Q-switched oscillation in thulium-doped fiber lasers using preloaded dynamic microbending technique
Sakata, H.; Takahashi, N.; Ushiro, Y.
2018-01-01
We demonstrate Q-switched pulse generation in thulium-doped fiber lasers by introducing piezoelectric-driven microbend with preloaded stress. We employed a pair of corrugated chips each attached on piezoelectric actuators (PAs) to clamp the fiber in a ring laser resonator. The thulium-doped fiber is pumped by a laser diode emitting at 1.63 μm and generates the Q-switched laser pulses at around 1.9 μm by switching off the PAs. The laser pulse performance is improved by optimizing the preload and switch-off period for the PAs. The Q-switched pulses with a peak power of 2.8 W and a pulsewidth of 900 ns are observed for a launched pump power of 161 mW. We expect that the in-fiber Q-switching technique will provide efficient laser systems for environmental sensing and medical applications.
Thulium oxide fuel characterization study: Part 3, Procedures
International Nuclear Information System (INIS)
Nelson, C.A.; Anderson, R.W.; Talbot, M.; Bierds, W.
1970-06-01
Procedures are presented for the following: Tm 2 O 3 -Yb 2 O 3 pseudo - binary phase diagram tests; compatibility tests; thulium-170 oxide dose rate measurements; preparation of Tm 2 O 3 wafers; SRL thulium and/or ytterbium oxide powder reprocessing for sintering; cold pressing and sintering thulium oxide wafers; preparation of thulium and/or ytterbium oxide powder via precipitation with oxalic acid, ammonium oxalate, urea and methyl oxalate; determination of the total surface area of rare earth oxide powders; determining oxygen in thulia - thulia/ytterbia for the purpose of determining metal-to-oxygen ratios; and determination of the impact resistance to fines generation of sintered rare earth oxide
Self-powered detectors with thulium emitter
International Nuclear Information System (INIS)
Haller, P.; Klar, E.
1978-01-01
In addition to fission chambers, prompt-indicating self-powered (SPN) detectors are used for measuring the neutron flux density in the core of power reactors. Although current SPN detectors with a cobalt emitter give satisfactora results, detectors with other emitter materials have been analyzed and tested. The author describes the properties and decay pattern of the nuclide thulium and presents the results of measurements made while testing thulium detectors. (orig.) [de
Transurethral vaporesection of prostate: diode laser or thulium laser?
Tan, Xinji; Zhang, Xiaobo; Li, Dongjie; Chen, Xiong; Dai, Yuanqing; Gu, Jie; Chen, Mingquan; Hu, Sheng; Bai, Yao; Ning, Yu
2018-05-01
This study compared the safety and effectiveness of the diode laser and thulium laser during prostate transurethral vaporesection for treating benign prostate hyperplasia (BPH). We retrospectively analyzed 205 patients with BPH who underwent a diode laser or thulium laser technique for prostate transurethral vaporesection from June 2016 to June 2017 and who were followed up for 3 months. Baseline characteristics of the patients, perioperative data, postoperative outcomes, and complications were compared. We also assessed the International Prostate Symptom Score (IPSS), quality of life (QoL), maximum flow rate (Q max ), average flow rate (AFR), and postvoid residual volume (PVR) at 1 and 3 months postoperatively to evaluate the functional improvement of each group. There were no significant differences between the diode laser and thulium laser groups related to age, prostate volume, operative time, postoperative hospital stays, hospitalization costs, or perioperative data. The catheterization time was 3.5 ± 0.8 days for the diode laser group and 4.7 ± 1.8 days for the thulium laser group (p diode laser and thulium laser contributes to safe, effective transurethral vaporesection in patients with symptomatic BPH. Diode laser, however, is better than thulium laser for prostate transurethral vaporesection because of its shorter catheterization time. The choice of surgical approach is more important than the choice of laser types during clinical decision making for transurethral laser prostatectomy.
Thulium distributed-feedback fiber lasers
DEFF Research Database (Denmark)
Agger, Søren Dyøe
2006-01-01
in silica and the fabri- cation, design and characterization of coherent Distributed Feed-Back (DFB) ber lasers incorporating thulium as the active laser medium. Our recent results have proved that single-frequency, single-polarization, narrow-linewidth (tens of kHz) operation of thulium doped DFB ber...... lasers is possible. Demonstrations of single-frequency lasers have, until now, been achieved at 1740 nm, 1984 nm and at a record-breaking 2090 nm. The 1740 nm laser has been boosted to 60 mW of output power with a linewidth of only 3 kHz and implemented in a plug-and-play turnkey system with SMF28-APC...
Capture cross section and resonance parameters of thulium-169
International Nuclear Information System (INIS)
Arbo, J.C.; Felvinci, J.P.; Melkonian, E.; Havens, W.W. Jr.
1975-01-01
The previously analyzed energy range for thulium capture resonance parameters is extended from 1 keV to 2 keV. In addition, point and group averaged thulium cross section curves are extended to above 2 keV and 181 Ta impurity levels are discussed. (SDF)
[Transurethral thulium laser urethrotomy for urethral stricture].
Liu, Chun-Lai; Zhang, Xi-Ling; Liu, Yi-Li; Wang, Ping
2011-09-01
To evaluate the effect of endourethrotomy with thulium laser as a minimally invasive treatment for urethral stricture. We treated 36 cases of urethral stricture or atresia by endourethrotomy with thulium laser, restored the urethral continuity by vaporization excision of the scar tissue, and observed the clinical effects and complications. The mean operation time was 35 min, ranging from 10 to 90 min. Smooth urination was achieved after 2-6 weeks of catheter indwelling, with no urinary incontinence. The patients were followed up for 4-24 (mean 12) months, during which 27 did not need any reintervention, 5 developed urinary thinning but cured by urethral dilation, 3 received another laser urethrotomy for previous negligence of timely urethral dilation, and the other 1 underwent open urethroplasty. Thulium laser urethrotomy is a safe and effective minimally invasive option for short urethral stricture, which is also suitable for severe urethral stricture and urethral atresia. Its short-term outcome is satisfactory, but its long-term effect remains to be further observed.
