gas Absorption for Type Ia Supernovae Observed through a Nonuniform Interstellar Medium

    Science.gov (United States)

    Huang, X.; Aldering, G.; Biederman, M.; Herger, B.

    2017-11-01

    For Type Ia supernovae (SNe Ia) observed through a nonuniform interstellar medium (ISM) in its host galaxy, we investigate whether the nonuniformity can cause observable time variations in dust extinction and in gas absorption due to the expansion of the SN photosphere with time. We show that, owing to the steep spectral index of the ISM density power spectrum, sizable density fluctuation amplitudes at the length scale of typical ISM structures (≳ 10 {pc}) will translate to much smaller fluctuations on the scales of an SN photosphere. Therefore, the typical amplitude of time variation due to a nonuniform ISM, of absorption equivalent widths, and of extinction, would be small. As a result, we conclude that nonuniform ISM density should not impact cosmology measurements based on SNe Ia. We apply our predictions based on the ISM density power-law power spectrum to the observations of two highly reddened SNe Ia, SN 2012cu and SN 2014J.

  2. Seasonal variations of aerosol residence time in the lower atmospheric boundary layer

    International Nuclear Information System (INIS)

    Ahmed, A.A.; Mohamed, A.; Ali, A.E.; Barakat, A.; Abd El-Hady, M.; El-Hussein, A.

    2004-01-01

    During a one year period, from Jan. 2002 up to Dec. 2002, approximately 130 air samples were analyzed to determine the atmospheric air activity concentrations of short- and long-lived ( 222 Rn) decay products 214 Pb and 210 Pb. The samples were taken by using a single-filter technique and γ-spectrometry was applied to determine the activity concentrations. A seasonal fluctuation in the concentration of 214 Pb and 210 Pb in surface air was observed. The activity concentrations of both radionuclides were observed to be relatively higher during the winter/autumn season than in spring/summer season. The mean activity concentration of 214 Pb and 210 Pb within the whole year was found to be 1.4±0.27 Bq m -3 and 1.2±0.15 mBq m -3 , respectively. Different 210 Pb: 214 Pb activity ratios during the year varied between 1.78x10 -4 and 1.6x10 -3 with a mean value of 8.9x10 -4 ±7.6x10 -5 . From the ratio between the activity concentrations of the radon decay products 214 Pb and 210 Pb a mean residence time (MRT) of aerosol particles in the atmosphere of about 10.5±0.91 d could be estimated. The seasonal variation pattern shows relatively higher values of MRT in spring/summer season than in winter/autumn season. The MRT data together with relative humidity (RH), air temperature (T) and wind speed (WS), were used for a comprehensive regression analysis of its seasonal variation in the atmospheric air

  3. Solar ultraviolet irradiance variations: a review

    International Nuclear Information System (INIS)

    Lean, J.

    1987-01-01

    Despite the geophysical importance of solar ultraviolet radiation, specific aspects of its temporal variations have not yet been adequately determined experimentally, nor are the mechanisms for the variability completely understood. Satellite observations have verified the reality of solar ultraviolet irradiance variations over time scales of days and months, and model calculations have confirmed the association of these short-term variations with the evolution and rotation of regions of enhanced magnetic activity on the solar disc. However, neither rocket nor satellite measurements have yet been made with sufficient accuracy and regularity to establish unequivocally the nature of the variability over the longer time of the 11-year solar cycle. The comparative importance for the long-term variations of local regions of enhanced magnetic activity and global scale activity perturbations is still being investigated. Solar ultraviolet irradiance variations over both short and long time scales are reviewed, with emphasis on their connection to solar magnetic activity. Correlations with ground-based measures of solar variability are examined because of the importance of the ground-based observations as historical proxies of ultraviolet irradiance variations. Current problems in understanding solar ultraviolet irradiance variations are discussed, and the measurements planned for solar cycle 22, which may resolve these problems, are briefly described. copyright American Geophysical Union 1987

  4. TIME VARIATION AND ASYMMETRY IN THE WORLD PRICE OF COVARIANCE RISK: THE IMPLICATIONS FOR INTERNATIONAL DIVERSIFICATION

    OpenAIRE

    Olan T. Henry; Nilss Olekalns; Kalvinder Shields

    2004-01-01

    The International Capital Asset Pricing Model measures country risk in terms of the conditional covariance of national returns with the world return. Using impulse responses from a multivariate nonlinear model we provide evidence of time variation and asymmetry in the measure of country risk. and the implied benefit to international diversification. The evidence implies that the price of risk and the benefits from diversification may differ in a statistically and economically meaningful fashi...

  5. Millennial-scale climate variations recorded in Early Pliocene colour reflectance time series from the lacustrine Ptolemais Basin (NW Greece)

    Science.gov (United States)

    Steenbrink, J.; Kloosterboer-van Hoeve, M. L.; Hilgen, F. J.

    2003-03-01

    Quaternary climate proxy records show compelling evidence for climate variability on time scales of a few thousand years. The causes for these millennial-scale or sub-Milankovitch cycles are still poorly understood, not least due to the complex feedback mechanisms of large ice sheets during the Quaternary. We present evidence of millennial-scale climate variability in Early Pliocene lacustrine sediments from the intramontane Ptolemais Basin in northwestern Greece. The sediments are well exposed in a series of open-pit lignite mines and exhibit a distinct millennial-scale sedimentary cyclicity of alternating lignites and lacustrine marl beds that resulted from precession-induced variations in climate. The higher-frequency, millennial-scale cyclicity is particularly prominent within the grey-coloured marl segment of individual cycles. A stratigraphic interval of ˜115 ka, covering five precession-induced sedimentary cycles, was studied in nine parallel sections from two open-pit lignite mines located several km apart. High-resolution colour reflectance records were used to quantify the within-cycle variability and to determine its lateral continuity. Much of the within-cycle variability could be correlated between the parallel sections, even in fine detail, which suggests that these changes reflect basin-wide variations in environmental conditions related to (regional) climate fluctuations. Interbedded volcanic ash beds demonstrate the synchronicity of these fluctuations and spectral analysis of the reflectance time series shows a significant concentration of within-cycle variability at periods of ˜11, ˜5.5 and ˜2 ka. The occurrence of variability at such time scales at times before the intensification of the Northern Hemisphere glaciation suggests that they cannot solely have resulted from internal ice-sheet dynamics. Possible candidates include harmonics or combination tones of the main orbital cycles, variations in solar output or periodic motions of the Earth

  6. Dynamic linear modeling of monthly electricity demand in Japan: Time variation of electricity conservation effect.

    Science.gov (United States)

    Honjo, Keita; Shiraki, Hiroto; Ashina, Shuichi

    2018-01-01

    After the severe nuclear disaster in Fukushima, which was triggered by the Great East Japan earthquake in March 2011, nuclear power plants in Japan were temporarily shut down for mandatory inspections. To prevent large-scale blackouts, the Japanese government requested companies and households to reduce electricity consumption in summer and winter. It is reported that the domestic electricity demand had a structural decrease because of the electricity conservation effect (ECE). However, quantitative analysis of the ECE is not sufficient, and especially time variation of the ECE remains unclear. Understanding the ECE is important because Japan's NDC (nationally determined contribution) assumes the reduction of CO2 emissions through aggressive energy conservation. In this study, we develop a time series model of monthly electricity demand in Japan and estimate time variation of the ECE. Moreover, we evaluate the impact of electricity conservation on CO2 emissions from power plants. The dynamic linear model is used to separate the ECE from the effects of other irrelevant factors (e.g. air temperature, economic production, and electricity price). Our result clearly shows that consumers' electricity conservation behavior after the earthquake was not temporary but became established as a habit. Between March 2011 and March 2016, the ECE on industrial electricity demand ranged from 3.9% to 5.4%, and the ECE on residential electricity demand ranged from 1.6% to 7.6%. The ECE on the total electricity demand was estimated at 3.2%-6.0%. We found a seasonal pattern that the residential ECE in summer is higher than that in winter. The emissions increase from the shutdown of nuclear power plants was mitigated by electricity conservation. The emissions reduction effect was estimated at 0.82 MtCO2-2.26 MtCO2 (-4.5% on average compared to the zero-ECE case). The time-varying ECE is necessary for predicting Japan's electricity demand and CO2 emissions after the earthquake.

  7. Dynamic linear modeling of monthly electricity demand in Japan: Time variation of electricity conservation effect.

    Directory of Open Access Journals (Sweden)

    Keita Honjo

    Full Text Available After the severe nuclear disaster in Fukushima, which was triggered by the Great East Japan earthquake in March 2011, nuclear power plants in Japan were temporarily shut down for mandatory inspections. To prevent large-scale blackouts, the Japanese government requested companies and households to reduce electricity consumption in summer and winter. It is reported that the domestic electricity demand had a structural decrease because of the electricity conservation effect (ECE. However, quantitative analysis of the ECE is not sufficient, and especially time variation of the ECE remains unclear. Understanding the ECE is important because Japan's NDC (nationally determined contribution assumes the reduction of CO2 emissions through aggressive energy conservation. In this study, we develop a time series model of monthly electricity demand in Japan and estimate time variation of the ECE. Moreover, we evaluate the impact of electricity conservation on CO2 emissions from power plants. The dynamic linear model is used to separate the ECE from the effects of other irrelevant factors (e.g. air temperature, economic production, and electricity price. Our result clearly shows that consumers' electricity conservation behavior after the earthquake was not temporary but became established as a habit. Between March 2011 and March 2016, the ECE on industrial electricity demand ranged from 3.9% to 5.4%, and the ECE on residential electricity demand ranged from 1.6% to 7.6%. The ECE on the total electricity demand was estimated at 3.2%-6.0%. We found a seasonal pattern that the residential ECE in summer is higher than that in winter. The emissions increase from the shutdown of nuclear power plants was mitigated by electricity conservation. The emissions reduction effect was estimated at 0.82 MtCO2-2.26 MtCO2 (-4.5% on average compared to the zero-ECE case. The time-varying ECE is necessary for predicting Japan's electricity demand and CO2 emissions after the

  8. Dynamic linear modeling of monthly electricity demand in Japan: Time variation of electricity conservation effect

    Science.gov (United States)

    Shiraki, Hiroto; Ashina, Shuichi

    2018-01-01

    After the severe nuclear disaster in Fukushima, which was triggered by the Great East Japan earthquake in March 2011, nuclear power plants in Japan were temporarily shut down for mandatory inspections. To prevent large-scale blackouts, the Japanese government requested companies and households to reduce electricity consumption in summer and winter. It is reported that the domestic electricity demand had a structural decrease because of the electricity conservation effect (ECE). However, quantitative analysis of the ECE is not sufficient, and especially time variation of the ECE remains unclear. Understanding the ECE is important because Japan’s NDC (nationally determined contribution) assumes the reduction of CO2 emissions through aggressive energy conservation. In this study, we develop a time series model of monthly electricity demand in Japan and estimate time variation of the ECE. Moreover, we evaluate the impact of electricity conservation on CO2 emissions from power plants. The dynamic linear model is used to separate the ECE from the effects of other irrelevant factors (e.g. air temperature, economic production, and electricity price). Our result clearly shows that consumers’ electricity conservation behavior after the earthquake was not temporary but became established as a habit. Between March 2011 and March 2016, the ECE on industrial electricity demand ranged from 3.9% to 5.4%, and the ECE on residential electricity demand ranged from 1.6% to 7.6%. The ECE on the total electricity demand was estimated at 3.2%–6.0%. We found a seasonal pattern that the residential ECE in summer is higher than that in winter. The emissions increase from the shutdown of nuclear power plants was mitigated by electricity conservation. The emissions reduction effect was estimated at 0.82 MtCO2–2.26 MtCO2 (−4.5% on average compared to the zero-ECE case). The time-varying ECE is necessary for predicting Japan’s electricity demand and CO2 emissions after the

  9. Time Resolved Digital PIV Measurements of Flow Field Cyclic Variation in an Optical IC Engine

    Energy Technology Data Exchange (ETDEWEB)

    Jarvis, S; Justham, T; Clarke, A; Garner, C P; Hargrave, G K; Halliwell, N A [Wolfson School of Mechanical and Manufacturing Engineering, Loughborough University, Loughborough, Leicestershire, LE11 3TU (United Kingdom)

    2006-07-15

    Time resolved digital particle image velocimetry (DPIV) experimental data is presented for the in-cylinder flow field development of a motored four stroke spark ignition (SI) optical internal combustion (IC) engine. A high speed DPIV system was employed to quantify the velocity field development during the intake and compression stroke at an engine speed of 1500 rpm. The results map the spatial and temporal development of the in-cylinder flow field structure allowing comparison between traditional ensemble average and cycle average flow field structures. Conclusions are drawn with respect to engine flow field cyclic variations.

  10. Time Resolved Digital PIV Measurements of Flow Field Cyclic Variation in an Optical IC Engine

    International Nuclear Information System (INIS)

    Jarvis, S; Justham, T; Clarke, A; Garner, C P; Hargrave, G K; Halliwell, N A

    2006-01-01

    Time resolved digital particle image velocimetry (DPIV) experimental data is presented for the in-cylinder flow field development of a motored four stroke spark ignition (SI) optical internal combustion (IC) engine. A high speed DPIV system was employed to quantify the velocity field development during the intake and compression stroke at an engine speed of 1500 rpm. The results map the spatial and temporal development of the in-cylinder flow field structure allowing comparison between traditional ensemble average and cycle average flow field structures. Conclusions are drawn with respect to engine flow field cyclic variations

  11. Time Resolved Digital PIV Measurements of Flow Field Cyclic Variation in an Optical IC Engine

    Science.gov (United States)

    Jarvis, S.; Justham, T.; Clarke, A.; Garner, C. P.; Hargrave, G. K.; Halliwell, N. A.

    2006-07-01

    Time resolved digital particle image velocimetry (DPIV) experimental data is presented for the in-cylinder flow field development of a motored four stroke spark ignition (SI) optical internal combustion (IC) engine. A high speed DPIV system was employed to quantify the velocity field development during the intake and compression stroke at an engine speed of 1500 rpm. The results map the spatial and temporal development of the in-cylinder flow field structure allowing comparison between traditional ensemble average and cycle average flow field structures. Conclusions are drawn with respect to engine flow field cyclic variations.

  12. Developmental plasticity in Tenebrio molitor (Coleoptera: Tenebrionidae): Analysis of Instar Variation in Number and Development Time under Different Diets

    Science.gov (United States)

    The variation in instar number and the pattern of sequential instar development time of Tenebrio molitor L. (Coleoptera: Tenebrionidae) was studied under 4 different diet regimes. Addition of dietary supplements consisting of dry potato or a mix of dry potato and dry egg whites significantly reduced...

  13. Estimation of time-dependent Hurst exponents with variational smoothing and application to forecasting foreign exchange rates

    Science.gov (United States)

    Garcin, Matthieu

    2017-10-01

    Hurst exponents depict the long memory of a time series. For human-dependent phenomena, as in finance, this feature may vary in the time. It justifies modelling dynamics by multifractional Brownian motions, which are consistent with time-dependent Hurst exponents. We improve the existing literature on estimating time-dependent Hurst exponents by proposing a smooth estimate obtained by variational calculus. This method is very general and not restricted to the sole Hurst framework. It is globally more accurate and easier than other existing non-parametric estimation techniques. Besides, in the field of Hurst exponents, it makes it possible to make forecasts based on the estimated multifractional Brownian motion. The application to high-frequency foreign exchange markets (GBP, CHF, SEK, USD, CAD, AUD, JPY, CNY and SGD, all against EUR) shows significantly good forecasts. When the Hurst exponent is higher than 0.5, what depicts a long-memory feature, the accuracy is higher.

  14. Fast-time Variations of Supernova Neutrino Fluxes and Detection Perspectives

    NARCIS (Netherlands)

    Tamborra, I.; Hanke, F.; Müller, B.; Janka, H.T.; Raffelt, G.G.

    2015-01-01

    In the delayed explosion scenario of a core-collapse supernova, the accretion phase shows pronounced convective over-turns and a low-multipole hydrodynamic instability, the so-called standing accretion shock instability (SASI). Neutrino signal variations from the first full-scale three-dimensional

  15. Nonlinear forecasts of ƒoF2: variation of model predictive accuracy over time

    Directory of Open Access Journals (Sweden)

    P. S. Cannon

    Full Text Available Space weather effects can strongly influence high-frequency (HF communications by changing the ionospheric environment through which the radio waves propagate. Since many systems utilize HF communications, the ability to make real-time assessments of propagation conditions is an important part of space weather monitoring systems. In this paper, we present new techniques for measuring high-latitude HF communications link parameters using data from SuperDARN radars. These techniques use ground-scatter returns to define the variation in skip distance with frequency. From these data, the maximum usable frequency (MUF as a function of range is determined and ionospheric critical frequencies are estimated. These calculations are made in near-real-time and the results are made available on the World Wide Web. F-region critical frequencies calculated using this method show good agreement with ionosonde data.Key words. Ionosphere (active experiments; instruments and techniques – Radio science (ionospheric propagation

  16. Nonlinear forecasts of ƒoF2: variation of model predictive accuracy over time

    Directory of Open Access Journals (Sweden)

    A. H. Y. Chan

    2002-07-01

    Full Text Available Space weather effects can strongly influence high-frequency (HF communications by changing the ionospheric environment through which the radio waves propagate. Since many systems utilize HF communications, the ability to make real-time assessments of propagation conditions is an important part of space weather monitoring systems. In this paper, we present new techniques for measuring high-latitude HF communications link parameters using data from SuperDARN radars. These techniques use ground-scatter returns to define the variation in skip distance with frequency. From these data, the maximum usable frequency (MUF as a function of range is determined and ionospheric critical frequencies are estimated. These calculations are made in near-real-time and the results are made available on the World Wide Web. F-region critical frequencies calculated using this method show good agreement with ionosonde data.Key words. Ionosphere (active experiments; instruments and techniques – Radio science (ionospheric propagation

  17. Fetal short time variation during labor: a non-invasive alternative to fetal scalp pH measurements?

    OpenAIRE

    Schiermeier, Sven; Reinhard, Joscha; Hatzmann, Hendrike; Zimmermann, Ralf C.; Westhof, Gregor

    2009-01-01

    Objective: To determine whether short time variation (STV) of fetal heart beat correlates with scalp pH measurements during labor. Patients and methods: From 1279 deliveries, 197 women had at least one fetal scalp pH measurement. Using the CTG-Player®, STVs were calculated from the electronically saved cardiotocography (CTG) traces and related to the fetal scalp pH measurements. Results: There was no correlation between STV and fetal scalp pH measurements (r=−0.0592). Conclusions: Fetal ST...

  18. Intrapopulation genome size variation in D. melanogaster reflects life history variation and plasticity.

    Directory of Open Access Journals (Sweden)

    Lisa L Ellis

    2014-07-01

    Full Text Available We determined female genome sizes using flow cytometry for 211 Drosophila melanogaster sequenced inbred strains from the Drosophila Genetic Reference Panel, and found significant conspecific and intrapopulation variation in genome size. We also compared several life history traits for 25 lines with large and 25 lines with small genomes in three thermal environments, and found that genome size as well as genome size by temperature interactions significantly correlated with survival to pupation and adulthood, time to pupation, female pupal mass, and female eclosion rates. Genome size accounted for up to 23% of the variation in developmental phenotypes, but the contribution of genome size to variation in life history traits was plastic and varied according to the thermal environment. Expression data implicate differences in metabolism that correspond to genome size variation. These results indicate that significant genome size variation exists within D. melanogaster and this variation may impact the evolutionary ecology of the species. Genome size variation accounts for a significant portion of life history variation in an environmentally dependent manner, suggesting that potential fitness effects associated with genome size variation also depend on environmental conditions.

  19. Intrapopulation Genome Size Variation in D. melanogaster Reflects Life History Variation and Plasticity

    Science.gov (United States)

    Ellis, Lisa L.; Huang, Wen; Quinn, Andrew M.; Ahuja, Astha; Alfrejd, Ben; Gomez, Francisco E.; Hjelmen, Carl E.; Moore, Kristi L.; Mackay, Trudy F. C.; Johnston, J. Spencer; Tarone, Aaron M.

    2014-01-01

    We determined female genome sizes using flow cytometry for 211 Drosophila melanogaster sequenced inbred strains from the Drosophila Genetic Reference Panel, and found significant conspecific and intrapopulation variation in genome size. We also compared several life history traits for 25 lines with large and 25 lines with small genomes in three thermal environments, and found that genome size as well as genome size by temperature interactions significantly correlated with survival to pupation and adulthood, time to pupation, female pupal mass, and female eclosion rates. Genome size accounted for up to 23% of the variation in developmental phenotypes, but the contribution of genome size to variation in life history traits was plastic and varied according to the thermal environment. Expression data implicate differences in metabolism that correspond to genome size variation. These results indicate that significant genome size variation exists within D. melanogaster and this variation may impact the evolutionary ecology of the species. Genome size variation accounts for a significant portion of life history variation in an environmentally dependent manner, suggesting that potential fitness effects associated with genome size variation also depend on environmental conditions. PMID:25057905

  20. NO TIMING VARIATIONS OBSERVED IN THIRD TRANSIT OF SNOW-LINE EXOPLANET KEPLER-421b

    International Nuclear Information System (INIS)

    Dalba, Paul A.; Muirhead, Philip S.

    2016-01-01

    We observed Kepler-421 during the anticipated third transit of the snow-line exoplanet Kepler-421b in order to constrain the existence and extent of transit timing variations (TTVs). Previously, the Kepler spacecraft only observed two transits of Kepler-421b, leaving the planet’s transit ephemeris unconstrained. Our visible light, time-series observations from the 4.3 m Discovery Channel Telescope were designed to capture pre-transit baseline and the partial transit of Kepler-421b, barring significant TTVs. We use the light curves to assess the probabilities of various transit models using both the posterior odds ratio and the Bayesian Information Criterion, and find that a transit model with no TTVs is favored to 3.6 σ confidence. These observations suggest that Kepler-421b is either alone in its system or is only experiencing minor dynamic interactions with an unseen companion. With the Kepler-421b ephemeris constrained, we calculate future transit times and discuss the opportunity to characterize the atmosphere of this cold, long-period exoplanet via transmission spectroscopy. Our investigation emphasizes the difficulties associated with observing long-period exoplanet transits and the consequences that arise from failing to refine transit ephemerides.

  1. Prezygotic barriers to hybridization in marine broadcast spawners: reproductive timing and mating system variation.

    Directory of Open Access Journals (Sweden)

    Carla A Monteiro

    Full Text Available Sympatric assemblages of congeners with incomplete reproductive barriers offer the opportunity to study the roles that ecological and non-ecological factors play in reproductive isolation. While interspecific asynchrony in gamete release and gametic incompatibility are known prezygotic barriers to hybridization, the role of mating system variation has been emphasized in plants. Reproductive isolation between the sibling brown algal species Fucus spiralis, Fucus guiryi (selfing hermaphrodite and Fucus vesiculosus (dioecious was studied because they form hybrids in parapatry in the rocky intertidal zone, maintain species integrity over a broad geographic range, and have contrasting mating systems. We compared reproductive synchrony (spawning overlap between the three species at several temporal scales (yearly/seasonal, semilunar/tidal, and hourly during single tides. Interspecific patterns of egg release were coincident at seasonal (single peak in spring to early summer to semilunar timescales. Synthesis of available data indicated that spawning is controlled by semidiurnal tidal and daily light-dark cues, and not directly by semilunar cycles. Importantly, interspecific shifts in timing detected at the hourly scale during single tides were consistent with a partial ecological prezygotic hybridization barrier. The species displayed patterns of gamete release consistent with a power law distribution, indicating a high degree of reproductive synchrony, while the hypothesis of weaker selective constraints for synchrony in selfing versus outcrossing species was supported by observed spawning in hermaphrodites over a broader range of tidal phase than in outcrossers. Synchronous gamete release is critical to the success of external fertilization, while high-energy intertidal environments may offer only limited windows of reproductive opportunity. Within these windows, however, subtle variations in reproductive timing have evolved with the potential to

  2. Relaxation time of normal breast tissues. Changes with age and variations during the menstrual cycle

    International Nuclear Information System (INIS)

    Dean, K.I.; Majurin, M.L.; Komu, M.

    1994-01-01

    The influence of age on the relaxation times of normal breast parenchyma and its surrounding fatty tissue were evaluated, and the variations during a normal menstrual cycle were analyzed using an ultra low field 0.02 T imager. Thirty-nine healthy volunteers aged 21 to 59 years were examined to determine T1 and T2 relaxation times, and 8 of these volunteers were studied once weekly during one menstrual cycle. The only significant trend was an increase in the T2 of breast parenchyma with increasing age. During the menstrual cycle there was a slight but insignificant (p=0.10) increase in T1 of the breast parenchyma values during the latter half of the menstrual cycle, and a corresponding increase in T2 values between the 2nd and 3rd weeks of the menstrual cycle, which was significant. (orig.)

  3. Relaxation time of normal breast tissues. Changes with age and variations during the menstrual cycle

    Energy Technology Data Exchange (ETDEWEB)

    Dean, K.I. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology); Majurin, M.L. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology); Komu, M. (University Central Hospital, Turku (Finland). Dept. of Diagnostic Radiology)

    1994-05-01

    The influence of age on the relaxation times of normal breast parenchyma and its surrounding fatty tissue were evaluated, and the variations during a normal menstrual cycle were analyzed using an ultra low field 0.02 T imager. Thirty-nine healthy volunteers aged 21 to 59 years were examined to determine T1 and T2 relaxation times, and 8 of these volunteers were studied once weekly during one menstrual cycle. The only significant trend was an increase in the T2 of breast parenchyma with increasing age. During the menstrual cycle there was a slight but insignificant (p=0.10) increase in T1 of the breast parenchyma values during the latter half of the menstrual cycle, and a corresponding increase in T2 values between the 2nd and 3rd weeks of the menstrual cycle, which was significant. (orig.).

  4. The circadian variation of premature atrial contractions

    DEFF Research Database (Denmark)

    Larsen, Bjørn Strøier; Kumarathurai, Preman; Nielsen, Olav W

    2016-01-01

    AIMS: The aim of the study was to assess a possible circadian variation of premature atrial contractions (PACs) in a community-based population and to determine if the daily variation could be used to assess a more vulnerable period of PACs in predicting later incidence of atrial fibrillation (AF...... variation in heart rate. After adjusting for relevant risk factors, the risk of AF was equal in all time intervals throughout the day. CONCLUSION: Premature atrial contractions showed a circadian variation in subjects with frequent PACs. No specific time interval of the day was more predictive of AF than...

  5. A search for transit timing variations and orbital decay in WASP-46b

    Science.gov (United States)

    Petrucci, R.; Jofré, E.; Ferrero, L. V.; Cúneo, V.; Saker, L.; Lovos, F.; Gómez, M.; Mauas, P.

    2018-02-01

    We present 12 new transit observations of the exoplanet WASP-46b obtained with the 1.54-m telescope at Estación Astrofísica de Bosque Alegre (EABA, Argentina) and the 0.40-m Horacio Ghielmetti and 2.15-m Jorge Sahade telescopes at Complejo Astronómico El Leoncito (CASLEO, Argentina). We analyse them together with 37 light curves from the literature to re-determine the physical parameters and search for additional planets via transit timing variations (TTVs). We consider the 31 transits with uncertainties in their mid-transit times (e_T0) activity could be affecting the measured mid-transit times. This value of dispersion allows us to rule out the presence of additional bodies with masses larger than 2.3, 4.6, 7 and 9.3 M_{\\oplus} at the first-order mean-motion resonances 2:1, 3:2, 4:3 and 5:4 with the transiting planet, respectively. Despite the 6 yr baseline and a typical light-curve precision of 2 × 10-3, we find that we cannot significantly demonstrate a slow decrease of the orbital period of WASP-46b. We place a lower limit of Q⋆ > 7 × 103 on the tidal quality factor and determine that an additional 6 yr baseline is required to rule out Q⋆ < 105.

  6. On minimizers of causal variational principles

    International Nuclear Information System (INIS)

    Schiefeneder, Daniela

    2011-01-01

    Causal variational principles are a class of nonlinear minimization problems which arise in a formulation of relativistic quantum theory referred to as the fermionic projector approach. This thesis is devoted to a numerical and analytic study of the minimizers of a general class of causal variational principles. We begin with a numerical investigation of variational principles for the fermionic projector in discrete space-time. It is shown that for sufficiently many space-time points, the minimizing fermionic projector induces non-trivial causal relations on the space-time points. We then generalize the setting by introducing a class of causal variational principles for measures on a compact manifold. In our main result we prove under general assumptions that the support of a minimizing measure is either completely timelike, or it is singular in the sense that its interior is empty. In the examples of the circle, the sphere and certain flag manifolds, the general results are supplemented by a more detailed analysis of the minimizers. (orig.)

  7. Variational Algorithms for Test Particle Trajectories

    Science.gov (United States)

    Ellison, C. Leland; Finn, John M.; Qin, Hong; Tang, William M.

    2015-11-01

    The theory of variational integration provides a novel framework for constructing conservative numerical methods for magnetized test particle dynamics. The retention of conservation laws in the numerical time advance captures the correct qualitative behavior of the long time dynamics. For modeling the Lorentz force system, new variational integrators have been developed that are both symplectic and electromagnetically gauge invariant. For guiding center test particle dynamics, discretization of the phase-space action principle yields multistep variational algorithms, in general. Obtaining the desired long-term numerical fidelity requires mitigation of the multistep method's parasitic modes or applying a discretization scheme that possesses a discrete degeneracy to yield a one-step method. Dissipative effects may be modeled using Lagrange-D'Alembert variational principles. Numerical results will be presented using a new numerical platform that interfaces with popular equilibrium codes and utilizes parallel hardware to achieve reduced times to solution. This work was supported by DOE Contract DE-AC02-09CH11466.

  8. Chinese L1 children's English L2 verb morphology over time: individual variation in long-term outcomes.

    Science.gov (United States)

    Paradis, Johanne; Tulpar, Yasemin; Arppe, Antti

    2016-05-01

    This study examined accuracy in production and grammaticality judgements of verb morphology by eighteen Chinese-speaking children learning English as a second language (L2) followed longitudinally from four to six years of exposure to English, and who began to learn English at age 4;2. Children's growth in accuracy with verb morphology reached a plateau by six years, where 11/18 children did not display native-speaker levels of accuracy for one or more morphemes. Variation in children's accuracy with verb morphology was predicted by their English vocabulary size and verbal short-term memories primarily, and quality and quantity of English input at home secondarily. This study shows that even very young L2 learners might not all catch up to native speakers in this time frame and that non-age factors play a role in determining individual variation in child L2 learners' long-term outcomes with English morphology.

  9. Real T1 relaxation time measurement and diurnal variation analysis of intervertebral discs in a healthy population of 50 volunteers

    International Nuclear Information System (INIS)

    Galley, J.; Maestretti, G.; Koch, G.; Hoogewoud, H-M.

    2017-01-01

    Purpose: To measure the real T1 relaxation time of the lumbar intervertebral discs in a young and healthy population, using different inversion recovery times, and assess diurnal variation. Material and methods: Intervertebral discs from D12 to S1 of 50 healthy volunteers from 18 to 25 years old were evaluated twice the same day, in the morning and in the late afternoon. Dedicated MRI sequences with different inversion recovery times (from 100 to 2500 ms) were used to calculate the real T1 relaxation time. Three regions of interest (ROIs) were defined in each disc, the middle representing the nucleus pulposus (NP) and the outer parts the annulus fibrosus (AF) anterior and posterior. Diurnal variation and differences between each disc level were analyzed. Results: T1 mean values in the NP were 1142 ± 12 ms in the morning and 1085 ± 13 ms in the afternoon, showing a highly significant decrease of 57 ms (p < 0.001). A highly significant difference between the levels of the spine was found. The mean T1 of the anterior part of the AF was 577 ± 9 ms in the morning and 554 ± 8 ms in the afternoon. For the posterior part, the mean values were 633 ± 8 ms in the morning and 581 ± 7 ms in the evening. It shows a highly significant decrease of 23 ms for the anterior part and 51 ms for the posterior part (all p < 0.001). Conclusion: T1 mapping is a promising method of intervertebral disc evaluation. Significant diurnal variation and difference between levels of the lumbar spine were demonstrated. A potential use for longitudinal study in post-operative follow up or sport medicine needs to be evaluated.

  10. Real T1 relaxation time measurement and diurnal variation analysis of intervertebral discs in a healthy population of 50 volunteers

    Energy Technology Data Exchange (ETDEWEB)

    Galley, J., E-mail: galleyjulien@gmail.com [Department of Radiology, HFR Fribourg, Hôpital Cantonal (Switzerland); Maestretti, G. [Department of Orthopedic Surgery, HFR Fribourg, Hôpital Cantonal (Switzerland); Koch, G.; Hoogewoud, H-M. [Department of Radiology, HFR Fribourg, Hôpital Cantonal (Switzerland)

    2017-02-15

    Purpose: To measure the real T1 relaxation time of the lumbar intervertebral discs in a young and healthy population, using different inversion recovery times, and assess diurnal variation. Material and methods: Intervertebral discs from D12 to S1 of 50 healthy volunteers from 18 to 25 years old were evaluated twice the same day, in the morning and in the late afternoon. Dedicated MRI sequences with different inversion recovery times (from 100 to 2500 ms) were used to calculate the real T1 relaxation time. Three regions of interest (ROIs) were defined in each disc, the middle representing the nucleus pulposus (NP) and the outer parts the annulus fibrosus (AF) anterior and posterior. Diurnal variation and differences between each disc level were analyzed. Results: T1 mean values in the NP were 1142 ± 12 ms in the morning and 1085 ± 13 ms in the afternoon, showing a highly significant decrease of 57 ms (p < 0.001). A highly significant difference between the levels of the spine was found. The mean T1 of the anterior part of the AF was 577 ± 9 ms in the morning and 554 ± 8 ms in the afternoon. For the posterior part, the mean values were 633 ± 8 ms in the morning and 581 ± 7 ms in the evening. It shows a highly significant decrease of 23 ms for the anterior part and 51 ms for the posterior part (all p < 0.001). Conclusion: T1 mapping is a promising method of intervertebral disc evaluation. Significant diurnal variation and difference between levels of the lumbar spine were demonstrated. A potential use for longitudinal study in post-operative follow up or sport medicine needs to be evaluated.

  11. Joint inversion of shear wave travel time residuals and geoid and depth anomalies for long-wavelength variations in upper mantle temperature and composition along the Mid-Atlantic Ridge

    Science.gov (United States)

    Sheehan, Anne F.; Solomon, Sean C.

    1991-01-01

    Measurements were carried out for SS-S differential travel time residuals for nearly 500 paths crossing the northern Mid-Atlantic Ridge, assuming that the residuals are dominated by contributions from the upper mantle near the surface bounce point of the reflected phase SS. Results indicate that the SS-S travel time residuals decrease linearly with square root of age, to an age of 80-100 Ma, in general agreement with the plate cooling model. A joint inversion was formulated of travel time residuals and geoid and bathymetric anomalies for lateral variation in the upper mantle temperature and composition. The preferred inversion solutions were found to have variations in upper mantle temperature along the Mid-Atlantic Ridge of about 100 K. It was calculated that, for a constant bulk composition, such a temperature variation would produce about a 7-km variation in crustal thickness, larger than is generally observed.

  12. Unitary Dynamics of Strongly Interacting Bose Gases with the Time-Dependent Variational Monte Carlo Method in Continuous Space

    Science.gov (United States)

    Carleo, Giuseppe; Cevolani, Lorenzo; Sanchez-Palencia, Laurent; Holzmann, Markus

    2017-07-01

    We introduce the time-dependent variational Monte Carlo method for continuous-space Bose gases. Our approach is based on the systematic expansion of the many-body wave function in terms of multibody correlations and is essentially exact up to adaptive truncation. The method is benchmarked by comparison to an exact Bethe ansatz or existing numerical results for the integrable Lieb-Liniger model. We first show that the many-body wave function achieves high precision for ground-state properties, including energy and first-order as well as second-order correlation functions. Then, we study the out-of-equilibrium, unitary dynamics induced by a quantum quench in the interaction strength. Our time-dependent variational Monte Carlo results are benchmarked by comparison to exact Bethe ansatz results available for a small number of particles, and are also compared to quench action results available for noninteracting initial states. Moreover, our approach allows us to study large particle numbers and general quench protocols, previously inaccessible beyond the mean-field level. Our results suggest that it is possible to find correlated initial states for which the long-term dynamics of local density fluctuations is close to the predictions of a simple Boltzmann ensemble.

  13. A Brief Study of Variation Theory in Quality Management

    Directory of Open Access Journals (Sweden)

    Mostafa Farah Bakhsh

    2016-06-01

    Full Text Available Variation is part of everyday life and exists all the time. Variation is the product of differences. Difference in nature of processes results in different products during the time. Proper diagnosis of variation patterns in minimizing the loss is necessary. Continuous quality improvement is regarded as successive reduction of performance variation for delivering high quality products to the customers. In Deming viewpoint, quality deviation is classified to two groups of common and special causes. Variation is not a new word, but understanding and concerns about it are modern. First step in performance variation management is acceptance and belief of variation. For proper management of variations, appropriate tools should be used for detection and display of them. Control are useful tools in recognition, analysis and removing process performance variations.

  14. Finite time exergy analysis and multi-objective ecological optimization of a regenerative Brayton cycle considering the impact of flow rate variations

    International Nuclear Information System (INIS)

    Naserian, Mohammad Mahdi; Farahat, Said; Sarhaddi, Faramarz

    2015-01-01

    Highlights: • Defining a dimensionless parameter includes the finite-time and size concepts. • Inserting the concept of exergy of fluid streams into finite-time thermodynamics. • Defining, drawing and modifying of maximum ecological function curve. • Suggesting the appropriate performance zone, according to maximum ecological curve. - Abstract: In this study, the optimal performance of a regenerative Brayton cycle is sought through power and then ecological function maximization using finite-time thermodynamic concept and finite-size components. Multi-objective optimization is used for maximizing the ecological function. Optimizations are performed using genetic algorithm. In order to take into account the finite-time and finite-size concepts in current problem, a dimensionless mass-flow parameter is introduced deploying time variations. The variations of output power, total exergy destruction of the system, and decision variables for the optimum state (maximum ecological function state) are compared to the maximum power state using the dimensionless parameter. The modified ecological function in optimum state is obtained and plotted relating to the dimensionless mass-flow parameter. One can see that the modified ecological function study results in a better performance than that obtained with the maximum power state. Finally, the appropriate performance zone of the heat engine will be obtained

  15. Developmental Change and Time-Specific Variation in Global and Specific Aspects of Self-Concept in Adolescence and Association with Depressive Symptoms

    Science.gov (United States)

    Kuzucu, Yasar; Bontempo, Daniel E.; Hofer, Scott M.; Stallings, Michael C.; Piccinin, Andrea M.

    2014-01-01

    Previous research has demonstrated that adolescents make differential self-evaluations in multiple domains that include physical appearance, academic competence, and peer acceptance. We report growth curve analyses over a seven year period from age 9 to age 16 on the six domains of the Harter Self-Perception Profile for Children. In general, we find little change in self-concept, on average, but do find substantial individual differences in level, rate of change, and time-specific variation in these self- evaluations. The results suggest that sex differences and adoptive status were related to only certain aspects of the participants’ self-concept. Depressive symptoms were found to have significant effects on individual differences in rate of change and on time-specific variation in general self-concept, as well as on some of the specific domains of self-concept. PMID:25143664

  16. Structure of carbon monoxide time variations in the atmospheric thickness over Central Eurasia (Issyk Kul Monitoring Station)

    Science.gov (United States)

    Aref'ev, V. N.; Kashin, F. V.; Orozaliev, M. D.; Sizov, N. I.; Sinyakov, V. P.; Sorokina, L. I.

    2013-03-01

    The results of measurements of the CO content in the atmospheric thickness by the method of solar molecular-absorption spectroscopy are presented. Over 87 months of observations, the annual mean CO content decreased by ˜19% at a mean rate of changes equal to -(0.14 ± 0.02) atm cm per year. Maxima and minima of seasonal variations most often fall on February and September, respectively. The mean overall amplitude of changes in the CO content during the annual cycle is about 50% of the mean value. The Fourier analysis revealed variations in the CO composition with periods from 3 to 84 months. A simple statistical model satisfactorily describes time changes in the CO content in the atmospheric thickness. The results of measurements of the CO content in the atmospheric thickness are compared with the data of CO measurements in samples of surface air at stations of the Global Atmospheric Watch.

  17. Modelling regional variation of first-time births in Denmark 1980-1994 by an age-period-cohort model

    Directory of Open Access Journals (Sweden)

    Lisbeth B. Knudsen

    2005-12-01

    Full Text Available Despite the small size of Denmark, there have traditionally been rather consistent regional differences in fertility rates. We apply the statistical age-period-cohort model to include the effect of these three time-related factors thereby concisely illuminating the regional differences of first-time births in Denmark. From the Fertility of Women and Couples Dataset we obtain data on number of births by nulliparous women by year (1980-1994, age (15-45 and county of residence. We show that the APC-model describes the fertility rates of nulliparous women satisfactorily. To catch the regional variation an interaction parameter between age and county is necessary, which provides a surprisingly good description suggesting that the county-specific age-distributions of first-time fertility rates differ. Our results are in general agreement with the 'moral geography' concepts of Tonboe (2001.

  18. Modelling regional variation of first-time births in Denmark 1980-1994 by an age-period-cohort model

    DEFF Research Database (Denmark)

    Thygesen, Lau Caspar; Knudsen, Lisbeth B.; Keiding, Niels

    2005-01-01

    Despite the small size of Denmark, there have traditionally been rather consistent regional differences in fertility rates. We apply the statistical age-period-cohort model to include the effect of these three time-related factors thereby concisely illuminating the regional differences of first......-time births in Denmark. From the Fertility of Women and Couples Dataset we obtain data on number of births by nulliparous women by year (1980-1994), age (15-45) and county of residence. We show that the APC-model describes the fertility rates of nulliparous women satisfactorily. To catch the regional...... variation an interaction parameter between age and county is necessary, which provides a surprisingly good description suggesting that the county-specific age-distributions of first-time fertility rates differ. Our results are in general agreement with the 'moral geography' concepts of Tonboe (2001)....

  19. Cosmological constants and variations

    International Nuclear Information System (INIS)

    Barrow, John D

    2005-01-01

    We review properties of theories for the variation of the gravitation and fine structure 'constants'. We highlight some general features of the cosmological models that exist in these theories with reference to recent quasar data that is consistent with time-variation in the fine structure 'constant' since a redshift of 3.5. The behaviour of a simple class of varying alpha cosmologies is outlined in the light of all the observational constraints. We also discuss some of the consequences of varying 'constants' for oscillating universes and show by means of exact solutions that they appear to evolve monotonically in time even though the scale factor of the universe oscillates

  20. Characteristics of seasonal variation and solar activity dependence of the geomagnetic solar quiet daily variation

    Science.gov (United States)

    Shinbori, A.; Koyama, Y.; Nose, M.; Hori, T.

    2017-12-01

    Characteristics of seasonal variation and solar activity dependence of the X- and Y-components of the geomagnetic solar quiet (Sq) daily variation at Memanbetsu in mid-latitudes and Guam near the equator have been investigated using long-term geomagnetic field data with 1-h time resolution from 1957 to 2016. In this analysis, we defined the quiet day when the maximum value of the Kp index is less than 3 for that day. In this analysis, we used the monthly average of the adjusted daily F10.7 corresponding to geomagnetically quiet days. For identification of the monthly mean Sq variation in the X and Y components (Sq-X and Sq-Y), we first determined the baseline of the X and Y components from the average value from 22 to 2 h (LT: local time) for each quiet day. Next, we calculated a deviation from the baseline of the X- and Y-components of the geomagnetic field for each quiet day, and computed the monthly mean value of the deviation for each local time. As a result, Sq-X and Sq-Y shows a clear seasonal variation and solar activity dependence. The amplitude of seasonal variation increases significantly during high solar activities, and is proportional to the solar F10.7 index. The pattern of the seasonal variation is quite different between Sq-X and Sq-Y. The result of the correlation analysis between the solar F10.7 index and Sq-X and Sq-Y shows almost the linear relationship, but the slope and intercept of the linear fitted line varies as function of local time and month. This implies that the sensitivity of Sq-X and Sq-Y to the solar activity is different for different local times and seasons. The local time dependence of the offset value of Sq-Y at Guam and its seasonal variation suggest a magnetic field produced by inter-hemispheric field-aligned currents (FACs). From the sign of the offset value of Sq-Y, it is infer that the inter-hemispheric FACs flow from the summer to winter hemispheres in the dawn and dusk sectors and from the winter to summer hemispheres in

  1. Variational approach to nuclear fluid dynamics

    International Nuclear Information System (INIS)

    Da Providencia, J.P.; Holzwarth, G.

    1983-01-01

    A variational derivation of a fluid-dynamical formalism for finite Fermi systems is presented which is based on a single determinant as variational function and does not exclude the possibility of transverse flow. Therefore the explicit specification of the time-odd part has to go beyond the local chi-approximation, while the time-even part is taken in the generalized scaling form. The necessary boundary conditions are derived from the variation of the lagrangian. The results confirm previous simplified approaches to a remarkable degree for quadrupole modes; for other multipolarities the deviations are much less than might be expected according to a sizeable change in the transverse sound speed. (orig.)

  2. Variational coupling between q-number and c-number dynamics

    International Nuclear Information System (INIS)

    Amaral, C.M. do; Joffily, S.

    1984-01-01

    The time-dependent quantum variational principle is generalized for the case of hamiltonian operators having real parameters and their time derivates. The obtained variational system is formed by a Schroedinger equation coupled to a Lagrange equation system, where the lagrangian is the average value of the parametrized hamiltonian operator. The consequent dynamics of the variational principle, describes the interaction between a q-number sub-dynamics with a c-number sub-dynamics. In the ((h/2π)) 0 -order W.K.B. approximation, the variational system reduces to a Hamilton-Jacobi-like equation, coupled to a Lagrange equation family. The formal features of the obtained variational system are appropriated for the description of, adiabatics and non-adiabatics, time-dependent q-number c-number interactions. (L.C.) [pt

  3. Revisiting the returns-volume relationship: Time variation, alternative measures and the financial crisis

    Science.gov (United States)

    Cook, Steve; Watson, Duncan

    2017-03-01

    Following its introduction in the seminal study of Osborne (1959), a voluminous literature has emerged examining the returns-volume relationship for financial assets. The present paper revisits this relationship in an examination of the FTSE100 which extends the existing literature in two ways. First, alternative daily measures of the FTSE100 index are used to create differing returns and absolute returns series to employ in an examination of returns-volume causality. Second, rolling regression analysis is utilised to explore potential time variation in the returns-volume relationship. The findings obtained depict a hitherto unconsidered complexity in this relationship with the type of returns series considered and financial crisis found to be significant underlying factors. The implications of the newly derived results for both the understanding of the nature of the returns-volume relationship and the development of theories in connection to it are discussed.

  4. Variations in VLT/UVES-based OH rotational temperatures for time scales from hours to 15 years

    Science.gov (United States)

    Noll, Stefan; Kimeswenger, Stefan; Proxauf, Bastian; Kausch, Wolfgang; Unterguggenberger, Stefanie; Jones, Amy M.

    2017-04-01

    Hydroxyl (OH) emission is an important tracer of the climate, chemistry, and dynamics of the Earth's mesopause region. However, the relation of intensity variations in different OH lines is not well understood yet. This is critical for the most popular use of OH lines: the estimate of ambient temperatures based on transitions at low rotational levels of the same band. It is possible that the measured variability of the derived rotational temperature does not coincide with changes in the ambient temperature. Such differences can be caused by varying deviations from the local thermodynamic equilibrium (LTE) for the population distribution over the considered rotational levels. The non-LTE effects depend on the ratio of the thermalising collisions (mostly related to molecular oxygen) and competing radiative transitions or collisions without thermalisation of the rotational level distribution. Therefore, significant changes in the vertical structure of excited OH and its main quenchers can affect the temperature measurements. We have investigated the variability of OH rotational temperatures and the corresponding contributions of non-LTE effects for different OH bands and time scales up to 15 years based on data of the high-resolution echelle spectrograph UVES at the Very Large Telescope at Cerro Paranal in Chile. In order to link the measured rotational temperatures with the structure of the OH emission layer, we have also studied OH emission and kinetic temperature profiles from the multi-channel radiometer SABER on the TIMED satellite taken between 2002 and 2015. The results show that non-LTE contributions can significantly affect the OH rotational temperatures. Their variations can be especially strong during the night and for high upper vibrational levels of the transitions, where amplitudes of several Kelvins can be measured. They appear to be weak if long-term variations such as those caused by the solar cycle are investigated. These differences in the response

  5. Time-Depending Parametric Variational Approach for an Economic General Equilibrium Problem of Pure Exchange with Application

    International Nuclear Information System (INIS)

    Scaramuzzino, F.

    2009-01-01

    This paper considers a qualitative analysis of the solution of a pure exchange general economic equilibrium problem according to two independent parameters. Some recently results obtained by the author in the static and the dynamic case have been collected. Such results have been applied in a particular parametric case: it has been focused the attention on a numerical application for which the existence of the solution of time-depending parametric variational inequality that describes the equilibrium conditions has been proved by means of the direct method. By using MatLab computation after a linear interpolation, the curves of equilibrium have been visualized.

  6. Real-time electrical impedimetric monitoring of blood coagulation process under temperature and hematocrit variations conducted in a microfluidic chip.

    Directory of Open Access Journals (Sweden)

    Kin Fong Lei

    Full Text Available Blood coagulation is an extremely complicated and dynamic physiological process. Monitoring of blood coagulation is essential to predict the risk of hemorrhage and thrombosis during cardiac surgical procedures. In this study, a high throughput microfluidic chip has been developed for the investigation of the blood coagulation process under temperature and hematocrit variations. Electrical impedance of the whole blood was continuously recorded by on-chip electrodes in contact with the blood sample during coagulation. Analysis of the impedance change of the blood was conducted to investigate the characteristics of blood coagulation process and the starting time of blood coagulation was defined. The study of blood coagulation time under temperature and hematocrit variations was shown a good agreement with results in the previous clinical reports. The electrical impedance measurement for the definition of blood coagulation process provides a fast and easy measurement technique. The microfluidic chip was shown to be a sensitive and promising device for monitoring blood coagulation process even in a variety of conditions. It is found valuable for the development of point-of-care coagulation testing devices that utilizes whole blood sample in microliter quantity.

  7. Amplitude Variations in Pulsating Red Giants. II. Some Systematics

    Science.gov (United States)

    Percy, J. R.; Laing, J.

    2017-12-01

    In order to extend our previous studies of the unexplained phenomenon of cyclic amplitude variations in pulsating red giants, we have used the AAVSO time-series analysis package vstar to analyze long-term AAVSO visual observations of 50 such stars, mostly Mira stars. The relative amount of the variation, typically a factor of 1.5, and the time scale of the variation, typically 20-35 pulsation periods, are not significantly different in longer-period, shorter-period, and carbon stars in our sample, and they also occur in stars whose period is changing secularly, perhaps due to a thermal pulse. The time scale of the variations is similar to that in smaller-amplitude SR variables, but the relative amount of the variation appears to be larger in smaller-amplitude stars, and is therefore more conspicuous. The cause of the amplitude variations remains unclear, though they may be due to rotational modulation of a star whose pulsating surface is dominated by the effects of large convective cells.

  8. Cone-Beam Computed Tomography–Guided Positioning of Laryngeal Cancer Patients with Large Interfraction Time Trends in Setup and Nonrigid Anatomy Variations

    International Nuclear Information System (INIS)

    Gangsaas, Anne; Astreinidou, Eleftheria; Quint, Sandra; Levendag, Peter C.; Heijmen, Ben

    2013-01-01

    Purpose: To investigate interfraction setup variations of the primary tumor, elective nodes, and vertebrae in laryngeal cancer patients and to validate protocols for cone beam computed tomography (CBCT)-guided correction. Methods and Materials: For 30 patients, CBCT-measured displacements in fractionated treatments were used to investigate population setup errors and to simulate residual setup errors for the no action level (NAL) offline protocol, the extended NAL (eNAL) protocol, and daily CBCT acquisition with online analysis and repositioning. Results: Without corrections, 12 of 26 patients treated with radical radiation therapy would have experienced a gradual change (time trend) in primary tumor setup ≥4 mm in the craniocaudal (CC) direction during the fractionated treatment (11/12 in caudal direction, maximum 11 mm). Due to these trends, correction of primary tumor displacements with NAL resulted in large residual CC errors (required margin 6.7 mm). With the weekly correction vector adjustments in eNAL, the trends could be largely compensated (CC margin 3.5 mm). Correlation between movements of the primary and nodal clinical target volumes (CTVs) in the CC direction was poor (r 2 =0.15). Therefore, even with online setup corrections of the primary CTV, the required CC margin for the nodal CTV was as large as 6.8 mm. Also for the vertebrae, large time trends were observed for some patients. Because of poor CC correlation (r 2 =0.19) between displacements of the primary CTV and the vertebrae, even with daily online repositioning of the vertebrae, the required CC margin around the primary CTV was 6.9 mm. Conclusions: Laryngeal cancer patients showed substantial interfraction setup variations, including large time trends, and poor CC correlation between primary tumor displacements and motion of the nodes and vertebrae (internal tumor motion). These trends and nonrigid anatomy variations have to be considered in the choice of setup verification protocol and

  9. Time-temperature dependent variations in beta-carotene contents in carrot using different spectrophotometric techniques

    Science.gov (United States)

    Ullah, Rahat; Khan, Saranjam; Shah, Attaullah; Ali, Hina; Bilal, Muhammad

    2018-05-01

    The current study presents time dependent variations in the concentration of beta-carotene in carrot under different storage-temperature conditions using UV–VIS and Raman spectrophotometric techniques. The UV–VIS absorption spectra of beta-carotene extracted from carrot shows three distinct absorption peaks at 442, 467, and 500 nm with maximum absorption at 467 nm. These absorption peaks are very much reproducible and are assigned to β-carotene. Similarly, Raman spectra of carrot samples also confirmed the three main Raman peaks of beta-carotene at shift positions 1003, 1150, and 1515 cm‑1. An overall decrease in beta-carotene content has been observed for time-temperature conditions. These results depict a decrease of about 40% in the content of beta-carotene when carrot samples were stored in a refrigerator (4 °C) for the first 20 d, whereas a decrease of about 25% was observed when carrot samples were stored in a freezer (‑16 °C) for the same period. The objective of this study is to investigate the possible use of Raman spectroscopy and UV–VIS spectroscopy for quick and detailed analysis of changes (degradation) in beta-carotene content associated with time and temperature in storage (frozen foods) in order to promote quality foods for consumers. Future study with a greater focus on the concentration/content of beta-carotene in other fruits/vegetables is also desirable.

  10. Incorporating Spatio-temporal Phenological Variation in Detecting Exotic Saltcedar Using Landsat Time Series

    Science.gov (United States)

    Diao, C.; Wang, L.

    2017-12-01

    The invasion of exotic species compromises ecosystem functions and causes substantial economic losses at the global scale. Over the past century, non-native saltcedar has expanded into most riparian zones in southwestern United States and posed significant threats to the native biotic communities. Repeated monitoring of saltcedar distribution is essential for conservation agencies to locate highly susceptible areas and develop corresponding control strategies. Throughout the phenological cycle, the leaf senescence stage has been found to be the most crucial in spectrally detecting saltcedar. However, due to climate variability and anthropogenic forcing, the timing of saltcedar leaf senescence may vary over space and time. This spatial and inter-annual variation need to be accommodated to pinpoint the appropriate remotely sensed imagery for saltcedar mapping. The objective of this study was to develop a Landsat-based Multiyear Spectral Angle Clustering (MSAC) model to monitor the inter-annual leaf senescence of exotic saltcedar. At the Landsat scale, the time series analysis of vegetation phenology is usually limited by the temporal resolution of images. The MSAC model can overcome this limit and take advantage of the Landsat images from multiple years to compensate the lack of images in a single year. Results indicated the MSAC model provided a Landsat-based solution to capture the inter-annual leaf senescence of saltcedar. Compared to traditional NDVI-based phenological approaches, the proposed model achieved a more accurate classification results of saltcedar across years. The MSAC model provides unique opportunities to guide the selection of appropriate remotely sensed image for repetitive saltcedar mapping.

  11. Local time, seasonal, and solar cycle dependency of longitudinal variations of TEC along the crest of EIA over India

    Science.gov (United States)

    Sunda, Surendra; Vyas, B. M.

    2013-10-01

    global wave number 4 structure in the Indian longitudinal region spanning from ~70 to 95°E forming the upward slope of the peak in the total electron content (TEC) are reported along the crest of equatorial ionization anomaly (EIA). The continuous and simultaneous measurements from five GPS stations of GPS Aided Geo Augmented Navigation (GAGAN) network are used in this study. The long-term database (2004-2012) is utilized for examining the local time, seasonal, and solar cycle dependency on the longitudinal variations of TEC. Our results confirm the existence of longitudinal variations of TEC in accordance with wave number 4 longitudinal structure including its strength. The results suggest that these variations, in general, start to develop at ~09 LT, achieve maximum strength at 12-15 LT, and decay thereafter, the decay rate depending on the season. They are more pronounced in equinoctial season followed by summer and winter. The longitudinal variations persist beyond midnight in equinox seasons, whereas in winter, they are conspicuously absent. Interestingly, they also exhibit significant solar cycle dependence in the solstices, whereas in the equinoxes, they are independent of solar activity. The comparison of crest-to-trough ratio (CTR) in the eastern (92°E) and western (72°E) extreme longitudes reveals higher CTR on the eastern side than over the western extreme, suggesting the role of nonmigrating tides in modulating the ExB vertical drift and the consequential EIA crest formation.

  12. A passive heat tracer experiment to determine the seasonal variation in residence times in a managed aquifer recharge system with DTS

    NARCIS (Netherlands)

    des Tombe, B.F.; Bakker, M.; Schaars, F; van der Made, KJ; Calje, R; Borst, L.

    2016-01-01

    Targeted provisional session N°8.01 The seasonal variation in residence times is determined in a managed aquifer recharge system using a passive heat tracer test. The managed aquifer recharge system consists of a sequence of alternating elongated recharge basins and rows of recovery wells. The

  13. Incidence, time trends and regional variation of childhood leukaemia in Germany and Europe

    International Nuclear Information System (INIS)

    Kaatsch, P.; Mergenthaler, A.

    2008-01-01

    This paper presents data on the German and Europe-wide incidence, time trends and regional variations of childhood leukaemia. Data were provided by the German Childhood Cancer Registry (GCCR), a population-based cancer registry recording all cases of malignant diseases in children under 15 y of age residing in Germany and by the Automated Childhood Cancer Information System (ACCIS) co-ordinated at International Agency for Research on Cancer, Lyon, that combines and evaluates data from several European population-based cancer registries. The incidence of leukaemia (44.0 per million) has increased in Europe as well as in Germany in the last decades (0.6% annually on average). Germany shows no systematic aggregation of regions with low or high cancer incidence in terms of regional clustering. Incidence rates differ between European regions with the highest rates in Northern Europe (48.0 per million) and the lowest rates in Eastern Europe (39.1). Altogether, the results from ACCIS and the GCCR show good agreement. (authors)

  14. A New Look at the Eclipse Timing Variation Diagram Analysis of Selected 3-body W UMa Systems

    Science.gov (United States)

    Christopoulou, P.-E.; Papageorgiou, A.

    2015-07-01

    The light travel effect produced by the presence of tertiary components can reveal much about the origin and evolution of over-contact binaries. Monitoring of W UMa systems over the last decade and/or the use of publicly available photometric surveys (NSVS, ASAS, etc.) has uncovered or suggested the presence of many unseen companions, which calls for an in-depth investigation of the parameters derived from cyclic period variations in order to confirm or reject the assumption of hidden companion(s). Progress in the analysis of eclipse timing variations is summarized here both from the empirical and the theoretical points of view, and a more extensive investigation of the proposed orbital parameters of third bodies is proposed. The code we have developed for this, implemented in Python, is set up to handle heuristic scanning with parameter perturbation in parameter space, and to establish realistic uncertainties from the least squares fitting. A computational example is given for TZ Boo, a W UMa system with a spectroscopically detected third component. Future options to be implemented include MCMC and bootstrapping.

  15. Variation Tolerant On-Chip Interconnects

    CERN Document Server

    Nigussie, Ethiopia Enideg

    2012-01-01

    This book presents design techniques, analysis and implementation of high performance and power efficient, variation tolerant on-chip interconnects.  Given the design paradigm shift to multi-core, interconnect-centric designs and the increase in sources of variability and their impact in sub-100nm technologies, this book will be an invaluable reference for anyone concerned with the design of next generation, high-performance electronics systems. Provides comprehensive, circuit-level explanation of high-performance, energy-efficient, variation-tolerant on-chip interconnect; Describes design techniques to mitigate problems caused by variation; Includes techniques for design and implementation of self-timed on-chip interconnect, delay variation insensitive communication protocols, high speed signaling techniques and circuits, bit-width independent completion detection and process, voltage and temperature variation tolerance.                          

  16. Geometrical treatment of non-potential interactions: the exterior variational calculus, dynamical systems, physical 1-forms and variational selfadjointness

    International Nuclear Information System (INIS)

    Trostel, R.

    1982-01-01

    A mathematical objective of this paper is to provide geometrical formulation of the integrability conditions for the existence of an action functional, that is, to provide a geometrical counterpart (similar to that by Abraham, Marsden, and Hughes) of the variational and functional approach to self-adjointness. This objective is achieved via the exterior variational calculus, an exterior differential calculus on the vector space of functions depending on time or space time, using from the outset extensively the concept of functional differentiation as its foundation. Variational self-adjointness equals the variational closure of the physical 1-form, the vanishing of a generalized curl-operation applied to the equations of motion. The convenience of this more formal approach is demonstrated, not only when deriving the conditions of variational self-adjointness for materials of differential type of arbitrary order (particles or fields), using roughly no more than Dirac's delta-distributions, but also when treating materials of a broader class (including causal and acausal constitutive functionals, materials of rate type, integral type, etc.). A physical objective of this paper is achieved by pointing out that, as physics is primarily concerned with the solutions of the evolution equations, i.e., with the set of the zero points of the physical 1-form, an equivalence relation among the physical 1-forms on the infinite dimensional vector space of functions is constructed by leaving the set of their zero points unchanged. Using this result, a direct Lagrangian universality is indicated and an almost one presented. Moreover, all physical 1-forms connected by invertible supermatrices (thus mixing the evolution law of different times or space-time) are equivalent. Choosing these supermatrices to be diagonal in time or space-time yields the indirect analytical representation factors

  17. Latitudinal cogradient variation of development time and growth rate and a negative latitudinal body weight cline in a widely distributed cabbage beetle.

    Directory of Open Access Journals (Sweden)

    Jianjun Tang

    Full Text Available The evolutionary and phenotypic responses to environmental gradients are often assumed to be the same, a phenomenon known as "cogradient variation". However, only a few insect species display cogradient variation in physiological traits along a latitudinal gradient. We found evidence for such a response in the examination of the life history traits of the cabbage beetle Colaphellus bowringi from 6 different geographical populations at 16, 19, 22, 24, 26 and 28°C. Our results showed that larval and pupal development times significantly decreased as rearing temperature increased, and that growth rates were positively correlated with temperature. Body weight tended to decrease with increasing temperature, consistent with the general pattern in ectothermic animals. Larval development time was positively correlated with latitude, whereas the growth rate decreased as latitude increased, showing an example of latitudinal cogradient variation. Body weight significantly decreased with increasing latitude in a stepwise manner, showing a negative latitudinal body weight cline. Females were significantly larger than males, consistent with the female biased sex dimorphism in insects. Body weight tended to decrease with increasing rearing temperature, whereas the differences in sexual size dimorphism (SSD tended to decrease with increasing body weight, which biased our results toward acceptance of Rensch's rule. We found that weight loss was an important regulator of SSD, and because male pupae lost significantly more weight at metamorphosis than female pupae, SSD was greater in adults than in pupae. Overall, our data provide a new example that a latitudinal cogradient variation in physiological traits is associated with a negative latitudinal body weight cline.

  18. SU-E-T-16: A Comparison of Expected Dwell Times and Dose Variations for NAMD Patients Treated with An Episcleral Brachytherapy Device

    Energy Technology Data Exchange (ETDEWEB)

    Hamilton, R [Univ Arizona, Tucson, AZ (United States); Patel, P; Balaggan, K; Restori, M; Ilginis, T [Moorfields Eye Hospital, London (United Kingdom); Drew, M; McGovern, M; Vitali, J; Marsteller, L [Salutaris Medical Devices, Inc., Tucson, AZ (United States)

    2015-06-15

    Purpose: To evaluate the variations in dwell times and doses expected when using an episcleral brachytherapy device for treatment of neovascular agerelated macular degeneration (n-AMD) based on accurate imaging modalities Methods: Data from 40 eyes from 40 subjects with known n- AMD acquired through the Distance of Choroid Study (DOCS) conducted at Moorfields Eye Hospital was used to determine the target depth; the distance from the outer scleral surface of the eye, through the choroid, to the apex of the choroidal neovascularization (CNV). Each subject underwent, in triplicate, enhanced-depth Spectral Domain Optical Coherence Tomography (SD-OCT), Swept Source Optical Coherence Tomography, (SS-OCT) and Ocular Ultrasound (O-US). These data are the most comprehensive and accurate measurements of the dimensions of the CNV and adjacent layers of the eye for this cohort of patients. During treatment of n-AMD, patients receive a dose of 24Gy to the apex at the target depth. Using the percentage depth dose for a Sr-90 episcleral brachytherapy device, dwell times and doses to the apex were computed to determine the expected variations. Results: The mean target depth and the 95% confidence interval (CI) determined by combining O-US with SD-OCT were 1326 (956,1696)µm and with SS-OCT were 1332 (970,1693)µm. The calculated corresponding mean dwell times and 95% (CI) were 334 (223,445)s and 335 (226,445)s for SD-OCT and SS-OCT determined depths, respectively. The corresponding mean apex dose and 95% (CI) were 24 (35.9,18.0)Gy (SD-OCT) and 24 (35.6,18.1)Gy (SS-OCT). Conclusion: For episcleral brachytherapy treatment of n-AMD, using a patient population average target depth for treatment planning is inadequate, resulting in dose variations of a factor of approximately two over the 95% CI and larger variations for a nontrivial segment of the population. Each patient should have individualized imaging studies to determine the target depth for use in the dwell time calculation

  19. SU-E-T-16: A Comparison of Expected Dwell Times and Dose Variations for NAMD Patients Treated with An Episcleral Brachytherapy Device

    International Nuclear Information System (INIS)

    Hamilton, R; Patel, P; Balaggan, K; Restori, M; Ilginis, T; Drew, M; McGovern, M; Vitali, J; Marsteller, L

    2015-01-01

    Purpose: To evaluate the variations in dwell times and doses expected when using an episcleral brachytherapy device for treatment of neovascular agerelated macular degeneration (n-AMD) based on accurate imaging modalities Methods: Data from 40 eyes from 40 subjects with known n- AMD acquired through the Distance of Choroid Study (DOCS) conducted at Moorfields Eye Hospital was used to determine the target depth; the distance from the outer scleral surface of the eye, through the choroid, to the apex of the choroidal neovascularization (CNV). Each subject underwent, in triplicate, enhanced-depth Spectral Domain Optical Coherence Tomography (SD-OCT), Swept Source Optical Coherence Tomography, (SS-OCT) and Ocular Ultrasound (O-US). These data are the most comprehensive and accurate measurements of the dimensions of the CNV and adjacent layers of the eye for this cohort of patients. During treatment of n-AMD, patients receive a dose of 24Gy to the apex at the target depth. Using the percentage depth dose for a Sr-90 episcleral brachytherapy device, dwell times and doses to the apex were computed to determine the expected variations. Results: The mean target depth and the 95% confidence interval (CI) determined by combining O-US with SD-OCT were 1326 (956,1696)µm and with SS-OCT were 1332 (970,1693)µm. The calculated corresponding mean dwell times and 95% (CI) were 334 (223,445)s and 335 (226,445)s for SD-OCT and SS-OCT determined depths, respectively. The corresponding mean apex dose and 95% (CI) were 24 (35.9,18.0)Gy (SD-OCT) and 24 (35.6,18.1)Gy (SS-OCT). Conclusion: For episcleral brachytherapy treatment of n-AMD, using a patient population average target depth for treatment planning is inadequate, resulting in dose variations of a factor of approximately two over the 95% CI and larger variations for a nontrivial segment of the population. Each patient should have individualized imaging studies to determine the target depth for use in the dwell time calculation

  20. A Wireless Sensor Network Framework for Real-Time Monitoring of Height and Volume Variations on Sandy Beaches and Dunes

    Directory of Open Access Journals (Sweden)

    Alessandro Pozzebon

    2018-04-01

    Full Text Available In this paper, the authors describe the realization and testing of a Wireless Sensor Network (WSN framework aiming at measuring, remotely and in real time, the level variations of the sand layer of sandy beaches or dunes. The proposed framework is based on an innovative low cost sensing structure, able to measure the level variations with a 5-cm degree of precision and to locally transfer the acquired data through the ZigBee protocol. The described sensor is integrated in a wider ZigBee wireless sensor network architecture composed of an array of sensors that, arranged according to a grid layout, can acquire the same data at different points, allowing the definition of a dynamic map of the area under study. The WSN is connected to a local Global System for Mobile Communications (GSM gateway that is in charge of data processing and transmission to a cloud infrastructure through a General Packet Radio Service (GPRS connection. Data are then stored in a MySQL database and made available any time and anywhere through the Internet. The proposed architecture has been tested in a laboratory, to analyze data acquisition, processing timing and power consumption and then in situ to prove the effectiveness of the system. The described infrastructure is expected to be integrated in a wider IoT architecture including different typologies of sensors, in order to create a multi-purpose tool for the study of coastal erosive processes.

  1. Fetal short time variation during labor: a non-invasive alternative to fetal scalp pH measurements?

    Science.gov (United States)

    Schiermeier, Sven; Reinhard, Joscha; Hatzmann, Hendrike; Zimmermann, Ralf C; Westhof, Gregor

    2009-01-01

    To determine whether short time variation (STV) of fetal heart beat correlates with scalp pH measurements during labor. From 1279 deliveries, 197 women had at least one fetal scalp pH measurement. Using the CTG-Player, STVs were calculated from the electronically saved cardiotocography (CTG) traces and related to the fetal scalp pH measurements. There was no correlation between STV and fetal scalp pH measurements (r=-0.0592). Fetal STV is an important parameter with high sensitivity for antenatal fetal acidosis. This study shows that STV calculations do not correlate with fetal scalp pH measurements during labor, hence are not helpful in identifying fetal acidosis.

  2. Models of Solar Irradiance Variations: Current Status Natalie A ...

    Indian Academy of Sciences (India)

    Abstract. Regular monitoring of solar irradiance has been carried out since 1978 to show that solar total and spectral irradiance varies at different time scales. Whereas variations on time scales of minutes to hours are due to solar oscillations and granulation, variations on longer time scales are driven by the evolution of the ...

  3. Polyglutamine variation in a flowering time protein correlates with island age in a Hawaiian plant radiation

    Directory of Open Access Journals (Sweden)

    Laakkonen Liisa

    2007-07-01

    Full Text Available Abstract Background A controversial topic in evolutionary developmental biology is whether morphological diversification in natural populations can be driven by expansions and contractions of amino acid repeats in proteins. To promote adaptation, selection on protein length variation must overcome deleterious effects of multiple correlated traits (pleiotropy. Thus far, systems that demonstrate this capacity include only ancient or artificial morphological diversifications. The Hawaiian Islands, with their linear geological sequence, present a unique environment to study recent, natural radiations. We have focused our research on the Hawaiian endemic mints (Lamiaceae, a large and diverse lineage with paradoxically low genetic variation, in order to test whether a direct relationship between coding-sequence repeat diversity and morphological change can be observed in an actively evolving system. Results Here we show that in the Hawaiian mints, extensive polyglutamine (CAG codon repeat polymorphism within a homolog of the pleiotropic flowering time protein and abscisic acid receptor FCA tracks the natural environmental cline of the island chain, consequent with island age, across a period of 5 million years. CAG expansions, perhaps following their natural tendency to elongate, are more frequent in colonists of recently-formed, nutrient-rich islands than in their forebears on older, nutrient-poor islands. Values for several quantitative morphological variables related to reproductive investment, known from Arabidopsis fca mutant studies, weakly though positively correlate with increasing glutamine tract length. Together with protein modeling of FCA, which indicates that longer polyglutamine tracts could induce suboptimally mobile functional domains, we suggest that CAG expansions may form slightly deleterious alleles (with respect to protein function that become fixed in founder populations. Conclusion In the Hawaiian mint FCA system, we infer that

  4. Geostatistical Characteristic of Space -Time Variation in Underground Water Selected Quality Parameters in Klodzko Water Intake Area (SW Part of Poland)

    Science.gov (United States)

    Namysłowska-Wilczyńska, Barbara

    2016-04-01

    This paper presents selected results of research connected with the development of a (3D) geostatistical hydrogeochemical model of the Klodzko Drainage Basin, dedicated to the spatial and time variation in the selected quality parameters of underground water in the Klodzko water intake area (SW part of Poland). The research covers the period 2011÷2012. Spatial analyses of the variation in various quality parameters, i.e, contents of: ammonium ion [gNH4+/m3], NO3- (nitrate ion) [gNO3/m3], PO4-3 (phosphate ion) [gPO4-3/m3], total organic carbon C (TOC) [gC/m3], pH redox potential and temperature C [degrees], were carried out on the basis of the chemical determinations of the quality parameters of underground water samples taken from the wells in the water intake area. Spatial and time variation in the quality parameters was analyzed on the basis of archival data (period 1977÷1999) for 22 (pump and siphon) wells with a depth ranging from 9.5 to 38.0 m b.g.l., later data obtained (November 2011) from tests of water taken from 14 existing wells. The wells were built in the years 1954÷1998. The water abstraction depth (difference between the terrain elevation and the dynamic water table level) is ranged from 276÷286 m a.s.l., with an average of 282.05 m a.s.l. Dynamic water table level is contained between 6.22 m÷16.44 m b.g.l., with a mean value of 9.64 m b.g.l. The latest data (January 2012) acquired from 3 new piezometers, with a depth of 9÷10m, which were made in other locations in the relevant area. Thematic databases, containing original data on coordinates X, Y (latitude, longitude) and Z (terrain elevation and time - years) and on regionalized variables, i.e. the underground water quality parameters in the Klodzko water intake area determined for different analytical configurations (22 wells, 14 wells, 14 wells + 3 piezometers), were created. Both archival data (acquired in the years 1977÷1999) and the latest data (collected in 2011÷2012) were analyzed

  5. Explaining the Cross-National Time Series Variation in Life Expectancy: Income, Women’s Education, Shifts, and What Else?

    OpenAIRE

    Lant Pritchett; Martina Viarengo

    2010-01-01

    This paper examines the variation across countries and evolution over time of life expectancy. Using historical data going back to the beginning of the 20th century several basic facts about the relationship between national income and life expectancy are established. The paper shows that even by examining the augmented Preston curve there is no indication that the Preston curve is “breaking down” and no indication from over 100 years of data that a very strong relationship between national i...

  6. Spatial and time variations of radon-222 concentration in the atmosphere of a dead-end horizontal tunnel

    International Nuclear Information System (INIS)

    Richon, Patrick; Perrier, Frederic; Sabroux, Jean-Christophe; Trique, Michaeel; Ferry, Cecile; Voisin, Vincent; Pili, Eric

    2004-01-01

    The concentration of radon-222 has been monitored since 1995 in the atmosphere of a 2 m transverse dimension, 128 m long, dead-end horizontal tunnel located in the French Alps, at an altitude of 1600 m. Most of the time, the radon concentration is stable, with an average value ranging from 200 Bq m -3 near the entrance to about 1000 Bq m -3 in the most confined section, with an equilibrium factor between radon and its short-lived decay products varying from 0.61 to 0.78. However, radon bursts are repeatedly observed, with amplitudes reaching up to 36 x 10 3 Bq m -3 and durations varying from one to several weeks, with similar spatial variations along the tunnel as the background concentration. These spatial variations are qualitatively interpreted in terms of natural ventilation. Comparing the radon background concentration with the measured radon exhalation flux at the wall yields an estimate of 8 ± 2 x 10 -6 s -1 (0.03 ± 0.007 h -1 ) for the ventilation rate. The hypothesis that the bursts could be due to transient changes in ventilation can be ruled out. Thus, the bursts are the results of transient increased radon exhalation at the walls, that could be due to meteorological effects or possibly combined hydrological and mechanical forcing associated with the water level variations of the nearby Roselend reservoir lake. Such studies are of interest for radiation protection in poorly ventilated underground settings, and, ultimately, for a better understanding of radon exhalation associated with tectonic or volcanic processes

  7. Process-variation aware mapping of best-effort and real-time streaming applications to MPSoCs

    NARCIS (Netherlands)

    Mirzoyan, D.; Akesson, K.B.; Goossens, K.G.W.

    2014-01-01

    As technology scales, the impact of process variation on the maximum supported frequency (FMAX) of individual cores in a multiprocessor system-on-chip (MPSoC) becomes more pronounced. Task allocation without variation-aware performance analysis can greatly compromise performance and lead to a

  8. Time variations of hf induced plasma waves

    International Nuclear Information System (INIS)

    Showen, R.L.

    1976-01-01

    Intense plasma waves are generated by an HF pump wave in an ionospheric heating experiment at the Arecibo Observatory. These plasma waves can be observed as enhancements to the ion and plasma lines of the incoherent backscatter echo. The enhancements can be three or four orders of magnitude more intense than the unenhanced lines, and tend to fluctuate wildly. Both the purely growing and the decay mode parametric instabilities are present. When the pump wave is turned on abruptly the enhancements develop in time in a repeatable manner. A rather remarkable feature on time scales of seconds is an overshoot in instability power. These overshoots occur frequently but not universally and last for 1 to 6 seconds. They can have a magnitude from ten to hundreds of times the average instability level. Field aligned irregularities may be the cause of the overshoots. The overshoots appear definitely related to an unusually rapid rise in measured electron temperature that cannot be understood in terms of ohmic energy deposition. On time scales of milliseconds there is a ''mini-overshoot'' before the growth of the instability to a large value. The spectral details also change in a striking manner. The instabilities can first be detected 2 to 4 msec after the pump wave turn-on. The decay mode is present as well as a broad featureless ''noise bump'', which partially sharpens into a line as time progresses. These changes of the spectra in time seem to run counter to the currently accepted theories of plasma wave saturation

  9. Space-Time Variations in Water Vapor as Observed by the UARS Microwave Limb Sounder

    Science.gov (United States)

    Elson, Lee S.; Read, William G.; Waters, Joe W.; Mote, Philip W.; Kinnersley, Jonathan S.; Harwood, Robert S.

    1996-01-01

    Water vapor in the upper troposphere has a significant impact on the climate system. Difficulties in making accurate global measurements have led to uncertainty in understanding water vapor's coupling to the hydrologic cycle in the lower troposphere and its role in radiative energy balance. The Microwave Limb Sounder (MLS) on the Upper Atmosphere Research Satellite is able to retrieve water vapor concentration in the upper troposphere with good sensitivity and nearly global coverage. An analysis of these preliminary retrievals based on 3 years of observations shows the water vapor distribution to be similar to that measured by other techniques and to model results. The primary MLS water vapor measurements were made in the stratosphere, where this species acts as a conserved tracer under certain conditions. As is the case for the upper troposphere, most of the stratospheric discussion focuses on the time evolution of the zonal mean and zonally varying water vapor. Stratospheric results span a 19-month period and tropospheric results a 36-month period, both beginning in October of 1991. Comparisons with stratospheric model calculations show general agreement, with some differences in the amplitude and phase of long-term variations. At certain times and places, the evolution of water vapor distributions in the lower stratosphere suggests the presence of meridional transport.

  10. The rhesus macaque is three times as diverse but more closely equivalent in damaging coding variation as compared to the human

    Directory of Open Access Journals (Sweden)

    Yuan Qiaoping

    2012-06-01

    Full Text Available Abstract Background As a model organism in biomedicine, the rhesus macaque (Macaca mulatta is the most widely used nonhuman primate. Although a draft genome sequence was completed in 2007, there has been no systematic genome-wide comparison of genetic variation of this species to humans. Comparative analysis of functional and nonfunctional diversity in this highly abundant and adaptable non-human primate could inform its use as a model for human biology, and could reveal how variation in population history and size alters patterns and levels of sequence variation in primates. Results We sequenced the mRNA transcriptome and H3K4me3-marked DNA regions in hippocampus from 14 humans and 14 rhesus macaques. Using equivalent methodology and sampling spaces, we identified 462,802 macaque SNPs, most of which were novel and disproportionately located in the functionally important genomic regions we had targeted in the sequencing. At least one SNP was identified in each of 16,797 annotated macaque genes. Accuracy of macaque SNP identification was conservatively estimated to be >90%. Comparative analyses using SNPs equivalently identified in the two species revealed that rhesus macaque has approximately three times higher SNP density and average nucleotide diversity as compared to the human. Based on this level of diversity, the effective population size of the rhesus macaque is approximately 80,000 which contrasts with an effective population size of less than 10,000 for humans. Across five categories of genomic regions, intergenic regions had the highest SNP density and average nucleotide diversity and CDS (coding sequences the lowest, in both humans and macaques. Although there are more coding SNPs (cSNPs per individual in macaques than in humans, the ratio of dN/dS is significantly lower in the macaque. Furthermore, the number of damaging nonsynonymous cSNPs (have damaging effects on protein functions from PolyPhen-2 prediction in the macaque is more

  11. Alongshore Variation in the Depth of Activation: Implications of Oil Residence Time

    Science.gov (United States)

    Flores, P.; Houser, C.