Single-frequency thulium-doped distributed-feedback fibre laser
DEFF Research Database (Denmark)
Agger, Søren; Povlsen, Jørn Hedegaard; Varming, Poul
2004-01-01
We have successfully demonstrated a single-frequency distributed-feedback (DFB) thulium-doped silica fiber laser emitting at a wavelength of 1735 nm. The laser cavity is less than 5 cm long and is formed by intracore UV-written Bragg gratings with a phase shift. The laser is pumped at 790 nm from...... a Ti:sapphire laser and has a threshold pump power of 59 mW. The laser has a maximum output power of 1 mW in a singlefrequency, single-polarization radiation mode and is tunable over a few nanometers. To the best of the authors’ knowledge, this is the first report of a single-frequency DFB fiber laser...... that uses thulium as the amplifying medium. The lasing wavelength is the longest demonstrated with DFB fiber lasers and yet is among the shortest obtained for thulium-doped silica fiber lasers....
Thulium laser urethrotomy for urethral stricture: a preliminary report.
Wang, Linhui; Wang, Zhixiang; Yang, Bo; Yang, Qing; Sun, Yinghao
2010-09-01
The outcome of thulium laser urethrotomy for patients with urethral stricture had not been reported. The purpose of this study was to evaluate outcome of endourethrotomy with the thulium laser as a minimally invasive treatment for urethral stricture. Twenty-one consecutive patients with urethral stricture were evaluated by retrograde uroflowmetry, International Prostate Symptom Score (IPSS), and quality of life preoperatively at a single academic center. All patients were treated with thulium laser urethrotomy. All patients were followed up for 12-24 months postoperatively by uroflowmetry and by retrograde with voiding cystourethrogram every 3 months. And all patients were followed up by mailed questionnaire, including IPSS and quality of life. Retrograde endoscopic thulium laser urethrotomy was performed in all 21 patients. Most patients (N = 16; 76.2%) did not need any reintervention. Five patients developed recurrent strictures, of them two patients were treated by another laser urethrotomy, one patient was treated by open urethroplasty with buccal mucosa and the other two patients' reintervention were treated by urethral dilation. No intraoperative complications were encountered, although in 9.5% (N = 2) of patients, a urinary tract infection was diagnosed postoperatively. No gross hematuria occurred. Including two patients treated with repeat laser urethrotomy, 17(81.0%) showed good flow of urine (Q(ave)>16.0 ml/second) and adequate caliber urethra in retrograde urethrogram (RGU) 12 months after operation. Three (14.3%) patients showed narrow stream of urine (Q(ave)urethrotomy. The thulium laser urethrotomy was a safe and effective minimally invasive therapeutic modality for urethral stricture. 2010 Wiley-Liss, Inc.
Thulium heat source for high-endurance and high-energy density power systems
International Nuclear Information System (INIS)
Walter, C.E.; Kammeraad, J.E.; Van Konynenburg, R.; VanSant, J.H.
1991-05-01
We are studying the performance characteristics of radioisotope heat source designs for high-endurance and high-energy-density power systems that use thulium-170. Heat sources in the power range of 5--50 kW th coupled with a power conversion efficiency of ∼30%, can easily satisfy current missions for autonomous underwater vehicles. New naval missions will be possible because thulium isotope power systems have a factor of one-to-two hundred higher endurance and energy density than chemical and electrochemical systems. Thulium-170 also has several other attractive features, including the fact that it decays to stable ytterbium-170 with a half-life of four months. For terrestrial applications, refueling on that time scale should be acceptable in view of the advantage of its benign decay. The heat source designs we are studying account for the requirements of isotope production, shielding, and integration with power conversion components. These requirements are driven by environmental and safety considerations. Thulium is present in the form of thin refractory thulia disks that allow power conversion at high peak temperature. We give estimates of power system state points, performance, mass, and volume characteristics. Monte Carlo radiation analysis provides a detailed assessment of shield requirements and heat transfer under normal and distressed conditions is also considered. 11 refs., 7 figs., 4 tabs
Zero ischemia laparoscopic partial thulium laser nephrectomy.
LENUS (Irish Health Repository)
Thomas, Arun Z
2013-11-01
Laser technology presents a promising alternative to achieve tumor excision and renal hemostasis with or without hilar occlusion, yet its use in partial nephrectomy has not been significantly evaluated. We prospectively evaluated the thulium:yttrium-aluminum-garnet laser in laparoscopic partial nephrectomy (LPN) in our institution over a 1-year period.
Thulium-based bulk metallic glass
International Nuclear Information System (INIS)
Yu, H. B.; Yu, P.; Wang, W. H.; Bai, H. Y.
2008-01-01
We report the formation and properties of a thulium-based bulk metallic glass (BMG). Compared with other known rare-earth (RE) based BMGs, Tm-based BMGs show features of excellent glass formation ability, considerable higher elastic modulus, smaller Poisson's ratio, high mechanical strength, and intrinsic brittleness. The reasons for the different properties between the Tm-based and other RE-based BMGs are discussed. It is expected that the Tm-based glasses with the unique properties are appropriate candidates for studying some important issues in BMGs
Enhanced performance of an S-band fiber laser using a thulium-doped photonic crystal fiber
Muhammad, A. R.; Emami, S. D.; Hmood, J. K.; Sayar, K.; Penny, R.; Abdul-Rashid, H. A.; Ahmad, H.; Harun, S. W.