    2016-12-01

    In 2010 the Deepwater Horizon Oil Spill released approximately 5 million barrels of oil into the Gulf of Mexico just as the nearshore and beach profile were recovering from winter storms. As a consequence, oil mats and tar balls were trapped at depth within the beach and nearshore profile. Excavation of this buried oil during subsequent storms creates the potential for the contamination of adjacent beaches and the degradation of marine ecosystems, which can in turn negatively impact local economies that depend on fisheries and tourism. The potential for oil burial and persistence is dependent on four things: the physio-chemical nature of the oil as it reaches the nearshore environment, the pre-existing morphology of the beach and nearshore, and the evolution of that morphology after the oil is deposited. The depth at which the oil is buried is also dependent on the beach profile during the time of the spill. The purpose of this study is to characterize the alongshore variation in depth of activation on a Deepwater Horizon impacted section of Pensacola Beach, Florida with regards to the implications of oil residence time. Ground- Penetrating Radar (GPR) surveys were conducted along two parallel 1-km transects adjacent to the swash zone and the dune. Additional cross- shore transects were completed every 150 m from the base of the dune to the top of the swash zone. Sediments cores were taken at the crossing points of the alongshore and cross-shore transects, to calibrate the GPR surveys and complete an elemental analysis for the identification of storm layers. The cores were also analyzed for the presence of buried oil.

  12. Annual and interannual variations in global 6.5DWs from 20 to 110 km during 2002-2016 observed by TIMED/SABER

    Science.gov (United States)

    Huang, Y. Y.; Zhang, S. D.; Li, C. Y.; Li, H. J.; Huang, K. M.; Huang, C. M.

    2017-08-01

    Using version 2.0 of the TIMED/SABER kinetic temperature data, we have conducted a study on the annual and interannual variations of 6.5DWs at 20-110 km, from 52°S to 52°N for 2002-2016. First, we obtained global annual variations in the spectral power and amplitudes of 6.5DWs. We found that strong wave amplitudes emerged from 25°S/N to 52°S/N and peaked in the altitudes of the stratosphere, mesosphere, and the lower thermosphere. The annual variations in the 6.5DWs are similar in both hemispheres but different at various altitudes. At 40-50 km, the annual maxima emerge mostly in winters. In the MLT, annual peaks occurred twice every half year. At 80-90 km, 6.5DWs appeared mainly in equinoctial seasons and winters. At 100-110 km, 6.5DWs emerged mainly in equinoctial seasons. Second, we continued the study of the interannual variations in 6.5DW amplitudes from 2002 to 2016. Frequency spectra of the monthly mean amplitudes showed that main dynamics in the long-term variations of 6.5DWs were AO and SAO in both hemispheres. In addition, 4 month period signals were noticed in the MLT of the NH. The amplitudes of SAO and AO were obtained using a band-pass filter and were found to increase with altitude, as do the 6.5DW amplitudes. In both hemispheres, the relative importance of SAO and AO changes with altitude. At 40-50 and 100-110 km, AO play a dominant role, while at 80-90 km, they are weaker than SAO. Our results show that both the annual and interannual variations in 6.5DWs are mainly caused by the combined action of SAO and AO.

  13. The search for possible time variations in Davis' measurements of the argon production rate in the solar neutrino experiment

    International Nuclear Information System (INIS)

    Haubold, H.J.; Gerth, E.

    1985-01-01

    With the gradual accumulation of experimental data in the solar neutrino experiment of Davis and collaborators (runs 18-74 for 1970-1982), the question, whether there are time variations of the solar neutrino flux, is of renewed interest. We discuss the mathematical-numerical methods applied to the statistical analysis of Davis' argon-37 production rate up till now known in the literature. These methods are characterized by the arbitrary arrangement of the Davis data in a time series. We perform a certain Fourier transformation for unequally-spaced time series of the measuring data of the argon-37 production rate, discuss the discovered periods and give significance criteria with respect to each period. We find that all periods discussed in the literature are contained in our series of periods. Pointing out the more mathematical character of the time series analysis we emphasize the predominant significance of the detected periods. (author)

  14. SYSTEMATIC AND STOCHASTIC VARIATIONS IN PULSAR DISPERSION MEASURES

    International Nuclear Information System (INIS)

    Lam, M. T.; Cordes, J. M.; Chatterjee, S.; Jones, M. L.; McLaughlin, M. A.; Armstrong, J. W.

    2016-01-01

    We analyze deterministic and random temporal variations in the dispersion measure (DM) from the full three-dimensional velocities of pulsars with respect to the solar system, combined with electron-density variations over a wide range of length scales. Previous treatments have largely ignored pulsars’ changing distances while favoring interpretations involving changes in sky position from transverse motion. Linear trends in pulsar DMs observed over 5–10 year timescales may signify sizable DM gradients in the interstellar medium (ISM) sampled by the changing direction of the line of sight to the pulsar. We show that motions parallel to the line of sight can also account for linear trends, for the apparent excess of DM variance over that extrapolated from scintillation measurements, and for the apparent non-Kolmogorov scalings of DM structure functions inferred in some cases. Pulsar motions through atomic gas may produce bow-shock ionized gas that also contributes to DM variations. We discuss the possible causes of periodic or quasi-periodic changes in DM, including seasonal changes in the ionosphere, annual variations of the solar elongation angle, structure in the heliosphere and ISM boundary, and substructure in the ISM. We assess the solar cycle’s role on the amplitude of ionospheric and solar wind variations. Interstellar refraction can produce cyclic timing variations from the error in transforming arrival times to the solar system barycenter. We apply our methods to DM time series and DM gradient measurements in the literature and assess their consistency with a Kolmogorov medium. Finally, we discuss the implications of DM modeling in precision pulsar timing experiments

  15. Spatial and temporal variation of residence time and storage volume of subsurface water evaluated by multi-tracers approach in mountainous headwater catchments

    Science.gov (United States)

    Tsujimura, Maki; Yano, Shinjiro; Abe, Yutaka; Matsumoto, Takehiro; Yoshizawa, Ayumi; Watanabe, Ysuhito; Ikeda, Koichi

    2015-04-01

    Headwater catchments in mountainous region are the most important recharge area for surface and subsurface waters, additionally time and stock information of the water is principal to understand hydrological processes in the catchments. However, there have been few researches to evaluate variation of residence time and storage volume of subsurface water in time and space at the mountainous headwaters especially with steep slope. We performed an investigation on age dating and estimation of storage volume using simple water budget model in subsurface water with tracing of hydrological flow processes in mountainous catchments underlain by granite, Paleozoic and Tertiary, Yamanashi and Tsukuba, central Japan. We conducted hydrometric measurements and sampling of spring, stream and ground waters in high-flow and low-flow seasons from 2008 through 2012 in the catchments, and CFCs, stable isotopic ratios of oxygen-18 and deuterium, inorganic solute constituent concentrations were determined on all water samples. Residence time of subsurface water ranged from 11 to 60 years in the granite catchments, from 17 to 32 years in the Paleozoic catchments, from 13 to 26 years in the Tertiary catchments, and showed a younger age during the high-flow season, whereas it showed an older age in the low-flow season. Storage volume of subsurface water was estimated to be ranging from 10 ^ 4 to 10 ^ 6 m3 in the granite catchments, from 10 ^ 5 to 10 ^ 7 m3 in the Paleozoic catchments, from 10 ^ 4 to 10 ^ 6 m3 in the Tertiary catchments. In addition, seasonal change of storage volume in the granite catchments was the highest as compared with those of the Paleozoic and the Tertiary catchments. The results suggest that dynamic change of hydrological process seems to cause a larger variation of the residence time and storage volume of subsurface water in time and space in the granite catchments, whereas higher groundwater recharge rate due to frequent fissures or cracks seems to cause larger

  16. Batch leachate treatment using stirred electrocoagulation reactor with variation of residence time and stirring rate

    Science.gov (United States)

    Sitorus, I. S.; Astono, W.; Iswanto, B.

    2018-01-01

    This study aims to reduce pollutant levels of the leachate by electrocoagulation method using a stirred electrocoagulation reactor as the electrochemical water treatment. The release of active coagulants as metallic ions took place in the anode, while in the cathode, the electrolysis reaction in the form of hydrogen gas dischargeoccurred. The source of wastewater is Waste Water Treatment Plant inlet III of Bantar Gebang, Bekasi. Some parameters were analyzed in this research, i.e., Chemical Oxygen Demand (COD), Biochemical Oxygen Demand (BOD), NH3, NO3 -, NO2 -, N-total, and organic substances as well as the microorganism growth before and after electrocoagulation, with variations of detention time (seconds) of 10, 20, 120, 600 and rapid mixing conditions (rpm) of 60, 100 and 200. The results show that the greater the rapid mixing speed and the detention time of electrolysis, the higher the removal of contaminants in liquid waste. The optimum condition of electrocoagulation was encountered at 200 rpm rapid mixing with 600 seconds of processing time. The removal efficiencies of electrocoagulation method for each parameter are TSS of 46.80%, BOD5 of 71.33%, COD of 73.77%, Pb of 62.5%,and NH3-N of 57.92%,whereas the pH value has been increased from 8.03 to 8.95. The electrocoagulation method can reduce levels of pollutants, complying with the environmental standards.

  17. Patterns of activity and use of time in rural Bangladesh: class, gender, and seasonal variations.

    Science.gov (United States)

    Zaman, H

    1995-04-01

    Tarapur is a village in the district of Rajshahi, Bangladesh, covering an area of 821.05 acres. 342 households with a total population of 1981 were identified in the village by the 1985 census. The author investigated the use of time during 1984 and 1985 in busy, intermediate, and slack seasons among the village population to examine the variation in time use by gender and social class. Activity patterns were found to vary from one season to another, and also across social classes. The study highlights the need to refine some of the conceptual and methodological issues in the collection of data on women and work. The study also presents useful data on home-based production and market-oriented work. It could be useful to adopt an anthropological approach in order to understand the allocation of time by men and women from the perspective of household production and the local economy and culture. Study findings focus upon the following policy issues: the need for a better understanding and recognition of the significant role of women in field agriculture and postharvest processing, creation of further nontraditional employment and business opportunities for poor women in rural areas, and consciousness-raising and the challenge of cultural barriers affecting women. Rural women, especially those in need of employment and involved in market-oriented production, should be the target of mainstream development activities in future planning.

  18. Variations in soil-to-red pepper transfer factors of radionuclides with time of their application and fruit harvest

    International Nuclear Information System (INIS)

    Choi, Yong Ho; Lee, Won Yun; Lim, Kwang Muk; Park, Soo Won; Lee, Myung Ho; Lee, Chang Woo; Lee, Hyun Duk; Lee, Jeong Ho

    1997-01-01

    A mixed solution of 54 Mn, 60 Co, 85 Sr and 137 Cs was applied to the soil of culture boxes in a greenhouse 2 days before transplanting red pepper and at 3 different times during its growth for investigating transfer factors (m 2 /kg-dry) for its green and red fruits. Transfer factors varied with radionuclide, application time and harvest time by factors of about 20-100. They decreased mostly radionuclide, application time and harvest time by factors of about 20-100. They decreased mostly in the order of 85 Sr> 54 Mn> 60 Co> 137 Cs while 54 Mn and 60 Co was higher than 85 Sr when time lapse between application and harvest was short. Transfer factors of 85 Sr and 137 Cs at the last application were lower than those at the previous one by factors of 3-20 depending on harvest time. Variations in 54 Mn and 60 Co transfer factors with application time after transplanting were comparatively low. Transfer factors of 54 Mn, 60 Co and 85 Sr mixed with topsoil before transplanting were up to 3-9 times higher than those for the application onto soil surface 2 days after transplanting root-uptake concentrations of the radionuclides in red pepper fruit and taking proper measures for its harvest and consumption at the event of an accidental release during the growing season of red pepper

  19. Variation in the Time of Colonization of Broiler Carcasses by Carrion Flies in Nakhonsawan Province, Thailand.

    Science.gov (United States)

    Moophayak, Kittikhun; Sukontason, Kabkaew L; Ruankham, Watcharapong; Tomberlin, Jeffery K; Bunchu, Nophawan

    2017-09-01

    Carrion flies are the primary insects colonizing vertebrate carrion; however, limited information is available on the variation in the time of colonization (TOC) as related to time of placement (TOP) and time of death (TOD), particularly in Thailand. Three seasonal sets of nine broiler carcasses (euthanized and placed in field within 0.5 h after death) were placed in mesh enclosures within a disturbed deciduous dipterocarp forest at Nakhonsawan Province, upper-central Thailand, for 3 d to determine the colonization time by carrion flies. In total, 21,536 arthropods were collected using traps placed over each carcass. Carrion flies of the family Calliphoridae, Muscidae, and Sarcophagidae predominated (93.42%). Of these, Chrysomya megacephala (F.) (Diptera: Calliphoridae) and Chrysomya rufifacies (Macquart) (Diptera: Calliphoridae) were the dominant species being 36.18% and 35.36%, respectively, across season. These species arrived immediately (5 min) after placement of the carrion in the field during the rainy season, while they were delayed 1-2 h during the dry season. Chrysomya megacephala, C. rufifacies, and Parasarcophaga dux (Thomson) colonized the remains. Time of colonization by C. megacephala and C. rufifacies occurred mostly at ∼1600-1700 hours (10-11 h after placement) for all seasons. In contrast, TOC by P. dux was delayed for 1 d during rainy and dry season. These results mark the first record of carrion fly colonization in this area and also may deserve important information for the further study as they demonstrate time of colonization differs from TOP and most importantly TOD. © Crown copyright 2017.

  20. Long-term variations of fumarole temperatures on Vulcano Island (Italy

    Directory of Open Access Journals (Sweden)

    Iole Serena Diliberto

    2011-06-01

    Full Text Available Fumarole temperatures are the ultimate results of many processes that are encountered by deep fluids during their passage to the surface. Here, the time variations of high-temperature fumaroles acquired by continuous monitoring are presented, to show the effects of the forces that act on the system. Data acquired by continuous monitoring of fumaroles and the time relationships with the different parameters related to the activity of the volcanic system are discussed. From 1998 to 2010, the temperature and compositional changes of fumarolic gases were monitored at the same time as variations in the number of volcano-seismic events, which indicate frequent variations of energy release (heat and mass flow, and seismic strain release. Geochemical modeling applied to the volcanic system of Vulcano Island suggests that the overall expansion of magmatic gas through the fractured system is an almost iso-enthalpic process at depth, which shifts to an adiabatic process at shallow depth, where the rock permeability increases. Thus, the time variations of the fumarole temperatures reflect various physical variations of the system that can either occur at depth or close to the surface. The temperature monitoring performed in the fumarolic area of La Fossa Cone showed short-term effects related to rain events, and negligible effects related to other external agents (ambient temperature and atmospheric pressure variations. At the same time, the long-term monitoring highlighted some mean-term and long-term variations. These last are the main characters observed in the time-series, and they both appear to be related to endogenous forces that perturb the equilibrium of this complex geochemical system.

  1. Variation in Patients' Travel Times among Imaging Examination Types at a Large Academic Health System.

    Science.gov (United States)

    Rosenkrantz, Andrew B; Liang, Yu; Duszak, Richard; Recht, Michael P

    2017-08-01

    Patients' willingness to travel farther distances for certain imaging services may reflect their perceptions of the degree of differentiation of such services. We compare patients' travel times for a range of imaging examinations performed across a large academic health system. We searched the NYU Langone Medical Center Enterprise Data Warehouse to identify 442,990 adult outpatient imaging examinations performed over a recent 3.5-year period. Geocoding software was used to estimate typical driving times from patients' residences to imaging facilities. Variation in travel times was assessed among examination types. The mean expected travel time was 29.2 ± 20.6 minutes, but this varied significantly (p travel times were shortest for ultrasound (26.8 ± 18.9) and longest for positron emission tomography-computed tomography (31.9 ± 21.5). For magnetic resonance imaging, travel times were shortest for musculoskeletal extremity (26.4 ± 19.2) and spine (28.6 ± 21.0) examinations and longest for prostate (35.9 ± 25.6) and breast (32.4 ± 22.3) examinations. For computed tomography, travel times were shortest for a range of screening examinations [colonography (25.5 ± 20.8), coronary artery calcium scoring (26.1 ± 19.2), and lung cancer screening (26.4 ± 14.9)] and longest for angiography (32.0 ± 22.6). For ultrasound, travel times were shortest for aortic aneurysm screening (22.3 ± 18.4) and longest for breast (30.1 ± 19.2) examinations. Overall, men (29.9 ± 21.6) had longer (p travel times than women (27.8 ± 20.3); this difference persisted for each modality individually (p ≤ 0.006). Patients' willingness to travel longer times for certain imaging examination types (particularly breast and prostate imaging) supports the role of specialized services in combating potential commoditization of imaging services. Disparities in travel times by gender warrant further investigation. Copyright

  2. Variational integrators for electric circuits

    International Nuclear Information System (INIS)

    Ober-Blöbaum, Sina; Tao, Molei; Cheng, Mulin; Owhadi, Houman; Marsden, Jerrold E.

    2013-01-01

    In this contribution, we develop a variational integrator for the simulation of (stochastic and multiscale) electric circuits. When considering the dynamics of an electric circuit, one is faced with three special situations: 1. The system involves external (control) forcing through external (controlled) voltage sources and resistors. 2. The system is constrained via the Kirchhoff current (KCL) and voltage laws (KVL). 3. The Lagrangian is degenerate. Based on a geometric setting, an appropriate variational formulation is presented to model the circuit from which the equations of motion are derived. A time-discrete variational formulation provides an iteration scheme for the simulation of the electric circuit. Dependent on the discretization, the intrinsic degeneracy of the system can be canceled for the discrete variational scheme. In this way, a variational integrator is constructed that gains several advantages compared to standard integration tools for circuits; in particular, a comparison to BDF methods (which are usually the method of choice for the simulation of electric circuits) shows that even for simple LCR circuits, a better energy behavior and frequency spectrum preservation can be observed using the developed variational integrator

  3. Application of Synthetic Storm Technique for Diurnal and Seasonal Variation of Slant Path Ka-Band Rain Attenuation Time Series over a Subtropical Location in South Africa

    Directory of Open Access Journals (Sweden)

    J. S. Ojo

    2015-01-01

    Full Text Available As technology advances and more demands are on satellite services, rain-induced attenuation still creates one of the most damaging effects of the atmosphere on the quality of radio communication signals, especially those operating above 10 GHz. System designers therefore require statistical information on rain-induced attenuation over the coverage area in order to determine the appropriate transmitter and receiver characteristics to be adopted. This paper presents results on the time-varying rain characterization and diurnal variation of slant path rain attenuation in the Ka-band frequency simulated with synthetic storm techniques over a subtropical location in South Africa using 10-year rain rate time-series data. The analysis is based on the CDF of one-minute rain rate; time-series seasonal variation of rain rate observed over four time intervals: 00:00–06:00, 06:00–12:00, 12:00–18:00, and 18:00–24:00; diurnal fades margin; and diurnal variation of rain attenuation. Comparison was also made between the synthesized values and measured attenuation data. The predicted statistics are in good agreement with those obtained from the propagation beacon measurement in the area. The overall results will be needed for an acceptable planning that can effectively reduce the fade margin to a very low value for an optimum data communication over this area.

  4. Deep CNNs Along the Time Axis With Intermap Pooling for Robustness to Spectral Variations

    Science.gov (United States)

    Lee, Hwaran; Kim, Geonmin; Kim, Ho-Gyeong; Oh, Sang-Hoon; Lee, Soo-Young

    2016-10-01

    Convolutional neural networks (CNNs) with convolutional and pooling operations along the frequency axis have been proposed to attain invariance to frequency shifts of features. However, this is inappropriate with regard to the fact that acoustic features vary in frequency. In this paper, we contend that convolution along the time axis is more effective. We also propose the addition of an intermap pooling (IMP) layer to deep CNNs. In this layer, filters in each group extract common but spectrally variant features, then the layer pools the feature maps of each group. As a result, the proposed IMP CNN can achieve insensitivity to spectral variations characteristic of different speakers and utterances. The effectiveness of the IMP CNN architecture is demonstrated on several LVCSR tasks. Even without speaker adaptation techniques, the architecture achieved a WER of 12.7% on the SWB part of the Hub5'2000 evaluation test set, which is competitive with other state-of-the-art methods.

  5. The Influence of Variation in Time and HCl Concentration to the Glucose Produced from Kepok Banana

    Science.gov (United States)

    Widodo M, Rohman; Noviyanto, Denny; RM, Faisal

    2016-01-01

    Kepok banana (Musa paradisiaca) is a plant that has many advantagesfrom its fruit, stems, leaves, flowers and cob. However, we just tend to take benefit from the fruit. We grow and harvest the fruit without taking advantages from other parts. So they would be a waste or detrimental to animal nest if not used. The idea to take the benefit from the banana crop yields, especially cob is rarely explored. This study is an introduction to the use of banana weevil especially from the glucose it contains. This study uses current methods of hydrolysis using HCl as a catalyst with the concentration variation of 0.4 N, 0.6 N and 0.8 N and hydrolysis times variation of 20 minutes, 25 minutes and 30 minutes. The stages in the hydrolysis include preparation of materials, the process of hydrolysis and analysis of test results using Fehling and titrate with standard glucose solution. HCl is used as a catalyst because it is cheaper than the enzyme that has the same function. NaOH 60% is used for neutralizing the pH of the filtrate result of hydrolysis. From the results of analysis, known thatthe biggest yield of glucose is at concentration 0.8 N and at 30 minutes reaction, it contains 6.25 gram glucose / 20 gram dry sampel, and the convertion is 27.22% at 20 gram dry sampel.

  6. Geomagnetic field variations at the equatorial electrojet station in Sri Lanka, Peredinia

    Directory of Open Access Journals (Sweden)

    R. G. Rastogi

    2004-09-01

    Full Text Available The paper discusses the variations of the horizontal (H, vertical (Z and eastward (Y components of the geomagnetic field at Peredinia (PRD, an electrojet station in Sri Lanka, with the time of the day, season, sudden commencement (SSC and during geomagnetic storms. The daily variation of H showed a large peak around midday. The daily variation of Z appeared to be almost a time gradient curve of the daily variation of H, showing a maximum around 09:00 LT (75° EMT when the H field was increasing fastest and not at noon when Δ H was the maximum. Storm time variation of H resembled the variation of the Dst index but that of Z showed a large minimum about 2-3h before the time of minimum Dst or at the time of maximum time gradient of Dst variation. These features are compared with corresponding variations at the equatorial stations Trivandrum (TRD in India, and remarkable similarity in all observations is noticed at PRD and TRD. It is suggested that the observed abnormal features of Z variations at electrojet stations in India-Sri Lanka are due to (i direct effect of the ionospheric electrojet current (ii the induction effect of the image current by the average spatially extended conductivity region and (iii the induction current in the local subsurface conductor. It is suggested that the conductor responsible for the observed features in Z in India and Sri Lanka has to have extended spatial domain to latitudes well south of India, rather than confined to narrow Palk Strait.

  7. Variational principles for locally variational forms

    International Nuclear Information System (INIS)

    Brajercik, J.; Krupka, D.

    2005-01-01

    We present the theory of higher order local variational principles in fibered manifolds, in which the fundamental global concept is a locally variational dynamical form. Any two Lepage forms, defining a local variational principle for this form, differ on intersection of their domains, by a variationally trivial form. In this sense, but in a different geometric setting, the local variational principles satisfy analogous properties as the variational functionals of the Chern-Simons type. The resulting theory of extremals and symmetries extends the first order theories of the Lagrange-Souriau form, presented by Grigore and Popp, and closed equivalents of the first order Euler-Lagrange forms of Hakova and Krupkova. Conceptually, our approach differs from Prieto, who uses the Poincare-Cartan forms, which do not have higher order global analogues

  8. Ethnic variations in overweight and obesity among children over time: findings from analyses of the Health Surveys for England 1998-2009.

    Science.gov (United States)

    Karlsen, S; Morris, S; Kinra, S; Vallejo-Torres, L; Viner, R M

    2014-06-01

    The increase in the prevalence of obesity among children and adolescents in England since the mid-1990s has been dramatic. Cross-sectional evidence suggests ethnic variations in childhood obesity prevalence. The objective of the study was to examine whether and how ethnic variations in childhood overweight/obesity have changed over time, and are affected by socioeconomic factors. This study uses logistic regression to analyse ethnic differences in the relative likelihood of being at or above the age- and gender-specific thresholds for overweight and obesity developed by the International Obesity Task Force among children aged between 2 and 15 from 11 ethnic groups included in the Health Surveys for England between 1998 and 2009, adjusting for age, gender, year of data collection and equivalized household income. We separately analyse the likelihood of being at or above the thresholds for overweight (but below those for obesity) and obesity. Trends in overweight/obesity over time among ethnic minority groups do not follow those of white English children. Black African children had higher rates of overweight and obesity, which appear to have peaked, and black Caribbean children had higher rates of obesity than other groups examined, which appear to continue rising. These differences were not explained by socioeconomic variations between groups. Policies are required that encourage healthy lifestyles among ethnic minority young people, while engaging with the complexities associated with these choices during childhood and adolescence. © 2013 The Authors. Pediatric Obesity © 2013 International Association for the Study of Obesity.

  9. Evaluation of quantitative imaging methods for organ activity and residence time estimation using a population of phantoms having realistic variations in anatomy and uptake

    International Nuclear Information System (INIS)

    He Bin; Du Yong; Segars, W. Paul; Wahl, Richard L.; Sgouros, George; Jacene, Heather; Frey, Eric C.

    2009-01-01

    Estimating organ residence times is an essential part of patient-specific dosimetry for radioimmunotherapy (RIT). Quantitative imaging methods for RIT are often evaluated using a single physical or simulated phantom but are intended to be applied clinically where there is variability in patient anatomy, biodistribution, and biokinetics. To provide a more relevant evaluation, the authors have thus developed a population of phantoms with realistic variations in these factors and applied it to the evaluation of quantitative imaging methods both to find the best method and to demonstrate the effects of these variations. Using whole body scans and SPECT/CT images, organ shapes and time-activity curves of 111In ibritumomab tiuxetan were measured in dosimetrically important organs in seven patients undergoing a high dose therapy regimen. Based on these measurements, we created a 3D NURBS-based cardiac-torso (NCAT)-based phantom population. SPECT and planar data at realistic count levels were then simulated using previously validated Monte Carlo simulation tools. The projections from the population were used to evaluate the accuracy and variation in accuracy of residence time estimation methods that used a time series of SPECT and planar scans. Quantitative SPECT (QSPECT) reconstruction methods were used that compensated for attenuation, scatter, and the collimator-detector response. Planar images were processed with a conventional (CPlanar) method that used geometric mean attenuation and triple-energy window scatter compensation and a quantitative planar (QPlanar) processing method that used model-based compensation for image degrading effects. Residence times were estimated from activity estimates made at each of five time points. The authors also evaluated hybrid methods that used CPlanar or QPlanar time-activity curves rescaled to the activity estimated from a single QSPECT image. The methods were evaluated in terms of mean relative error and standard deviation of the

  10. Short-time variations of the solar neutrino luminosity (Fourier analysis of the argon-37 production rate data)

    International Nuclear Information System (INIS)

    Haubold, H.J.; Gerth, E.

    1985-01-01

    We continue the Fourier analysis of the argon-37 production rate for runs 18--80 observed in Davis' well known solar neutrino experiment. The method of Fourier analysis with the unequally-spaced data of Davis and associates is described and the discovered periods we compare with our recently published results for the analysis of runs 18--69 (Haubold and Gerth, 1983). The harmonic analysis of the data of runs 18--80 shows time variations of the solar neutrino flux with periods π = 8.33; 5.26; 2.13; 1.56; 0.83; 0.64; 0.54; and 0.50 years, respectively, which confirms our earlier computations

  11. Variation in the human lymphocyte sister chromatid exchange frequency as a function of time: results of daily and twice-weekly sampling

    Energy Technology Data Exchange (ETDEWEB)

    Tucker, J.D.; Christensen, M.L.; Strout, C.L.; McGee, K.A.; Carrano, A.V.

    1987-01-01

    The variation in lymphocyte sister chromatid exchange (SCE) frequency was investigated in healthy nonsmokers who were not taking any medication. Two separate studies were undertaken. In the first, blood was drawn from four women twice a week for 8 weeks. These donors recorded the onset and termination of menstruation and times of illness. In the second study, blood was obtained from two women and two men for 5 consecutive days on two separate occasions initiated 14 days apart. Analysis of the mean SCE frequencies in each study indicated that significant temporal variation occurred in each donor, and that more variation occurred in the longer study. Some of the variation was found to be associated with the menstrual cycle. In the daily study, most of the variation appeared to be random, but occasional day-to-day changes occurred that were greater than those expected by chance. To determine how well a single SCE sample estimated the pooled mean for each donor in each study, the authors calculated the number of samples that encompassed that donor's pooled mean within 1 or more standard errors. For both studies, about 75% of the samples encompassed the pooled mean within 2 standard errors. An analysis of high-frequency cells (HFCs) was also undertaken. The results for each study indicate that the proportion of HFCs, compared with the use of Fisher's Exact test, is significantly more constant than the means, which were compared by using the t-test. These results coupled with our previous work suggest that HFC analysis may be the method of choice when analyzing data from human population studies.

  12. Variational principle for nonlinear gyrokinetic Vlasov--Maxwell equations

    International Nuclear Information System (INIS)

    Brizard, Alain J.

    2000-01-01

    A new variational principle for the nonlinear gyrokinetic Vlasov--Maxwell equations is presented. This Eulerian variational principle uses constrained variations for the gyrocenter Vlasov distribution in eight-dimensional extended phase space and turns out to be simpler than the Lagrangian variational principle recently presented by H. Sugama [Phys. Plasmas 7, 466 (2000)]. A local energy conservation law is then derived explicitly by the Noether method. In future work, this new variational principle will be used to derive self-consistent, nonlinear, low-frequency Vlasov--Maxwell bounce-gyrokinetic equations, in which the fast gyromotion and bounce-motion time scales have been eliminated

  13. Modal Identification of a Time-Invariant 6-Storey Model Test RC-Frame from Free Decay Tests using Multi-Variate Models

    DEFF Research Database (Denmark)

    Skjærbæk, P. S.; Nielsen, Søren R. K.; Kirkegaard, Poul Henning

    1997-01-01

    in the comparison. The data investigated are sampled from a laboratory model of a plane 6-storey, 2-bay RC-frame. The laboratory model is excited at the top storey where two different types of excitation where considered. In the first case the structure was excited in the first mode and in the second case......The scope of the paper is to apply multi-variate time-domain models for identification of eginfrequencies and mode shapes of a time- invariant model test Reinforced Concrete (RC) frame from measured decays. The frequencies and mode shapes of interest are the two lowest ones since they are normally...

  14. Modal Identification of a Time-Invariant 6-Storey Model Test RC-Frame from Free Decay Tests using Multi-Variate Models

    DEFF Research Database (Denmark)

    Skjærbæk, P. S.; Nielsen, Søren R. K.; Kirkegaard, Poul Henning

    in the comparison. The data investigated are sampled from a laboratory model of a plane 6-storey, 2-bay RC-frame. The laboratory model is excited at the top storey where two different types of excitation where considered. In the first case the structure was excited in the first mode and in the second case......The scope of the paper is to apply multi-variate time-domain models for identification of eginfrequencies and mode shapes of a time- invariant model test Reinforced Concrete (RC) frame from measured decays. The frequencies and mode shapes of interest are the two lowest ones since they are normally...

  15. Solar cycle variations of geocoronal balmer α emission

    International Nuclear Information System (INIS)

    Nossal, S.; Reynolds, R.J.; Roesler, F.L.; Scherb, F.

    1993-01-01

    Observations of the geocoronal Balmer in nightglow have been made from Wisconsin for more than a solar cycle with an internally consistent intensity reference to standard astronomical nebulae. These measurements were made with a double etalon, pressure-scanned, 15-cm aperture Fabry-Perot interferometer. The resulting long time data provides an opportunity to examine solar cycle influence on the mid-latitude exosphere and to address accompanying questions concerning the degree to which the exosphere is locally static or changing. The exospheric Balmer α absolute intensity measurements reported here show no statistically significant variations throughout the solar cycle when the variation with viewing geometry is removed by normalizing the data to reference exospheric model predictions by Anderson et al. However, the relative intensity dependence on solar depression angle does show a solar cycle variation. This variation suggests a possible related variation in the exospheric hydrogen density profile, although other interpretations are also possible. The results suggest that additional well-calibrated data taken over a longer time span could probe low-amplitude variations over the solar cycle and test predictions of a slow monotonic increase in exospheric hydrogen arising from greenhouse gases. 21 refs., 9 figs., 2 tabs

  16. Gender-related difference, geographical variation and time trend in dietary cadmium intake in Japan

    International Nuclear Information System (INIS)

    Watanabe, T.; Shimbo, S.; Nakatsuka, H.; Koizumi, A.; Higashikawa, K.; Matsuda-Inoguchi, N.; Ikeda, M.

    2004-01-01

    Objectives: The present analysis was initiated to examine possible gender-dependency, geographic variation, and time-dependent changes in dietary intake of cadmium (Cd-F) among general populations in Cd-non-polluted areas in Japan. The role of rice as Cd-F source was also within the scope. Methods: Two databases on Cd and nutritional analyses were re-visited. Both databases were established through collection of 24-h food duplicate portion samples from residents in areas with no known Cd pollution, and contained information on Cd and energy contents in the duplicate portion, together with daily rice consumption, the gender, the age and the location of the residence of each sample donor. The first and the second databases were established through surveys in the years around 1980 on 564 cases and around 1995 on 702 cases, respectively. The two databases were combined for evaluation by multiple regression (MRA) and other analyses. Results: The analyses showed that men tended to take more Cd than women, more clearly so in the 1980 survey than in the 1995 survey. When Cd-F in the 1995 survey was compared with that in the 1980 survey, a substantial decrease was observed, e.g. by 30% (from 37.5 to 26.2 μg/day) in case of women. Cd-F values varied subject to the survey sites in a wide range (e.g. from 20 to 86 μg/day among women in the 1980 survey). In MRA with Cd-F as a dependent variable and survey sites and food intake factors (e.g. rice and energy intakes) as independent variables, the survey sites could explain more than 53% and 35% of total variation in Cd-F in the 1980 and 1995 surveys, respectively. Rice consumption was also influential to Cd-F in both surveys with partial correlation coefficients of 0.36 and 0.21, respectively, the influence being stronger in the 1980 survey than in the 1995 survey. A significant correlation was detected between the 1980 and 1995 survey results both in Cd-F and in rice consumption. Conclusion: Geographic and gender

  17. The Kepler-19 System: A Thick-envelope Super-Earth with Two Neptune-mass Companions Characterized Using Radial Velocities and Transit Timing Variations

    Energy Technology Data Exchange (ETDEWEB)

    Malavolta, Luca; Borsato, Luca; Granata, Valentina; Piotto, Giampaolo; Nascimbeni, Valerio [Dipartimento di Fisica e Astronomia “Galileo Galilei”, Universita’di Padova, Vicolo dell’Osservatorio 3, I-35122 Padova (Italy); Lopez, Eric [SUPA, Institute for Astronomy, University of Edinburgh, Royal Observatory, Blackford Hill, Edinburgh, EH93HJ (United Kingdom); Vanderburg, Andrew; Charbonneau, David [Harvard-Smithsonian Center for Astrophysics, 60 Garden Street, Cambridge, Massachusetts 02138 (United States); Figueira, Pedro [Instituto de Astrofísica e Ciências do Espaço, Universidade do Porto, CAUP, Rua das Estrelas, PT4150-762 Porto (Portugal); Mortier, Annelies; Cameron, Andrew Collier [Centre for Exoplanet Science, SUPA, School of Physics and Astronomy, University of St. Andrews, St. Andrews KY16 9SS (United Kingdom); Affer, Laura [INAF—Osservatorio Astronomico di Palermo, Piazza del Parlamento 1, I-90124 Palermo (Italy); Bonomo, Aldo S. [INAF—Osservatorio Astrofisico di Torino, via Osservatorio 20, I-10025 Pino Torinese (Italy); Bouchy, Francois [Observatoire Astronomique de l’Université de Genève, 51 ch. des Maillettes, 1290 Versoix (Switzerland); Buchhave, Lars A. [Centre for Star and Planet Formation, Natural History Museum of Denmark and Niels Bohr Institute, University of Copenhagen, Øster Voldgade 5-7, DK-1350 Copenhagen K (Denmark); Cosentino, Rosario, E-mail: luca.malavolta@unipd.it [INAF—Fundación Galileo Galilei, Rambla José Ana Fernandez Pérez 7, E-38712 Breña Baja (Spain); and others

    2017-05-01

    We report a detailed characterization of the Kepler-19 system. This star was previously known to host a transiting planet with a period of 9.29 days, a radius of 2.2 R {sub ⊕}, and an upper limit on the mass of 20 M {sub ⊕}. The presence of a second, non-transiting planet was inferred from the transit time variations (TTVs) of Kepler-19b over eight quarters of Kepler photometry, although neither the mass nor period could be determined. By combining new TTVs measurements from all the Kepler quarters and 91 high-precision radial velocities obtained with the HARPS-N spectrograph, using dynamical simulations we obtained a mass of 8.4 ± 1.6 M {sub ⊕} for Kepler-19b. From the same data, assuming system coplanarity, we determined an orbital period of 28.7 days and a mass of 13.1 ± 2.7 M {sub ⊕} for Kepler-19c and discovered a Neptune-like planet with a mass of 20.3 ± 3.4 M {sub ⊕} on a 63-day orbit. By comparing dynamical simulations with non-interacting Keplerian orbits, we concluded that neglecting interactions between planets may lead to systematic errors that can hamper the precision in the orbital parameters when the data set spans several years. With a density of 4.32 ± 0.87 g cm{sup −3} (0.78 ± 0.16 ρ {sub ⊕}) Kepler-19b belongs to the group of planets with a rocky core and a significant fraction of volatiles, in opposition to low-density planets characterized only by transit time variations and an increasing number of rocky planets with Earth-like density. Kepler-19 joins the small number of systems that reconcile transit timing variation and radial velocity measurements.

  18. Genomic variation landscape of the human gut microbiome

    DEFF Research Database (Denmark)

    Schloissnig, Siegfried; Arumugam, Manimozhiyan; Sunagawa, Shinichi

    2013-01-01

    Whereas large-scale efforts have rapidly advanced the understanding and practical impact of human genomic variation, the practical impact of variation is largely unexplored in the human microbiome. We therefore developed a framework for metagenomic variation analysis and applied it to 252 faecal...... polymorphism rates of 0.11 was more variable between gut microbial species than across human hosts. Subjects sampled at varying time intervals exhibited individuality and temporal stability of SNP variation patterns, despite considerable composition changes of their gut microbiota. This indicates...

  19. Time evolution of coupled-bunch modes from beta function variation in storage rings

    Directory of Open Access Journals (Sweden)

    Kai Meng Hock

    2007-08-01

    Full Text Available We present an analytical and numerical study of the equations of motion for bunches coupled by transverse wakefields. We base our study on a recent lattice design for the damping rings in the baseline configuration of the International Linear Collider. Using the macroparticle model, and assuming resistive wall wakefield coupling, we present numerical results on the time evolution of the multibunch modes. Decay modes display growth after initial decay, and mode amplitudes exhibit high-frequency oscillations. These phenomena are not expected if the beta function is assumed to have a constant, averaged value. We show analytically that they can come from coupling between modes caused by variation of the beta function in a real lattice. The effect is shown to be comparable to the effect of a nonuniform fill pattern and significantly larger than that of the higher-order mode wakefield localized in the rf cavities. Turning to the case of constant beta function, we develop a more complete treatment of the equations of motion. We derive general formulas for the bunch trajectories, and show that such formulas can only be valid in the limit of small wakefield coupling.

  20. Estimation of water transit time in soils under Amazon forest cover using variations in delta18O values

    International Nuclear Information System (INIS)

    Leopoldo, P.R.; Matsui, E.; Salati, E.

    1984-01-01

    The work was carried out at the forest reserve of the Instituto Nacional de Pesquisas da Amazonia, located at km 45 of Manaus, in an area characterized by Amazon vegetation of the 'terra-firme' type. To extract the soil water, four soil-water collecting stations were installed, and in each the porous cups were placed at 15, 25, 50, 80 and 120 cm depth from the soil surface. The rain-water and soil-water samples were collected only weekly for analysis of the 18 O content. In an attempt to estimate the soil-water transit time using the variation in 18 O values, a statistical model was used. This model is based on linear regression analysis applied to the values observed for soil water and rain water. From this analysis, regression coefficients are obtained which vary according to time. The values of the coefficients obtained can be adjusted generally, according to a quadratic regression, with the maximum value of the function representing the time in which the best statistical correlation between the observed delta 18 O values occurs. The time obtained from these correlations represents the mean time necessary for the water to run from one collecting point to the next. (author)

  1. Differences in genetic and environmental variation in adult BMI by sex, age, time period, and region

    DEFF Research Database (Denmark)

    Silventoinen, Karri; Jelenkovic, Aline; Sund, Reijo

    2017-01-01

    Background: Genes and the environment contribute to variation in adult body mass index [BMI (in kg/m(2))], but factors modifying these variance components are poorly understood.Objective: We analyzed genetic and environmental variation in BMI between men and women from young adulthood to old age...

  2. Differences in genetic and environmental variation in adult BMI by sex, age, time period, and region

    DEFF Research Database (Denmark)

    Silventoinen, Karri; Jelenkovic, Aline; Sund, Reijo

    2017-01-01

    Background: Genes and the environment contribute to variation in adult body mass index [BMI (in kg/m(2))], but factors modifying these variance components are poorly understood. Objective: We analyzed genetic and environmental variation in BMI between men and women from young adulthood to old age...