2014-11-01
This work proposes a new method to enhance the performance of an S-band fiber laser by using a thulium-doped photonic crystal fiber (PCF). The proposed method is based on amplified spontaneous emission (ASE) suppression provided by the thulium-doped PCF unique geometric structure. The enhanced performance of this filter based PCF is dependent on the short and long cut-off wavelength characteristics that define the fiber transmission window. Realizing the short wavelength cut-off location requires the PCF cladding to be doped with a high index material, which provides a refractive index difference between the core and cladding region. Achieving the long cut-off wavelength necessitates enlarging the size of the air holes surrounding the rare-earth doped core region. The PCF structure is optimized so as to achieve the desired ASE suppression regions of below 0.8 μm and above 1.8 μm. The laser performance is simulated for different host media, namely pure silica, alumino-silicate, and fluoride-based fiber ZBLAN based on this thulium-doped PCF design. The host media spectroscopic details, including lifetime variations and quantum efficiency effect on the lasing emission are also discussed. Information on the filter based PCF design is gathered via a full-vectorial finite element method analysis and specifically a numerical modelling solution for the energy level rate equation using the Runge-Kutta method. Results are analyzed for gain improvement, lasing cavity, laser efficiency and effect of core size diameter variation. Results are compared with conventional thulium-doped fiber and thulium-doped PCF for every single host media. We observe that the ZBLAN host media is the most promising candidate due to its greater quantum efficiency.
Enhanced performance of an S-band fiber laser using a thulium-doped photonic crystal fiber
International Nuclear Information System (INIS)
Muhammad, A R; Emami, S D; Penny, R; Ahmad, H; Harun, S W; Hmood, J K; Sayar, K; Abdul-Rashid, H A
2014-01-01
This work proposes a new method to enhance the performance of an S-band fiber laser by using a thulium-doped photonic crystal fiber (PCF). The proposed method is based on amplified spontaneous emission (ASE) suppression provided by the thulium-doped PCF unique geometric structure. The enhanced performance of this filter based PCF is dependent on the short and long cut-off wavelength characteristics that define the fiber transmission window. Realizing the short wavelength cut-off location requires the PCF cladding to be doped with a high index material, which provides a refractive index difference between the core and cladding region. Achieving the long cut-off wavelength necessitates enlarging the size of the air holes surrounding the rare-earth doped core region. The PCF structure is optimized so as to achieve the desired ASE suppression regions of below 0.8 μm and above 1.8 μm. The laser performance is simulated for different host media, namely pure silica, alumino-silicate, and fluoride-based fiber ZBLAN based on this thulium-doped PCF design. The host media spectroscopic details, including lifetime variations and quantum efficiency effect on the lasing emission are also discussed. Information on the filter based PCF design is gathered via a full-vectorial finite element method analysis and specifically a numerical modelling solution for the energy level rate equation using the Runge–Kutta method. Results are analyzed for gain improvement, lasing cavity, laser efficiency and effect of core size diameter variation. Results are compared with conventional thulium-doped fiber and thulium-doped PCF for every single host media. We observe that the ZBLAN host media is the most promising candidate due to its greater quantum efficiency. (paper)
Fedushkin, I L; Bochkarev, M N; Dechert, S; Schumann, H
2001-08-17
Thulium diiodide reduces cyclic aromatic hydrocarbons that have reduction potentials more positive than - 2.0 V versus SCE. Thus, TmI2 reacts with cyclooctatetraene or acenaphthylene in THF, or with lithium anthracenide in 1,2-dimethoxyethane (DME) to give thulium triiodide and the thulium(III) complexes [(eta8-C8H8)TmI(thf)2] (1), rac-ansa-[(eta5-C12H8)2TmI(thf)] (2), or [(eta2-C14H10)TmI-(dme)2] (3), respectively. The molecular structures of 1-3 were determined by single-crystal X-ray diffraction.
Walter, Carl E.; Van Konynenburg, Richard; VanSant, James H.
1992-01-01
An isotopic heat source is formed using stacks of thin individual layers of a refractory isotopic fuel, preferably thulium oxide, alternating with layers of a low atomic weight diluent, preferably graphite. The graphite serves several functions: to act as a moderator during neutron irradiation, to minimize bremsstrahlung radiation, and to facilitate heat transfer. The fuel stacks are inserted into a heat block, which is encased in a sealed, insulated and shielded structural container. Heat pipes are inserted in the heat block and contain a working fluid. The heat pipe working fluid transfers heat from the heat block to a heat exchanger for power conversion. Single phase gas pressure controls the flow of the working fluid for maximum heat exchange and to provide passive cooling.
Kwon, In Ho; Bae, Youin; Yeo, Un-Cheol; Lee, Jin Yong; Kwon, Hyuck Hoon; Choi, Young Hee; Park, Gyeong-Hun
2018-02-01
The histologic responses to varied parameters of 1,927-nm fractional thulium fiber laser treatment have not yet been sufficiently elucidated. This study sought to evaluate histologic changes immediately after 1,927-nm fractional thulium fiber laser session at various parameters. The dorsal skin of Yucatan mini-pig was treated with 1,927-nm fractional thulium fiber laser at varied parameters, with or without skin drying. The immediate histologic changes were evaluated to determine the effects of varying laser parameters on the width and the depth of treated zones. The increase in the level of pulse energy widened the area of epidermal changes in the low power level, but increased the dermal penetration depth in the high power level. As the pulse energy level increased, the increase in the power level under the given pulse energy level more evidently made dermal penetration deeper and the treatment area smaller. Skin drying did not show significant effects on epidermal changes, but evidently increased the depth of dermal denaturation under both high and low levels of pulse energy. These results may provide important information to establish treatment parameters of the 1,927-nm fractional thulium fiber laser for various skin conditions.
International Nuclear Information System (INIS)
Castrillejo, Y.; Fernandez, P.; Bermejo, M.R.; Barrado, E.; Martinez, A.M.
2009-01-01
The electrochemical behaviour of TmCl 3 solutions was studied in the eutectic LiCl-KCl in the temperature range 673-823 K using inert and reactive electrodes, i.e. W and Al, respectively. On an inert electrode, Tm(III) ions are reduced to metallic thulium through two consecutive steps: Tm(III) + 1e ↔ Tm(II) and Tm(II) + 2e ↔ Tm(0) The electroreduction of Tm(III) to Tm(II) was found to be quasi-reversible. The intrinsic rate constant of charge transfer, k 0 , as well as of the charge transfer coefficient, α, have been calculated by simulation of the cyclic voltammograms and logarithmic analysis of the convoluted curves. Electrocrystallization of thulium plays an important role in the electrodeposition process, being the nucleation mode affected by temperature. The diffusion coefficients of Tm(III) and Tm(II) ions have been found to be equal. The validity of the Arrhenius law was verified by plotting the variation of the logarithm of the diffusion coefficients vs. 1/T. The electrode reactions of Tm(III) solutions at an Al electrode were also investigated. The results showed that for the extraction of thulium from molten chlorides, the use of a reactive electrode made of aluminium leading to Al-Tm alloys seems to be a pertinent route. Potentiometric titrations of Tm(III) solutions with oxide donors, using a ytria stabilized zirconia electrode 'YSZE' as a pO 2- indicator electrode, have shown the formation of thulium oxychloride and thulium oxide and their corresponding solubility products have been determined at 723 K (pk s (TmOCl) = 8.0 ± 0.3 pk s (Tm 2 O 3 ) = 18.8 ± 0.7).