  3. Seasonal variations of the high-latitude F region for

    International Nuclear Information System (INIS)

    Sojka, J.J.; Schunk, R.W.; Raitt, W.J.

    1982-01-01

    We combined a plasma convection model with an inosphere-atmospheric composition model in order to study the seasonal variations of the high-latitude F region for strong convection. Our numerical study produced time-dependent, three-dimensional, ion density distributions for the ions NO + , O 2 + , N 2 + , O + , N + , and He + . We covered the high-latitude ionosphere above 42 0 N magnetic latitude and at altitudes between 160 and 800 km for a time period of one complete day. From our study we found the following: (1) For strong convection, the high-altitude ionosphere exhibits a significant UT variation both during winter and summer. (2) In general, the electron density is lower in winter than in summer. However, at certain universal times the electron density in the dayside polar cap is larger in winter than in summer owing to the effect of the mid-latitude 'winter anomaly' in combination with strong antisunward convection. (3) In both summer and winter, the major region of low electron density is associated with the main or mid-latitudde trough. The trough is deeper and its local time extend is much greater in winter than in summer. (4) Typically, the electron density exhibits a much larger variation with altitude in winter than in summer. (5) The ion composition and molecular/atomic ion transition altitude are highly UT dependent in both summer and winter. (6) The ion composition also displays a significant seasonal variation. However, at a given location the seasonal variation can be opposite at different universal times. (7) High-speed convection cells should display a marked seasonal variation, with a much larger concentration of molecular ions near the F region peak in summer than in winter

  4. Spatial and temporal variations of thaw layer thickness and its controlling factors identified using time-lapse electrical resistivity tomography and hydro-thermal modeling

    Science.gov (United States)

    Tran, Anh Phuong; Dafflon, Baptiste; Bisht, Gautam; Hubbard, Susan S.

    2018-06-01

    Quantitative understanding of controls on thaw layer thickness (TLT) dynamics in the Arctic peninsula is essential for predictive understanding of permafrost degradation feedbacks to global warming and hydrobiochemical processes. This study jointly interprets electrical resistivity tomography (ERT) measurements and hydro-thermal numerical simulation results to assess spatiotemporal variations of TLT and to determine its controlling factors in Barrow, Alaska. Time-lapse ERT measurements along a 35-m transect were autonomously collected from 2013 to 2015 and inverted to obtain soil electrical resistivity. Based on several probe-based TLT measurements and co-located soil electrical resistivity, we estimated the electrical resistivity thresholds associated with the boundary between the thaw layer and permafrost using a grid search optimization algorithm. Then, we used the obtained thresholds to derive the TLT from all soil electrical resistivity images. The spatiotemporal analysis of the ERT-derived TLT shows that the TLT at high-centered polygons (HCPs) is smaller than that at low-centered polygons (LCPs), and that both thawing and freezing occur earlier at the HCPs compared to the LCPs. In order to provide a physical explanation for dynamics in the thaw layer, we performed 1-D hydro-thermal simulations using the community land model (CLM). Simulation results showed that air temperature and precipitation jointly govern the temporal variations of TLT, while the topsoil organic content (SOC) and polygon morphology are responsible for its spatial variations. When the topsoil SOC and its thickness increase, TLT decreases. Meanwhile, at LCPs, a thicker snow layer and saturated soil contribute to a thicker TLT and extend the time needed for TLT to freeze and thaw. This research highlights the importance of combination of measurements and numerical modeling to improve our understanding spatiotemporal variations and key controls of TLT in cold regions.

  5. A Finite-Time Thermal Cycle Variational Optimization with a Stefan–Boltzmann Law for Three Different Criteria

    Directory of Open Access Journals (Sweden)

    Juan C. Chimal-Eguía

    2012-12-01

    Full Text Available This work shows the power of the variational approach for studying the efficiency of thermal engines in the context of the Finite Time Thermodynamics (FTT. Using an endoreversible Curzon–Ahlborn (CA heat engine as a model for actual thermal engines, three different criteria for thermal efficiency were analyzed: maximum power output, ecological function, and maximum power density. By means of this procedure, the performance of the CA heat engine with a nonlinear heat transfer law (the Stefan–Boltzmann law was studied to describe the heat exchanges between the working substance and its thermal reservoirs. The specific case of the Müser engine for all the criteria was analyzed. The results confirmed some previous findings using other procedures and additionally new results for the Müser engine performance were obtained.

  6. Quasi-static responses and variational principles in gradient plasticity

    Science.gov (United States)

    Nguyen, Quoc-Son

    2016-12-01

    Gradient models have been much discussed in the literature for the study of time-dependent or time-independent processes such as visco-plasticity, plasticity and damage. This paper is devoted to the theory of Standard Gradient Plasticity at small strain. A general and consistent mathematical description available for common time-independent behaviours is presented. Our attention is focussed on the derivation of general results such as the description of the governing equations for the global response and the derivation of related variational principles in terms of the energy and the dissipation potentials. It is shown that the quasi-static response under a loading path is a solution of an evolution variational inequality as in classical plasticity. The rate problem and the rate minimum principle are revisited. A time-discretization by the implicit scheme of the evolution equation leads to the increment problem. An increment of the response associated with a load increment is a solution of a variational inequality and satisfies also a minimum principle if the energy potential is convex. The increment minimum principle deals with stables solutions of the variational inequality. Some numerical methods are discussed in view of the numerical simulation of the quasi-static response.

  7. The Prediction of Length-of-day Variations Based on Gaussian Processes

    Science.gov (United States)

    Lei, Y.; Zhao, D. N.; Gao, Y. P.; Cai, H. B.

    2015-01-01

    Due to the complicated time-varying characteristics of the length-of-day (LOD) variations, the accuracies of traditional strategies for the prediction of the LOD variations such as the least squares extrapolation model, the time-series analysis model, and so on, have not met the requirements for real-time and high-precision applications. In this paper, a new machine learning algorithm --- the Gaussian process (GP) model is employed to forecast the LOD variations. Its prediction precisions are analyzed and compared with those of the back propagation neural networks (BPNN), general regression neural networks (GRNN) models, and the Earth Orientation Parameters Prediction Comparison Campaign (EOP PCC). The results demonstrate that the application of the GP model to the prediction of the LOD variations is efficient and feasible.

  8. Fermion systems in discrete space-time

    International Nuclear Information System (INIS)

    Finster, Felix

    2007-01-01

    Fermion systems in discrete space-time are introduced as a model for physics on the Planck scale. We set up a variational principle which describes a non-local interaction of all fermions. This variational principle is symmetric under permutations of the discrete space-time points. We explain how for minimizers of the variational principle, the fermions spontaneously break this permutation symmetry and induce on space-time a discrete causal structure

  9. Fermion systems in discrete space-time

    Energy Technology Data Exchange (ETDEWEB)

    Finster, Felix [NWF I - Mathematik, Universitaet Regensburg, 93040 Regensburg (Germany)

    2007-05-15

    Fermion systems in discrete space-time are introduced as a model for physics on the Planck scale. We set up a variational principle which describes a non-local interaction of all fermions. This variational principle is symmetric under permutations of the discrete space-time points. We explain how for minimizers of the variational principle, the fermions spontaneously break this permutation symmetry and induce on space-time a discrete causal structure.

  10. Fermion Systems in Discrete Space-Time

    OpenAIRE

    Finster, Felix

    2006-01-01

    Fermion systems in discrete space-time are introduced as a model for physics on the Planck scale. We set up a variational principle which describes a non-local interaction of all fermions. This variational principle is symmetric under permutations of the discrete space-time points. We explain how for minimizers of the variational principle, the fermions spontaneously break this permutation symmetry and induce on space-time a discrete causal structure.

  11. Fermion systems in discrete space-time

    Science.gov (United States)

    Finster, Felix

    2007-05-01

    Fermion systems in discrete space-time are introduced as a model for physics on the Planck scale. We set up a variational principle which describes a non-local interaction of all fermions. This variational principle is symmetric under permutations of the discrete space-time points. We explain how for minimizers of the variational principle, the fermions spontaneously break this permutation symmetry and induce on space-time a discrete causal structure.

  12. Fast Variations In Spectrum of Comet Halley

    Science.gov (United States)

    Borysenko, S. A.

    The goal of this work is to research fast variations of spectral lines intensities in spectra of comet Halley. The present research was made on the basis of more then 500 high- resolution spectrogram obtained by L.M. Shulman and H.K. Nazarchuk in November- December, 1985 at the 6-m telescope (SAO, Russia). Some fast variations with different quasiperiods were detected in all the spectrograms. Quasiperiods of these variations were from 15 - 40 min to 1.5 - 2 hours. As data from spacecraft "Vega-2" show, more fast variations with quasiperiods 5 - 10 min are obviously present in cometary time variations. Only the most important lines so as C2, C3, CN, CH and NH2 were analyzed. False periods were checked by comparison of the power spectra of the variations with the computed spectral window of the data. Only false periods about 400 sec (the avarage period of exposition) were detected. An algorithm for analysis of locally Poisson's time series was proposed. Two types of fast variations are detected: 1)high amplitude variations with more long quasiperiods (1.5 - 2 hours) and the coefficient of crosscorrelations between line intensities about 0.9 - 0.95; 2)low amplitude variations with short periods (15 - 40 min), which look like white noise and have the coefficient of crosscorrelations about 0.1 - 0.3. This difference may be caused by nature of variations. The first type variations may be an effect of both active processes in cometary nucleus and streams of solar protons. Analysis of solar proton flux variation with energies >1 MeV in November - Decem- ber 1985 confirms the above-mentioned version. In the second case it may by only inner processes in the nucleus that generate the observed variations. For determination of general parameters of cometary atmosphere, such as the produc- tion rates of radicals C2, C3, CN, CH, and NH2 it was necessary to estimate the contri- bution of dust grains luminiscence into the continuum of the comet. Space and wave- length distribution

  13. A statistical model for measurement error that incorporates variation over time in the target measure, with application to nutritional epidemiology.

    Science.gov (United States)

    Freedman, Laurence S; Midthune, Douglas; Dodd, Kevin W; Carroll, Raymond J; Kipnis, Victor

    2015-11-30

    Most statistical methods that adjust analyses for measurement error assume that the target exposure T is a fixed quantity for each individual. However, in many applications, the value of T for an individual varies with time. We develop a model that accounts for such variation, describing the model within the framework of a meta-analysis of validation studies of dietary self-report instruments, where the reference instruments are biomarkers. We demonstrate that in this application, the estimates of the attenuation factor and correlation with true intake, key parameters quantifying the accuracy of the self-report instrument, are sometimes substantially modified under the time-varying exposure model compared with estimates obtained under a traditional fixed-exposure model. We conclude that accounting for the time element in measurement error problems is potentially important. Copyright © 2015 John Wiley & Sons, Ltd.

  14. Variation and Linguistic Theory.

    Science.gov (United States)

    Bailey, Charles-James N.

    This volume presents principles and models for describing language variation, and introduces a time-based, dynamic framework for linguistic description. The book first summarizes some of the problems of grammatical description encountered from Saussure through the present and then outlines possibilities for new descriptions of language which take…

  15. Decomposing Firm-level Sales Variation

    DEFF Research Database (Denmark)

    Munch, Jakob Roland; Nguyen, Daniel Xuyen

    , and that for the median product it drives 31% of the sales variation. When we remove first-time exports from our sample, the median value increases to 40%, implying that firm-destination-specific effects are most important the first year. We conclude that while firm-specific productivity can account for some......We measure the contribution of firm-specific effects to overall sales variation within a destination and find it remarkably low. Our empirical decomposition is structurally motivated by a heterogeneity model of exporting involving destination-specific, firm-specific, and firm......-destination-specific latent effects with incidental truncation. We use a highly detailed dataset with exports by products and destinations for all Danish manufacturing fi…rms. We fi…nd the contribution of firm-specific heterogeneity to within-destination sales variation varies greatly across HS6 products...

  16. The variation of particle gas-borne concentration with time in a gas cooled reactor

    International Nuclear Information System (INIS)

    Reed, J.; Hall, D.; Reeks, M.W.

    1985-01-01

    If volatile fission products are released from fuel during a reactor fault, a significant fraction could become attached to small particles also present in the coolant. In such circumstances the retention of those particles by the reactor circuit will limit the level of gas-borne particle concentration and hence be important in reducing the potential release of fission product activity to the atmosphere. Clearly the retention of particles will be influenced by both the deposition and resuspension of particles from surfaces exposed to the coolant flow. In this paper we consider deposition and resuspension but pay particular attention to the role of resuspension, which in the past has been given little consideration. A recently developed model for the resuspension of small particles by a turbulent flow is outlined. Traditionally, resuspension has been interpreted as a force balance between the aerodynamic removal forces and the surface adhesive forces. In contrast, this new approach embodies an energy balance criterion for particle resuspension. Furthermore, the stochastic nature of this new model has shown that resuspension can be sub-divided into two regimes: (i) initial resuspension (resuspension occurring in times less than a second) which reduces the net deposition of particles to a surface; and (ii) longer term resuspension (resuspension after 1 second) which determines the asymptotic decay of particle gas-borne concentration. It is seen that the asymptotic decay varies almost inversely as the decay time. Force balance models are unsuccessful in accounting for the experimentally observed longer term resuspension. We show that a Volterra integro-differential equation best describes the variation of particle gas-borne concentration with time in a recirculating gas flow such as a gas cooled reactor. It is seen that the longer term resuspension has a major influence in the final decay of particle concentration. (author)

  17. The variation of particle gas-borne concentration with time in a gas cooled reactor

    Energy Technology Data Exchange (ETDEWEB)

    Reed, J; Hall, D; Reeks, M W [Central Electricity Generating Board, Berkeley Nuclear Laboratories (United Kingdom)

    1985-07-01

    If volatile fission products are released from fuel during a reactor fault, a significant fraction could become attached to small particles also present in the coolant. In such circumstances the retention of those particles by the reactor circuit will limit the level of gas-borne particle concentration and hence be important in reducing the potential release of fission product activity to the atmosphere. Clearly the retention of particles will be influenced by both the deposition and resuspension of particles from surfaces exposed to the coolant flow. In this paper we consider deposition and resuspension but pay particular attention to the role of resuspension, which in the past has been given little consideration. A recently developed model for the resuspension of small particles by a turbulent flow is outlined. Traditionally, resuspension has been interpreted as a force balance between the aerodynamic removal forces and the surface adhesive forces. In contrast, this new approach embodies an energy balance criterion for particle resuspension. Furthermore, the stochastic nature of this new model has shown that resuspension can be sub-divided into two regimes: (i) initial resuspension (resuspension occurring in times less than a second) which reduces the net deposition of particles to a surface; and (ii) longer term resuspension (resuspension after 1 second) which determines the asymptotic decay of particle gas-borne concentration. It is seen that the asymptotic decay varies almost inversely as the decay time. Force balance models are unsuccessful in accounting for the experimentally observed longer term resuspension. We show that a Volterra integro-differential equation best describes the variation of particle gas-borne concentration with time in a recirculating gas flow such as a gas cooled reactor. It is seen that the longer term resuspension has a major influence in the final decay of particle concentration. (author)

  18. Colour variations in the GRB 120327A afterglow

    Science.gov (United States)

    Melandri, A.; Covino, S.; Zaninoni, E.; Campana, S.; Bolmer, J.; Cobb, B. E.; Gorosabel, J.; Kim, J.-W.; Kuin, P.; Kuroda, D.; Malesani, D.; Mundell, C. G.; Nappo, F.; Sbarufatti, B.; Smith, R. J.; Steele, I. A.; Topinka, M.; Trotter, A. S.; Virgili, F. J.; Bernardini, M. G.; D'Avanzo, P.; D'Elia, V.; Fugazza, D.; Ghirlanda, G.; Gomboc, A.; Greiner, J.; Guidorzi, C.; Haislip, J. B.; Hanayama, H.; Hanlon, L.; Im, M.; Ivarsen, K. M.; Japelj, J.; Jelínek, M.; Kawai, N.; Kobayashi, S.; Kopac, D.; LaCluyzé, A. P.; Martin-Carrillo, A.; Murphy, D.; Reichart, D. E.; Salvaterra, R.; Salafia, O. S.; Tagliaferri, G.; Vergani, S. D.

    2017-10-01

    Aims: We present a comprehensive temporal and spectral analysis of the long Swift GRB 120327A afterglow data to investigate possible causes of the observed early-time colour variations. Methods: We collected data from various instruments and telescopes in X-ray, ultraviolet, optical, and near-infrared bands, and determined the shapes of the afterglow early-time light curves. We studied the overall temporal behaviour and the spectral energy distributions from early to late times. Results: The ultraviolet, optical, and near-infrared light curves can be modelled with a single power-law component between 200 and 2 × 104 s after the burst event. The X-ray light curve shows a canonical steep-shallow-steep behaviour that is typical of long gamma-ray bursts. At early times a colour variation is observed in the ultraviolet/optical bands, while at very late times a hint of a re-brightening is visible. The observed early-time colour change can be explained as a variation in the intrinsic optical spectral index, rather than an evolution of the optical extinction. Table 2 is only available at the CDS via anonymous ftp to http://cdsarc.u-strasbg.fr (http://130.79.128.5) or via http://cdsarc.u-strasbg.fr/viz-bin/qcat?J/A+A/607/A29

  19. Method of determining the variation of concentration of the potential alpha energy of radon daughters with time without changing the filter

    International Nuclear Information System (INIS)

    Feddersen, C.

    1979-01-01

    Considering the drawbacks of sample measurement of radon daughter concentration or potential alpha energy concentration, a method is described allowing to determine the variation with time of the measuring quantities mentioned. For this purpose, the same filter is exposed in defined time intervals and the decay curve is evaluated using Markov's method. Residual activity of preceding measurements is estimated as a function of the density of measuring points. A practicable technique is given for taking into account residual activity together with the background. An apparatus consisting of commercial devices and special accessories of own manufacture is described. The results obtained with this apparatus are illustrated and discussed using two examples. (author)

  20. Variation tolerant SoC design

    Science.gov (United States)

    Kozhikkottu, Vivek J.

    performance distribution. This task is particularly complex and challenging due to the inter-dependencies between components' execution, indirect effects of shared resources, and interactions between multiple system-level "execution paths". We argue that accurate variation-aware performance analysis requires Monte-Carlo based repeated system execution. Our proposed analysis framework leverages emulation to significantly speedup performance analysis without sacrificing the generality and accuracy achieved by Monte-Carlo based simulations. Our experiments show performance improvements of around 60x compared to state-of-the-art hardware-software co-simulation tools and also underscore the framework's potential to enable variation-aware design and exploration at the system level. Our second contribution addresses the problem of designing variation-tolerant SoCs using recovery based design, a popular circuit design paradigm that addresses variations by eliminating guard-bands and operating circuits at close to "zero margins" while detecting and recovering from timing errors. While previous efforts have demonstrated the potential benefits of recovery based design, we identify several challenges that need to be addressed in order to apply this technique to SoCs. We present a systematic design framework to apply recovery based design at the system level. We propose to partition SoCs into "recovery islands", wherein each recovery island consists of one or more SoC components that can recover independent of the rest of the SoC. We present a variation-aware design methodology that partitions a given SoC into recovery islands and computes the optimal operating points for each island, taking into account the various trade-offs involved. Our experiments demonstrate that the proposed design framework achieves an average of 32% energy savings over conventional worst-case designs, with negligible losses in performance. The third contribution of this thesis introduces disproportionate

  1. Time variations of oxygen emission lines and solar wind dynamic parameters in low latitude region

    Science.gov (United States)

    Jamlongkul, P.; Wannawichian, S.; Mkrtichian, D.; Sawangwit, U.; A-thano, N.

    2017-09-01

    Aurora phenomenon is an effect of collision between precipitating particles with gyromotion along Earth’s magnetic field and Earth’s ionospheric atoms or molecules. The particles’ precipitation occurs normally around polar regions. However, some auroral particles can reach lower latitude regions when they are highly energetic. A clear emission from Earth’s aurora is mostly from atomic oxygen. Moreover, the sun’s activities can influence the occurrence of the aurora as well. This work studies time variations of oxygen emission lines and solar wind parameters, simultaneously. The emission’s spectral lines were observed by Medium Resolution Echelle Spectrograph (MRES) along with 2.4 meters diameter telescope at Thai National Observatory, Intanon Mountain, Chiang Mai, Thailand. Oxygen (OI) emission lines were calibrated by Dech-Fits spectra processing program and Dech95 2D image processing program. The correlations between oxygen emission lines and solar wind dynamics will be analyzed. This result could be an evidence of the aurora in low latitude region.

  2. Real-time simulation of response to load variation for a ship reactor based on point-reactor double regions and lumped parameter model

    Energy Technology Data Exchange (ETDEWEB)

    Wang Qiao; Zhang De [Department of Nuclear Energy Science and Engineering, Naval University of Engineering, Wuhan 430033 (China); Chen Wenzhen, E-mail: Cwz2@21cn.com [Department of Nuclear Energy Science and Engineering, Naval University of Engineering, Wuhan 430033 (China); Chen Zhiyun [Department of Nuclear Energy Science and Engineering, Naval University of Engineering, Wuhan 430033 (China)

    2011-05-15

    Research highlights: > We calculate the variation of main parameters of the reactor core by the Simulink. > The Simulink calculation software (SCS) can deal well with the stiff problem. > The high calculation precision is reached with less time, and the results can be easily displayed. > The quick calculation of ship reactor transient can be achieved by this method. - Abstract: Based on the point-reactor double regions and lumped parameter model, while the nuclear power plant second loop load is increased or decreased quickly, the Simulink calculation software (SCS) is adopted to calculate the variation of main physical and thermal-hydraulic parameters of the reactor core. The calculation results are compared with those of three-dimensional simulation program. It is indicated that the SCS can deal well with the stiff problem of the point-reactor kinetics equations and the coupled problem of neutronics and thermal-hydraulics. The high calculation precision can be reached with less time, and the quick calculation of parameters of response to load disturbance for the ship reactor can be achieved. The clear image of the calculation results can also be displayed quickly by the SCS, which is very significant and important to guarantee the reactor safety operation.

  3. Worldwide variation in atmospheric noise intensities with sunspot number: an in-depth look at the 20 to 24 hour seasonal time block

    International Nuclear Information System (INIS)

    Joglekar, P.J.; Sathiamurthy, T.S.

    1975-01-01

    Comparisons of the variation of atmospheric radio noise intensities for 20 to 24 hr to sunspot numbers have been completed. Statistical dependence between the noise intensities and sunspot numbers was found for different seasons at a number of frequencies for many locations in the global network of ARN-2 noise recorders. The noise intensities generally tended to decrease with sunspot number in the range from 50 kHz to 5 MHz, which is presumed to be due to increases in residual ionospheric absorption during nighttime. At frequencies greater than 5 MHz, noise intensities increased with sunspot number in many cases, which would be expected from our present knowledge of ionospheric behavior in the HF range. By convention, CCIR treats year-to-year variation in the noise intensities as random and includes them in the prediction uncertainty sigma /sub Fam/ (for which one value is given at a frequency for a seasonal time block for all locations) in system performance evaluation. An error analysis on a global basis shows that a large portion of the year-to-year variability is due to sunspot variation. This suggests the possibility of improved noise estimates. (auth)

  4. Variational data assimilation for the optimized ozone initial state and the short-time forecasting

    Directory of Open Access Journals (Sweden)

    S.-Y. Park

    2016-03-01

    Full Text Available In this study, we apply the four-dimensional variational (4D-Var data assimilation to optimize initial ozone state and to improve the predictability of air quality. The numerical modeling systems used for simulations of atmospheric condition and chemical formation are the Weather Research and Forecasting (WRF model and the Community Multiscale Air Quality (CMAQ model. The study area covers the capital region of South Korea, where the surface measurement sites are relatively evenly distributed. The 4D-Var code previously developed for the CMAQ model is modified to consider background error in matrix form, and various numerical tests are conducted. The results are evaluated with an idealized covariance function for the appropriateness of the modified codes. The background error is then constructed using the NMC method with long-term modeling results, and the characteristics of the spatial correlation scale related to local circulation are analyzed. The background error is applied in the 4D-Var research, and a surface observational assimilation is conducted to optimize the initial concentration of ozone. The statistical results for the 12 h assimilation periods and the 120 observatory sites show a 49.4 % decrease in the root mean squared error (RMSE, and a 59.9 % increase in the index of agreement (IOA. The temporal variation of spatial distribution of the analysis increments indicates that the optimized initial state of ozone concentration is transported to inland areas by the clockwise-rotating local circulation during the assimilation windows. To investigate the predictability of ozone concentration after the assimilation window, a short-time forecasting is carried out. The ratios of the RMSE (root mean squared error with assimilation versus that without assimilation are 8 and 13 % for the +24 and +12 h, respectively. Such a significant improvement in the forecast accuracy is obtained solely by using the optimized initial state. The potential

  5. Two levels ARIMAX and regression models for forecasting time series data with calendar variation effects

    Science.gov (United States)

    Suhartono, Lee, Muhammad Hisyam; Prastyo, Dedy Dwi

    2015-12-01

    The aim of this research is to develop a calendar variation model for forecasting retail sales data with the Eid ul-Fitr effect. The proposed model is based on two methods, namely two levels ARIMAX and regression methods. Two levels ARIMAX and regression models are built by using ARIMAX for the first level and regression for the second level. Monthly men's jeans and women's trousers sales in a retail company for the period January 2002 to September 2009 are used as case study. In general, two levels of calendar variation model yields two models, namely the first model to reconstruct the sales pattern that already occurred, and the second model to forecast the effect of increasing sales due to Eid ul-Fitr that affected sales at the same and the previous months. The results show that the proposed two level calendar variation model based on ARIMAX and regression methods yields better forecast compared to the seasonal ARIMA model and Neural Networks.

  6. Allelic Variations at Four Major Maturity E Genes and Transcriptional Abundance of the E1 Gene Are Associated with Flowering Time and Maturity of Soybean Cultivars

    Science.gov (United States)

    Wang, Yueqiang; Chen, Xin; Ren, Haixiang; Yang, Jiayin; Cheng, Wen; Zong, Chunmei; Gu, Heping; Qiu, Hongmei; Wu, Hongyan; Zhang, Xingzheng; Cui, Tingting; Xia, Zhengjun

    2014-01-01

    The time to flowering and maturity are ecologically and agronomically important traits for soybean landrace and cultivar adaptation. As a typical short-day crop, long day conditions in the high-latitude regions require soybean cultivars with photoperiod insensitivity that can mature before frost. Although the molecular basis of four major E loci (E1 to E4) have been deciphered, it is not quite clear whether, or to what degree, genetic variation and the expression level of the four E genes are associated with the time to flowering and maturity of soybean cultivars. In this study, we genotyped 180 cultivars at E1 to E4 genes, meanwhile, the time to flowering and maturity of those cultivars were investigated at six geographic locations in China from 2011 to 2012 and further confirmed in 2013. The percentages of recessive alleles at E1, E2, E3 and E4 loci were 38.34%, 84.45%, 36.33%, and 7.20%, respectively. Statistical analysis showed that allelic variations at each of four loci had a significant effect on flowering time as well as maturity. We classified the 180 cultivars into eight genotypic groups based on allelic variations of the four major E loci. The genetic group of e1-nf representing dysfunctional alleles at the E1 locus flowered earliest in all the geographic locations. In contrast, cultivars in the E1E2E3E4 group originated from the southern areas flowered very late or did not flower before frost at high latitude locations. The transcriptional abundance of functional E1 gene was significantly associated with flowering time. However, the ranges of time to flowering and maturity were quite large within some genotypic groups, implying the presence of some other unknown genetic factors that are involved in control of flowering time or maturity. Known genes (e.g. E3 and E4) and other unknown factors may function, at least partially, through regulation of the expression of the E1 gene. PMID:24830458

  7. Asynchronous variational integration using continuous assumed gradient elements.

    Science.gov (United States)

    Wolff, Sebastian; Bucher, Christian

    2013-03-01

    Asynchronous variational integration (AVI) is a tool which improves the numerical efficiency of explicit time stepping schemes when applied to finite element meshes with local spatial refinement. This is achieved by associating an individual time step length to each spatial domain. Furthermore, long-term stability is ensured by its variational structure. This article presents AVI in the context of finite elements based on a weakened weak form (W2) Liu (2009) [1], exemplified by continuous assumed gradient elements Wolff and Bucher (2011) [2]. The article presents the main ideas of the modified AVI, gives implementation notes and a recipe for estimating the critical time step.

  8. Investigation into the Mpemba Effect: Variation in the Freezing Time of Water Dependent on Initial Temperature and Purity

    Science.gov (United States)

    Thvedt, Ingrid; Roseberry, Martha; Lehman, Susan

    2009-03-01

    The observation that hot water sometimes appears to freeze more quickly than cold water, known as the Mpemba effect, has generated vigorous debate. Prior research [1] into the Mpemba effect has resulted in conflicting results, due to a variety of observation techniques, multiple definitions of freezing, and different water treatments. To clarify the previous results, we have tested multiple types of water and improved the sample monitoring. During cooling and freezing, each 50 g water sample is continually monitored by three thermistors at different depths. Samples of tap, distilled, and nanopure water were heated, heated and cooled, or boiled before being frozen. We monitor the time to reach freezing, the duration of freezing, and the total time to reach -7^oC. We observe the Mpemba effect most consistently in the length of the freezing transition in tap water. Observations of temperature variation during freezing will also be presented. [1] See the review by M. Jeng, Am.J.Phys. 74 514 (2006).

  9. Temporal variation of optimal UV exposure time over Korea: risks and benefits of surface UV radiation

    Science.gov (United States)

    Lee, Y. G.; Koo, J. H.

    2015-12-01

    Solar UV radiation in a wavelength range between 280 to 400 nm has both positive and negative influences on human body. Surface UV radiation is the main natural source of vitamin D, providing the promotion of bone and musculoskeletal health and reducing the risk of a number of cancers and other medical conditions. However, overexposure to surface UV radiation is significantly related with the majority of skin cancer, in addition other negative health effects such as sunburn, skin aging, and some forms of eye cataracts. Therefore, it is important to estimate the optimal UV exposure time, representing a balance between reducing negative health effects and maximizing sufficient vitamin D production. Previous studies calculated erythemal UV and vitamin-D UV from the measured and modelled spectral irradiances, respectively, by weighting CIE Erythema and Vitamin D3 generation functions (Kazantzidis et al., 2009; Fioletov et al., 2010). In particular, McKenzie et al. (2009) suggested the algorithm to estimate vitamin-D production UV from erythemal UV (or UV index) and determined the optimum conditions of UV exposure based on skin type Ⅱ according to the Fitzpatrick (1988). Recently, there are various demands for risks and benefits of surface UV radiation on public health over Korea, thus it is necessary to estimate optimal UV exposure time suitable to skin type of East Asians. This study examined the relationship between erythemally weighted UV (UVEry) and vitamin D weighted UV (UVVitD) over Korea during 2004-2012. The temporal variations of the ratio (UVVitD/UVEry) were also analyzed and the ratio as a function of UV index was applied in estimating the optimal UV exposure time. In summer with high surface UV radiation, short exposure time leaded to sufficient vitamin D and erythema and vice versa in winter. Thus, the balancing time in winter was enough to maximize UV benefits and minimize UV risks.

  10. Timing is everything: international variations in historical sexual partnership concurrency and HIV prevalence.

    Directory of Open Access Journals (Sweden)

    Martina Morris

    Full Text Available BACKGROUND: Higher prevalence of concurrent partnerships is one hypothesis for the severity of the HIV epidemic in the countries of Southern Africa. But measures of the prevalence of concurrency alone do not adequately capture the impact concurrency will have on transmission dynamics. The importance of overlap duration and coital exposure are examined here. METHODOLOGY/PRINCIPAL FINDINGS: We conducted a comparison of data from three studies of sexual behavior carried out in the early 1990s in Uganda, Thailand and the US. Using cumulative concurrency measures, the three countries appeared somewhat similar. Over 50% of both Thai and Ugandan men reported a concurrency within the last three partnerships and over 20% reported a concurrency in the last year, the corresponding rates among US men were nearly 20% for Blacks and Hispanics, and about 10% for other racial/ethnic groups. Concurrency measures that were more sensitive to overlap duration, however, showed large differences. The point prevalence of concurrency on the day of interview was over 10% among Ugandan men compared to 1% for Thai men. Ugandan concurrencies were much longer duration - a median of about two years - than either the Thai (1 day or US concurrencies (4-9 months across all groups, and involved 5-10 times more coital risk exposure with the less frequent partner. In the US, Blacks and Hispanics reported higher prevalence, longer duration and greater coital exposure than Whites, but were lower than Ugandans on nearly every measure. Together, the differences in the prevalence, duration and coital exposure of concurrent partnerships observed align with the HIV prevalence differentials seen in these populations at the time the data were collected. CONCLUSIONS/SIGNIFICANCE: There were substantial variations in the patterns of concurrent partnerships within and between populations. More long-term overlapping partnerships, with regular coital exposure, were found in populations with

  11. The sun in time

    International Nuclear Information System (INIS)

    Sonett, C.P.; Giampapa, M.S.; Matthews, M.S.

    1991-01-01

    Various papers on solar science are presented. The topics considered include: variability of solar irradiance, sunspot number, solar diameter, and solar wind properties; theory of luminosity and radius variations; standard solar models; the sun and the IMF; variations of cosmic-ray flux with time; accelerated particles in solar flares; solar cosmic ray fluxes during the last 10 million yrs; solar neutrinos and solar history; time variations of Be-10 and solar activity; solar and terrestrial components of the atmospheric C-14 variation spectrum; solar flare heavy-ion tracks in extraterrestrial objects. Also addressed are: the faint young sun problem; atmospheric responses to solar irradiation; quaternary glaciations; solar-terrestrial relationships in recent sea sediments; magnetic history of the sun; pre- and main-sequence evolution of solar activity; magnetic activity in pre-main-sequence stars; classical T Tauri stars; relict magnetism of meteorites; luminosity variability of solar-type stars; evolution of angular momentum in solar-mass stars; time evolution of magnetic fields on solarlike stars

  12. On the analysis of line profile variations: A statistical approach

    International Nuclear Information System (INIS)

    McCandliss, S.R.

    1988-01-01

    This study is concerned with the empirical characterization of the line profile variations (LPV), which occur in many of and Wolf-Rayet stars. The goal of the analysis is to gain insight into the physical mechanisms producing the variations. The analytic approach uses a statistical method to quantify the significance of the LPV and to identify those regions in the line profile which are undergoing statistically significant variations. Line positions and flux variations are then measured and subject to temporal and correlative analysis. Previous studies of LPV have for the most part been restricted to observations of a single line. Important information concerning the range and amplitude of the physical mechanisms involved can be obtained by simultaneously observing spectral features formed over a range of depths in the extended mass losing atmospheres of massive, luminous stars. Time series of a Wolf-Rayet and two of stars with nearly complete spectral coverage from 3940 angstrom to 6610 angstrom and with spectral resolution of R = 10,000 are analyzed here. These three stars exhibit a wide range of both spectral and temporal line profile variations. The HeII Pickering lines of HD 191765 show a monotonic increase in the peak rms variation amplitude with lines formed at progressively larger radii in the Wolf-Rayet star wind. Two times scales of variation have been identified in this star: a less than one day variation associated with small scale flickering in the peaks of the line profiles and a greater than one day variation associated with large scale asymmetric changes in the overall line profile shapes. However, no convincing period phenomena are evident at those periods which are well sampled in this time series

  13. Coupled variations of fundamental couplings and primordial nucleosynthesis

    International Nuclear Information System (INIS)

    Coc, Alain; Nunes, Nelson J.; Olive, Keith A.; Uzan, Jean-Philippe; Vangioni, Elisabeth

    2006-10-01

    The effect of variations of the fundamental nuclear parameters on big-bang nucleosynthesis are modeled and discussed in detail taking into account the interrelations between the fundamental parameters arising in unified theories. Considering only 4 He, strong constraints on the variation of the neutron lifetime, neutron-proton mass difference are set. These constraints are then translated into constraints on the time variation of the Yukawa couplings and the fine structure constant. Furthermore, we show that a variation of the deuterium binding energy is able to reconcile the 7 Li abundance deduced from the WMAP analysis with its spectroscopically determined value while maintaining concordance with D and 4 He. (authors)

  14. Uncertainties in container failure time predictions

    International Nuclear Information System (INIS)

    Williford, R.E.

    1990-01-01

    Stochastic variations in the local chemical environment of a geologic waste repository can cause corresponding variations in container corrosion rates and failure times, and thus in radionuclide release rates. This paper addresses how well the future variations in repository chemistries must be known in order to predict container failure times that are bounded by a finite time period within the repository lifetime. Preliminary results indicate that a 5000 year scatter in predicted container failure times requires that repository chemistries be known to within ±10% over the repository lifetime. These are small uncertainties compared to current estimates. 9 refs., 3 figs

  15. IQ variations across time, race, and nationality: an artifact of differences in literacy skills.

    Science.gov (United States)

    Marks, David F

    2010-06-01

    A body of data on IQ collected over 50 years has revealed that average population IQ varies across time, race, and nationality. An explanation for these differences may be that intelligence test performance requires literacy skills not present in all people to the same extent. In eight analyses, population mean full scale IQ and literacy scores yielded correlations ranging from .79 to .99. In cohort studies, significantly larger improvements in IQ occurred in the lower half of the IQ distribution, affecting the distribution variance and skewness in the predicted manner. In addition, three Verbal subscales on the WAIS show the largest Flynn effect sizes and all four Verbal subscales are among those showing the highest racial IQ differences. This pattern of findings supports the hypothesis that both secular and racial differences in intelligence test scores have an environmental explanation: secular and racial differences in IQ are an artifact of variation in literacy skills. These findings suggest that racial IQ distributions will converge if opportunities are equalized for different population groups to achieve the same high level of literacy skills. Social justice requires more effective implementation of policies and programs designed to eliminate inequities in IQ and literacy.

  16. The Sidereal Time Variations of the Lorentz Force and Maximum Attainable Speed of Electrons

    Science.gov (United States)

    Nowak, Gabriel; Wojtsekhowski, Bogdan; Roblin, Yves; Schmookler, Barak

    2016-09-01

    The Continuous Electron Beam Accelerator Facility (CEBAF) at Jefferson Lab produces electrons that orbit through a known magnetic system. The electron beam's momentum can be determined through the radius of the beam's orbit. This project compares the beam orbit's radius while travelling in a transverse magnetic field with theoretical predictions from special relativity, which predict a constant beam orbit radius. Variations in the beam orbit's radius are found by comparing the beam's momentum entering and exiting a magnetic arc. Beam position monitors (BPMs) provide the information needed to calculate the beam momentum. Multiple BPM's are included in the analysis and fitted using the method of least squares to decrease statistical uncertainty. Preliminary results from data collected over a 24 hour period show that the relative momentum change was less than 10-4. Further study will be conducted including larger time spans and stricter cuts applied to the BPM data. The data from this analysis will be used in a larger experiment attempting to verify special relativity. While the project is not traditionally nuclear physics, it involves the same technology (the CEBAF accelerator) and the same methods (ROOT) as a nuclear physics experiment. DOE SULI Program.

  17. Spectroscopic and DFT studies of calix[4]arene: time-dependent DFT calculations for elucidating the variation in the excitation energies with geometry

    Energy Technology Data Exchange (ETDEWEB)

    Boo, Bong Hyun; Kwak, Hae Ran; Hong, Seung Ki [Chungnam National University, Daejeon (Korea, Republic of); Park, Chan Jo [Korea Research Institute of Chemical Technology, Daejeon (Korea, Republic of); No, Kwang Hyun [Sookmyung Womens University, Seoul (Korea, Republic of)

    2010-08-15

    We have searched low-lying conformers of calix[4]arene and found one global minimum having a cone shape, together with three conformers such as partial cone-shape conformers. We then elucidated the thermodynamics for the conformational changes by performing density-functional theory (DFT) calculations. The time-dependent DFT calculation enabled us to assign the absorption spectrum and to reveal a variation of the excitation energies with geometry.

  18. Origins and interrelationship of Intraseasonal rainfall variations around the Maritime Continent during boreal winter

    Science.gov (United States)

    Cao, Xi; Wu, Renguang

    2018-04-01

    Large intraseasonal rainfall variations are identified over the southern South China Sea (SSCS), tropical southeastern Indian Ocean (SEIO), and east coast of the Philippines (EPHI) in boreal winter. The present study contrasts origins and propagations and investigates interrelations of intraseasonal rainfall variations on the 10-20- and 30-60-day time scales in these regions. Different origins are identified for intraseasonal rainfall anomalies over the SSCS, SEIO, and EPHI on both time scales. On the 10-20-day time scale, strong northerly or northeasterly wind anomalies related to the East Asian winter monsoon (EAWM) play a major role in intraseasonal rainfall variations over the SSCS and EPHI. On the 30-60-day time scale, both the intraseasonal signal from the tropical Indian Ocean and the EAWM-related wind anomalies contribute to intraseasonal rainfall variations over the SSCS, whereas the EAWM-related wind anomalies have a major contribution to the intraseasonal rainfall variations over the EPHI. No relation is detected between the intraseasonal rainfall variations over the SEIO and the EAWM on both the 10-20-day and 30-60-day time scales. The anomalies associated with intraseasonal rainfall variations over the SSCS and EPHI propagate northwestward and northeastward, respectively, on the 10-20- and 30-60-day time scales. The intraseasonal rainfall anomalies display northwestward and northward propagation over the Bay of Bengal, respectively, on the 10-20- and 30-60-day time scales.