Use of thulium-sensitized rare earth-doped low phonon energy crystalline hosts for IR sources.
Ganem, Joseph; Bowman, Steven R
2013-11-01
Crystalline hosts with low phonon energies enable novel energy transfer processes when doped with rare earth ions. Two applications of energy transfer for rare earth ions in thulium-sensitized low phonon energy crystals that result in infrared luminescence are discussed. One application is an endothermic, phonon-assisted cross-relaxation process in thulium-doped yttrium chloride that converts lattice phonons to infrared emission, which raises the possibility of a fundamentally new method for achieving solid-state optical cooling. The other application is an optically pumped mid-IR phosphor using thulium-praseodymium-doped potassium lead chloride that converts 805-nm diode light to broadband emission from 4,000 to 5,500 nm. These two applications in chloride crystals are discussed in terms of critical radii calculated from Forster-Dexter energy transfer theory. It is found that the critical radii for electric dipole-dipole interactions in low phonon energy chloride crystals are comparable to those in conventional oxide and fluoride crystals. It is the reduction in multi-phonon relaxation rates in chloride crystals that enable these additional energy transfer processes and infrared luminescence.
The beta strength function structure in β+ decay of lutetium, thulium and cesium isotopes
International Nuclear Information System (INIS)
Alkhazov, G.D.; Bykov, A.A.; Vitman, V.D.; Naumov, Yu.V.; Orlov, S.Yu.
1981-01-01
The spectra of total γ-absorption in the decays of some Lutecium, Thulium and Cesium isotopes have been measured. The probabilities for level population in the decay of the isotopes have been determined. The deduced beta strength functions reveal pronounced structure. Calculations of the strength functions using the Saxon-Woods potential and the residual Gamow-Teller interaction are presented. It is shown that in β + decay of light Thulium and Cesium isotopes the strength function comprises more than 70% of the Gamow-Teller excitations with μsub(tau) = +1. This result is the first direct observation of the Gamow-Teller resonance in β + decay of nuclei with Tsub(z) > O. (orig.)
Thulium-doped fibre broadband source for spectral region near 2 micrometers
Czech Academy of Sciences Publication Activity Database
Písařík, Michael; Peterka, P.; Aubrecht, J.; Cajzl, J.; Benda, A.; Mareš, D.; Todorov, F.; Podrazký, O.; Honzatko, P.; Kašík, I.
2016-01-01
Roč. 24, č. 4 (2016), s. 223-231 ISSN 1230-3402 Institutional support: RVO:68378271 Keywords : fibre lasers * amplified spontaneous emission * thulium-doped fibres Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.449, year: 2016
Rejuvenation of the male scalp using 1,927 nm non-ablative fractional thulium fiber laser.
Boen, Monica; Wilson, Monique J Vanaman; Goldman, Mitchel P; Wu, Douglas C
2017-07-01
The male scalp undergoes extensive photodamage due to a high prevalence of androgenic alopecia and exposure to ultraviolet radiation. This photodamage presents as solar lentigines, fine rhytides, and keratosis, and can prematurely age a patient. In this study, we demonstrate the safety and efficacy of the fractionated 1,927 nm thulium fiber laser using high density and high energy settings to achieve rejuvenation of the male scalp after a single treatment session. Four male patients with Fitzpatrick skin types II-III and extensive photodamage on the scalp underwent one treatment with the fractional non-ablative 1,927 nm thulium fiber laser. The patients had a 60-90% improvement in dyspigmentation, lentigines, and keratosis. No adverse events were observed and the patients tolerated the procedure well. This case series is the first report in the literature demonstrating the successful rejuvenation of the scalp using the 1,927 nm thulium fiber laser. Lasers Surg. Med. 49:475-479, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
Palmero-Martí, J L; Panach-Navarrete, J; Valls-González, L; Ganau-Ituren, A; Miralles-Aguado, J; Benedicto-Redón, A
2017-04-01
To compare the results of efficacy and safety of Thulium laser 150W against Greenlight laser 120W in the treatment of short term benign prostatic hyperplasia (12 months after surgery). This is a retrospective observational study where men who underwent the surgical technique of prostate vaporization over a period of four years in our center are included. The homogeneity of the sample was checked, and postoperative complications (acute urinary retention, reentry, need for transfusion), failures per year of surgery (reoperation, peak flow .05). No differences in complications were observed: in urine acute retention, 4.3% with thulium and 6.8% with green laser (P=.41); in readmissions, 2.6% with thulium and 1.7% with green laser (P=.68); in need for transfusion, 2.6% with thulium and 0% with green laser (P=.12). No differences were observed in the percentage of patients reoperation (1.7% in the group of thulium, 5.1% in the green laser, P=.28); or in individuals with Qmáx less than 15ml/sec (6.9% with thulium, 6.77% with green laser, P=.75), or in the absence of improvement in the IPSS (5, 2% with thulium, 3.4% with green laser, P=.65). There was also no difference in the levels of PSA in ng/mL a year after surgery: with thulium 2.78±2.09 and with green laser 1.83±1.48 (P=.75). Prostate vaporization with thulium laser 150W is comparable to that made with green laser 120W for the treatment of lower urinary tract symptoms caused by BPH, being both effective and safe techniques to 12 months after surgery. Future prospective randomized studies are needed to confirm this conclusion on both techniques. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
Thulium-170-labeled microparticles for local radiotherapy: preliminary studies.