  19. Introduction and application of the multiscale coefficient of variation analysis.

    Science.gov (United States)

    Abney, Drew H; Kello, Christopher T; Balasubramaniam, Ramesh

    2017-10-01

    Quantifying how patterns of behavior relate across multiple levels of measurement typically requires long time series for reliable parameter estimation. We describe a novel analysis that estimates patterns of variability across multiple scales of analysis suitable for time series of short duration. The multiscale coefficient of variation (MSCV) measures the distance between local coefficient of variation estimates within particular time windows and the overall coefficient of variation across all time samples. We first describe the MSCV analysis and provide an example analytical protocol with corresponding MATLAB implementation and code. Next, we present a simulation study testing the new analysis using time series generated by ARFIMA models that span white noise, short-term and long-term correlations. The MSCV analysis was observed to be sensitive to specific parameters of ARFIMA models varying in the type of temporal structure and time series length. We then apply the MSCV analysis to short time series of speech phrases and musical themes to show commonalities in multiscale structure. The simulation and application studies provide evidence that the MSCV analysis can discriminate between time series varying in multiscale structure and length.

  20. Somaclonal variation in rice

    International Nuclear Information System (INIS)

    Kucherenko, L.

    1990-01-01

    Full text: 32 varieties of Oryza sativa L. ssp. japonica were used as donors for callus induction from somatic tissues. In some cases, the callus was treated before regeneration with the chemical mutagen MNU. Some of the regenerated plants demonstrated heritable alterations, among them chlorophyll deficiencies, variation in plant height, awness, glume colouring and fertility. Along with these, a number of lines with agronomically valuable alterations concerning maturity time, panicle structure, plant productivity and grain quality were found. The spectrum of variability was very wide. Vivipary was noticed. Superdwarfs with plant height of about 15 cm were found. Plants with no visible distinctions could be variants too, for example, with increased protein content or disease resistance. The rate and the spectrum of the somaclonal variation were not influenced by the culture media but depended on the donor's genotype. On the basis of somaclonal variation a variety 'Bioryza' was developed. It is an early maturing (about 95-100 days), long grain variety, with grain yield up to 8 t/ha. (author)

  1. Scaling laws for trace impurity confinement: a variational approach

    International Nuclear Information System (INIS)

    Thyagaraja, A.; Haas, F.A.

    1990-01-01

    A variational approach is outlined for the deduction of impurity confinement scaling laws. Given the forms of the diffusive and convective components to the impurity particle flux, we present a variational principle for the impurity confinement time in terms of the diffusion time scale and the convection parameter, which is a non-dimensional measure of the size of the convective flux relative to the diffusive flux. These results are very general and apply irrespective of whether the transport fluxes are of theoretical or empirical origin. The impurity confinement time scales exponentially with the convection parameter in cases of practical interest. (orig.)

  2. Variability of OH rotational temperatures on time scales from hours to 15 years by kinetic temperature variations, emission layer changes, and non-LTE effects

    Science.gov (United States)

    Noll, Stefan

    2016-07-01

    Rotational temperatures derived from hydroxyl (OH) line emission are frequently used to study atmospheric temperatures at altitudes of about 87 km. While the measurement only requires intensities of a few bright lines of an OH band, the interpretation can be complicated. Ground-based temperatures are averages for the entire, typically 8 km wide emission layer. Variations in the rotational temperature are then caused by changes of the kinetic temperature and the OH emission profile. The latter can also be accompanied by differences in the layer-averaged efficiency of the thermalisation of the OH rotational level populations. Since this especially depends on the frequency of collisions with O_2, which is low at high altitudes, the non-local thermodynamic equilibrium (non-LTE) contribution to the measured temperatures can be significant and variable. In order to understand the impact of the different sources of OH rotational temperature variations from time scales of hours to a solar cycle, we have studied spectra from the astronomical echelle spectrographs X-shooter and UVES located at Cerro Paranal in Chile. While the X-shooter data spanning 3.5 years allowed us to measure temperatures for 25 OH and two O_2 bands, the UVES spectra cover no more than 10 OH bands simultaneously but a period of about 15 years. These data have been complemented by kinetic temperature and OH and O_2 emission profiles from the multi-channel radiometer SABER on the TIMED satellite. Taking the O_2 and SABER kinetic temperatures as reference and considering the different band-dependent emission profiles, we could evaluate the contribution of non-LTE effects to the measured OH rotational temperatures depending on line set, band, and time. Non-LTE contributions are significant for most bands and can exceed 10 K. The amplitudes of their average nocturnal and seasonal variation are of the order of 1 to 2 K.

  3. Reactor thermal behaviors under kinetics parameters variations in fast reactivity insertion

    Energy Technology Data Exchange (ETDEWEB)

    Abou-El-Maaty, Talal [Reactors Department, Atomic Energy Authority, Cairo 13759 (Egypt)], E-mail: talal22969@yahoo.com; Abdelhady, Amr [Reactors Department, Atomic Energy Authority, Cairo 13759 (Egypt)

    2009-03-15

    The influences of variations in some of the kinetics parameters affecting the reactivity insertion are considered in this study, it has been accomplished in order to acquire knowledge about the role that kinetic parameters play in prompt critical transients from the safety point of view. The kinetics parameters variations are limited to the effective delayed neutron fraction ({beta}{sub eff}) and the prompt neutron generation time ({lambda}). The reactor thermal behaviors under the variations in effective delayed neutron fraction and prompt neutron generation time included, the reactor power, maximum fuel temperature, maximum clad temperature, maximum coolant temperature and the mass flux variations at the hot channel. The analysis is done for a typical swimming pool, plate type research reactor with low enriched uranium. The scram system is disabled during the accidents simulations. Calculations were done using PARET code. As a result of simulations, it is concluded that, the reactor (ETRR2) thermal behavior is considerably more sensitive to the variation in the effective delayed neutron fraction than to the variation in prompt neutron generation time and the fast reactivity insertion in both cases causes a flow expansion and contraction at the hot channel exit. The amplitude of the oscillated flow is a qualitatively increases with the decrease in both {beta}{sub eff} and {lambda}.

  4. Monitoring crop leaf area index time variation from higher resolution remotely sensed data

    International Nuclear Information System (INIS)

    Jiao, Sihong

    2014-01-01

    The leaf area index (LAI) is significant for research on global climate change and ecological environment. China HJ-1 satellite has a revisit cycle of four days, providing CCD data (HJ-1 CCD) with a resolution of 30 m. However, the HJ-1 CCD is incapable of obtaining observations at multiple angles. This is problematic because single angle observations provide insufficient data for determining the LAI. This article proposes a new method for determining LAI using HJ-1 CCD data. The proposed method uses background knowledge of dynamic land surface processes that are extracted from MODerate resolution Imaging Spectroradiometer (MODIS) LAI 1-km resolution data. To process the uncertainties that arise from using two data sources with different spatial resolutions, the proposed method is implemented in a dynamitic Bayesian network scheme by integrating a LAI dynamic process model and a canopy reflectance model with remotely sensed data. Validation results showed that the determination coefficient between estimated and measured LAI was 0.791, and the RMSE was 0.61. This method can enhance the accuracy of the retrieval results while retaining the time series variation characteristics of the vegetation LAI. The results suggest that this algorithm can be widely applied to determining high-resolution leaf area indices using data from China HJ-1 satellite even if information from single angle observations are insufficient for quantitative application

  5. Business cycles and compositional variation in U.S. unemployment

    NARCIS (Netherlands)

    Abbring, J.H.; van den Berg, G.J.; van Ours, J.C.

    2002-01-01

    In this article, we study U.S. unemployment dynamics using grouped unemployment data from the Current Population Survey over the period 1968-1992. We estimate a model that traces variation in these unemployment data, both over time and between demographic groups, back to the underlying variation in

  6. INTERNAL-CYCLE VARIATION OF SOLAR DIFFERENTIAL ROTATION

    International Nuclear Information System (INIS)

    Li, K. J.; Xie, J. L.; Shi, X. J.

    2013-01-01

    The latitudinal distributions of the yearly mean rotation rates measured by Suzuki in 1998 and 2012 and Pulkkinen and Tuominen in 1998 are utilized to investigate internal-cycle variation of solar differential rotation. The rotation rate at the solar equator seems to have decreased since cycle 10 onward. The coefficient B of solar differential rotation, which represents the latitudinal gradient of rotation, is found to be smaller in the several years after the minimum of a solar cycle than in the several years after the maximum time of the cycle, and it peaks several years after the maximum time of the solar cycle. The internal-cycle variation of the solar rotation rates looks similar in profile to that of the coefficient B. A new explanation is proposed to address such a solar-cycle-related variation of the solar rotation rates. Weak magnetic fields may more effectively reflect differentiation at low latitudes with high rotation rates than at high latitudes with low rotation rates, and strong magnetic fields may more effectively repress differentiation at relatively low latitudes than at high latitudes. The internal-cycle variation is inferred as the result of both the latitudinal migration of the surface torsional pattern and the repression of strong magnetic activity in differentiation.

  7. Variation in Payment Rates under Medicare's Inpatient Prospective Payment System.

    Science.gov (United States)

    Krinsky, Sam; Ryan, Andrew M; Mijanovich, Tod; Blustein, Jan

    2017-04-01

    To measure variation in payment rates under Medicare's Inpatient Prospective Payment System (IPPS) and identify the main payment adjustments that drive variation. Medicare cost reports for all Medicare-certified hospitals, 1987-2013, and Dartmouth Atlas geographic files. We measure the Medicare payment rate as a hospital's total acute inpatient Medicare Part A payment, divided by the standard IPPS payment for its geographic area. We assess variation using several measures, both within local markets and nationally. We perform a factor decomposition to identify the share of variation attributable to specific adjustments. We also describe the characteristics of hospitals receiving different payment rates and evaluate changes in the magnitude of the main adjustments over time. Data downloaded from the Centers for Medicare and Medicaid Services, the National Bureau of Economic Research, and the Dartmouth Atlas. In 2013, Medicare paid for acute inpatient discharges at a rate 31 percent above the IPPS base. For the top 10 percent of discharges, the mean rate was double the IPPS base. Variations were driven by adjustments for medical education and care to low-income populations. The magnitude of variation has increased over time. Adjustments are a large and growing share of Medicare hospital payments, and they create significant variation in payment rates. © Health Research and Educational Trust.

  8. Using areas of known occupancy to identify sources of variation in detection probability of raptors: taking time lowers replication effort for surveys.

    Science.gov (United States)

    Murn, Campbell; Holloway, Graham J

    2016-10-01

    Species occurring at low density can be difficult to detect and if not properly accounted for, imperfect detection will lead to inaccurate estimates of occupancy. Understanding sources of variation in detection probability and how they can be managed is a key part of monitoring. We used sightings data of a low-density and elusive raptor (white-headed vulture Trigonoceps occipitalis ) in areas of known occupancy (breeding territories) in a likelihood-based modelling approach to calculate detection probability and the factors affecting it. Because occupancy was known a priori to be 100%, we fixed the model occupancy parameter to 1.0 and focused on identifying sources of variation in detection probability. Using detection histories from 359 territory visits, we assessed nine covariates in 29 candidate models. The model with the highest support indicated that observer speed during a survey, combined with temporal covariates such as time of year and length of time within a territory, had the highest influence on the detection probability. Averaged detection probability was 0.207 (s.e. 0.033) and based on this the mean number of visits required to determine within 95% confidence that white-headed vultures are absent from a breeding area is 13 (95% CI: 9-20). Topographical and habitat covariates contributed little to the best models and had little effect on detection probability. We highlight that low detection probabilities of some species means that emphasizing habitat covariates could lead to spurious results in occupancy models that do not also incorporate temporal components. While variation in detection probability is complex and influenced by effects at both temporal and spatial scales, temporal covariates can and should be controlled as part of robust survey methods. Our results emphasize the importance of accounting for detection probability in occupancy studies, particularly during presence/absence studies for species such as raptors that are widespread and

  9. Dynamics of nonholonomic systems from variational principles embedded variation identity

    International Nuclear Information System (INIS)

    Guo Yongxin; Liu Shixing; Liu Chang; Chang Peng

    2009-01-01

    Nondeterminacy of dynamics, i.e., the nonholonomic or the vakonomic, fundamental variational principles, e.g., the Lagrange-d'Alembert or Hamiltonian, and variational operators, etc., of nonholonomic mechanical systems can be attributed to the non-uniqueness of ways how to realize nonholonomic constraints. Making use of a variation identity of nonholonomic constraints embedded into the Hamilton's principle with the method of Lagrange undetermined multipliers, three kinds of dynamics for the nonholonomic systems including the vakonomic and nonholonomic ones and a new one are obtained if the variation is respectively reduced to three conditional variations: vakonomic variation, Hoelder's variation and Suslov's variation, defined by the identity. Therefore, different dynamics of nonholonomic systems can be derived from an integral variational principle, utilizing one way of embedding constraints into the principle, with different variations. It is verified that the similar embedding of the identity into the Lagrange-d'Alembert principle gives rise to the nonholonomic dynamics but fails to give the vakonomic one unless the constraints are integrable.

  10. Detection of different-time-scale signals in the length of day variation based on EEMD analysis technique

    Directory of Open Access Journals (Sweden)

    Wenbin Shen

    2016-05-01

    Full Text Available Scientists pay great attention to different-time-scale signals in the length of day (LOD variations ΔLOD, which provide signatures of the Earth's interior structure, couplings among different layers, and potential excitations of ocean and atmosphere. In this study, based on the ensemble empirical mode decomposition (EEMD, we analyzed the latest time series of ΔLOD data spanning from January 1962 to March 2015. We observed the signals with periods and amplitudes of about 0.5 month and 0.19 ms, 1.0 month and 0.19 ms, 0.5 yr and 0.22 ms, 1.0 yr and 0.18 ms, 2.28 yr and 0.03 ms, 5.48 yr and 0.05 ms, respectively, in coincidence with the results of predecessors. In addition, some signals that were previously not definitely observed by predecessors were detected in this study, with periods and amplitudes of 9.13 d and 0.12 ms, 13.69 yr and 0.10 ms, respectively. The mechanisms of the LOD fluctuations of these two signals are still open.

  11. Rolling Element Bearing Performance Degradation Assessment Using Variational Mode Decomposition and Gath-Geva Clustering Time Series Segmentation

    Directory of Open Access Journals (Sweden)

    Yaolong Li

    2017-01-01

    Full Text Available By focusing on the issue of rolling element bearing (REB performance degradation assessment (PDA, a solution based on variational mode decomposition (VMD and Gath-Geva clustering time series segmentation (GGCTSS has been proposed. VMD is a new decomposition method. Since it is different from the recursive decomposition method, for example, empirical mode decomposition (EMD, local mean decomposition (LMD, and local characteristic-scale decomposition (LCD, VMD needs a priori parameters. In this paper, we will propose a method to optimize the parameters in VMD, namely, the number of decomposition modes and moderate bandwidth constraint, based on genetic algorithm. Executing VMD with the acquired parameters, the BLIMFs are obtained. By taking the envelope of the BLIMFs, the sensitive BLIMFs are selected. And then we take the amplitude of the defect frequency (ADF as a degradative feature. To get the performance degradation assessment, we are going to use the method called Gath-Geva clustering time series segmentation. Afterwards, the method is carried out by two pieces of run-to-failure data. The results indicate that the extracted feature could depict the process of degradation precisely.

  12. No Escaping the Rat Race: Simulated Night Shift Work Alters the Time-of-Day Variation in BMAL1 Translational Activity in the Prefrontal Cortex.

    Science.gov (United States)

    Marti, Andrea R; Patil, Sudarshan; Mrdalj, Jelena; Meerlo, Peter; Skrede, Silje; Pallesen, Ståle; Pedersen, Torhild T; Bramham, Clive R; Grønli, Janne

    2017-01-01

    Millions of people worldwide work during the night, resulting in disturbed circadian rhythms and sleep loss. This may cause deficits in cognitive functions, impaired alertness and increased risk of errors and accidents. Disturbed circadian rhythmicity resulting from night shift work could impair brain function and cognition through disrupted synthesis of proteins involved in synaptic plasticity and neuronal function. Recently, the circadian transcription factor brain-and-muscle arnt-like protein 1 (BMAL1) has been identified as a promoter of mRNA translation initiation, the most highly regulated step in protein synthesis, through binding to the mRNA "cap". In this study we investigated the effects of simulated shift work on protein synthesis markers. Male rats ( n = 40) were exposed to forced activity, either in their rest phase (simulated night shift work) or in their active phase (simulated day shift work) for 3 days. Following the third work shift, experimental animals and time-matched undisturbed controls were euthanized (rest work at ZT12; active work at ZT0). Tissue lysates from two brain regions (prefrontal cortex, PFC and hippocampus) implicated in cognition and sleep loss, were analyzed with m 7 GTP (cap) pull-down to examine time-of-day variation and effects of simulated shift work on cap-bound protein translation. The results show time-of-day variation of protein synthesis markers in PFC, with increased protein synthesis at ZT12. In the hippocampus there was little difference between ZT0 and ZT12. Active phase work did not induce statistically significant changes in protein synthesis markers at ZT0 compared to time-matched undisturbed controls. Rest work, however, resulted in distinct brain-region specific changes of protein synthesis markers compared to time-matched controls at ZT12. While no changes were observed in the hippocampus, phosphorylation of cap-bound BMAL1 and its regulator S6 kinase beta-1 (S6K1) was significantly reduced in the PFC

  13. No Escaping the Rat Race: Simulated Night Shift Work Alters the Time-of-Day Variation in BMAL1 Translational Activity in the Prefrontal Cortex

    Directory of Open Access Journals (Sweden)

    Andrea R. Marti

    2017-10-01

    Full Text Available Millions of people worldwide work during the night, resulting in disturbed circadian rhythms and sleep loss. This may cause deficits in cognitive functions, impaired alertness and increased risk of errors and accidents. Disturbed circadian rhythmicity resulting from night shift work could impair brain function and cognition through disrupted synthesis of proteins involved in synaptic plasticity and neuronal function. Recently, the circadian transcription factor brain-and-muscle arnt-like protein 1 (BMAL1 has been identified as a promoter of mRNA translation initiation, the most highly regulated step in protein synthesis, through binding to the mRNA “cap”. In this study we investigated the effects of simulated shift work on protein synthesis markers. Male rats (n = 40 were exposed to forced activity, either in their rest phase (simulated night shift work or in their active phase (simulated day shift work for 3 days. Following the third work shift, experimental animals and time-matched undisturbed controls were euthanized (rest work at ZT12; active work at ZT0. Tissue lysates from two brain regions (prefrontal cortex, PFC and hippocampus implicated in cognition and sleep loss, were analyzed with m7GTP (cap pull-down to examine time-of-day variation and effects of simulated shift work on cap-bound protein translation. The results show time-of-day variation of protein synthesis markers in PFC, with increased protein synthesis at ZT12. In the hippocampus there was little difference between ZT0 and ZT12. Active phase work did not induce statistically significant changes in protein synthesis markers at ZT0 compared to time-matched undisturbed controls. Rest work, however, resulted in distinct brain-region specific changes of protein synthesis markers compared to time-matched controls at ZT12. While no changes were observed in the hippocampus, phosphorylation of cap-bound BMAL1 and its regulator S6 kinase beta-1 (S6K1 was significantly reduced in

  14. Local time variations of the middle atmosphere of Venus: Solar-related structures

    Science.gov (United States)

    Zasova, L.; Khatountsev, I. V.; Ignatiev, N. I.; Moroz, V. I.

    Three-dimensional fields (latitude — altitude — local time) of temperature and aerosol in the upper clouds, obtained from the Venera-15 IR spectrometry data, were studied to search for the solar-related structures. The temperature variation at the isobaric levels vs. solar longitude was presented as a superposition of the cosines with periods of 1, 1/2, 1/3 and 1/4 Venusian days. At low latitudes the diurnal tidal component reaches a maximum above 0.2 mb (92km) level. At high latitudes it dominates at P> 50 mb (68 km) in the cold collar, being roughly twice as much as the semidiurnal one and passing through the maximum of 13 K at 400 mb (57 km). The semidiurnal tidal amplitude exceeds the diurnal one below 90 km (where its maximum locates near 83 km), and also in the upper clouds, above 58 km. At low latitudes the 1/3 days component predominates at 10 - 50 mb (68-76 km). In the upper clouds, where most of the solar energy, absorbed in the middle atmosphere, deposits, all four tidal components, including wavenumbers 3 and 4, have significant amplitudes. A position of the upper boundary of the clouds depends on local time in such a way that the lowest height of the clouds is observed in the morning at all selected latitude ranges. At low latitudes the highest position of the upper boundary of the clouds (at 1218 cm -1) is found at 8 - 9 PM, whereas the lowest one is near the morning terminator. At high latitudes the lowest position of the upper boundary of the clouds shifts towards the dayside being at 10:30 AM at 75° in the cold collar and the highest one shifts to 4 PM. The zonal mean altitude of the upper boundary of the clouds decreases from 69 km at 15° to 59 km at 75°. The diurnal tidal component has the highest amplitude in the cold collar (1.5 km). At low latitudes both amplitudes, diurnal and semidiurnal, reach the values 0.8 - 1 km.

  15. Dynamics of nonholonomic systems from variational principles embedded variation identity

    Energy Technology Data Exchange (ETDEWEB)

    Guo Yongxin, E-mail: yxguo@lnu.edu.c [College of Physics, Liaoning University, Shenyang 110036 (China); Liu Shixing [College of Physics, Liaoning University, Shenyang 110036 (China); Liu Chang; Chang Peng [Department of Applied Mechanics, Beijing Institute of Technology, Beijing 100081 (China)

    2009-10-19

    Nondeterminacy of dynamics, i.e., the nonholonomic or the vakonomic, fundamental variational principles, e.g., the Lagrange-d'Alembert or Hamiltonian, and variational operators, etc., of nonholonomic mechanical systems can be attributed to the non-uniqueness of ways how to realize nonholonomic constraints. Making use of a variation identity of nonholonomic constraints embedded into the Hamilton's principle with the method of Lagrange undetermined multipliers, three kinds of dynamics for the nonholonomic systems including the vakonomic and nonholonomic ones and a new one are obtained if the variation is respectively reduced to three conditional variations: vakonomic variation, Hoelder's variation and Suslov's variation, defined by the identity. Therefore, different dynamics of nonholonomic systems can be derived from an integral variational principle, utilizing one way of embedding constraints into the principle, with different variations. It is verified that the similar embedding of the identity into the Lagrange-d'Alembert principle gives rise to the nonholonomic dynamics but fails to give the vakonomic one unless the constraints are integrable.

  16. Use of intraspecific variation in thermal responses for estimating an elevational cline in the timing of cold hardening in a sub-boreal conifer.

    Science.gov (United States)

    Ishizuka, W; Ono, K; Hara, T; Goto, S

    2015-01-01

    To avoid winter frost damage, evergreen coniferous species develop cold hardiness with suitable phenology for the local climate regime. Along the elevational gradient, a genetic cline in autumn phenology is often recognised among coniferous populations, but further quantification of evolutionary adaptation related to the local environment and its responsible signals generating the phenological variation are poorly understood. We evaluated the timing of cold hardening among populations of Abies sachalinensis, based on time series freezing tests using trees derived from four seed source populations × three planting sites. Furthermore, we constructed a model to estimate the development of hardening from field temperatures and the intraspecific variations occurring during this process. An elevational cline was detected such that high-elevation populations developed cold hardiness earlier than low-elevation populations, representing significant genetic control. Because development occurred earlier at high-elevation planting sites, the genetic trend across elevation overlapped with the environmental trend. Based on the trade-off between later hardening to lengthen the active growth period and earlier hardening to avoid frost damage, this genetic cline would be adaptive to the local climate. Our modelling approach estimated intraspecific variation in two model components: the threshold temperature, which was the criterion for determining whether the trees accumulated the thermal value, and the chilling requirement for trees to achieve adequate cold hardiness. A higher threshold temperature and a lower chilling requirement could be responsible for the earlier phenology of the high-elevation population. These thermal responses may be one of the important factors driving the elevation-dependent adaptation of A. sachalinensis. © 2014 German Botanical Society and The Royal Botanical Society of the Netherlands.

  17. Seasonal variation and solar activity dependence of the quiet-time ionospheric trough

    Science.gov (United States)

    Ishida, T.; Ogawa, Y.; Kadokura, A.; Hiraki, Y.; Häggström, I.

    2014-08-01

    We have conducted a statistical analysis of the ionospheric F region trough, focusing on its seasonal variation and solar activity dependence under geomagnetically quiet and moderate conditions, using plasma parameter data obtained via Common Program 3 observations performed by the European Incoherent Scatter (EISCAT) radar between 1982 and 2011. We have confirmed that there is a major difference in frictional heating between the high- and low-latitude sides of the EISCAT field of view (FOV) at ~73°0'N-60°5'N (geomagnetic latitude) at an altitude of 325 km, which is associated with trough formation. Our statistical results show that the high-latitude and midlatitude troughs occur on the high- and low-latitude sides of the FOV, respectively. Seasonal variations indicate that dissociative recombination accompanied by frictional heating is a main cause of trough formation in sunlit regions. During summer, therefore, the occurrence rate is maintained at 80-90% in the postmidnight high-latitude region owing to frictional heating by eastward return flow. Solar activity dependence on trough formation indicates that field-aligned currents modulate the occurrence rate of the trough during the winter and equinox seasons. In addition, the trough becomes deeper via dissociative recombination caused by an increased ion temperature with F10.7, at least in the equinox and summer seasons but not in winter.

  18. Variational symplectic algorithm for guiding center dynamics and its application in tokamak geometry

    International Nuclear Information System (INIS)

    Qin Hong; Guan Xiaoyin; Tang, William M.

    2009-01-01

    A variational symplectic integrator for the guiding center motion of charged particles in general magnetic fields is developed to enable accurate long-time simulation studies of magnetized plasmas. Instead of discretizing the differential equations of the guiding center motion, the action of the guiding center motion is discretized and minimized to obtain the iteration rules for advancing the dynamics. The variational symplectic integrator conserves exactly a discrete Lagrangian symplectic structure and globally bounds the numerical error in energy by a small number for all simulation time steps. Compared with standard integrators, such as the fourth order Runge-Kutta method, the variational symplectic integrator has superior numerical properties over long integration time. For example, in a two-dimensional tokamak geometry, the variational symplectic integrator is able to guarantee the accuracy for both the trapped and transit particle orbits for arbitrarily long simulation time. This is important for modern large-scale simulation studies of fusion plasmas where it is critical to use algorithms with long-term accuracy and fidelity. The variational symplectic integrator is expected to have a wide range of applications.

  19. Variational principles for collective motion: Relation between invariance principle of the Schroedinger equation and the trace variational principle

    International Nuclear Information System (INIS)

    Klein, A.; Tanabe, K.

    1984-01-01

    The invariance principle of the Schroedinger equation provides a basis for theories of collective motion with the help of the time-dependent variational principle. It is formulated here with maximum generality, requiring only the motion of intrinsic state in the collective space. Special cases arise when the trial vector is a generalized coherent state and when it is a uniform superposition of collective eigenstates. The latter example yields variational principles uncovered previously only within the framework of the equations of motion method. (orig.)

  20. Analyzing Seasonal Variations in Suicide With Fourier Poisson Time-Series Regression: A Registry-Based Study From Norway, 1969-2007.

    Science.gov (United States)

    Bramness, Jørgen G; Walby, Fredrik A; Morken, Gunnar; Røislien, Jo

    2015-08-01

    Seasonal variation in the number of suicides has long been acknowledged. It has been suggested that this seasonality has declined in recent years, but studies have generally used statistical methods incapable of confirming this. We examined all suicides occurring in Norway during 1969-2007 (more than 20,000 suicides in total) to establish whether seasonality decreased over time. Fitting of additive Fourier Poisson time-series regression models allowed for formal testing of a possible linear decrease in seasonality, or a reduction at a specific point in time, while adjusting for a possible smooth nonlinear long-term change without having to categorize time into discrete yearly units. The models were compared using Akaike's Information Criterion and analysis of variance. A model with a seasonal pattern was significantly superior to a model without one. There was a reduction in seasonality during the period. Both the model assuming a linear decrease in seasonality and the model assuming a change at a specific point in time were both superior to a model assuming constant seasonality, thus confirming by formal statistical testing that the magnitude of the seasonality in suicides has diminished. The additive Fourier Poisson time-series regression model would also be useful for studying other temporal phenomena with seasonal components. © The Author 2015. Published by Oxford University Press on behalf of the Johns Hopkins Bloomberg School of Public Health. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  1. Planck intermediate results. XXIV. Constraints on variation of fundamental constants

    CERN Document Server

    Ade, P A R; Arnaud, M.; Ashdown, M.; Aumont, J.; Baccigalupi, C.; Banday, A.J.; Barreiro, R.B.; Battaner, E.; Benabed, K.; Benoit-Levy, A.; Bernard, J.P.; Bersanelli, M.; Bielewicz, P.; Bond, J.R.; Borrill, J.; Bouchet, F.R.; Burigana, C.; Butler, R.C.; Calabrese, E.; Chamballu, A.; Chiang, H.C.; Christensen, P.R.; Clements, D.L.; Colombo, L.P.L.; Couchot, F.; Curto, A.; Cuttaia, F.; Danese, L.; Davies, R.D.; Davis, R.J.; de Bernardis, P.; de Rosa, A.; de Zotti, G.; Delabrouille, J.; Diego, J.M.; Dole, H.; Dore, O.; Dupac, X.; Ensslin, T.A.; Eriksen, H.K.; Fabre, O.; Finelli, F.; Forni, O.; Frailis, M.; Franceschi, E.; Galeotta, S.; Galli, S.; Ganga, K.; Giard, M.; Gonzalez-Nuevo, J.; Gorski, K.M.; Gregorio, A.; Gruppuso, A.; Hansen, F.K.; Hanson, D.; Harrison, D.L.; Henrot-Versille, S.; Hernandez-Monteagudo, C.; Herranz, D.; Hildebrandt, S.R.; Hivon, E.; Hobson, M.; Holmes, W.A.; Hornstrup, A.; Hovest, W.; Huffenberger, K.M.; Jaffe, A.H.; Jones, W.C.; Keihanen, E.; Keskitalo, R.; Kneissl, R.; Knoche, J.; Kunz, M.; Kurki-Suonio, H.; Lamarre, J.M.; Lasenby, A.; Lawrence, C.R.; Leonardi, R.; Lesgourgues, J.; Liguori, M.; Lilje, P.B.; Linden-Vornle, M.; Lopez-Caniego, M.; Lubin, P.M.; Macias-Perez, J.F.; Mandolesi, N.; Maris, M.; Martin, P.G.; Martinez-Gonzalez, E.; Masi, S.; Matarrese, S.; Mazzotta, P.; Meinhold, P.R.; Melchiorri, A.; Mendes, L.; Menegoni, E.; Mennella, A.; Migliaccio, M.; Miville-Deschenes, M.A.; Moneti, A.; Montier, L.; Morgante, G.; Moss, A.; Munshi, D.; Murphy, J.A.; Naselsky, P.; Nati, F.; Natoli, P.; Norgaard-Nielsen, H.U.; Noviello, F.; Novikov, D.; Novikov, I.; Oxborrow, C.A.; Pagano, L.; Pajot, F.; Paoletti, D.; Pasian, F.; Patanchon, G.; Perdereau, O.; Perotto, L.; Perrotta, F.; Piacentini, F.; Piat, M.; Pierpaoli, E.; Pietrobon, D.; Plaszczynski, S.; Pointecouteau, E.; Polenta, G.; Ponthieu, N.; Popa, L.; Pratt, G.W.; Prunet, S.; Rachen, J.P.; Rebolo, R.; Reinecke, M.; Remazeilles, M.; Renault, C.; Ricciardi, S.; Ristorcelli, I.; Rocha, G.; Roudier, G.; Rusholme, B.; Sandri, M.; Savini, G.; Scott, D.; Spencer, L.D.; Stolyarov, V.; Sudiwala, R.; Sutton, D.; Suur-Uski, A.S.; Sygnet, J.F.; Tauber, J.A.; Tavagnacco, D.; Terenzi, L.; Toffolatti, L.; Tomasi, M.; Tristram, M.; Tucci, M.; Uzan, J.P.; Valenziano, L.; Valiviita, J.; Van Tent, B.; Vielva, P.; Villa, F.; Wade, L.A.; Yvon, D.; Zacchei, A.; Zonca, A.

    2015-01-01

    Any variation of the fundamental physical constants, and more particularly of the fine structure constant, $\\alpha$, or of the mass of the electron, $m_e$, would affect the recombination history of the Universe and cause an imprint on the cosmic microwave background angular power spectra. We show that the Planck data allow one to improve the constraint on the time variation of the fine structure constant at redshift $z\\sim 10^3$ by about a factor of 5 compared to WMAP data, as well as to break the degeneracy with the Hubble constant, $H_0$. In addition to $\\alpha$, we can set a constraint on the variation of the mass of the electron, $m_{\\rm e}$, and on the simultaneous variation of the two constants. We examine in detail the degeneracies between fundamental constants and the cosmological parameters, in order to compare the limits obtained from Planck and WMAP and to determine the constraining power gained by including other cosmological probes. We conclude that independent time variations of the fine structu...

  2. From Hard Times to Better Times: College Majors, Unemployment, and Earnings

    Science.gov (United States)

    Carnevale, Anthony P.; Cheah, Ban

    2015-01-01

    This third installment of "Hard Times" updates the previous analyses of college majors, unemployment, and earnings over the Great Recession. While there is wide variation by college majors, hard times have become better times for most college graduates, but the recovery is far from complete. Hard times are becoming better times for most…

  3. Calculus of variations

    CERN Document Server

    Elsgolc, L E; Stark, M

    1961-01-01

    Calculus of Variations aims to provide an understanding of the basic notions and standard methods of the calculus of variations, including the direct methods of solution of the variational problems. The wide variety of applications of variational methods to different fields of mechanics and technology has made it essential for engineers to learn the fundamentals of the calculus of variations. The book begins with a discussion of the method of variation in problems with fixed boundaries. Subsequent chapters cover variational problems with movable boundaries and some other problems; sufficiency

  4. Patterns of variation across primates in jaw-muscle electromyography during mastication.

    Science.gov (United States)

    Vinyard, Christopher J; Wall, Christine E; Williams, Susan H; Hylander, William L

    2008-08-01

    Biologists that study mammals continue to discuss the evolution of and functional variation in jaw-muscle activity during chewing. A major barrier to addressing these issues is collecting sufficient in vivo data to adequately capture neuromuscular variation in a clade. We combine data on jaw-muscle electromyography (EMG) collected during mastication from 14 species of primates and one of treeshrews to assess patterns of neuromuscular variation in primates. All data were collected and analyzed using the same methods. We examine the variance components for EMG parameters using a nested ANOVA design across successive hierarchical factors from chewing cycle through species for eight locations in the masseter and temporalis muscles. Variation in jaw-muscle EMGs was not distributed equally across hierarchical levels. The timing of peak EMG activity showed the largest variance components among chewing cycles. Relative levels of recruitment of jaw muscles showed the largest variance components among chewing sequences and cycles. We attribute variation among chewing cycles to (1) changes in food properties throughout the chewing sequence, (2) variation in bite location, and (3) the multiple ways jaw muscles can produce submaximal bite forces. We hypothesize that variation among chewing sequences is primarily related to variation in properties of food. The significant proportion of variation in EMGs potentially linked to food properties suggests that experimental biologists must pay close attention to foods given to research subjects in laboratory-based studies of feeding. The jaw muscles exhibit markedly different variance components among species suggesting that primate jaw muscles have evolved as distinct functional units. The balancing-side deep masseter (BDM) exhibits the most variation among species. This observation supports previous hypotheses linking variation in the timing and activation of the BDM to symphyseal fusion in anthropoid primates and in strepsirrhines

  5. Time series analyses of hydrological parameter variations and their correlations at a coastal area in Busan, South Korea

    Science.gov (United States)

    Chung, Sang Yong; Senapathi, Venkatramanan; Sekar, Selvam; Kim, Tae Hyung

    2018-02-01

    Monitoring and time-series analysis of the hydrological parameters electrical conductivity (EC), water pressure, precipitation and tide were carried out, to understand the characteristics of the parameter variations and their correlations at a coastal area in Busan, South Korea. The monitoring data were collected at a sharp interface between freshwater and saline water at the depth of 25 m below ground. Two well-logging profiles showed that seawater intrusion has largely expanded (progressed inland), and has greatly affected the groundwater quality in a coastal aquifer of tuffaceous sedimentary rock over a 9-year period. According to the time series analyses, the periodograms of the hydrological parameters present very similar trends to the power spectral densities (PSD) of the hydrological parameters. Autocorrelation functions (ACF) and partial autocorrelation functions (PACF) of the hydrological parameters were produced to evaluate their self-correlations. The ACFs of all hydrologic parameters showed very good correlation over the entire time lag, but the PACF revealed that the correlations were good only at time lag 1. Crosscorrelation functions (CCF) were used to evaluate the correlations between the hydrological parameters and the characteristics of seawater intrusion in the coastal aquifer system. The CCFs showed that EC had a close relationship with water pressure and precipitation rather than tide. The CCFs of water pressure with tide and precipitation were in inverse proportion, and the CCF of water pressure with precipitation was larger than that with tide.

  6. Speed, speed variation and crash relationships for urban arterials.

    Science.gov (United States)

    Wang, Xuesong; Zhou, Qingya; Quddus, Mohammed; Fan, Tianxiang; Fang, Shou'en

    2018-04-01

    Speed and speed variation are closely associated with traffic safety. There is, however, a dearth of research on this subject for the case of urban arterials in general, and in the context of developing nations. In downtown Shanghai, the traffic conditions in each direction are very different by time of day, and speed characteristics during peak hours are also greatly different from those during off-peak hours. Considering that traffic demand changes with time and in different directions, arterials in this study were divided into one-way segments by the direction of flow, and time of day was differentiated and controlled for. In terms of data collection, traditional fixed-based methods have been widely used in previous studies, but they fail to capture the spatio-temporal distributions of speed along a road. A new approach is introduced to estimate speed variation by integrating spatio-temporal speed fluctuation of a single vehicle with speed differences between vehicles using taxi-based high frequency GPS data. With this approach, this paper aims to comprehensively establish a relationship between mean speed, speed variation and traffic crashes for the purpose of formulating effective speed management measures, specifically using an urban dataset. From a total of 234 one-way road segments from eight arterials in Shanghai, mean speed, speed variation, geometric design features, traffic volume, and crash data were collected. Because the safety effects of mean speed and speed variation may vary at different segment lengths, arterials with similar signal spacing density were grouped together. To account for potential correlations among these segments, a hierarchical Poisson log-normal model with random effects was developed. Results show that a 1% increase in mean speed on urban arterials was associated with a 0.7% increase in total crashes, and larger speed variation was also associated with increased crash frequency. Copyright © 2018 Elsevier Ltd. All rights

  7. Fourteen years of geomagnetic daily variation at Mario Zucchelli Station (Antarctica

    Directory of Open Access Journals (Sweden)

    A. Meloni

    2007-06-01

    Full Text Available During the 1986-87 austral summer a geomagnetic observatory was installed at the Italian Antarctic Base Mario Zucchelli Station. In the first three years continuous time variation monitoring and absolute measurements of the geomagnetic field were carried out only during summer expeditions. Starting 1991 an automatic acquisition system, operating through all the year, was put in operation. We present here some peculiarities of the daily variation as observed for fourteen years (1987-2000. The availability of a long series of data has allowed the definition of seasonal, as well as solar cycle effects, on short time variations as observed at a cusp-cap observatory. In particular, contrary to mid latitude behaviour, a clear dependence of the daily variation amplitude on the global geomagnetic K index was well defined.

  8. Updated Outcome and Analysis of Tumor Response in Mobile Spine and Sacral Chordoma Treated With Definitive High-Dose Photon/Proton Radiation Therapy

    Energy Technology Data Exchange (ETDEWEB)

    Kabolizadeh, Peyman, E-mail: peyman.kabolizadeh@beaumont.org [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Chen, Yen-Lin; Liebsch, Norbert [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Hornicek, Francis J.; Schwab, Joseph H. [Department of Orthopedic Surgery, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Choy, Edwin [Department of Medicine, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Rosenthal, Daniel I. [Department of Radiology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States); Niemierko, Andrzej; DeLaney, Thomas F. [Department of Radiation Oncology, Massachusetts General Hospital, Harvard Medical School, Boston, Massachusetts (United States)

    2017-02-01

    Purpose: Treatment of spine and sacral chordoma generally involves surgical resection, usually in conjunction with radiation therapy. In certain circumstances where resection may result in significant neurologic or organ dysfunction, patients can be treated definitively with radiation therapy alone. Herein, we report the outcome and the assessment of tumor response to definitive radiation therapy. Methods and Materials: A retrospective analysis was performed on 40 patients with unresected chordoma treated with photon/proton radiation therapy. Nineteen patients had complete sets of imaging scans. The soft tissue and bone compartments of the tumor were defined separately. Tumor response was evaluated by the modified Response Evaluation Criteria in Solid Tumors (RECIST) and volumetric analysis. Results: With a median follow-up time of 50.3 months, the rates of 5-year local control, overall survival, disease-specific survival, and distant failure were 85.4%, 81.9%, 89.4%, and 20.2%, respectively. Eighty-four computed tomographic and magnetic resonance imaging scans were reviewed. Among the 19 patients, only 4 local failures occurred, and the median tumor dose was 77.4 GyRBE. Analysis at a median follow-up time of 18 months showed significant volumetric reduction of the total target volume (TTV) and the soft tissue target volume (STTV) within the first 24 months after treatment initiation, followed by further gradual reduction throughout the rest of the follow-up period. The median maximum percentage volumetric regressions of TTV and STTV were 43.2% and 70.4%, respectively. There was only a small reduction in bone target volume over time. In comparison with the modified RECIST, volumetric analysis was more reliable, more reproducible, and could help in measuring minimal changes in the tumor volume. Conclusion: These results continue to support the use of high-dose definitive radiation therapy for selected patients with unresected spine and sacral chordomas

  9. Updated Outcome and Analysis of Tumor Response in Mobile Spine and Sacral Chordoma Treated With Definitive High-Dose Photon/Proton Radiation Therapy

    International Nuclear Information System (INIS)

    Kabolizadeh, Peyman; Chen, Yen-Lin; Liebsch, Norbert; Hornicek, Francis J.; Schwab, Joseph H.; Choy, Edwin; Rosenthal, Daniel I.; Niemierko, Andrzej; DeLaney, Thomas F.

    2017-01-01

    Purpose: Treatment of spine and sacral chordoma generally involves surgical resection, usually in conjunction with radiation therapy. In certain circumstances where resection may result in significant neurologic or organ dysfunction, patients can be treated definitively with radiation therapy alone. Herein, we report the outcome and the assessment of tumor response to definitive radiation therapy. Methods and Materials: A retrospective analysis was performed on 40 patients with unresected chordoma treated with photon/proton radiation therapy. Nineteen patients had complete sets of imaging scans. The soft tissue and bone compartments of the tumor were defined separately. Tumor response was evaluated by the modified Response Evaluation Criteria in Solid Tumors (RECIST) and volumetric analysis. Results: With a median follow-up time of 50.3 months, the rates of 5-year local control, overall survival, disease-specific survival, and distant failure were 85.4%, 81.9%, 89.4%, and 20.2%, respectively. Eighty-four computed tomographic and magnetic resonance imaging scans were reviewed. Among the 19 patients, only 4 local failures occurred, and the median tumor dose was 77.4 GyRBE. Analysis at a median follow-up time of 18 months showed significant volumetric reduction of the total target volume (TTV) and the soft tissue target volume (STTV) within the first 24 months after treatment initiation, followed by further gradual reduction throughout the rest of the follow-up period. The median maximum percentage volumetric regressions of TTV and STTV were 43.2% and 70.4%, respectively. There was only a small reduction in bone target volume over time. In comparison with the modified RECIST, volumetric analysis was more reliable, more reproducible, and could help in measuring minimal changes in the tumor volume. Conclusion: These results continue to support the use of high-dose definitive radiation therapy for selected patients with unresected spine and sacral chordomas

  10. Using spectral element method to solve variational inequalities with applications in finance

    International Nuclear Information System (INIS)

    Moradipour, M.; Yousefi, S.A.

    2015-01-01

    Under the Black–Scholes model, the value of an American option solves a time dependent variational inequality problem (VIP). In this paper, first we discretize the variational inequality of American option in temporal direction by applying the Rannacher time stepping and achieve a sequence of elliptic variational inequalities. Second we discretize the spatial domain of variational inequalities by using spectral element methods with high order Lagrangian polynomials introduced on Gauss–Legendre–Lobatto points. Also by computing integrals by the Gauss–Legendre–Lobatto quadrature rule we derive a sequence of the linear complementarity problems (LCPs) having a positive definite sparse coefficient matrix. To find the unique solutions of the LCPs, we use the projected successive over-relaxation (PSOR) algorithm. Furthermore we present some existence and uniqueness theorems for the variational inequalities and LCPs. Finally, theoretical results are verified on the relevant numerical examples.

  11. Diurnal variations of Titan

    Science.gov (United States)

    Cui, J.; Galand, M.; Yelle, R. V.; Vuitton, V.; Wahlund, J.-E.; Lavvas, P. P.; Mueller-Wodarg, I. C. F.; Kasprzak, W. T.; Waite, J. H.

    2009-04-01

    We present our analysis of the diurnal variations of Titan's ionosphere (between 1,000 and 1,400 km) based on a sample of Ion Neutral Mass Spectrometer (INMS) measurements in the Open Source Ion (OSI) mode obtained from 8 close encounters of the Cassini spacecraft with Titan. Though there is an overall ion depletion well beyond the terminator, the ion content on Titan's nightside is still appreciable, with a density plateau of ~700 cm-3 below ~1,300 km. Such a plateau is associated with the combination of distinct diurnal variations of light and heavy ions. Light ions (e.g. CH5+, HCNH+, C2H5+) show strong diurnal variation, with clear bite-outs in their nightside distributions. In contrast, heavy ions (e.g. c-C3H3+, C2H3CNH+, C6H7+) present modest diurnal variation, with significant densities observed on the nightside. We propose that the distinctions between light and heavy ions are associated with their different chemical loss pathways, with the former primarily through "fast" ion-neutral chemistry and the latter through "slow" electron dissociative recombination. The INMS data suggest day-to-night transport as an important source of ions on Titan's nightside, to be distinguished from the conventional scenario of auroral ionization by magnetospheric particles as the only ionizing source on the nightside. This is supported by the strong correlation between the observed night-to-day ion density ratios and the associated ion lifetimes. We construct a time-dependent ion chemistry model to investigate the effects of day-to-night transport on the ionospheric structures of Titan. The predicted diurnal variation has similar general characteristics to those observed, with some apparent discrepancies which could be reconciled by imposing fast horizontal thermal winds in Titan's upper atmosphere.

  12. Time variations of stellar water masers

    International Nuclear Information System (INIS)

    Cox, G.G.; Parker, E.A.

    1979-01-01

    The 22-GHz H 2 O spectra of the stars RS Vir, RT Vir, R Aql, W Hya, U Her, S Cr B, Rx Boo, R Crt and VY CMa have been observed at intervals during the period 1974 September -1977 May. Optical and infrared measurements have also been made. New components have been observed in the H 2 O spectra of most of the stars, and the flux density of W Hya reached 2000 Jy near Jd 2442700. The intensities of the three main groups of components in VY CMa varied in phase consistent with a central pump source. In several stars the intensities were very different from those found by earlier observers, showing that stellar H 2 O masers are often not stable for more than a few cycles of the stellar luminosity. For part of the time the H 2 O and infrared intensities of R Aql and RS Vir were anticorrelated. (author)

  13. Image denoising by a direct variational minimization

    Directory of Open Access Journals (Sweden)

    Pilipović Stevan

    2011-01-01

    Full Text Available Abstract In this article we introduce a novel method for the image de-noising which combines a mathematically well-posdenes of the variational modeling with the efficiency of a patch-based approach in the field of image processing. It based on a direct minimization of an energy functional containing a minimal surface regularizer that uses fractional gradient. The minimization is obtained on every predefined patch of the image, independently. By doing so, we avoid the use of an artificial time PDE model with its inherent problems of finding optimal stopping time, as well as the optimal time step. Moreover, we control the level of image smoothing on each patch (and thus on the whole image by adapting the Lagrange multiplier using the information on the level of discontinuities on a particular patch, which we obtain by pre-processing. In order to reduce the average number of vectors in the approximation generator and still to obtain the minimal degradation, we combine a Ritz variational method for the actual minimization on a patch, and a complementary fractional variational principle. Thus, the proposed method becomes computationally feasible and applicable for practical purposes. We confirm our claims with experimental results, by comparing the proposed method with a couple of PDE-based methods, where we get significantly better denoising results specially on the oscillatory regions.

  14. Variational and quasi-variational inequalities in mechanics

    CERN Document Server

    Kravchuk, Alexander S

    2007-01-01

    The essential aim of the present book is to consider a wide set of problems arising in the mathematical modelling of mechanical systems under unilateral constraints. In these investigations elastic and non-elastic deformations, friction and adhesion phenomena are taken into account. All the necessary mathematical tools are given: local boundary value problem formulations, construction of variational equations and inequalities, and the transition to minimization problems, existence and uniqueness theorems, and variational transformations (Friedrichs and Young-Fenchel-Moreau) to dual and saddle-point search problems. Important new results concern contact problems with friction. The Coulomb friction law and some others are considered, in which relative sliding velocities appear. The corresponding quasi-variational inequality is constructed, as well as the appropriate iterative method for its solution. Outlines of the variational approach to non-stationary and dissipative systems and to the construction of the go...

  15. Diurnal changes of earthquake activity and geomagnetic Sq-variations

    Directory of Open Access Journals (Sweden)

    G. Duma

    2003-01-01

    Full Text Available Statistic analyses demonstrate that the probability of earthquake occurrence in many earthquake regions strongly depends on the time of day, that is on Local Time (e.g. Conrad, 1909, 1932; Shimshoni, 1971; Duma, 1997; Duma and Vilardo, 1998. This also applies to strong earthquake activity. Moreover, recent observations reveal an involvement of the regular diurnal variations of the Earth’s magnetic field, commonly known as Sq-variations, in this geodynamic process of changing earthquake activity with the time of day (Duma, 1996, 1999. In the article it is attempted to quantify the forces which result from the interaction between the induced Sq-variation currents in the Earth’s lithosphere and the regional Earth’s magnetic field, in order to assess the influence on the tectonic stress field and on seismic activity. A reliable model is obtained, which indicates a high energy involved in this process. The effect of Sq-induction is compared with the results of the large scale electromagnetic experiment "Khibiny" (Velikhov, 1989, where a giant artificial current loop was activated in the Barents Sea.

  16. High-Cadence Transit Timing Variation Monitoring of Extrasolar Planets

    Directory of Open Access Journals (Sweden)

    Naef D.

    2011-02-01

    Full Text Available We report ground-based high-cadence transit timing observations of the extrasolar planet WASP-2b. We achieve a typical timing error of 15-30 sec. The data show no significant deviations from the predicted ephemeris.

  17. Calculus of variations

    CERN Document Server

    Elsgolc, Lev D

    2007-01-01

    This concise text offers both professionals and students an introduction to the fundamentals and standard methods of the calculus of variations. In addition to surveys of problems with fixed and movable boundaries, it explores highly practical direct methods for the solution of variational problems.Topics include the method of variation in problems with fixed boundaries; variational problems with movable boundaries and other problems; sufficiency conditions for an extremum; variational problems of constrained extrema; and direct methods of solving variational problems. Each chapter features nu

  18. How does the predicted geomagnetic main field variation alter the thermosphere-ionosphere storm-time response?

    Science.gov (United States)

    Maute, A. I.; Lu, G.; Richmond, A. D.

    2017-12-01

    Earth's magnetic main field plays an important role in the thermosphere-ionosphere (TI) system, as well as its coupling to Earth's magnetosphere. The ionosphere consists of a weakly ionized plasma strongly influenced by the main field and embedded in the thermosphere. Therefore, ion-neutral coupling and ionospheric electrodynamics can influence the plasma distribution and neutral dynamics. There are strong longitude variations of the TI storm response. At high latitude magnetosphere-ionosphere coupling is organized by the geomagnetic main field, leading in general to stronger northern middle latitude storm time response in the American sector due to the geomagnetic dipole location. In addition, the weak geomagnetic main field in the American sector leads to larger local ExB drift and can alter the plasma densities. During geomagnetic storms the intense energy input into the high latitude region is redistributed globally, leading to thermospheric heating, wind circulation changes and alterations of the ionospheric electrodynamics. The storm time changes are measurable in the plasma density, ion drift, temperature, neutral composition, and other parameters. All these changes depend, to some degree, on the geomagnetic main field which changes on decadal time scales. In this study, we employ a forecast model of the geomagnetic main field based on data assimilation and geodynamo modeling [Aubert et al., 2015]. The main field model predicts that in 50 years the South Atlantic Anomaly is further weakened by 2 mT and drifts westward by approximately 10o. The dipole axis moves northward and westward by 2o and 6o, respectively. Simulating the March 2015 geomagnetic storm with the Thermosphere-Ionosphere Electrodynamics General Circulation Model (TIE-GCM) driven by the Assimilative Mapping of Ionospheric Electrodynamics (AMIE), we evaluate the thermosphere-ionosphere response using the geomagnetic main field of 2015, 2065, and 2115. We compare the TI response for 2015 with

  19. Genetic spectrum of low density lipoprotein receptor gene variations in South Indian population.

    Science.gov (United States)

    ArulJothi, K N; Suruthi Abirami, B; Devi, Arikketh

    2018-03-01

    Low density lipoprotein receptor (LDLR) is a membrane bound receptor maintaining cholesterol homeostasis along with Apolipoprotein B (APOB), Proprotein Convertase Subtilisin/Kexin type 9 (PCSK9) and other genes of lipid metabolism. Any pathogenic variation in these genes alters the function of the receptor and leads to Familial Hypercholesterolemia (FH) and other cardiovascular diseases. This study was aimed at screening the LDLR, APOB and PCSK9 genes in Hypercholesterolemic patients to define the genetic spectrum of FH in Indian population. Familial Hypercholesterolemia patients (n=78) of South Indian Tamil population with LDL cholesterol and Total cholesterol levels above 4.9mmol/l and 7.5mmol/l with family history of Myocardial infarction were involved. DNA was isolated by organic extraction method from blood samples and LDLR, APOB and PCSK9 gene exons were amplified using primers that cover exon-intron boundaries. The amplicons were screened using High Resolution Melt (HRM) Analysis and the screened samples were sequenced after purification. This study reports 20 variations in South Indian population for the first time. In this set of variations 9 are novel variations which are reported for the first time, 11 were reported in other studies also. The in silico analysis for all the variations detected in this study were done to predict the probabilistic effect in pathogenicity of FH. This study adds 9 novel variations and 11 recurrent variations to the spectrum of LDLR gene mutations in Indian population. All these variations are reported for the first time in Indian population. This spectrum of variations was different from the variations of previous Indian reports. Copyright © 2017 Elsevier B.V. All rights reserved.

  20. Geomagnetic Core Field Secular Variation Models

    DEFF Research Database (Denmark)

    Gillet, N.; Lesur, V.; Olsen, Nils

    2010-01-01

    highlight the difficulty of resolving the time variability of the high degree secular variation coefficients (i.e. the secular acceleration), arising for instance from the challenge to properly separate sources of internal and of external origin. In addition, the regularisation process may also result...

  1. A variational integrators approach to second order modeling and identification of linear mechanical systems

    NARCIS (Netherlands)

    Bruschetta, M.; Saccon, A.; Picci, G.

    2014-01-01

    The theory of variational integration provides a systematic procedure to discretize the equations of motion of a mechanical system, preserving key properties of the continuous time flow. The discrete-time model obtained by variational integration theory inherits structural conditions which in

  2. Pulse-to-pulse variations in accreting X-ray pulsars

    Directory of Open Access Journals (Sweden)

    Kretschmar Peter

    2014-01-01

    Full Text Available In most accreting X-ray pulsars, the periodic signal is very clear and easily shows up as soon as data covering sufficient pulse periods (a few ten are available. The mean pulse profile is often quite typical for a given source and with minor variations repeated and recognisable across observations done years or even decades apart. At the time scale of individual pulses, significant pulse-to-pulse variations are commonly observed. While at low energies some of these variations might be explained by absorption, in the hard X-rays they will reflect changes in the accretion and subsequent emission. The amount of these variations appears to be quite different between sources and contains information about the surrounding material as well ass possibly interactions at the magnetosphere. We investigate such variations for a sample of well-known sources.

  3. Temporal and spatial variations in fly ash quality

    Science.gov (United States)

    Hower, J.C.; Trimble, A.S.; Eble, C.F.

    2001-01-01

    Fly ash quality, both as the amount of petrographically distinguishable carbons and in chemistry, varies in both time and space. Temporal variations are a function of a number of variables. Variables can include variations in the coal blend organic petrography, mineralogy, and chemistry; variations in the pulverization of the coal, both as a function of the coal's Hardgrove grindability index and as a function of the maintenance and settings of the pulverizers; and variations in the operating conditions of the boiler, including changes in the pollution control system. Spatial variation, as an instantaneous measure of fly ash characteristics, should not involve changes in the first two sets of variables listed above. Spatial variations are a function of the gas flow within the boiler and ducts, certain flow conditions leading to a tendency for segregation of the less-dense carbons in one portion of the gas stream. Caution must be applied in sampling fly ash. Samples from a single bin, or series of bins, m ay not be representative of the whole fly ash, providing a biased view of the nature of the material. Further, it is generally not possible to be certain about variation until the analysis of the ash is complete. ?? 2001 Elsevier Science B.V. All rights reserved.

  4. Periodical climate variations and their impact on Earth rotation for the last 800Kyr

    Science.gov (United States)

    Chapanov, Yavor; Gambis, Daniel

    2010-05-01

    The Earth rotation variations are highly affected by climatic variations associated with the glacial cycles in the late Pleistocene. The processes of glaciation, followed by ice melting, are connected with significant changes of the mean sea level. These processes redistribute great amount of water masses between oceans and ice sheets, which lead to changes of the axial moment of inertia and corresponding variations of the Universal Time UT1 and Length of Day LOD, according to the law of angular momentum conservation. The climatic variations for the last 800Kyr are analyzed by means of time series of temperature changes, determined by deuterium data from Antarctica ice core. Reconstructed glacial sea level variations for the last 380Kyr, determined by the sediments from the Red sea, are used, too. Common periodicities of the temperature and mean sea level variations are determined. Time series of the long-periodical UT1 and LOD oscillations for the last 380Kyr and 800Kyr are reconstructed by means of empirical hydrological model of global water redistribution between the ocean and ice sheets during the last glacial events.

  5. Variations in the service quality of medical practices.

    Science.gov (United States)

    Ly, Dan P; Glied, Sherry A

    2013-11-01

    To examine regional variation in the service quality of physician practices and to assess the association of this variation with the supply and organization of physicians. Secondary analyses of the Community Tracking Study (CTS) household and physician surveys. A total of 40,339 individuals who had seen a primary care physician because of an illness or injury and 17,345 generalist physicians across 4 survey time periods in 60 CTS sites were included. Service quality measures used were lag between making an appointment and seeing a physician, and wait time at the physician's office. Our supply measure was the physician-to-population ratio. Our organizational measure was the percentage of physicians in group practices. Multivariate regressions were performed to examine the relationship between service quality and the supply and organization of physicians. There was substantial variation in the service quality of physician visits across the country. For example, in 2003, the average wait time to see a doctor was 16 minutes in Milwaukee but more than 41 minutes in Miami; the average appointment lag for a sick visit in 2003 was 1.2 days in west-central Alabama but almost 6 days in Northwestern Washington. Service quality was not associated with the primary care physician-to-population ratio and had varying associations with the organization of practices. Cross-site variation in service quality of care in primary care has been large, persistent, and associated with the organization of practices. Areas with higher primary care physician-to-population ratios had longer, not shorter, appointment lags.

  6. Temporal variations in elemental concentrations of atmospheric aerosols in Mexico City

    International Nuclear Information System (INIS)

    Aldape U, F.

    1992-05-01

    Measurements are reported of elemental concentrations of airborne particulates in Mexico City and their time variation over a one-week period in the spring of 1988. Proton-induced X-ray emission analysis, PIXE, was used to analyse the atmospheric aerosols which were bombarded with 2.5 MeV protons from the 12 MV Tandem Van de Graaff accelerator at the National Institute of Nuclear Research, ININ. Variations in the elemental concentrations were observed over the time period studied. An intercomparison was made in the case of the element lead with PIXE results obtained at the Crocker Nuclear Laboratory, CNL, University of California for the same set of samples. Excellent agreement was obtained both for the time variation of the relative concentration and the absolute lead concentrations. These results give added confidence to the protocol adopted at ININ. (Author)

  7. Time-series analysis of foreign exchange rates using time-dependent pattern entropy

    Science.gov (United States)

    Ishizaki, Ryuji; Inoue, Masayoshi

    2013-08-01

    Time-dependent pattern entropy is a method that reduces variations to binary symbolic dynamics and considers the pattern of symbols in a sliding temporal window. We use this method to analyze the instability of daily variations in foreign exchange rates, in particular, the dollar-yen rate. The time-dependent pattern entropy of the dollar-yen rate was found to be high in the following periods: before and after the turning points of the yen from strong to weak or from weak to strong, and the period after the Lehman shock.

  8. Phylogenetic heritability of geographic range size in haematophagous ectoparasites: time of divergence and variation among continents.

    Science.gov (United States)

    Krasnov, Boris R; Shenbrot, Georgy I; van der Mescht, Luther; Warburton, Elizabeth M; Khokhlova, Irina S

    2018-04-12

    To understand existence, patterns and mechanisms behind phylogenetic heritability in the geographic range size (GRS) of parasites, we measured phylogenetic signal (PS) in the sizes of both regional (within a region) and continental (within a continent) geographic ranges of fleas in five regions. We asked whether (a) GRS is phylogenetically heritable and (b) the manifestation of PS varies between regions. We also asked whether geographic variation in PS reflects the effects of the environment's spatiotemporal stability (e.g. glaciation disrupting geographic ranges) or is associated with time since divergence (accumulation differences among species over time). Support for the former hypothesis would be indicated by stronger PS in southern than in northern regions, whereas support for the latter hypothesis would be shown by stronger PS in regions with a large proportion of species belonging to the derived lineages than in regions with a large proportion of species belonging to the basal lineages. We detected significant PS in both regional and continental GRSs of fleas from Canada and in continental GRS of fleas from Mongolia. No PS was found in the GRS of fleas from Australia and Southern Africa. Venezuelan fleas demonstrated significant PS in regional GRS only. Local Indicators of Phylogenetic Association detected significant local positive autocorrelations of GRS in some clades even in regions in which PS has not been detected across the entire phylogeny. This was mainly characteristic of younger taxa.

  9. PGG: An Online Pattern Based Approach for Stream Variation Management

    Institute of Scientific and Technical Information of China (English)

    Lu-An Tang; Bin Cui; Hong-Yan Li; Gao-Shan Miao; Dong-Qing Yang; Xin-Biao Zhou

    2008-01-01

    Many database applications require efficient processing of data streams with value variations and fiuctuant sampling frequency. The variations typically imply fundamental features of the stream and important domain knowledge of underlying objects. In some data streams, successive events seem to recur in a certain time interval, but the data indeed evolves with tiny differences as time elapses. This feature, so called pseudo periodicity, poses a new challenge to stream variation management. This study focuses on the online management for variations over such streams. The idea can be applied to many scenarios such as patient vital signal monitoring in medical applications. This paper proposes a new method named Pattern Growth Graph (PGG) to detect and manage variations over evolving streams with following features: 1) adopts the wave-pattern to capture the major information of data evolution and represent them compactly;2) detects the variations in a single pass over the stream with the help of wave-pattern matching algorithm; 3) only stores different segments of the pattern for incoming stream, and hence substantially compresses the data without losing important information; 4) distinguishes meaningful data changes from noise and reconstructs the stream with acceptable accuracy.Extensive experiments on real datasets containing millions of data items, as well as a prototype system, are carried out to demonstrate the feasibility and effectiveness of the proposed scheme.

  10. A three-component system incorporating Ppd-D1, copy number variation at Ppd-B1, and numerous small-effect quantitative trait loci facilitates adaptation of heading time in winter wheat cultivars of worldwide origin.

    Science.gov (United States)

    Würschum, Tobias; Langer, Simon M; Longin, C Friedrich H; Tucker, Matthew R; Leiser, Willmar L

    2018-06-01

    The broad adaptability of heading time has contributed to the global success of wheat in a diverse array of climatic conditions. Here, we investigated the genetic architecture underlying heading time in a large panel of 1,110 winter wheat cultivars of worldwide origin. Genome-wide association mapping, in combination with the analysis of major phenology loci, revealed a three-component system that facilitates the adaptation of heading time in winter wheat. The photoperiod sensitivity locus Ppd-D1 was found to account for almost half of the genotypic variance in this panel and can advance or delay heading by many days. In addition, copy number variation at Ppd-B1 was the second most important source of variation in heading, explaining 8.3% of the genotypic variance. Results from association mapping and genomic prediction indicated that the remaining variation is attributed to numerous small-effect quantitative trait loci that facilitate fine-tuning of heading to the local climatic conditions. Collectively, our results underpin the importance of the two Ppd-1 loci for the adaptation of heading time in winter wheat and illustrate how the three components have been exploited for wheat breeding globally. © 2018 John Wiley & Sons Ltd.

  11. A variational principle for Newton-Cartan theory

    International Nuclear Information System (INIS)

    Goenner, H.F.M.

    1984-01-01

    In the framework of a space-time theory of gravitation a variational principle is set up for the gravitational field equations and the equations of motion of matter. The general framework leads to Newton's equations of motion with an unspecified force term and, for irrotational motion, to a restriction on the propagation of the shear tensor along the streamlines of matter. The field equations obtained from the variation are weaker than the standard field equations of Newton-Cartan theory. An application to fluids with shear and bulk viscosity is given. (author)

  12. Tectono-metamorphic evolution of the Jomolhari massif: Variations in timing of syn-collisional metamorphism across western Bhutan

    Science.gov (United States)

    Regis, Daniele; Warren, Clare J.; Young, David; Roberts, Nick M. W.

    2014-03-01

    Our current understanding of the rates and timescales of mountain-building processes is largely based on information recorded in U-bearing accessory minerals such as monazite, which is found in low abundance but which hosts the majority of the trace element budget. Monazite petrochronology was used to investigate the timing of crustal melting in migmatitic metasedimentary rocks from the Jomolhari massif (NW Bhutan). The samples were metamorphosed at upper amphibolite to granulite facies conditions (~ 0.85 GPa, ~ 800 °C), after an earlier High-Pressure stage (P > 1.4 GPa), and underwent partial melting through dehydration melting reactions involving muscovite and biotite. In order to link the timing of monazite growth/dissolution to the pressure-temperature (P-T) evolution of the samples, we identified 'chemical fingerprints' in major and accessory phases that were used to back-trace specific metamorphic reactions. Variations in Eu anomaly and Ti in garnet were linked to the growth and dissolution of major phases (e.g. growth of K-feldspar and dehydration melting of muscovite/biotite). Differences in M/HREE and Y from garnet core to rim were instead related to apatite breakdown and monazite-forming reactions. Chemically zoned monazite crystals reacted multiple times during the metamorphic evolution suggesting that the Jomolhari massif experienced a prolonged high-temperature metamorphic evolution from 36 Ma to 18 Ma, significantly different from the P-T-time path recorded in other portions of the Greater Himalayan Sequence (GHS) in Bhutan. Our data demonstrate unequivocally that the GHS in Bhutan consists of units that experienced independent high-grade histories and that were juxtaposed across different tectonic structures during exhumation. The GHS may have been exhumed in response to (pulsed) mid-crustal flow but cannot be considered a coherent block.

  13. Variations in the magnetopause current layer

    Science.gov (United States)

    Laakso, H. E.; Middleton, H. R.

    2017-12-01

    We use multi-point observations from the Cluster spacecraft to investigate the variations in the magnetopause current layer. With help of the curlometer technique one can determine the magnetopause current and its variability. Most of the time the magnetopause location is moving back and forth, so during any given pass the current layer is crossed several times. We use such crossings to investigate the characteristics of the current layer as the solar wind pressure varies (and the magnetopause moves accordingly). In addition we take an advantage of the ambient electron measurements from the EDI experiment which have been calibrated against the PEACE electron spectrometer data. These data can be used to detect fast variations of 1 keV electrons at resolution of 1-100 ms. Overall, Cluster observations are highly complimentary to the MMS observations due to the polar orbit of the Cluster spacecraft which provide fast vertical profiles of the magnetopause current layer.

  14. Racial and Ethnic Variation in Time to Prostate Biopsy After an Elevated Screening Level of Serum Prostate-specific Antigen.

    Science.gov (United States)

    Reading, Stephanie R; Porter, Kimberly R; Hsu, Jin-Wen Y; Wallner, Lauren P; Loo, Ronald K; Jacobsen, Steven J

    2016-10-01

    To examine the racial and ethnic variation in time to prostate biopsy after an elevated screening level of serum prostate-specific antigen (PSA). Male members of the Kaiser Permanente of Southern California health plan, 45 years of age or older, with no history of prostate cancer or a prostate biopsy, and at least 1 elevated screening level of serum PSA between January 1, 1998 and December 31, 2007 were retrospectively identified (n = 59,506). All participants were passively followed via electronic health records until their time of prostate biopsy, death, membership disenrollment, or study conclusion (December 31, 2014), whichever was the initial event. Proportional hazard regression analyses were used to estimate the association between time from an elevated screening level of serum PSA to prostate biopsy, adjusting for age, benign prostatic hyperplasia, prostatitis, type 2 diabetes mellitus, hypertension, and Charlson Comorbidity Index score. Median time until biopsy was 0.6 years (214 days), with approximately 41% of participants receiving a prostate biopsy within the study period. Results from the fully adjusted analysis indicated that the non-Hispanic Asian or Pacific Islanders (hazard ratio: 1.10, 95% confidence interval: [1.04, 1.15]) and the non-Hispanic blacks (hazard ratio: 1.04, 95% confidence interval: [1.00, 1.08]) had a slightly shorter time to prostate biopsy after an elevated screening level of serum PSA compared to the non-Hispanic whites. These data suggest that, within an integrated healthcare organization, minimal differences exist between racial and ethnic subgroups in their time to prostate biopsy after an elevated screening level of serum PSA. Copyright © 2016. Published by Elsevier Inc.

  15. Time-series analysis of multiple foreign exchange rates using time-dependent pattern entropy

    Science.gov (United States)

    Ishizaki, Ryuji; Inoue, Masayoshi

    2018-01-01

    Time-dependent pattern entropy is a method that reduces variations to binary symbolic dynamics and considers the pattern of symbols in a sliding temporal window. We use this method to analyze the instability of daily variations in multiple foreign exchange rates. The time-dependent pattern entropy of 7 foreign exchange rates (AUD/USD, CAD/USD, CHF/USD, EUR/USD, GBP/USD, JPY/USD, and NZD/USD) was found to be high in the long period after the Lehman shock, and be low in the long period after Mar 2012. We compared the correlation matrix between exchange rates in periods of high and low of the time-dependent pattern entropy.

  16. Walk-free fast timing for a heavy-ion time-of-flight telescope

    International Nuclear Information System (INIS)

    Sanderson, N.E.; Fulton, B.R.; England, J.B.A.

    1976-01-01

    An intrinsic time resolution of 68 ps between two surface barrier detectors has been achieved. The timing walk associated with pulse height variations is reduced by means of computer correction to below 30 ps. (Auth.)

  17. Detecting Inter-Annual Variations in the Phenology of Evergreen Conifers Using Long-Term MODIS Vegetation Index Time Series

    Directory of Open Access Journals (Sweden)

    Laura Ulsig

    2017-01-01

    Full Text Available Long-term observations of vegetation phenology can be used to monitor the response of terrestrial ecosystems to climate change. Satellite remote sensing provides the most efficient means to observe phenological events through time series analysis of vegetation indices such as the Normalized Difference Vegetation Index (NDVI. This study investigates the potential of a Photochemical Reflectance Index (PRI, which has been linked to vegetation light use efficiency, to improve the accuracy of MODIS-based estimates of phenology in an evergreen conifer forest. Timings of the start and end of the growing season (SGS and EGS were derived from a 13-year-long time series of PRI and NDVI based on a MAIAC (multi-angle implementation of atmospheric correction processed MODIS dataset and standard MODIS NDVI product data. The derived dates were validated with phenology estimates from ground-based flux tower measurements of ecosystem productivity. Significant correlations were found between the MAIAC time series and ground-estimated SGS (R2 = 0.36–0.8, which is remarkable since previous studies have found it difficult to observe inter-annual phenological variations in evergreen vegetation from satellite data. The considerably noisier NDVI product could not accurately predict SGS, and EGS could not be derived successfully from any of the time series. While the strongest relationship overall was found between SGS derived from the ground data and PRI, MAIAC NDVI exhibited high correlations with SGS more consistently (R2 > 0.6 in all cases. The results suggest that PRI can serve as an effective indicator of spring seasonal transitions, however, additional work is necessary to confirm the relationships observed and to further explore the usefulness of MODIS PRI for detecting phenology.

  18. Genetic variation in natural honeybee populations, Apis mellifera capensis

    Science.gov (United States)

    Hepburn, Randall; Neumann, Peter; Radloff, Sarah E.

    2004-09-01

    Genetic variation in honeybee, Apis mellifera, populations can be considerably influenced by breeding and commercial introductions, especially in areas with abundant beekeeping. However, in southern Africa apiculture is based on the capture of wild swarms, and queen rearing is virtually absent. Moreover, the introduction of European subspecies constantly failed in the Cape region. We therefore hypothesize a low human impact on genetic variation in populations of Cape honeybees, Apis mellifera capensis. A novel solution to studying genetic variation in honeybee populations based on thelytokous worker reproduction is applied to test this hypothesis. Environmental effects on metrical morphological characters of the phenotype are separated to obtain a genetic residual component. The genetic residuals are then re-calculated as coefficients of genetic variation. Characters measured included hair length on the abdomen, width and length of wax plate, and three wing angles. The data show for the first time that genetic variation in Cape honeybee populations is independent of beekeeping density and probably reflects naturally occurring processes such as gene flow due to topographic and climatic variation on a microscale.

  19. TRANSIT TIMING VARIATION MEASUREMENTS OF WASP-12b AND QATAR-1b: NO EVIDENCE OF ADDITIONAL PLANETS

    Energy Technology Data Exchange (ETDEWEB)

    Collins, Karen A.; Stassun, Keivan G. [Department of Physics and Astronomy, Vanderbilt University, Nashville, TN 37235 (United States); Kielkopf, John F. [Department of Physics and Astronomy, University of Louisville, Louisville, KY 40292 (United States)

    2017-02-01

    WASP-12b and Qatar-1b are transiting hot Jupiters for which previous works have suggested the presence of transit timing variations (TTVs) indicative of additional bodies in these systems—an Earth-mass planet in WASP-12 and a brown-dwarf mass object in Qatar-1. Here, we present 23 new WASP-12b and 18 new Qatar-1b complete (or nearly complete) transit observations. We perform global system fits to all of our light curves for each system, as well as RV and stellar spectroscopic parameters from the literature. The global fits provide refined system parameters and uncertainties for each system, including precise transit center times for each transit. The transit model residuals of the combined and five minute binned light curves have an rms of 183 and 255 parts per million (ppm) for WASP-12b and Qatar-1b, respectively. Most of the WASP-12b system parameter values from this work are consistent with values from previous studies, but have ∼40%–50% smaller uncertainties. Most of the Qatar-1b system parameter values and uncertainties from this work are consistent with values recently reported in the literature. We find no convincing evidence for sinusoidal TTVs with a semi-amplitude of more than ∼35 and ∼25 s in the WASP-12b and Qatar-1b systems, respectively.

  20. Global variations and time trends in the prevalence of childhood myopia, a systematic review and quantitative meta-analysis:implications for aetiology and early prevention

    OpenAIRE

    Rudnicka, Alicja R.; Kapetanakis, Venediktos V.; Wathern, Andrea K.; Logan, Nicola S.; Gilmartin, Bernard; Whincup, Peter H.; Cook, Derek G.; Owen, Christopher G.

    2016-01-01

    The aim of this review was to quantify the global variation in childhood myopia prevalence over time taking account of demographic and study design factors. A systematic review identified population-based surveys with estimates of childhood myopia prevalence published by February 2015. Multilevel binomial logistic regression of log odds of myopia was used to examine the association with age, gender, urban versus rural setting and survey year, among populations of different ethnic origins, adj...

  1. A variational approach to the Gross-Neveu model

    International Nuclear Information System (INIS)

    Mishra, H.; Misra, P.; Mishra, A.

    1988-01-01

    The authors solve the instability of perturbative vacuum of Gross-Neveu model. They use a variational method. The analysis is nonperturbative as it uses only equal time commmutator/anticommutator algebra

  2. Ethnic variations of sweet preferences in Malaysian children: A pilot study

    OpenAIRE

    Jaafar, N.; Razak, I. A.

    2017-01-01

    Diet and sugar eating habits, in particular sweet preference levels, are gradually nurtured over time by culturally accepted dietary norms. The dietary habits of Malaysia's three main ethnic groups are distinctively different from each other and expectedly, many studies have discovered significant ethnic variations in caries experience. In order to guide further research work into the causes of these variations, this pilot study was designed to establish whether ethnic variations exist in swe...

  3. Time-dependent variation of the neutron multiplication factor in spent fuel storage

    Energy Technology Data Exchange (ETDEWEB)

    Leotlela, M.J. [Univ. of the Witwatersrand, Johannesburg (South Africa). School of Physics; Eskom, Johannesburg (South Africa). Regulations and Licensing, Koeberg Operating Unit; Olifant, T. [Cape Town Univ. (South Africa). Dept. of Electrical Engineering and Nuclear Power Studies; Koeberg Nuclear Power Station, Cape Town (South Africa). Operating Dept.; Petr, I. [Univ. of the Witwatersrand, Johannesburg (South Africa). School of Physics

    2017-12-15

    After spent fuel assemblies have been discharged from the reactor, reactivity will fluctuate as the cooling period progresses because of changes in the number density of fissile nuclides and neutron absorber nuclides. The purpose of this project was (1) to quantify the contribution of each individual nuclide to the reactivity of the fissile system, (2) to identify nuclides that are responsible for the fluctuation in reactivity, and (3) to determine the effect of the number of nuclides on reactivity. This paper will present the results of the study of the behaviour of the k{sub eff} with respect to variation in the duration of the cooling period during storage.

  4. Life time fatality risk assessment due to variation of indoor radon concentration in dwellings in western Haryana, India

    International Nuclear Information System (INIS)

    Kansal, Sandeep; Mehra, Rohit; Singh, N.P.

    2012-01-01

    Indoor radon measurements in 60 dwellings belonging to 12 villages of Sirsa, Fatehbad and Hisar districts of western Haryana, India, have been carried out, using LR-115 type II cellulose nitrate films in the bare mode. The annual average indoor radon value in the studied area varies from 76.00 to 115.46 Bq m −3 , which is well within the recommended action level 200–300 Bq m −3 (). The winter/summer ratio of indoor radon ranges from 0.78 to 2.99 with an average of 1.52. The values of annual average dose received by the residents and Life time fatality risk assessment due to variation of indoor radon concentration in dwellings of studied area suggests that there is no significance threat to the human beings due to the presence of natural radon in the dwellings. - Highlights: ► The radon concentration values in the dwellings are 2–3 times more than the world average of 40 Bq m −3 . ► These values are lower than the recommended action level of 200–300 Bq m −3 (). ► The annual effective dose is less than the recommended action level of 3–10 mSv per year (). ► The values of life time fatality risk determined for the studied area are within safe standards. ► There is no significant threat to the human beings due to the presence of natural radon in the dwellings.

  5. Gravity Variations Related to Earthquakes in the BTTZ Region in China

    Science.gov (United States)

    Zheng, J.; Liu, K.; Lu, H.; Liu, D.; Chen, Y.; Kuo, J. T.

    2006-05-01

    Temporal variations of gravity before and after earthquakes have been observed since 1960s, but a definitive conclusion has not been reached concerning the relationship between the gravity variation and earthquake occurrence. Since 1980, the first US/China joint scientific research project has been monitoring micro-gravity variations related to earthquakes in the Beijing-Tianjin-Tangshan-Zhangjiekou (BTTZ) region in China through the establishment of a network of spatially and temporally continuous and discrete gravity stations. With the data of both temporally continuous and discrete data of gravity variations accumulated and analyzed, a general picture of gravity variation associated with the seismogenesis and occurrence of earthquakes in the BTTZ region has been emerged clearly. Some of the major findings are 1. Gravity variations before and after earthquakes exist spatially and temporally; 2. Gravity variation data of temporally continuous measurements are essential to monitor the variations of gravity related to earthquakes unless temporally discrete gravity data are made in very close time intervals. 3. Concept of epicentroid and hypocentroid with respect to the maximum values of gravity variation is valid and has been experimentally verified; 4. The gravity variations related to the occurrence of earthquakes in the BTTZ region for the magnitudes of 4-5 earthquakes support the proposed "combined dilatation model", i.e., a dual-dilatancy of diffusion dilatancy (D/D) and the fault zone dilatancy (FZD) models; 5. Although the temporally discrete gravity variation data were collected in a larger time interval of about six months in the BTTZ region, these gravity variation data, in some cases, indicate that these variations are related to the occurrence of earthquakes; 7. Subsurface fluids do play a very important role in the gravity variations that have not been recognized and emphasized previously; 7. With the temporally continuous gravity variation data, the

  6. 4D segmentation of brain MR images with constrained cortical thickness variation.