Polyak, Andras; Das, Tapas; Chakraborty, Sudipta; Kiraly, Reka; Dabasi, Gabriella; Joba, Robert Peter; Jakab, Csaba; Thuroczy, Julianna; Postenyi, Zita; Haasz, Veronika; Janoki, Gergely; Janoki, Gyozo A; Pillai, Maroor R A; Balogh, Lajos
2014-10-01
The present article describes the preparation, characterization, and biological evaluation of Thulium-170 ((170)Tm) [T1/2 = 128.4 days; Eβmax = 968 keV; Eγ = 84 keV (3.26%)] labeled tin oxide microparticles for its possible use in radiation synovectomy (RSV) of medium-sized joints. (170)Tm was produced by irradiation of natural thulium oxide target. 170Tm-labeled microparticles were synthesized with high yield and radionuclidic purity (> 99%) along with excellent in vitro stability by following a simple process. Particle sizes and morphology of the radiolabeled particles were examined by light microscope, dynamic light scattering, and transmission electron microscope and found to be of stable spherical morphology within the range of 1.4-3.2 μm. The preparation was injected into the knee joints of healthy Beagle dogs intraarticularly for biological studies. Serial whole-body and regional images were taken by single-photon-emission computed tomography (SPECT) and SPECT-CT cameras up to 9 months postadministration, which showed very low leakage (compound did not show any possible radiotoxicological effect. These preliminary studies showed that 170Tm-labeled microparticles could be a promising nontoxic and effective radiopharmaceutical for RSV applications or later local antitumor therapy.
Thulium heat sources for space power applications
International Nuclear Information System (INIS)
Alderman, C.J.
1992-05-01
Reliable power supplies for use in transportation and remote systems will be an important part of space exploration terrestrial activities. A potential power source is available in the rare earth metal, thulium. Fuel sources can be produced by activating Tm-169 targets in the space station reactor. The resulting Tm-170 heat sources can be used in thermoelectric generators to power instrumentation and telecommunications located at remote sites such as weather stations. As the heat source in a dynamic Sterling or Brayton cycle system, the heat source can provide a lightweight power source for rovers or other terrestrial transportation systems
Thulium-doped fibre broadband source for spectral region near 2 micrometers
Czech Academy of Sciences Publication Activity Database
Písařík, M.; Peterka, Pavel; Aubrecht, Jan; Cajzl, Jakub; Benda, Adam; Mareš, D.; Todorov, Filip; Podrazký, Ondřej; Honzátko, Pavel; Kašík, Ivan
2016-01-01
Roč. 24, č. 4 (2016), s. 223-231 ISSN 1230-3402 R&D Projects: GA MZd(CZ) NV15-33459A Institutional support: RVO:67985882 ; RVO:68378271 Keywords : fibre lasers * amplified spontaneous emission * thulium-doped fibres Subject RIV: BH - Optics, Masers, Lasers OBOR OECD: Optics (including laser optics and quantum optics) Impact factor: 1.449, year: 2016
Electron states in thulium and other rare-earth metals
International Nuclear Information System (INIS)
Strange, P.; Fairbairn, W.M.; Lee, P.M.
1983-01-01
The LMTO method has been applied to calculate band structures for the heavier rare-earth metals. The calculations are relativistic. Thulium in particular has been considered, where a frozen core approximation is used, and the outer electrons are treated selfconsistently. Problems associated with the localisation and interactions of the 4f electrons are discussed. Teh comparisons between experimental data and calculated quantities are encouraging, but more data on high-purity single crystals would be helpful. (author)
Separation of thulium, ytterbium and lutetium from uranium
International Nuclear Information System (INIS)
Lopez, G.H.
1987-01-01
The behaviour at different temperatures, shaking times and hydrochloric acid concentrations on the solvent extraction system UO 2 2+ - (Tm 3+ , Yb 3+ , Lu 3+ ) - H 2 O - HCl - TBP was studied. Quantitative determinations of the elements were performed by visible spectrophotometry and X-ray fluorescence. The uranyl ion was efficiently extracted by TBP from an aqueous hydrochloric acid solution (4-7M) shaken during 10 minutes at room temperature. On these conditions the separation factors for uranium from thulium and ytterbium were found to be 3000 and from lutetium 140. (author)
Two-micron (Thulium) Laser Prostatectomy: An Effective Method for BPH Treatment.
Jiang, Qi; Xia, Shujie
2014-01-01
The two-micron (thulium) laser is the newest laser technique for treatment of bladder outlet obstruction resulting from benign prostatic hyperplasia (BPH). It takes less operative time than standard techniques, provides clear vision and lower blood loss as well as shorter catheterization times and hospitalization times. It has been identified to be a safe and efficient method for BPH treatment regardless of the prostate size.
Determination of thermoluminescence kinetic parameters of thulium doped lithium calcium borate
International Nuclear Information System (INIS)
Jose, M.T.; Anishia, S.R.; Annalakshmi, O.; Ramasamy, V.
2011-01-01
For the first time kinetic parameters of thulium doped Lithium calcium borate (LCB) Thermoluminescence (TL) material are reported here. Irradiated LCB:Tm 3+ powder has revealed two intense TL glow peaks one at 510 (peak 1) and the other at 660 K (peak 2). Activation energy (E), frequency factor (s) and order of kinetics (b) of these peaks were determined by various heating rate (VHR), initial rise (IR), and peak shape (PS) methods. The trap depth and frequency factor determined for peaks 1 and 2 of LCB:Tm phosphor using VHR and IR methods are in good agreement. The average activation energy of peaks 1 and 2 obtained by these methods is 1.62 and 1.91 eV respectively. The frequency factors of peaks 1 and 2 are in the range of 10 13-16 and 10 12-14 sec -1 respectively. The E and s values estimated using the glow peak shape dependent parameters are relatively less compared to the values obtained from other methods. The large difference in these values is due to the complex nature of the glow curves. The order of the kinetics process for complex glow curve peaks could not be assigned on the basis of shape parameters alone but T m response on absorbed dose is to be considered for final confirmation. Glow peaks 1 and 2 of LCB:Tm 3+ obey first and general order kinetics respectively. - Highlights: → Trap depth and frequency factor are determined for the peaks at 510 and 660 K of LCB:Tm. → Parameters obtained by various heating rate and initial rise methods are in good agreement. → Trap depth of peak 1 and peak 2 is 1.61 eV and 1.91 eV respectively. → T m response to absorbed dose is used to distinguish a first order or non-first order kinetics.