    Directory of Open Access Journals (Sweden)

    Li Wang

    Full Text Available Segmentation of brain MR images plays an important role in longitudinal investigation of developmental, aging, disease progression changes in the cerebral cortex. However, most existing brain segmentation methods consider multiple time-point images individually and thus cannot achieve longitudinal consistency. For example, cortical thickness measured from the segmented image will contain unnecessary temporal variations, which will affect the time related change pattern and eventually reduce the statistical power of analysis. In this paper, we propose a 4D segmentation framework for the adult brain MR images with the constraint of cortical thickness variations. Specifically, we utilize local intensity information to address the intensity inhomogeneity, spatial cortical thickness constraint to maintain the cortical thickness being within a reasonable range, and temporal cortical thickness variation constraint in neighboring time-points to suppress the artificial variations. The proposed method has been tested on BLSA dataset and ADNI dataset with promising results. Both qualitative and quantitative experimental results demonstrate the advantage of the proposed method, in comparison to other state-of-the-art 4D segmentation methods.

  7. Is there much variation in variation? Revisiting statistics of small area variation in health services research

    Directory of Open Access Journals (Sweden)

    Ibáñez Berta

    2009-04-01

    Full Text Available Abstract Background The importance of Small Area Variation Analysis for policy-making contrasts with the scarcity of work on the validity of the statistics used in these studies. Our study aims at 1 determining whether variation in utilization rates between health areas is higher than would be expected by chance, 2 estimating the statistical power of the variation statistics; and 3 evaluating the ability of different statistics to compare the variability among different procedures regardless of their rates. Methods Parametric bootstrap techniques were used to derive the empirical distribution for each statistic under the hypothesis of homogeneity across areas. Non-parametric procedures were used to analyze the empirical distribution for the observed statistics and compare the results in six situations (low/medium/high utilization rates and low/high variability. A small scale simulation study was conducted to assess the capacity of each statistic to discriminate between different scenarios with different degrees of variation. Results Bootstrap techniques proved to be good at quantifying the difference between the null hypothesis and the variation observed in each situation, and to construct reliable tests and confidence intervals for each of the variation statistics analyzed. Although the good performance of Systematic Component of Variation (SCV, Empirical Bayes (EB statistic shows better behaviour under the null hypothesis, it is able to detect variability if present, it is not influenced by the procedure rate and it is best able to discriminate between different degrees of heterogeneity. Conclusion The EB statistics seems to be a good alternative to more conventional statistics used in small-area variation analysis in health service research because of its robustness.

  8. A variational model for propagation time, volumetric and synchronicity optimization in the spinal cord axon network, and a method for testing it

    Science.gov (United States)

    Mota, Bruno

    2014-03-01

    Most information in the central nervous system in general and the (simpler) spinal cord in particular, is transmitted along bundles of parallel axons. Each axon's transmission time increases linearly with length and decreases as a power law of caliber. Therefore, evolution must find a distribution of axonal numbers, lengths and calibers that balances the various tradeoffs between gains in propagation time, signal throughput and synchronicity, against volumetric and metabolic costs. Here I apply a variational method to calculate the distribution of axonal caliber in the spinal cord as a function of axonal length, that minimizes the average axonal signal propagation time, subject to the constraints of white matter total volume and the variance of propagation times, and allowing for arbitrary fiber priorities and end-points. The Lagrange multipliers obtained thereof can be naturally interpreted as 'exchange rates', e.g., how much evolution is willing to pay, in white matter added volume, per unit time decrease of propagation time. This is, to my knowledge, the first model that quantifies explicitly these evolutionary tradeoffs, and can obtain them empirically by measuring the distribution of axonal calibers. We are in the process of doing so using the isotropic fractionator method. I thank FAPERJ for financial support.

  9. Quadrature representation of finite element variational forms

    DEFF Research Database (Denmark)

    Ølgaard, Kristian Breum; Wells, Garth N.

    2012-01-01

    This chapter addresses the conventional run-time quadrature approach for the numerical integration of local element tensors associated with finite element variational forms, and in particular automated optimizations that can be performed to reduce the number of floating point operations...

  10. Heterogeneous treatment in the variational nodal method

    International Nuclear Information System (INIS)

    Fanning, T.H.

    1995-01-01

    The variational nodal transport method is reduced to its diffusion form and generalized for the treatment of heterogeneous nodes while maintaining nodal balances. Adapting variational methods to heterogeneous nodes requires the ability to integrate over a node with discontinuous cross sections. In this work, integrals are evaluated using composite gaussian quadrature rules, which permit accurate integration while minimizing computing time. Allowing structure within a nodal solution scheme avoids some of the necessity of cross section homogenization, and more accurately defines the intra-nodal flux shape. Ideally, any desired heterogeneity can be constructed within the node; but in reality, the finite set of basis functions limits the practical resolution to which fine detail can be defined within the node. Preliminary comparison tests show that the heterogeneous variational nodal method provides satisfactory results even if some improvements are needed for very difficult, configurations

  11. Variation of tumour radiosensitivity with time after anaesthetic

    Energy Technology Data Exchange (ETDEWEB)

    Nias, A.H.W.; Perry, P.M. (Saint Thomas' Hospital, London (UK). Richard Dimbleby Research Lab.)

    1989-10-01

    Transplanted C{sub 3}H mouse mammary tumours were given single doses of X irradiation in air or oxygen at 1 atmosphere (atm) with or without anaesthesia of recipient mice by ketamine and diazepam. The radiation response to single doses of 25 Gy was determined in terms of time taken to reach 3.5 times the treatment volume. Under all conditions there was more growth delay in tumours irradiated in pure oxygen than in air. In air and oxygen, the radiation response for anaestheitized animals tended to fall below the level for non-anaesthetized ones when only 10 min had elapsed after administration of anaesthesia. After 25 min, the response in air was back to the level for non-anaesthetized animals but the oxygen group then showed significant sensitization compared with the oxygen without anaesthetic group. After 40 min, the air group showed slight sensitization and the oxygen group still showed significant sensitization by the anaesthetic. (author).

  12. Short-term variations of Icelandic ice cap mass inferred from cGPS coordinate time series

    DEFF Research Database (Denmark)

    Compton, Kathleen; Bennett, Richard A.; Hreinsdóttir, Sigrún

    2017-01-01

    As the global climate changes, understanding short-term variations in water storage is increasingly important. Continuously operating Global Positioning System (cGPS) stations in Iceland record annual periodic motion—the elastic response to winter accumulation and spring melt seasons—with peak-to...

  13. Photospheric Ca and Mg line-strength variations in G29-38

    International Nuclear Information System (INIS)

    Hippel, Ted von; Thompson, Susan E; Reach, W T; Mullally, F; Kilic, Mukremin; Nitta, Atsuko

    2009-01-01

    Temporal variations in metal-line strengths in H-atmosphere white dwarfs hold the potential to test the timescales of gravitational settling theory. These short timescales, in turn, require that DAZs are currently accreting. Such temporal variations would also indicate that accretion from a circumstellar dust disk can be episodic. We are compiling increasing evidence for time-variable Ca and Mg line-strength variations in the best studied DAZ, G29-38. Our evidence to date supports the gravitational settling timescales of Koester and Wilken (2006) and episodic accretion from G29-38's debris disk. Furthermore, we have detected evidence for time-variable accretion with a timescale = 24 hours, and typical variability of ∼4% during the 100 days of our autumn 2007 monitoring campaign.

  14. Photospheric Ca and Mg line-strength variations in G29-38

    Energy Technology Data Exchange (ETDEWEB)

    Hippel, Ted von [Physics Department, Siena College, Loudonville, NY (United States); Thompson, Susan E [Department of Physics and Astronomy, University of Delaware, Newark, DE (United States); Reach, W T [IPAC, California Institute of Technology, Pasadena, CA (United States); Mullally, F [Department of Astronomy, Princeton University, Princeton, NJ (United States); Kilic, Mukremin [Center for Astrophysics, Harvard University, Cambridge, MA (United States); Nitta, Atsuko, E-mail: tvonhippel@siena.ed, E-mail: sthomp@physics.udel.ed, E-mail: reach@ipac.caltech.ed, E-mail: fergal@astro.princeton.ed, E-mail: kilic@astronomy.ohio-state.ed, E-mail: anitta@gemini.ed [Gemini Observatory, Hilo, HI (United States)

    2009-06-01

    Temporal variations in metal-line strengths in H-atmosphere white dwarfs hold the potential to test the timescales of gravitational settling theory. These short timescales, in turn, require that DAZs are currently accreting. Such temporal variations would also indicate that accretion from a circumstellar dust disk can be episodic. We are compiling increasing evidence for time-variable Ca and Mg line-strength variations in the best studied DAZ, G29-38. Our evidence to date supports the gravitational settling timescales of Koester and Wilken (2006) and episodic accretion from G29-38's debris disk. Furthermore, we have detected evidence for time-variable accretion with a timescale = 24 hours, and typical variability of approx4% during the 100 days of our autumn 2007 monitoring campaign.

  15. On the Total Variation Distance of Semi-Markov Chains

    DEFF Research Database (Denmark)

    Bacci, Giorgio; Bacci, Giovanni; Larsen, Kim Guldstrand

    2015-01-01

    Semi-Markov chains (SMCs) are continuous-time probabilistic transition systems where the residence time on states is governed by generic distributions on the positive real line. This paper shows the tight relation between the total variation distance on SMCs and their model checking problem over...

  16. Design for Corrosion Control of Aviation Fuel Storage and Distribution Systems

    Science.gov (United States)

    1975-06-01

    may be painted, or oiled. The paint usually used is an asphalt varnish applied in one coat in accor- dance with Federal Specification TT-V-51A...Fluorocarbon plastics -- Plastics based on resins made by the polymeri- zation of monomers composed of fluorine and carbon only. Film thickness -- Depth...natural or synthetic, contained in varnishes , lacquers and paints; the film former. -- A solid, semisolid, or pseudosolid organic material which has an

  17. Gauge properties of the guiding center variational symplectic integrator

    International Nuclear Information System (INIS)

    Squire, J.; Tang, W. M.; Qin, H.

    2012-01-01

    Variational symplectic algorithms have recently been developed for carrying out long-time simulation of charged particles in magnetic fields [H. Qin and X. Guan, Phys. Rev. Lett. 100, 035006 (2008); H. Qin, X. Guan, and W. Tang, Phys. Plasmas (2009); J. Li, H. Qin, Z. Pu, L. Xie, and S. Fu, Phys. Plasmas 18, 052902 (2011)]. As a direct consequence of their derivation from a discrete variational principle, these algorithms have very good long-time energy conservation, as well as exactly preserving discrete momenta. We present stability results for these algorithms, focusing on understanding how explicit variational integrators can be designed for this type of system. It is found that for explicit algorithms, an instability arises because the discrete symplectic structure does not become the continuous structure in the t→0 limit. We examine how a generalized gauge transformation can be used to put the Lagrangian in the “antisymmetric discretization gauge,” in which the discrete symplectic structure has the correct form, thus eliminating the numerical instability. Finally, it is noted that the variational guiding center algorithms are not electromagnetically gauge invariant. By designing a model discrete Lagrangian, we show that the algorithms are approximately gauge invariant as long as A and φ are relatively smooth. A gauge invariant discrete Lagrangian is very important in a variational particle-in-cell algorithm where it ensures current continuity and preservation of Gauss’s law [J. Squire, H. Qin, and W. Tang (to be published)].

  18. Seasonal variations of volcanic eruption frequencies

    Science.gov (United States)

    Stothers, Richard B.

    1989-01-01

    Do volcanic eruptions have a tendency to occur more frequently in the months of May and June? Some past evidence suggests that they do. The present study, based on the new eruption catalog of Simkin et al.(1981), investigates the monthly statistics of the largest eruptions, grouped according to explosive magnitude, geographical latitude, and year. At the 2-delta level, no month-to-month variations in eruption frequency are found to be statistically significant. Examination of previously published month-to-month variations suggests that they, too, are not statistically significant. It is concluded that volcanism, at least averaged over large portions of the globe, is probably not periodic on a seasonal or annual time scale.

  19. Y-Chromosome variation in hominids: intraspecific variation is limited to the polygamous chimpanzee.

    Directory of Open Access Journals (Sweden)

    Gabriele Greve

    Full Text Available BACKGROUND: We have previously demonstrated that the Y-specific ampliconic fertility genes DAZ (deleted in azoospermia and CDY (chromodomain protein Y varied with respect to copy number and position among chimpanzees (Pan troglodytes. In comparison, seven Y-chromosomal lineages of the bonobo (Pan paniscus, the chimpanzee's closest living relative, showed no variation. We extend our earlier comparative investigation to include an analysis of the intraspecific variation of these genes in gorillas (Gorilla gorilla and orangutans (Pongo pygmaeus, and examine the resulting patterns in the light of the species' markedly different social and mating behaviors. METHODOLOGY/PRINCIPAL FINDINGS: Fluorescence in situ hybridization analysis (FISH of DAZ and CDY in 12 Y-chromosomal lineages of western lowland gorilla (G. gorilla gorilla and a single lineage of the eastern lowland gorilla (G. beringei graueri showed no variation among lineages. Similar findings were noted for the 10 Y-chromosomal lineages examined in the Bornean orangutan (Pongo pygmaeus, and 11 Y-chromosomal lineages of the Sumatran orangutan (P. abelii. We validated the contrasting DAZ and CDY patterns using quantitative real-time polymerase chain reaction (qPCR in chimpanzee and bonobo. CONCLUSION/SIGNIFICANCE: High intraspecific variation in copy number and position of the DAZ and CDY genes is seen only in the chimpanzee. We hypothesize that this is best explained by sperm competition that results in the variant DAZ and CDY haplotypes detected in this species. In contrast, bonobos, gorillas and orangutans-species that are not subject to sperm competition-showed no intraspecific variation in DAZ and CDY suggesting that monoandry in gorillas, and preferential female mate choice in bonobos and orangutans, probably permitted the fixation of a single Y variant in each taxon. These data support the notion that the evolutionary history of a primate Y chromosome is not simply encrypted in its DNA

  20. Short and long periodic atmospheric variations between 25 and 200 km

    Science.gov (United States)

    Justus, C. G.; Woodrum, A.

    1973-01-01

    Previously collected data on atmospheric pressure, density, temperature and winds between 25 and 200 km from sources including Meteorological Rocket Network data, ROBIN falling sphere data, grenade release and pitot tube data, meteor winds, chemical release winds, satellite data, and others were analyzed by a daily difference method and results on the distribution statistics, magnitude, and spatial structure of gravity wave and planetary wave atmospheric variations are presented. Time structure of the gravity wave variations were determined by the analysis of residuals from harmonic analysis of time series data. Planetary wave contributions in the 25-85 km range were discovered and found to have significant height and latitudinal variation. Long period planetary waves, and seasonal variations were also computed by harmonic analysis. Revised height variations of the gravity wave contributions in the 25 to 85 km height range were computed. An engineering method and design values for gravity wave magnitudes and wave lengths are given to be used for such tasks as evaluating the effects on the dynamical heating, stability and control of spacecraft such as the space shuttle vehicle in launch or reentry trajectories.

  1. Circadian Variation Of Stroke Onset

    Directory of Open Access Journals (Sweden)

    Kamath vasantha

    2003-01-01

    Full Text Available Diurnal variations in various physiological and biochemical functions and certain pathological events like myocardial infarction and stroke have been documented. We studied prospectively one hundred and seven patients of acute onset stroke confirmed by computed tomography for the exact time of onset, risk factors and type of stroke. Patients who were unclear of time of onset and with a diagnosis of cerebral venous thrombosis or sub-arachnoid hemorrhage were excluded. Infarction was detected in 71 patients and hemorrhage in 33 patients. Men out numbered women (1:6:1. Hypertension was more frequent in hemorrhage in the morning time (5 AM-12 noon and more infarction between 12-6 pm. However there was no relation between the time of onset of stroke and various risk-factors of stroke.

  2. Delay Variation Model with Two Service Queues

    Directory of Open Access Journals (Sweden)

    Filip Rezac

    2010-01-01

    Full Text Available Delay in VoIP technology is very unpleasant issue and therefore a voice packets prioritization must be ensured. To maintain the high call quality a maximum information delivery time from the sender to the recipient is set to 150 ms. This paper focuses on the design of a mathematical model of end-to-end delay of a VoIP connection, in particular on a delay variation. It describes all partial delay components and mechanisms, their generation, facilities and mathematical formulations. A new approach to the delay variation model is presented and its validation has been done by experimention.

  3. Effects of time-dependent photoionization on interstellar pickup atoms

    International Nuclear Information System (INIS)

    Isenberg, P.A.; Lee, M.A.

    1995-01-01

    We present an analytical model for the density variations of interstellar pickup ions in the solar wind due to a time-dependent variation in the photoionization rate, our model predicts a pickup ion density enhancement lasting for a time of the order of the duration of the increase plus the solar wind convection time to the observation point. If the photoionization rate returns to its initial value, this enhancement is followed by a decreased pickup ion density resulting from a depleted interstellar neutral particle density. In the absence of further variations in the photoionization rate, the pickup ion density recovers on a time which scales as the radial position of the observation point divided by the inflow speed of the neutral particles. Gradual variations in the photoionization rate result in a pickup ion density which tends to track the ionization rate, though the density variations are smoothed and delayed in time due to the solar wind convection of ions picked up at points closer to the Sun. 27 refs., 4 figs

  4. Near Real-Time Assessment of Anatomic and Dosimetric Variations for Head and Neck Radiation Therapy via Graphics Processing Unit–based Dose Deformation Framework

    Energy Technology Data Exchange (ETDEWEB)

    Qi, X. Sharon, E-mail: xqi@mednet.ucla.edu [Department of Radiation Oncology, University of California Los Angeles, Los Angeles, California (United States); Santhanam, Anand; Neylon, John; Min, Yugang; Armstrong, Tess; Sheng, Ke [Department of Radiation Oncology, University of California Los Angeles, Los Angeles, California (United States); Staton, Robert J.; Pukala, Jason [Department of Radiation Oncology, UF Health Cancer Center - Orlando Health, Orlando, Florida (United States); Pham, Andrew; Low, Daniel A.; Lee, Steve P. [Department of Radiation Oncology, University of California Los Angeles, Los Angeles, California (United States); Steinberg, Michael; Manon, Rafael [Department of Radiation Oncology, UF Health Cancer Center - Orlando Health, Orlando, Florida (United States); Chen, Allen M.; Kupelian, Patrick [Department of Radiation Oncology, University of California Los Angeles, Los Angeles, California (United States)

    2015-06-01

    Purpose: The purpose of this study was to systematically monitor anatomic variations and their dosimetric consequences during intensity modulated radiation therapy (IMRT) for head and neck (H&N) cancer by using a graphics processing unit (GPU)-based deformable image registration (DIR) framework. Methods and Materials: Eleven IMRT H&N patients undergoing IMRT with daily megavoltage computed tomography (CT) and weekly kilovoltage CT (kVCT) scans were included in this analysis. Pretreatment kVCTs were automatically registered with their corresponding planning CTs through a GPU-based DIR framework. The deformation of each contoured structure in the H&N region was computed to account for nonrigid change in the patient setup. The Jacobian determinant of the planning target volumes and the surrounding critical structures were used to quantify anatomical volume changes. The actual delivered dose was calculated accounting for the organ deformation. The dose distribution uncertainties due to registration errors were estimated using a landmark-based gamma evaluation. Results: Dramatic interfractional anatomic changes were observed. During the treatment course of 6 to 7 weeks, the parotid gland volumes changed up to 34.7%, and the center-of-mass displacement of the 2 parotid glands varied in the range of 0.9 to 8.8 mm. For the primary treatment volume, the cumulative minimum and mean and equivalent uniform doses assessed by the weekly kVCTs were lower than the planned doses by up to 14.9% (P=.14), 2% (P=.39), and 7.3% (P=.05), respectively. The cumulative mean doses were significantly higher than the planned dose for the left parotid (P=.03) and right parotid glands (P=.006). The computation including DIR and dose accumulation was ultrafast (∼45 seconds) with registration accuracy at the subvoxel level. Conclusions: A systematic analysis of anatomic variations in the H&N region and their dosimetric consequences is critical in improving treatment efficacy. Nearly real-time

  5. Quantum Variational Calculus

    OpenAIRE

    Malinowska , Agnieszka B.; Torres , Delfim

    2014-01-01

    International audience; Introduces readers to the treatment of the calculus of variations with q-differences and Hahn difference operators Provides the reader with the first extended treatment of quantum variational calculus Shows how the techniques described can be applied to economic models as well as other mathematical systems This Brief puts together two subjects, quantum and variational calculi by considering variational problems involving Hahn quantum operators. The main advantage of it...

  6. Short-time-scale Doppler and intensity variations in the spectrum of SS 433

    International Nuclear Information System (INIS)

    Wagner, R.M.; Newsom, G.H.; Foltz, C.B.; Byard, P.L.

    1981-01-01

    Spectroscopic observations of SS 433 were obtained on ten consecutive nights in 1981 May. Measurements of the equivalent widths of the spectral lines and Doppler shifts of the moving lines are presented. Not only does the 6-day period in the wavelengths of the moving lines appear quite clearly, but the data strongly suggest that this period is decreasing at a rate of (3.0 +- 1.1) x 10 -5 days/day. In addition, large equivalent width variations of the stationary lines are observed

  7. The influence of task variation on manifestation of fatigue is ambiguous : a literature review

    NARCIS (Netherlands)

    Luger, T.; Bosch, T.; Veeger, D.; Looze, M. de

    2014-01-01

    Task variation has been proposed to reduce shoulder fatigue resulting from repetitive hand-arm tasks. This review analyses the effect of task variation, both 'temporal (i.e. change of work-rest ratio)' and 'activity (i.e. job rotation)' variation, on physiological responses, endurance time (ET) and

  8. Temporal variations in the potential hydrological performance of extensive green roof systems

    Science.gov (United States)

    De-Ville, Simon; Menon, Manoj; Stovin, Virginia

    2018-03-01

    Existing literature provides contradictory information about variation in potential green roof hydrological performance over time. This study has evaluated a long-term hydrological monitoring record from a series of extensive green roof test beds to identify long-term evolutions and sub-annual (seasonal) variations in potential hydrological performance. Monitoring of nine differently-configured extensive green roof test beds took place over a period of 6 years in Sheffield, UK. Long-term evolutions and sub-annual trends in maximum potential retention performance were identified through physical monitoring of substrate field capacity over time. An independent evaluation of temporal variations in detention performance was undertaken through the fitting of reservoir-routing model parameters. Aggregation of the resulting retention and detention variations permitted the prediction of extensive green roof hydrological performance in response to a 1-in-30-year 1-h summer design storm for Sheffield, UK, which facilitated the comparison of multi and sub-annual hydrological performance variations. Sub-annual (seasonal) variation was found to be significantly greater than long-term evolution. Potential retention performance increased by up to 12% after 5-years, whilst the maximum sub-annual variation in potential retention was 27%. For vegetated roof configurations, a 4% long-term improvement was observed for detention performance, compared to a maximum 63% sub-annual variation. Consistent long-term reductions in detention performance were observed in unvegetated roof configurations, with a non-standard expanded-clay substrate experiencing a 45% reduction in peak attenuation over 5-years. Conventional roof configurations exhibit stable long-term hydrological performance, but are nonetheless subject to sub-annual variation.

  9. Sources of Variation in Sweat Chloride Measurements in Cystic Fibrosis

    Science.gov (United States)

    Blackman, Scott M.; Raraigh, Karen S.; Corvol, Harriet; Rommens, Johanna M.; Pace, Rhonda G.; Boelle, Pierre-Yves; McGready, John; Sosnay, Patrick R.; Strug, Lisa J.; Knowles, Michael R.; Cutting, Garry R.

    2016-01-01

    Rationale: Expanding the use of cystic fibrosis transmembrane conductance regulator (CFTR) potentiators and correctors for the treatment of cystic fibrosis (CF) requires precise and accurate biomarkers. Sweat chloride concentration provides an in vivo assessment of CFTR function, but it is unknown the degree to which CFTR mutations account for sweat chloride variation. Objectives: To estimate potential sources of variation for sweat chloride measurements, including demographic factors, testing variability, recording biases, and CFTR genotype itself. Methods: A total of 2,639 sweat chloride measurements were obtained in 1,761 twins/siblings from the CF Twin-Sibling Study, French CF Modifier Gene Study, and Canadian Consortium for Genetic Studies. Variance component estimation was performed by nested mixed modeling. Measurements and Main Results: Across the tested CF population as a whole, CFTR gene mutations were found to be the primary determinant of sweat chloride variability (56.1% of variation) with contributions from variation over time (e.g., factors related to testing on different days; 13.8%), environmental factors (e.g., climate, family diet; 13.5%), other residual factors (e.g., test variability; 9.9%), and unique individual factors (e.g., modifier genes, unique exposures; 6.8%) (likelihood ratio test, P < 0.001). Twin analysis suggested that modifier genes did not play a significant role because the heritability estimate was negligible (H2 = 0; 95% confidence interval, 0.0–0.35). For an individual with CF, variation in sweat chloride was primarily caused by variation over time (58.1%) with the remainder attributable to residual/random factors (41.9%). Conclusions: Variation in the CFTR gene is the predominant cause of sweat chloride variation; most of the non-CFTR variation is caused by testing variability and unique environmental factors. If test precision and accuracy can be improved, sweat chloride measurement could be a valuable biomarker

  10. Time-varying BRDFs.

    Science.gov (United States)

    Sun, Bo; Sunkavalli, Kalyan; Ramamoorthi, Ravi; Belhumeur, Peter N; Nayar, Shree K

    2007-01-01

    The properties of virtually all real-world materials change with time, causing their bidirectional reflectance distribution functions (BRDFs) to be time varying. However, none of the existing BRDF models and databases take time variation into consideration; they represent the appearance of a material at a single time instance. In this paper, we address the acquisition, analysis, modeling, and rendering of a wide range of time-varying BRDFs (TVBRDFs). We have developed an acquisition system that is capable of sampling a material's BRDF at multiple time instances, with each time sample acquired within 36 sec. We have used this acquisition system to measure the BRDFs of a wide range of time-varying phenomena, which include the drying of various types of paints (watercolor, spray, and oil), the drying of wet rough surfaces (cement, plaster, and fabrics), the accumulation of dusts (household and joint compound) on surfaces, and the melting of materials (chocolate). Analytic BRDF functions are fit to these measurements and the model parameters' variations with time are analyzed. Each category exhibits interesting and sometimes nonintuitive parameter trends. These parameter trends are then used to develop analytic TVBRDF models. The analytic TVBRDF models enable us to apply effects such as paint drying and dust accumulation to arbitrary surfaces and novel materials.

  11. Variational lower bound on the scattering length

    International Nuclear Information System (INIS)

    Rosenberg, L.; Spruch, L.

    1975-01-01

    The scattering length A characterizes the zero-energy scattering of one system by another. It was shown some time ago that a variational upper bound on A could be obtained using methods, of the Rayleigh-Ritz type, which are commonly employed to obtain upper bounds on energy eigenvalues. Here we formulate a method for obtaining a variational lower bound on A. Once again the essential idea is to express the scattering length as a variational estimate plus an error term and then to reduce the problem of bounding the error term to one involving bounds on energy eigenvalues. In particular, the variational lower bound on A is rigorously established provided a certin modified Hamiltonian can be shown to have no discrete states lying below the level of the continuum threshold. It is unfortunately true that necessary conditions for the existence of bound states are not available for multiparticle systems in general. However, in the case of positron-atom scattering the adiabatic approximation can be introduced as an (essentially) solvable comparison problem to rigorously establish the nonexistence of bound states of the modified Hamiltonian. It has recently been shown how the validity of the variational upper bound on A can be maintained when the target ground-state wave function is imprecisely known. Similar methods can be used to maintain the variational lower bound on A. Since the bound is variational, the error in the calculated scattering length will be of second order in the error in the wave function. The use of the adiabatic approximation in the present context places no limitation in principle on the accuracy achievable

  12. Poloidal variation of viscous forces in the banana collisionality regime

    International Nuclear Information System (INIS)

    Wang, J.P.; Callen, J.D.

    1992-12-01

    The poloidal variation of the parallel viscous and heat viscous forces are determined for the first time using a rigorous Chapman- Enskog-like approach that has been developed recently. It is shown that the poloidal variation is approximately proportional to the poloidal distribution of the trapped particles, which are concentrated on the outer edge (large major radius side) of the tokamak

  13. Planck intermediate results XXIV. Constraints on variations in fundamental constants

    DEFF Research Database (Denmark)

    Ade, P. A. R.; Aghanim, N.; Arnaud, M.

    2015-01-01

    cosmological probes. We conclude that independent time variations of the fine structure constant and of the mass of the electron are constrained by Planck to Δ Α/Α = (3.6±3.7) x 10-3 and Δ me/me = (4 ±11) x 10-3 at the 68% confidence level. We also investigate the possibility of a spatial variation of the fine...

  14. Midlatitude D region variations measured from broadband radio atmospherics

    Science.gov (United States)

    Han, Feng

    The high power, broadband very low frequency (VLF, 3--30 kHz) and extremely low frequency (ELF, 3--3000 Hz) electromagnetic waves generated by lightning discharges and propagating in the Earth-ionosphere waveguide can be used to measure the average electron density profile of the lower ionosphere (D region) across the wave propagation path due to several reflections by the upper boundary (lower ionosphere) of the waveguide. This capability makes it possible to frequently and even continuously monitor the D region electron density profile variations over geographically large regions, which are measurements that are essentially impossible by other means. These guided waves, usually called atmospherics (or sferics for short), are recorded by our sensors located near Duke University. The purpose of this work is to develop and implement algorithms to derive the variations of D region electron density profile which is modeled by two parameters (one is height and another is sharpness), by comparing the recorded sferic spectra to a series of model simulated sferic spectra from using a finite difference time domain (FDTD) code. In order to understand the time scales, magnitudes and sources for the midlatitude nighttime D region variations, we analyzed the sferic data of July and August 2005, and extracted both the height and sharpness of the D region electron density profile. The heights show large temporal variations of several kilometers on some nights and the relatively stable behavior on others. Statistical calculations indicate that the hourly average heights during the two months range between 82.0 km and 87.2 km with a mean value of 84.9 km and a standard deviation of 1.1 km. We also observed spatial variations of height as large as 2.0 km over 5 degrees latitudes on some nights, and no spatial variation on others. In addition, the measured height variations exhibited close correlations with local lightning occurrence rate on some nights but no correlation with local

  15. Variation in commercial smoking mixtures containing third-generation synthetic cannabinoids.

    Science.gov (United States)

    Frinculescu, Anca; Lyall, Catherine L; Ramsey, John; Miserez, Bram

    2017-02-01

    Variation in ingredients (qualitative variation) and in quantity of active compounds (quantitative variation) in herbal smoking mixtures containing synthetic cannabinoids has been shown for older products. This can be dangerous to the user, as accurate and reproducible dosing is impossible. In this study, 69 packages containing third-generation cannabinoids of seven brands on the UK market in 2014 were analyzed both qualitatively and quantitatively for variation. When comparing the labels to actual active ingredients identified in the sample, only one brand was shown to be correctly labelled. The other six brands contained less, more, or ingredients other than those listed on the label. Only two brands were inconsistent, containing different active ingredients in different samples. Quantitative variation was assessed both within one package and between several packages. Within-package variation was within a 10% range for five of the seven brands, but two brands showed larger variation, up to 25% (Relative Standard Deviation). Variation between packages was significantly higher, with variation up to 38% and maximum concentration up to 2.7 times higher than the minimum concentration. Both qualitative and quantitative variation are common in smoking mixtures and endanger the user, as it is impossible to estimate the dose or to know the compound consumed when smoking commercial mixtures. Copyright © 2016 John Wiley & Sons, Ltd. Copyright © 2016 John Wiley & Sons, Ltd.

  16. Variation Trend Analysis of Runoff and Sediment Time Series Based on the R/S Analysis of Simulated Loess Tilled Slopes in the Loess Plateau, China

    Directory of Open Access Journals (Sweden)

    Ju Zhang

    2017-12-01

    Full Text Available The objective of this study was to illustrate the temporal variation of runoff and sediment of loess tilled slopes under successive rainfall conditions. Loess tilled slopes with four microtopography types (straight cultivated slope, artificial backhoe, artificial digging, and contour tillage under five slope gradients (5°, 10°, 15°, 20°, 25° were simulated and a rainfall intensity of 60 mm/h was adopted. The temporal trends of runoff and sediment yield were predicted based on the Rescaled Range (R/S analysis method. The results indicate that the Hurst indices of runoff time series and sediment time series are higher than 0.5, and a long-term positive correlation exists between the future and the past. This means that runoff and sediment of loess tilled slopes in the future will have the same trends as in the past. The results obtained by the classical R/S analysis method were the same as those of the modified R/S analysis method. The rationality and reliability of the R/S analysis method were further identified and the method can be used for predicting the trend of runoff and sediment yield. The correlation between the microtopography and the Hurst indices of the runoff and sediment yield time series, as well as between the slopes and the Hurst indices, were tested, and the result was that there was no significant correlation between them. The microtopography and slopes cannot affect the correlation and continuity of runoff and sediment yield time series. This study provides an effective method for predicting variations in the trends of runoff and sediment yield on loess tilled slopes.

  17. Community variations in population exposure to near-field tsunami hazards as a function of pedestrian travel time to safety

    Science.gov (United States)

    Wood, Nathan J.; Schmidtlein, Mathew C.

    2013-01-01

    Efforts to characterize population exposure to near-field tsunami threats typically focus on quantifying the number and type of people in tsunami-hazard zones. To develop and prioritize effective risk-reduction strategies, emergency managers also need information on the potential for successful evacuations and how this evacuation potential varies among communities. To improve efforts to properly characterize and differentiate near-field tsunami threats among multiple communities, we assess community variations in population exposure to tsunamis as a function of pedestrian travel time to safety. We focus our efforts on the multiple coastal communities in Grays Harbor and Pacific Counties (State of Washington, USA), where a substantial resident and visitor population is threatened by near-field tsunamis related to a potential Cascadia subduction zone earthquake. Anisotropic, path-distance modeling is conducted to estimate travel times to safety and results are merged with various population data, including residents, employees, public venues, and dependent-care facilities. Results suggest that there is substantial variability among communities in the number of people that may have insufficient time to evacuate. Successful evacuations may be possible in some communities assuming slow-walking speeds, are plausible in others if travel speeds are increased, and are unlikely in another set of communities given the large distances and short time horizon. Emergency managers can use these results to prioritize the location and determine the most appropriate type of tsunami risk-reduction strategies, such as education and training in areas where evacuations are plausible and vertical-evacuation structures in areas where they are not.

  18. Three dimensional analysis of cosmic ray intensity variation

    International Nuclear Information System (INIS)

    Yasue, Shin-ichi; Mori, Satoru; Nagashima, Kazuo.

    1974-01-01

    Three dimensional analysis of cosmic ray anisotropy and its time variation was performed. This paper describes the analysis of the Forbush decrease in Jan. 1968 to investigate by comparing the direction of the magnetic field in interplanetary space and the direction of the reference axis for cosmic ray anisotropy. New anisotropy becomes dominant at the time of Forbush decrease because the anisotropy of cosmic ray in calm state is wiped out. Such anisotropy produces intensity variation in neutron monitors on the ground. The characteristic parameters of three dimensional anisotropy can be determined from theoretical value and observed intensity. Analyzed data were taken for 6 days from Jan. 25 to Jan. 30, 1968, at Deep River. The decrease of intensity at Deep River was seen for several hours from 11 o'clock (UT), Jan. 26, just before The Forbush decrease. This may be due to the loss cone. The Forbush decrease began at 19 o'clock, Jan. 26, and the main phase continued to 5 o'clock in the next morning. The spectrum of variation was Psup(-0.5). The time variations of the magnetic field in interplanetary space and the reference axis of cosmic ray anisotropy are shown for 15 hours. The average directions of both are almost in coincidence. The spatial distribution of cosmic ray near the earth may be expressed by the superposition of axial symmetrical distribution along a reference axis and its push-out to the direction of 12 o'clock. It is considered that the direction of magnetic force line and the velocity of solar wind correspond to the direction of the reference axis and the magnitude of anisotropy in the direction of 12 o'clock, respectively. (Kato, T.)

  19. No variation and low synonymous substitution rates in coral mtDNA despite high nuclear variation

    Directory of Open Access Journals (Sweden)

    Hellberg Michael E

    2006-03-01

    Full Text Available Abstract Background The mitochondrial DNA (mtDNA of most animals evolves more rapidly than nuclear DNA, and often shows higher levels of intraspecific polymorphism and population subdivision. The mtDNA of anthozoans (corals, sea fans, and their kin, by contrast, appears to evolve slowly. Slow mtDNA evolution has been reported for several anthozoans, however this slow pace has been difficult to put in phylogenetic context without parallel surveys of nuclear variation or calibrated rates of synonymous substitution that could permit quantitative rate comparisons across taxa. Here, I survey variation in the coding region of a mitochondrial gene from a coral species (Balanophyllia elegans known to possess high levels of nuclear gene variation, and estimate synonymous rates of mtDNA substitution by comparison to another coral (Tubastrea coccinea. Results The mtDNA surveyed (630 bp of cytochrome oxidase subunit I was invariant among individuals sampled from 18 populations spanning 3000 km of the range of B. elegans, despite high levels of variation and population subdivision for allozymes over these same populations. The synonymous substitution rate between B. elegans and T. coccinea (0.05%/site/106 years is similar to that in most plants, but 50–100 times lower than rates typical for most animals. In addition, while substitutions to mtDNA in most animals exhibit a strong bias toward transitions, mtDNA from these corals does not. Conclusion Slow rates of mitochondrial nucleotide substitution result in low levels of intraspecific mtDNA variation in corals, even when nuclear loci vary. Slow mtDNA evolution appears to be the basal condition among eukaryotes. mtDNA substitution rates switch from slow to fast abruptly and unidirectionally. This switch may stem from the loss of just one or a few mitochondrion-specific DNA repair or replication genes.

  20. Associated top production (ttV, tV) in ATLAS and CMS

    CERN Document Server

    Sánchez Cruz, Sergio

    2018-01-01

    A set of measurements of top quark pair and single top quark production in association with standard model (SM) bosons performed by the CMS and ATLAS Collaborations is presented. The consistency of these results among themselves and with the SM prediction is discussed. The latest results on four top quark production are also shown.

  1. Environmental survey to assess viral contamination of air and surfaces in hospital settings.

    Science.gov (United States)

    Carducci, A; Verani, M; Lombardi, R; Casini, B; Privitera, G

    2011-03-01

    The presence of pathogenic viruses in healthcare settings represents a serious risk for both staff and patients. Direct viral detection in the environment poses significant technical problems and the indirect indicators currently in use suffer from serious limitations. The aim of this study was to monitor surfaces and air in hospital settings to reveal the presence of hepatitis C virus, human adenovirus, norovirus, human rotavirus and torque teno virus by nucleic acid assays, in parallel with measurements of total bacterial count and haemoglobin presence. In total, 114 surface and 62 air samples were collected. Bacterial contamination was very low (air was 282 cfu/m(3). Overall, 19 (16.7%) surface samples tested positive for viral nucleic acids: one for norovirus, one for human adenovirus and 17 (14.9%) for torque teno virus (TTV). Only this latter virus was directly detected in 10 air samples (16.1%). Haemoglobin was found on two surfaces. No relationship was found between viral, biochemical or bacterial indicators. The data obtained confirm the difficulty of assessing viral contamination using bacterial indicators. The frequent detection of TTV suggests its possible use as an indicator for general viral contamination of the environment. Copyright © 2010 The Hospital Infection Society. Published by Elsevier Ltd. All rights reserved.

  2. T T virus in chronic hepatitis B, C patients

    International Nuclear Information System (INIS)

    Abd Rabo, L.A.

    2007-01-01

    In 1997, in Japan, a non-enveloped single stranded circular DNA virus was recovered from a patient. Who developed post transfusion hepatitis not related to any of the know hepatitis viruses . The virus owes its name (T T) virus to the initials of the patient in whom the virus was first identified . Although this acronym might also stand for transfusion - transmitted virus, however, this name would emphasize only one, and certainly not the most frequent mode of this virus transmission. The taxonomy of the virus is uncertain but it is believed now that it may belong to a new family called paracircoviridae. TTDNA has been detected in liver, bone marrow, lung, spleen, pancreas, kidney, lymph nodes, skeletal muscles and thyroid gland as well as in saliva, tear, stool, bile, throat swabs, breast milk and semen while could not be detected in urine and sweat. TTV infection is transmitted parenterally by feco-oral or droplet routes, or sexual intercourse. These properties of virus influence its high prevalence in general population whether intrauterine transmission of virus is possible remains uncertain. The aim of this work is viewing the prevalence of TTV infection, mode of transmission, pathogenicity, diagnosis and management among chronic hepatitis B and C patients and control group

  3. Topographical Variation of Human Femoral Articular Cartilage Thickness, T1rho and T2 Relaxation Times Is Related to Local Loading during Walking.