Enhanced pump absorption efficiency in coiled and twisted double-clad thulium-doped fibers
Czech Academy of Sciences Publication Activity Database
Koška, Pavel; Peterka, Pavel; Aubrecht, Jan; Podrazký, Ondřej; Todorov, Filip; Becker, M.; Baravets, Yauhen; Honzátko, Pavel; Kašík, Ivan
2016-01-01
Roč. 24, č. 1 (2016), s. 102-107 ISSN 1094-4087 R&D Projects: GA TA ČR(CZ) TH01010997; GA MŠk(CZ) LD15122 Institutional support: RVO:67985882 Keywords : Thulium-doped fiber s * Fiber lasers * Double clad fiber s Subject RIV: BH - Optics , Masers, Lasers Impact factor: 3.307, year: 2016
Separation of carrier-free 181Re produced in 16O-irradiated thulium target
International Nuclear Information System (INIS)
Lahiri, Susanta; Mukhopadhyay, Krishnendu; Banerjee, Kakoli; Ramaswami, A.; Manohar, S.B.
2001-01-01
Heavy ion activation of natural Tm 2 O 3 with 90 MeV 16 O beam results in the formation of carrier-free short-lived 181 Ir and 181 Os which ultimately decay out to 181 Re in the matrix. The liquid cation exchanger, HDEHP, has effectively been utilized as an extractant for quantitative separation of bulk thulium target matrix from carrier-free rhenium radionuclide
Diode-Pumped Thulium (Tm)/Holmium (Ho) Composite Fiber 2.1-Micrometers Laser
2015-09-01
Schematic of the 800-nm diode pumped Tm/Ho composite fiber laser 8 Under quasi-continuous wave (Q- CW ) pumping conditions of 1-ms duration and a...Fig. 9 (Top) Schematic of the 800-nm diode -pumped Tm/Ho composite fiber laser with outcoupler. (Left) Q- CW laser performance of the Tm/Ho composite...ARL-TR-7452 ● SEP 2015 US Army Research Laboratory Diode -Pumped Thulium (Tm)/Holmium (Ho) Composite Fiber 2.1-μm Laser by G
Optical emission spectrographic analysis of thulium oxide for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.; Dixit, V.C.
1988-01-01
An optical emission spectrographic method has been developed for the analysis of high purity thulium oxide to determine rare earth elements Er, Yb, Lu and Y. A 1200 groove/mm grating blazed at 3300 A is used to record the spectrum on Kodak SA-1 photographic plates after the excitation of the graphite-sample (1:1) mixture in DC arc. The determination range is 0.008 per cent to 0.1 per cent and the relative standard deviation is 17.6 per cent. (author). 15 refs., 5 tables, 5 figs
Infrastructure for thulium-170 isotope power systems for autonomous underwater vehicle fleets
International Nuclear Information System (INIS)
Walter, C.E.
1991-07-01
The radioisotope thulium-170 is a safe and environmentally benign heat source for providing the high endurance and energy densities needed by advanced power systems for autonomous underwater vehicles (AUV). Thulium Isotope Power (TIP) systems have an endurance of ∼3000 h, and gravimetric and volumetric energy densities of 3 x 10 4 Wh/kg and 3 x 10 8 Wh/m 3 , respectively. These energy densities are more than 200 times higher than those currently provided by Ag-Zn battery technology. In order to capitalize on these performance levels with about one hundred AUVs in continuous use, it will be necessary to establish an infrastructure for isotope production and heat-source refurbishment. The infrastructure cost is not trivial, and studies are needed to determine its optimum configuration. The major component of the projected infrastructure is the nuclear reactor used to produce Tm- 170 by neutron absorption in Tm-169. The reactor design should ideally be optimized for TM-170 production. Using the byproduct ''waste'' heat beneficially would help defray the cost of isotope production. However, generating electric power with the reactor would compromise both the cost of electricity and the isotope production capacity. A coastal location for the reactor would be most convenient from end-use considerations, and the ''waste'' heat could be used to desalinate seawater in water-thirsty states. 13 refs., 6 figs., 2 tabs
Thermoluminescence dosimetric characteristics of thulium doped ZnB2O4 phosphor
International Nuclear Information System (INIS)
Annalakshmi, O.; Jose, M.T.; Madhusoodanan, U.; Subramanian, J.; Venkatraman, B.; Amarendra, G.; Mandal, A.B.
2014-01-01
Polycrystalline powder samples of rare earth doped Zinc borates were synthesized by high temperature solid state diffusion technique. Dosimetric characteristics of the phosphor like thermoluminescence glow curve, TL emission spectra, dose–response, fading studies, reproducibility and reusability studies were carried out on the synthesized phosphors. Among the different rare earth doped phosphors, thulium doped zinc borate was found to have a higher sensitivity. Hence detailed dosimetric characteristics of this phosphor were carried out. It is observed that the dose–response is linear from 10 mGy to 10 3 Gy in this phosphor. EPR measurements were carried out on unirradiated, gamma irradiated and annealed phosphors to identify the defect centers responsible for thermoluminescence. A TL model is proposed based on the EPR studies in these materials. Kinetic parameters were evaluated for the dosimetric peaks using various methods. The experimental results show that this phosphor can have potential applications in radiation dosimetry applications. -- Highlights: • Polycrystalline powder samples of rare earth doped zinc borates were synthesized. • Thulium was observed to be the most efficient dopant in ZnB 2 O 4 lattice. • TL intensity of the dosimetric peak is around 20 times that of TLD-100. • Based on EPR studies a TL mechanism is proposed in zinc borate. • Deconvolution of the glow curve carried out
7 CFR 1427.161 - Administration.
2010-01-01
... 7 Agriculture 10 2010-01-01 2010-01-01 false Administration. 1427.161 Section 1427.161 Agriculture Regulations of the Department of Agriculture (Continued) COMMODITY CREDIT CORPORATION, DEPARTMENT OF AGRICULTURE LOANS, PURCHASES, AND OTHER OPERATIONS COTTON Recourse Seed Cotton Loans § 1427.161 Administration...
UV emission properties of thulium-doped fluorozirconate glasses
Energy Technology Data Exchange (ETDEWEB)
Piramidowicz, R., E-mail: r.piramidowicz@elka.pw.edu.p [Institute of Microelectronics and Optoelectronics, Koszykowa 75, 00-662 Warsaw (Poland); Telekomunikacja Polska Research and Development Centre, Obrzezna 7, 02-691 Warsaw (Poland); Bok, A.; Klimczak, M.; Malinowski, M. [Institute of Microelectronics and Optoelectronics, Koszykowa 75, 00-662 Warsaw (Poland)
2009-12-15
In this work, we present our latest results on UV emission in bulk ZBLAN glasses doped with thulium ions, broadening knowledge of the short-wavelength optical properties of this system. We examined a set of samples with different activator concentrations (2500, 10,000, 25,000 and 50,000 ppm) in respect of absorption and short-wavelength emission properties. The concentration-dependant spectra of UV emission from the {sup 1}I{sub 6}+{sup 3}P{sub 0} and {sup 1}D{sub 2} levels and fluorescence dynamics profiles have been recorded and carefully examined under direct (one-photon) excitation, enabling discussion of fluorescence quenching mechanisms and determination of appropriate cross-relaxation rates. According to authors' best knowledge, the three-photon red-to-UV up-conversion has been reported for the first time under excitation of a laser diode.
Investigation of diode-laser pumped thulium-doped fluoride lasers
International Nuclear Information System (INIS)
Matos, Paulo Sergio Fabris de
2006-01-01
Tunable lasers emitting around 2.3 mum region are important in many areas, like gas detection, remote sensing and medical applications. Thulium has a large emission spectra around 2.3 mum with demonstrated tuning range of 2.2-2.45 mum using the YLF host. For efficient pump absorption, a high concentration sensitizer like ytterbium can be used. We demonstrate quasi-cw operation of the Yb:Tm:YLF laser, pumped at 960 nm with a 20 W diode bar achieving the highest output power reported so far of 620 mW. Simultaneous pumping of the 2.3 mm Yb:Tm:YLF laser at 685 nm and 960 nm is demonstrated, showing higher slope efficiency than 960 nm alone. Numerical simulations and analytical models show the best ratio of pump power between both wavelengths. (author)
Collimation of a thulium atomic beam by two-dimensional optical molasses
Energy Technology Data Exchange (ETDEWEB)
Sukachev, D D; Kalganova, E S; Sokolov, A V; Savchenkov, A V; Vishnyakova, G A; Golovizin, A A; Akimov, A V; Kolachevsky, Nikolai N; Sorokin, Vadim N
2013-04-30
The number of laser cooled and trapped thulium atoms in a magneto-optical trap is increased by a factor of 3 using a two-dimensional optical molasses which collimated the atomic beam before entering a Zeeman slower. A diode laser operating at 410.6 nm was employed to form optical molasses: The laser was heated to 70 Degree-Sign C by a two-step temperature stabilisation system. The laser system consisting of a master oscillator and an injection-locked amplifier emitted more than 100 mW at 410 nm and had a spectral linewidth of 0.6 MHz. (extreme light fields and their applications)
Thermoluminescence dosimetric characteristics of thulium doped ZnB{sub 2}O{sub 4} phosphor
Energy Technology Data Exchange (ETDEWEB)
Annalakshmi, O. [Radiological Safety Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Jose, M.T., E-mail: mtj@igcar.gov.in [Radiological Safety Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Madhusoodanan, U. [Radiological Safety Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Subramanian, J. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai (India); Venkatraman, B. [Radiological Safety Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Amarendra, G. [Materials Physics Division, Indira Gandhi Centre for Atomic Research, Kalpakkam-603102 (India); Mandal, A.B. [Central Leather Research Institute, Council of Scientific and Industrial Research, Chennai (India)
2014-02-15
Polycrystalline powder samples of rare earth doped Zinc borates were synthesized by high temperature solid state diffusion technique. Dosimetric characteristics of the phosphor like thermoluminescence glow curve, TL emission spectra, dose–response, fading studies, reproducibility and reusability studies were carried out on the synthesized phosphors. Among the different rare earth doped phosphors, thulium doped zinc borate was found to have a higher sensitivity. Hence detailed dosimetric characteristics of this phosphor were carried out. It is observed that the dose–response is linear from 10 mGy to 10{sup 3} Gy in this phosphor. EPR measurements were carried out on unirradiated, gamma irradiated and annealed phosphors to identify the defect centers responsible for thermoluminescence. A TL model is proposed based on the EPR studies in these materials. Kinetic parameters were evaluated for the dosimetric peaks using various methods. The experimental results show that this phosphor can have potential applications in radiation dosimetry applications. -- Highlights: • Polycrystalline powder samples of rare earth doped zinc borates were synthesized. • Thulium was observed to be the most efficient dopant in ZnB{sub 2}O{sub 4} lattice. • TL intensity of the dosimetric peak is around 20 times that of TLD-100. • Based on EPR studies a TL mechanism is proposed in zinc borate. • Deconvolution of the glow curve carried out.
Pre-equilibrium decay process in alpha particle induced reactions on thulium and tantalum
International Nuclear Information System (INIS)
Mohan, Rao, A.V.; Chintalapudi, S.N.