    Science.gov (United States)

    Van Rossom, Sam; Wesseling, Mariska; Van Assche, Dieter; Jonkers, Ilse

    2018-01-01

    Objective Early detection of degenerative changes in the cartilage matrix composition is essential for evaluating early interventions that slow down osteoarthritis (OA) initiation. T1rho and T2 relaxation times were found to be effective for detecting early changes in proteoglycan and collagen content. To use these magnetic resonance imaging (MRI) methods, it is important to document the topographical variation in cartilage thickness, T1rho and T2 relaxation times in a healthy population. As OA is partially mechanically driven, the relation between these MRI-based parameters and localized mechanical loading during walking was investigated. Design MR images were acquired in 14 healthy adults and cartilage thickness and T1rho and T2 relaxation times were determined. Experimental gait data was collected and processed using musculoskeletal modeling to identify weight-bearing zones and estimate the contact force impulse during gait. Variation of the cartilage properties (i.e., thickness, T1rho, and T2) over the femoral cartilage was analyzed and compared between the weight-bearing and non-weight-bearing zone of the medial and lateral condyle as well as the trochlea. Results Medial condyle cartilage thickness was correlated to the contact force impulse ( r = 0.78). Lower T1rho, indicating increased proteoglycan content, was found in the medial weight-bearing zone. T2 was higher in all weight-bearing zones compared with the non-weight-bearing zones, indicating lower relative collagen content. Conclusions The current results suggest that medial condyle cartilage is adapted as a long-term protective response to localized loading during a frequently performed task and that the weight-bearing zone of the medial condyle has superior weight bearing capacities compared with the non-weight-bearing zones.

  4. Study of the effect of static/dynamic Coulomb friction variation at the tape-head interface of a spacecraft tape recorder by non-linear time response simulation

    Science.gov (United States)

    Mukhopadhyay, A. K.

    1978-01-01

    A description is presented of six simulation cases investigating the effect of the variation of static-dynamic Coulomb friction on servo system stability/performance. The upper and lower levels of dynamic Coulomb friction which allowed operation within requirements were determined roughly to be three times and 50% respectively of nominal values considered in a table. A useful application for the nonlinear time response simulation is the sensitivity analysis of final hardware design with respect to such system parameters as cannot be varied realistically or easily in the actual hardware. Parameters of the static/dynamic Coulomb friction fall in this category.

  5. Forcing of Climate Variations by Mev-gev Particles

    Science.gov (United States)

    Tinsley, Brian A.

    1990-01-01

    Changes in ionization production in the lower stratosphere by a few percent during Forbush decreases have been shown to correlate well with changes in winter tropospheric dynamics by a similar relatively small amount. Changes in ionization production by tens of percent on the decadal time scale have been shown to be correlated with changes in winter storm frequencies by tens of percent in the western North Atlantic. Changes in total solar irradiance or solar UV do not have time variations to match the tropospheric variations on the day to day time scales discussed here. Forcing related to magnetic activity is not supported. Thus solar wind/MeV-GeV particle changes appear to be the only viable forcing function for these day to day variations. If solar wind/particle forcing of a few percent amplitude can produce short term weather responses, then observed changes by tens of percent on the decadal and centennial time scale could produce climate changes on these longer time scales. The changes in circulation involved would produce regional climate changes, as observed. At present the relations between stratospheric ionization, electric fields and chemistry and aerosol and cloud microphysics are as poorly known as the relations between the latter and storm feedback processes. However, the capability for investigating these relationships now exists and has recently been most successfully used for elucidating the stratospheric chemistry and cloud microphysics associated with the Antarctic ozone hole. The economic benefits of being able to predict winter severity on an interannual basis, and the extent to which climate change related to solar variability will add to or substract from the greenhouse effect, should be more than adequate to justify support for research in this area.

  6. Long-term variations of cosmic ray intensity

    International Nuclear Information System (INIS)

    Dergachev, V.A.; Kocharov, G.E.; Ostryakov, V.M.

    1982-01-01

    At the present time we know only one possibility to reconstruct the Cosmic Ray intensity in the past. This possibility is connected with the measurements of radiocarbon abundance in the dendrochronologically dated wood samples. As the experiments carried out with the help of spacecrafts, balloons and ground apparatus show the Galactic Cosmic Ray flux essentially varies on a short time scales. The variations are caused by different astrophysical and geophysical phenomena. 14 C isotope allows us to investigate these reasons on a more long time interval in comparison with direct observational possibilities

  7. Time-related variation of volatile contents of Western Ghats volcanic formations, Deccan, India

    Science.gov (United States)

    Marzoli, Andrea; Callegaro, Sara; Baker, Don R.; De Min, Angelo; Renne, Paul R.

    2016-04-01

    Deccan volcanism in India covered more than 1 million square km and reached a maximum thickness of about 3 km, as presently preserved in the Western Ghats volcanic lava piles. Volcanic activity started at about 66.4 Ma (Jawhar formation) and ended at about 65.5 Ma (Mahabaleshwar unit; Renne et al., 2015). Deccan volcanism straddled the Cretaceous-Paleogene boundary (ca. 66.0 Ma) and possibly contributed to the end-Cretaceous mass extinction event through emission of gases such as SO2, CO2, Cl, F that may have triggered global climate changes. Severe pollution by volcanic gases is supported by the high S and Cl contents (up to 1400 and up to 900 ppm, respectively; Self et al., 2008) measured in a few olivine- and plagioclase-hosted melt inclusions from the Jawhar, Neral, and Thakurvadi Formations (early lava flows, ca. 66.3-66.4 ± 0.1 Ma; Renne et al., 2015) and by magmatic S contents (up to 1800 ppm; Callegaro et al., 2014) calculated from S measurements in clinopyroxenes from the Mahabaleshwar unit (ca. 65.5 ± 0.1; Schoene et al., 2015). Here, we present new analyses of S, Cl, and F, obtained by ion-probe and synchrotron light micro-fluorescence analyses on clinopyroxenes and plagioclase phenocrysts from ?al? lava flow units of the Western Ghats. The volatile contents of the host magmas have been calculated from recently published clinopyroxene/basalt partition coefficients. These new data will describe the time-related variation of volatile elements hosted and eventually emitted by Deccan lavas and shed light on their environmental impact. References: Callegaro S. et al. (2014). Geology 42, 895-898. Renne P.R. et al. (2015). Science 350, 76-78. Schoene B. et al. (2015). Science 347, 192-184. Self S. et al. (2008). Science 319, 1654-1657.

  8. Biological variation of free β chorionic gonadotropin and pregnancy-associated plasma protein A in first trimester pregnancies

    DEFF Research Database (Denmark)

    Sennels, Henriette P; Jørgensen, Finn Stener; Sørensen, Steen

    2011-01-01

    protein A (PAPP-A). However, little knowledge exists regarding the biological variation of hCGβ and PAPP-A when the time interval between sampling increases. Methods: We estimated these variations from double mea-surements of hCGβ and PAPP-A in first trimester pregnancies in 167 women. Data were divided...... into three groups based on the number of days between sampling. The correlation coefficients and biological variation were estimated for each group. Results: The correlation coefficient between the first and second samples was 0.841 for hCGβ, and 0.706 for PAPP-A. The ranges for biological variation were 11.......9%-48.5% for hCGβ and 31.6%-63.3% for PAPP-A, increasing with time between sampling. The average overall biological variation for hCGβ was 29%, and 49.7% for PAPP-A. Conclusions: We found high biological variation for plasma concentrations of hCGβ and PAPP-A, increasing with longer time intervals between...

  9. Biological variation of free β chorionic gonadotropin and pregnancy-associated plasma protein A in first trimester pregnancies

    DEFF Research Database (Denmark)

    Sennels, Henriette P; Jørgensen, Finn Stener; Sørensen, Steen

    2011-01-01

    protein A (PAPP-A). However, little knowledge exists regarding the biological variation of hCGß and PAPP-A when the time interval between sampling increases. Methods: We estimated these variations from double mea-surements of hCGß and PAPP-A in first trimester pregnancies in 167 women. Data were divided...... into three groups based on the number of days between sampling. The correlation coefficients and biological variation were estimated for each group. Results: The correlation coefficient between the first and second samples was 0.841 for hCGß, and 0.706 for PAPP-A. The ranges for biological variation were 11.......9%-48.5% for hCGß and 31.6%-63.3% for PAPP-A, increasing with time between sampling. The average overall biological variation for hCGß was 29%, and 49.7% for PAPP-A. Conclusions: We found high biological variation for plasma concentrations of hCGß and PAPP-A, increasing with longer time intervals between...

  10. On the Limitations of Variational Bias Correction

    Science.gov (United States)

    Moradi, Isaac; Mccarty, Will; Gelaro, Ronald

    2018-01-01

    Satellite radiances are the largest dataset assimilated into Numerical Weather Prediction (NWP) models, however the data are subject to errors and uncertainties that need to be accounted for before assimilating into the NWP models. Variational bias correction uses the time series of observation minus background to estimate the observations bias. This technique does not distinguish between the background error, forward operator error, and observations error so that all these errors are summed up together and counted as observation error. We identify some sources of observations errors (e.g., antenna emissivity, non-linearity in the calibration, and antenna pattern) and show the limitations of variational bias corrections on estimating these errors.

  11. Data-driven Inference and Investigation of Thermosphere Dynamics and Variations

    Science.gov (United States)

    Mehta, P. M.; Linares, R.

    2017-12-01

    This paper presents a methodology for data-driven inference and investigation of thermosphere dynamics and variations. The approach uses data-driven modal analysis to extract the most energetic modes of variations for neutral thermospheric species using proper orthogonal decomposition, where the time-independent modes or basis represent the dynamics and the time-depedent coefficients or amplitudes represent the model parameters. The data-driven modal analysis approach combined with sparse, discrete observations is used to infer amplitues for the dynamic modes and to calibrate the energy content of the system. In this work, two different data-types, namely the number density measurements from TIMED/GUVI and the mass density measurements from CHAMP/GRACE are simultaneously ingested for an accurate and self-consistent specification of the thermosphere. The assimilation process is achieved with a non-linear least squares solver and allows estimation/tuning of the model parameters or amplitudes rather than the driver. In this work, we use the Naval Research Lab's MSIS model to derive the most energetic modes for six different species, He, O, N2, O2, H, and N. We examine the dominant drivers of variations for helium in MSIS and observe that seasonal latitudinal variation accounts for about 80% of the dynamic energy with a strong preference of helium for the winter hemisphere. We also observe enhanced helium presence near the poles at GRACE altitudes during periods of low solar activity (Feb 2007) as previously deduced. We will also examine the storm-time response of helium derived from observations. The results are expected to be useful in tuning/calibration of the physics-based models.

  12. AGB mass-loss variations: What can we learn from (sub)millimetre observations?

    NARCIS (Netherlands)

    Dehaes, S.; Groenewegen, M.A.T.; Decin, L.; Hony, S.; Raskin, G.; Blommaert, J.A.D.L.

    2008-01-01

    It is generally acknowledged that the mass loss of Asymptotic Giant Branch (AGB) stars undergoes variations on different time scales. We address here the question of the influence of these variations on the spectral energy distribution (SED) of these sources. We therefore constructed models for the

  13. Temporal variation of floc size and settling velocity in the Dollard estuary

    Science.gov (United States)

    Van der Lee, Willem T. B.

    2000-09-01

    Temporal changes in floc size and settling velocity were measured in the Dollard estuary with an under water video camera. The results show that the flocs in the Dollard are very heterogeneous and that larger flocs have much lower effective densities than smaller flocs. Due to this density decrease, floc settling velocities show only a minor increase with increasing floc size. Floc sizes and settling velocities correlate with the suspended sediment concentration (SSC) on a tidal time scale, but not on a seasonal time scale. On a seasonal time scale floc sizes depend on the binding properties of the sediment, while floc settling velocities show hardly any variation, as an increase in floc size is mainly counterbalanced by a decrease in floc density. Tidal variations in settling velocity occur but cannot be modeled solely as a function of SSC, as the relation between floc size/settling velocity and SSC constantly changes in time and space. Settling velocity variations throughout the tide can however be expressed as a function of tidal phase.

  14. A Probabilistic Approach to Second Order Variational Inequalities ...

    Indian Academy of Sciences (India)

    . Under certain conditions we show the existence of a unique viscosity solution of these variational inequalities and give a stochastic representation to this solution. As an application, we study a stochastic game with stopping times and show ...

  15. Holocene hydrologic variation at Lake Titicaca, Bolivia/Peru, and its relationship to North Atlantic climate variation

    Science.gov (United States)

    Baker, P. A.; Fritz, S. C.; Garland, J.; Ekdahl, E.

    2005-10-01

    A growing number of sites in the Northern Hemisphere show centennial- to millennial-scale climate variation that has been correlated with change in solar variability or with change in North Atlantic circulation. However, it is unclear how (or whether) these oscillations in the climate system are manifest in the Southern Hemisphere because of a lack of sites with suitably high sampling resolution. In this paper, we reconstruct the lake-level history of Lake Titicaca, using the carbon isotopic content of sedimentary organic matter, to evaluate centennial- to millennial-scale precipitation variation and its phasing relative to sites in the Northern Hemisphere. The pattern and timing of lake-level change in Lake Titicaca is similar to the ice-rafted debris record of Holocene Bond events, demonstrating a possible coupling between precipitation variation on the Altiplano and North Atlantic sea-surface temperatures (SSTs). The cold periods of the Holocene Bond events correspond with periods of increased precipitation on the Altiplano. Holocene precipitation variability on the Altiplano is anti-phased with respect to precipitation in the Northern Hemisphere monsoon region. More generally, the tropical Andes underwent large changes in precipitation on centennial-to-millennial timescales during the Holocene.

  16. Genetics and variation

    Science.gov (United States)

    John R. Jones; Norbert V. DeByle

    1985-01-01

    The broad genotypic variability in quaking aspen (Populus tremuloides Michx.), that results in equally broad phenotypic variability among clones is important to the ecology and management of this species. This chapter considers principles of aspen genetics and variation, variation in aspen over its range, and local variation among clones. For a more...

  17. Some remarks on variational and quasi-variational inequalities of monotone operators

    International Nuclear Information System (INIS)

    Siddiqi, A.H.

    1990-08-01

    In this paper we study a fairly general class of variational and quasi-variational inequalities problem which represent some important physical phenomena. Several well-known results concerning variational inequalities are special cases of our results. Existence, uniqueness and numerical analysis of this problem have been studied. (author). 39 refs

  18. Positive-definite matrix processes of finite variation

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole Eiler; Stelzer, Robert

    2007-01-01

    Processes of finite variation, which take values in the positive semidefinite matrices and are representable as the sum of an integral with respect to time and one with respect to an extended Poisson random measure, are considered. For such processes we derive conditions for the square root (and ...

  19. Positive-Definite Matrix Processes of Finite Variation

    DEFF Research Database (Denmark)

    Barndorff-Nielsen, Ole Eiler; Stelzer, Robert

    Processes of finite variation, which take values in the positive semidefinite matrices and are representable as the sum of an integral with respect to time and one with respect to an extended Poisson random measure, are considered. For such processes we derive conditions for the square root (and ...

  20. variation of reverberation time with quantity of absorbers in an ...

    African Journals Online (AJOL)

    DJFLEX

    broadcasting and recording studios, reverberation time can be simply controlled to achieve desired results. KEY WORDS: ..... Positions and Actual sizes and Numbers of. Absorbers Used. Measured. Reverberation. Times (s). Calculated with. Sabine Formula. Calculated with. Arau-Puchades. Formula. 500. (Hz). 1000. (Hz).

  1. On the problem of the flux value of cosmic origin radioisotopes on the Earth and their time variations

    International Nuclear Information System (INIS)

    Styro, B.I.; Luyanas, V.Yu.; Zinkyavichyus, P.K.

    1977-01-01

    Cosmogenic radioisotopes flows on the Earth's surface are investigated. Nuclear reactions by the action of slow neutrons (cosmic rays) are analysed. It has been testified that the role of Ne, Kr, Ze and nuclei of the volcanic substance in production of cosmogenic nuclids is insignificant. Radioisotopes can provide by meteorites while passing through the atmosphere as a result of ablation. The evaluations of the meteoritic sustance falling out to the Earth can be used as a base to calculate flows of a number of radioactive isotopes. The flow density of most isotopes which come with the meteoric substance are quite insignificant. However the 26 Al flows can be of the same value as that of the rate of their production in the atmosphere. Changes of the rate of the production of cosmogenic isotopes both due to the flow variations meteoric and as a result of the cosmic ray intensity oscillations first of all effect the stratospheral reservoir. Time oscillations of cosmogenic radioisotope flows to the Earth's surface will occur with some delay because the life time of isotopes in the stratosphere lasts several years. The evaluation is given of the difference of phases between oscillations of the stratospheral rate of the formation of long-living isotopes and the flow density to the Earth's surface. It can approximate to 1-2 years

  2. Ensembl variation resources

    Directory of Open Access Journals (Sweden)

    Marin-Garcia Pablo

    2010-05-01

    Full Text Available Abstract Background The maturing field of genomics is rapidly increasing the number of sequenced genomes and producing more information from those previously sequenced. Much of this additional information is variation data derived from sampling multiple individuals of a given species with the goal of discovering new variants and characterising the population frequencies of the variants that are already known. These data have immense value for many studies, including those designed to understand evolution and connect genotype to phenotype. Maximising the utility of the data requires that it be stored in an accessible manner that facilitates the integration of variation data with other genome resources such as gene annotation and comparative genomics. Description The Ensembl project provides comprehensive and integrated variation resources for a wide variety of chordate genomes. This paper provides a detailed description of the sources of data and the methods for creating the Ensembl variation databases. It also explores the utility of the information by explaining the range of query options available, from using interactive web displays, to online data mining tools and connecting directly to the data servers programmatically. It gives a good overview of the variation resources and future plans for expanding the variation data within Ensembl. Conclusions Variation data is an important key to understanding the functional and phenotypic differences between individuals. The development of new sequencing and genotyping technologies is greatly increasing the amount of variation data known for almost all genomes. The Ensembl variation resources are integrated into the Ensembl genome browser and provide a comprehensive way to access this data in the context of a widely used genome bioinformatics system. All Ensembl data is freely available at http://www.ensembl.org and from the public MySQL database server at ensembldb.ensembl.org.

  3. Barium variation in Acropora palmata and Montastrea annularis

    Science.gov (United States)

    Pingitore, Nicholas E.; Rangel, Yolanda; Kwarteng, Andrew

    1989-06-01

    The barium contents of Acropora palmata and Montastrea annularis are distinct both in their averages (6 and 9 ppm, respectively) and, more impressively, in their variability (5 to 7 ppm and 6 to 15 ppm). A. palmata contained about 50% more Ba2+ than M. annularis and exhibited more than three times as much variation, as measured by their respective coefficients of variation. In contrast, the means and coefficients of variation of Sr2+ in these groups differed by only 6% and 15%. No obvious environmental or post-depositional causes for the inter-and intra-specific variation of Ba2+ could be found. Previous experiments indicate that the partitioning of Ba2+ into aragonite depends directly on the rate of precipitation. This suggests that Ba2+ does not substitute for Ca2+ but instead is incorporated by occlusion. Since growth rates in A. palmata often exceed those of M. annularis, this appears to be the mechanism which generates higher and more variable concentrations of Ba2+ in A. palmata.

  4. Variation and Mathematics Pedagogy

    Science.gov (United States)

    Leung, Allen

    2012-01-01

    This discussion paper put forwards variation as a theme to structure mathematical experience and mathematics pedagogy. Patterns of variation from Marton's Theory of Variation are understood and developed as types of variation interaction that enhance mathematical understanding. An idea of a discernment unit comprising mutually supporting variation…

  5. Effect of α variation on the vibrational spectrum of Sr2

    International Nuclear Information System (INIS)

    Beloy, K.; Hauser, A. W.; Borschevsky, A.; Schwerdtfeger, P.; Flambaum, V. V.

    2011-01-01

    We consider the effect of α variation on the vibrational spectrum of Sr 2 in the context of a planned experiment to test the stability of μ≡m e /m p using optically trapped Sr 2 molecules [Zelevinsky et al., Phys. Rev. Lett. 100, 043201 (2008); Kotochigova et al., Phys. Rev. A 79, 012504 (2009)]. We find the prospective experiment to be 3 to 4 times less sensitive to fractional variation in α as it is to fractional variation in μ. Depending on the precision ultimately achieved by the experiment, this result may give justification for the neglect of α variation or, alternatively, may call for its explicit consideration in the interpretation of experimental results.

  6. Assessment of variations in control of asthma over time.

    Science.gov (United States)

    Combescure, C; Chanez, P; Saint-Pierre, P; Daurès, J P; Proudhon, H; Godard, P

    2003-08-01

    Control and severity of asthma are two different but complementary concepts. The severity of asthma could influence the control over time. The aim of this study was to demonstrate this relationship. A total 365 patients with persistent asthma (severity) were enrolled and followed-up prospectively. Data were analysed using a continuous time homogeneous Markov model of the natural history of asthma. Control of asthma was defined according to three health states which were qualified: optimal, suboptimal and unacceptable control (states 1, 2 and 3). Transition forces (denoted lambda(ij) from state i to state j) and transition probabilities between control states were assessed and the results stratified by asthma severity were compared. Models were validated by comparing expected and observed numbers of patients in the different states. Transition probabilities stabilised between 100-250 days and more rapidly in patients with mild-to-moderate asthma. Patients with mild-to-moderate asthma in suboptimal or unacceptable control had a high probability of transition directly to optimal control. Patients with severe asthma had a tendency to remain in unacceptable control. A Markov model is a useful tool to model the control of asthma over time. Severity modified clearly the health states. It could be used to compare the performance of different approaches to asthma management.

  7. Discrete Variational Approach for Modeling Laser-Plasma Interactions

    Science.gov (United States)

    Reyes, J. Paxon; Shadwick, B. A.

    2014-10-01

    The traditional approach for fluid models of laser-plasma interactions begins by approximating fields and derivatives on a grid in space and time, leading to difference equations that are manipulated to create a time-advance algorithm. In contrast, by introducing the spatial discretization at the level of the action, the resulting Euler-Lagrange equations have particular differencing approximations that will exactly satisfy discrete versions of the relevant conservation laws. For example, applying a spatial discretization in the Lagrangian density leads to continuous-time, discrete-space equations and exact energy conservation regardless of the spatial grid resolution. We compare the results of two discrete variational methods using the variational principles from Chen and Sudan and Brizard. Since the fluid system conserves energy and momentum, the relative errors in these conserved quantities are well-motivated physically as figures of merit for a particular method. This work was supported by the U. S. Department of Energy under Contract No. DE-SC0008382 and by the National Science Foundation under Contract No. PHY-1104683.

  8. Solar cycle 22 control on daily geomagnetic variation at Terra Nova Bay (Antarctica

    Directory of Open Access Journals (Sweden)

    P. Palangio

    1998-06-01

    Full Text Available Nine summer geomagnetic observatory data (1986-1995 from Terra Nova Bay Base, Antarctica (Lat.74.690S, Long. 164.120E, 80.040S magnetic latitude are used to investigate the behaviour of the daily variation of the geomagnetic field at polar latitude. The instrumentation includes a proton precession magnetometer for total intensity |F| digital recordings; DI magnetometers for absolute measuring of the angular elements D and I and a three axis flux-gate system for acquiring H,D Z time variation data. We find that the magnetic time variation amplitude follows the solar cycle evolution and that the ratio between minimum solar median and maximum solar median is between 2-3 for intensive elements (H and Z and 1.7 for declination(D. The solar cycle effect on geomagnetic daily variation elements amplitude in Antarctica, in comparison with previous studies, is then probably larger than expected. As a consequence, the electric current system that causes the daily magnetic field variation reveals a quite large solar cycle effect at Terra Nova Bay.

  9. Prediction of ppm level electrical failure by using physical variation analysis

    Science.gov (United States)

    Hou, Hsin-Ming; Kung, Ji-Fu; Hsu, Y.-B.; Yamazaki, Y.; Maruyama, Kotaro; Toyoshima, Yuya; Chen, Chu-en

    2016-03-01

    The quality of patterns printed on wafer may be attributed to factors such as process window control, pattern fidelity, overlay performance, and metrology. Each of these factors play an important role in making the process more effective by ensuring that certain design- and process-specific parameters are kept within acceptable variation. Since chip size and pattern density are increasing accordingly, in-line real time catching the in-chip weak patterns/defects per million opportunities (WP-DPMO) plays more and more significant role for product yield with high density memory. However, the current in-line inspection tools focus on single layer defect inspection, not effectively and efficiently to catch multi-layer weak patterns/defects even through voltage contrast and/or special test structure design [1]-[2]. In general, the multi-layer weak patterns/defects are escaped easily by using in-line inspection and cause ignorance of product dysfunction until off-line time-consuming final PFA/EFA will be used. To effectively and efficiently in-line real time monitor the potential multi-layer weak patterns, we quantify the bridge electrical metric between contact and gate electrodes into CD physical metric via big data from the larger field of view (FOV: 8k x 16k with 3 nm pixel equalizes to image main field size 34 um x 34 um @ 3 nm pixel) e-beam quality image contour compared to layout GDS database (D2DB) as shown in Fig. 1. Hadoop-based distributed parallel computing is implemented to improve the performance of big data architectures, Fig. 2. Therefore, the state of art in-line real time catching in-chip potential multi-layer weak patterns can be proven and achieved by following some studying cases [3]. Therefore, manufacturing sources of variations can be partitioned to systematic and random variations by applying statistical techniques based on the big data fundamental infrastructures. After big data handling, the in-chip CD and AA variations are distinguished by

  10. Period Variations for the Cepheid VZ Cyg

    Science.gov (United States)

    Sirorattanakul, Krittanon; Engle, Scott; Pepper, Joshua; Wells, Mark; Laney, Clifton D.; Rodriguez, Joseph E.; Stassun, Keivan G.

    2017-12-01

    The Cepheid Period-Luminosity law is a key rung on the extragalactic distance ladder. However, numerous Cepheids are known to undergo period variations. Monitoring, refining, and understanding these period variations allows us to better determine the parameters of the Cepheids themselves and of the instability strip in which they reside, and to test models of stellar evolution. VZ Cyg, a classical Cepheid pulsating at ˜4.864 days, has been observed for over 100 years. Combining data from literature observations, the Kilodegree Extremely Little Telescope (KELT) transit survey, and new targeted observations with the Robotically Controlled Telescope (RCT) at Kitt Peak, we find a period change rate of dP/dt = -0.0642 ± 0.0018 s yr-1. However, when only the recent observations are examined, we find a much higher period change rate of dP/dt = -0.0923 ± 0.0110 s yr-1. This higher rate could be due to an apparent long-term (P ≈ 26.5 years) cyclic period variation. The possible interpretations of this single Cepheid’s complex period variations underscore both the need to regularly monitor pulsating variables and the important benefits that photometric surveys such as KELT can have on the field. Further monitoring of this interesting example of Cepheid variability is recommended to confirm and better understand the possible cyclic period variations. Further, Cepheid timing analyses are necessary to fully understand their current behaviors and parameters, as well as their evolutionary histories.

  11. Time-of-night variations in the story-like organization of dream experience developed during rapid eye movement sleep.

    Science.gov (United States)

    Cipolli, Carlo; Guazzelli, Mario; Bellucci, Claudia; Mazzetti, Michela; Palagini, Laura; Rosenlicht, Nicholas; Feinberg, Irwin

    2015-04-01

    This study aimed to investigate the cycles (2nd/4th) and duration-related (5/10 min) variations in the story-like organization of dream experience elaborated during rapid eye movement (REM) sleep. Dream reports were analysed using story grammar rules. Reports were provided by those subjects (14 of 22) capable of reporting a dream after each of the four awakenings provoked in 2 consecutive nights during REM sleep of the 2nd and 4th cycles, after periods of either 5 or 10 min, counterbalanced across the nights. Two researchers who were blind as to the sleep condition scored the dream reports independently. The values of the indicators of report length (measured as value of total word count) and of story-like organization of dream reports were matched taking time-of-night (2nd and 4th cycles) and REM duration (5 versus 10 min) as factors. Two-way analyses of variance showed that report length increased significantly in 4th-cycle REM sleep and nearly significantly for longer REM duration, whereas the number of dream-stories per report did not vary. The indices of sequential (number of statements describing the event structure developed in the story) and hierarchical (number of episodes per story) organization increased significantly only in dream-stories reported after 10 min of 4th-cycle REM sleep. These findings indicate that the characteristics of structural organization of dream-stories vary along with time of night, and suggest that the elaboration of a long and complex dream-story requires a fairly long time and the availability of a great amount of cognitive resources to maintain its continuity and coherence. © 2014 European Sleep Research Society.

  12. Genetic variation in IL-16 miRNA target site and time to prostate cancer diagnosis in African American men

    Science.gov (United States)

    Hughes, Lucinda; Ruth, Karen; Rebbeck, Timothy R.; Giri, Veda N.

    2013-01-01

    Background Men with a family history of prostate cancer and African American men are at high risk for prostate cancer and in need of personalized risk estimates to inform screening decisions. This study evaluated genetic variants in genes encoding microRNA (miRNA) binding sites for informing of time to prostate cancer diagnosis among ethnically-diverse, high-risk men undergoing prostate cancer screening. Methods The Prostate Cancer Risk Assessment Program (PRAP) is a longitudinal screening program for high-risk men. Eligibility includes men ages 35-69 with a family history of prostate cancer or African descent. Participants with ≥ 1 follow-up visit were included in the analyses (n=477). Genetic variants in regions encoding miRNA binding sites in four target genes (ALOX15, IL-16, IL-18, and RAF1) previously implicated in prostate cancer development were evaluated. Genotyping methods included Taqman® SNP Genotyping Assay (Applied Biosystems) or pyrosequencing. Cox models were used to assess time to prostate cancer diagnosis by risk genotype. Results Among 256 African Americans with ≥ one follow-up visit, the TT genotype at rs1131445 in IL-16 was significantly associated with earlier time to prostate cancer diagnosis vs. the CC/CT genotypes (p=0.013), with a suggestive association after correction for false-discovery (p=0.065). Hazard ratio after controlling for age and PSA for TT vs. CC/CT among African Americans was 3.0 (95% CI 1.26-7.12). No association to time to diagnosis was detected among Caucasians by IL-16 genotype. No association to time to prostate cancer diagnosis was found for the other miRNA target genotypes. Conclusions Genetic variation in IL-16 encoding miRNA target site may be informative of time to prostate cancer diagnosis among African American men enrolled in prostate cancer risk assessment, which may inform individualized prostate cancer screening strategies in the future. PMID:24061634

  13. Long-term trends of foE and geomagnetic activity variations

    Directory of Open Access Journals (Sweden)

    A. V. Mikhailov

    2003-03-01

    Full Text Available A relationship between foE trends and geomagnetic activity long-term variations has been revealed for the first time. By analogy with earlier obtained results on the foF2 trends it is possible to speak about the geomagnetic control of the foE long-term trends as well. Periods of increasing geomagnetic activity correspond to negative foE trends, while these trends are positive for the decreasing phase of geomagnetic activity. This "natural" relationship breaks down around 1970 (on some stations later when pronounced positive foE trends have appeared on most of the stations considered. The dependence of foE trends on geomagnetic activity can be related with nitric oxide variations at the E-layer heights. The positive foE trends that appeared after the "break down" effect may also be explained by the [NO] decrease which is not related to geomagnetic activity variations. But negative trends or irregular foE variations on some stations for the same time period require some different mechanism. Chemical pollution of the lower thermosphere due to the anthropogenic activity may be responsible for such abnormal foE behavior after the end of the 1960s.Key words. Ionosphere (ionosphere-atmosphere interactions; ionospheric disturbances

  14. Time-dependent post-imperative negative variation indicates adaptation and problem solving in migraine patients.

    Science.gov (United States)

    Kropp, Peter; Brecht, Ines-Beatrice; Niederberger, Uwe; Kowalski, Jens; Schröder, Dietmar; Thome, Johannes; Meyer, Wolfgang; Wallasch, Thomas-Martin; Hilgendorf, Inken; Gerber, Wolf-Dieter

    2012-10-01

    According to the Seligman theory of learned helplessness, depression is caused by a repetitive experience of loss of control resulting in internal, stable and global attributional styles for negative events. In depressed patients and healthy controls experiencing such events, an increased amplitude of the post-imperative negative variation (PINV) has been described. The aim of the study was to investigate a possible correlation between migraine, depression, learned helplessness and PINV. 24 patients suffering from migraine without aura and 24 healthy controls were exposed to a situation of loss of control whilst the contingent negative variation (CNV) from C3, C4 and Cz were recorded. Before conducting the experiment, the subjects were asked to answer the Beck Depression Inventory (BDI) and the German attributional style questionnaire (GASQ). Amplitudes of total CNV, early and late component and PINV were calculated in eight blocks of four recordings each. The results confirm findings of a pronounced PINV in situations of loss of control, though high amplitudes were not correlated with low values in the GASQ and therefore with learned helplessness. High PINV in migraine patients correlated with high scores in the BDI and the list of the complaints questionnaire. However, this was not the case in healthy controls. In this experimental situation, PINV in migraine patients can be interpreted as an expectancy potential in order to avoid failure and helplessness.

  15. Time Spent Outdoors, Depressive Symptoms, and Variation by Race and Ethnicity.

    Science.gov (United States)

    Beyer, Kirsten M M; Szabo, Aniko; Nattinger, Ann B

    2016-09-01

    Numerous studies have explored neighborhood environmental correlates of mental illnesses, presuming that the time individuals spend in their environment can confer benefit or harm based on environmental characteristics. However, few population-based studies have directly examined the relationship between time spent outdoors and mental health, and little work has been done to explore how experiences differ by race and ethnicity. Though some have proposed "doses of outdoor time" to improve health, the absence of information about the benefits conferred by particular "doses," and expected baseline levels of outdoor time, are needed to inform the development of recommendations and interventions. This study examined the relationship between time spent outdoors and depression among a population-based sample of American adults, characterized current levels of time spent outdoors by race and ethnicity, and examined how the relationship between time spent outdoors and depression varies by race and ethnicity. Descriptive statistics and survey regression models were used to examine data from the National Health and Nutrition Examination Survey for 2009-2012. Findings provide evidence that time spent outdoors is associated with fewer depressive symptoms, but this benefit may not be equally distributed by race and ethnicity. Descriptive analyses also reveal differences in time spent outdoors among different racial and ethnic groups. Study findings support the notion that increasing time spent outdoors may result in mental health benefits. However, this study questions whether that benefit is experienced equally among different groups, particularly given differences in occupational experiences and environmental characteristics of neighborhoods. Copyright © 2016 American Journal of Preventive Medicine. Published by Elsevier Inc. All rights reserved.

  16. Actinide collisions for QED and superheavy elements with the time-dependent Hartree-Fock theory and the Balian-Vénéroni variational principle

    Directory of Open Access Journals (Sweden)

    Kedziora David J.

    2011-10-01

    Full Text Available Collisions of actinide nuclei form, during very short times of few zs (10−21 s, the heaviest ensembles of interacting nucleons available on Earth. Such collisions are used to produce super-strong electric fields by the huge number of interacting protons to test spontaneous positron-electron pair emission (vacuum decay predicted by the quantum electrodynamics (QED theory. Multi-nucleon transfer in actinide collisions could also be used as an alternative way to fusion in order to produce neutron-rich heavy and superheavy elements thanks to inverse quasifission mechanisms. Actinide collisions are studied in a dynamical quantum microscopic approach. The three-dimensional time-dependent Hartree-Fock (TDHF code tdhf3d is used with a full Skyrme energy density functional to investigate the time evolution of expectation values of one-body operators, such as fragment position and particle number. This code is also used to compute the dispersion of the particle numbers (e.g., widths of fragment mass and charge distributions from TDHF transfer probabilities, on the one hand, and using the BalianVeneroni variational principle, on the other hand. A first application to test QED is discussed. Collision times in 238U+238U are computed to determine the optimum energy for the observation of the vacuum decay. It is shown that the initial orientation strongly affects the collision times and reaction mechanism. The highest collision times predicted by TDHF in this reaction are of the order of ~ 4 zs at a center of mass energy of 1200 MeV. According to modern calculations based on the Dirac equation, the collision times at Ecm > 1 GeV are sufficient to allow spontaneous electron-positron pair emission from QED vacuum decay, in case of bare uranium ion collision. A second application of actinide collisions to produce neutron-rich transfermiums is discussed. A new inverse quasifission mechanism associated to a specific orientation of the nuclei is proposed to

  17. Sea-level Variation Along the Suez Canal

    Science.gov (United States)

    Eid, F. M.; Sharaf El-Din, S. H.; Alam El-Din, K. A.

    1997-05-01

    The variation of sea level at 11 stations distributed along the Suez Canal was studied during the period from 1980 to 1986. The ranges of variation in daily mean sea level at Port Said and Port Tawfik are about 60 and 120 cm, respectively. The minimum range of daily variation is at Kantara (47 cm). The fluctuations of the monthly mean sea level between the two ends of the Suez Canal vary from one season to another. From July to December, the sea level at Port Said is higher than that at Port Tawfik, with the maximum difference (10·5 cm) in September. During the rest of the year, the mean sea level at Port Tawfik is higher than that at Port Said, with the maximum difference (31·5 cm) in March. The long-term variations of the annual mean sea level at both Port Said and Port Tawfik for the period from 1923 to 1986 showed a positive trend. The sea level at Port Said increased by about 27·8 cm century -1while it increased by only 9·1 cm century -1at Port Tawfik. This indicates that the difference between sea level at Port Said and Port Tawfik has decreased with time.

  18. Short-term variations of Icelandic ice cap mass inferred from cGPS coordinate time series

    DEFF Research Database (Denmark)

    Compton, Kathleen; Bennett, Richard A.; Hreinsdóttir, Sigrún

    2017-01-01

    As the global climate changes, understanding short-term variations in water storage is increasingly important. Continuously operating Global Positioning System (cGPS) stations in Iceland record annual periodic motion—the elastic response to winter accumulation and spring melt seasons—with peak-to...... insulation in response to tephra deposition following volcanic eruptions, processes that are not resolved with once or twice-yearly stake measurements....

  19. Analysis of holding time variations to Ni and Fe content and morphology in nickel laterite limonitic reduction process by using coal-dolomite bed

    Science.gov (United States)

    Abdul, Fakhreza; Pintowantoro, Sungging; Yuwandono, Ridwan Bagus

    2018-04-01

    With the depletion of nickel sulfide ore resources, the nickel laterit processing become an attention to fulfill nickel world demans. Reducing laterite nickel by using a low cost carbonaceous reductan has proved produces high grade ferronickel alloy. In this research, reduction was carried out to low grade laterite nickel (limonite) with 1.25% nikel content by using CO gas reductant formed by reaction between coal and dolomite. Reduction process preceded by forming brickets mixture from limonit ore, coal, and Na2SO4, then the brickets placed inside crucible bed together with dolomit and reduced at temperature 1400 °C with holding time variations 4, 6, and 8 hours. EDX, XRD, and SEM test were carried out to find out the Ni and nickel grade after reduced, the phases that formed, and the morphology brickets after reduced. The reduction results shows that the highest increase on nickel grade was obtained by 8 hours holding time increasing 5.84 % from initial grade, and the highest recovery was obtained by 6 hours holding time with recovery 88.51 %. While the higest increase on Fe grade was obtained by 4 hours holding time, and the highest recovery Fe was obtained by 4 hours holding time with recovery 85.41%.

  20. Effect of genetic variation in a Drosophila model of diabetes-associated misfolded human proinsulin.

    Science.gov (United States)

    He, Bin Z; Ludwig, Michael Z; Dickerson, Desiree A; Barse, Levi; Arun, Bharath; Vilhjálmsson, Bjarni J; Jiang, Pengyao; Park, Soo-Young; Tamarina, Natalia A; Selleck, Scott B; Wittkopp, Patricia J; Bell, Graeme I; Kreitman, Martin

    2014-02-01

    The identification and validation of gene-gene interactions is a major challenge in human studies. Here, we explore an approach for studying epistasis in humans using a Drosophila melanogaster model of neonatal diabetes mellitus. Expression of the mutant preproinsulin (hINS(C96Y)) in the eye imaginal disc mimics the human disease: it activates conserved stress-response pathways and leads to cell death (reduction in eye area). Dominant-acting variants in wild-derived inbred lines from the Drosophila Genetics Reference Panel produce a continuous, highly heritable distribution of eye-degeneration phenotypes in a hINS(C96Y) background. A genome-wide association study (GWAS) in 154 sequenced lines identified a sharp peak on chromosome 3L, which mapped to a 400-bp linkage block within an intron of the gene sulfateless (sfl). RNAi knockdown of sfl enhanced the eye-degeneration phenotype in a mutant-hINS-dependent manner. RNAi against two additional genes in the heparan sulfate (HS) biosynthetic pathway (ttv and botv), in which sfl acts, also modified the eye phenotype in a hINS(C96Y)-dependent manner, strongly suggesting a novel link between HS-modified proteins and cellular responses to misfolded proteins. Finally, we evaluated allele-specific expression difference between the two major sfl-intronic haplotypes in heterozygtes. The results showed significant heterogeneity in marker-associated gene expression, thereby leaving the causal mutation(s) and its mechanism unidentified. In conclusion, the ability to create a model of human genetic disease, map a QTL by GWAS to a specific gene, and validate its contribution to disease with available genetic resources and the potential to experimentally link the variant to a molecular mechanism demonstrate the many advantages Drosophila holds in determining the genetic underpinnings of human disease.