1994-01-01
Alpha particle induced reactions on the target elements Thulium and Tantalum were investigated upto 60 MeV using stacked foil activation technique and Ge(Li) gamma ray spectroscopy method. Excitation functions for six reactions of 169 Tm(α,xn); x=1-4 and 181 Ta(α,xn); x=2,4 were studied. The experimental results were compared with the updated version of Hybrid model (ALICE/90) using initial exciton configuration n 0 =4(4pOh). A general agreement was found for all the reactions with this option. (author)
Pre-equilibrium decay process in alpha particle induced reactions on thulium and tantalum
Energy Technology Data Exchange (ETDEWEB)
Mohan, Rao, A.V.; Chintalapudi, S.N. (Inter Univ. Consortium for Dept. of atomic Energy Facilities, Calcutta (India))
1994-01-01
Alpha particle induced reactions on the target elements Thulium and Tantalum were investigated upto 60 MeV using stacked foil activation technique and Ge(Li) gamma ray spectroscopy method. Excitation functions for six reactions of [sup 169]Tm([alpha],xn); x=1-4 and [sup 181]Ta([alpha],xn); x=2,4 were studied. The experimental results were compared with the updated version of Hybrid model (ALICE/90) using initial exciton configuration n[sub 0]=4(4pOh). A general agreement was found for all the reactions with this option. (author).
Divalent thulium triflate. A structural and spectroscopic study
Energy Technology Data Exchange (ETDEWEB)
Xemard, Mathieu; Jaoul, Arnaud; Cordier, Marie; Nocton, Gregory [Univ. Paris-Saclay, Palaiseau (France). LCM, Ecole polytechnique, CNRS; Molton, Florian; Duboc, Carole [Grenoble Univ., Saint Martin d' Heres (France). Dept. de Chimie Moleculaire; Cador, Olivier; Le Guennic, Boris [Univ. de Rennes 1 (France). Inst. des Sciences Chimique de Rennes, UMR 6226 CNRS; Maury, Olivier [Univ. Claude Bernard Lyon 1 (France). Lab. de Chimie; Clavaguera, Carine [Univ. Paris-Saclay, Palaiseau (France). LCM, Ecole polytechnique, CNRS; Univ. Paris Sud, Univ. Paris-Saclay, Orsay (France). Lab. de Chimie Physique, CNRS
2017-04-03
The first molecular Tm{sup II} luminescence measurements are reported along with rare magnetic, X and Q bands EPR studies. Access to simple and soluble molecular divalent lanthanide complexes is highly sought for small-molecule activation studies and organic transformations using single-electron transfer processes. However, owing to their low stability and propensity to disproportionate, these complexes are hard to synthetize and their electronic properties are therefore almost unexplored. Herein we present the synthesis of [Tm(μ-OTf){sub 2}(dme){sub 2}]{sub n}, a rare and simple coordination compound of divalent thulium that can be seen as a promising starting material for the synthesis of more elaborated complexes. This reactive complex was structurally characterized by X-ray diffraction analysis and its electronic structure has been compared with that of its halide cousin TmI{sub 2}(dme){sub 3}. (copyright 2017 Wiley-VCH Verlag GmbH and Co. KGaA, Weinheim)
7 CFR 1717.161 - Application process.
2010-01-01
... 7 Agriculture 11 2010-01-01 2010-01-01 false Application process. 1717.161 Section 1717.161 Agriculture Regulations of the Department of Agriculture (Continued) RURAL UTILITIES SERVICE, DEPARTMENT OF... Consolidations of Electric Borrowers § 1717.161 Application process. (a) Borrowers are responsible for ensuring...
46 CFR 161.012-7 - Construction.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Construction. 161.012-7 Section 161.012-7 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-7 Construction. (a...
46 CFR 161.012-9 - Performance.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Performance. 161.012-9 Section 161.012-9 Shipping COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-9 Performance. (a) If...
21 CFR 161.136 - Olympia oysters.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Olympia oysters. 161.136 Section 161.136 Food and... oysters. Olympia oysters, raw Olympia oysters, shucked Olympia oysters, are of the species Ostrea lurida and conform to the definition and standard of identity prescribed for oysters in § 161.130. ...
X-ray fluorescence analysis of thulium oxide/oxalate for rare earth impurities
International Nuclear Information System (INIS)
Chandola, L.C.; Khanna, P.P.
1986-01-01
An X-ray fluorescence spectrometric method for the analysis of thulium oxide is described. For the analysis, the sample in oxalate form is mixed with boric acid binding material and pressed into a pellet over a supporting pellet of boric acid. A wavelength dispersive Philips PW 1220 X-ray fluorescence spectrometer is used for the experiments; the minimum determination limits are 0.002per cent for Ho, Lu and Y, 0.005per cent for Dy and Er and 0.01per cent for Yb. Calculations for theoretical minimum detection limits and percent standard deviation at each concentration of the standard are carried out. (author)
International Nuclear Information System (INIS)
Azmairit Aziz; Nana Suherman
2015-01-01
Currently cancer patients are increasing every year in Indonesia and become the third leading cause of death after heart disease and high blood pressure. Terbium-161 ( 161 Tb) is a low β- emitter (E β - = 0.155 MeV, T 1/2 = 6.9 d) and very similar to 177 Lu in terms of half-life, E β - energy and chemical properties.However, 161 Tb also ejects internal conversion electrons and Auger electrons which can provide a greater therapeutic effect than 177 Lu. Radioisotope of 161 Tb can be produced as a carrier-free for use in labeling of biomolecules as a targeted radiopharmaceutical for cancer therapy. 161 Tb was obtained through 160 Gd(n,γ) 161 Tb nuclear reaction by thermal neutron bombardment on 100 mg of natural gadolinium oxide target in RSG-G.A. Siwabessy at a thermal neutron flux of ~10 14 n.cm -2 .s -1 and followed by radiochemical separation of 161 Tb from Gd isotopes using extraction chromatography method. The physico-chemical characterization of 161 TbCl 3 solution was studied by determination of its radionuclide purity by means of a γ-rays spectrometry with HP-Ge detector coupled to a multichannel analyzer (MCA). Radiochemical purity was determined using paper chromatography and paper electrophoresis methods. The results showed that 161 TbCl 3 radioisotope has a pH of 2, radiochemical purity of 99.64 ± 0.34%, radionuclide purity of 99.69 ± 0.20%, specific activity and radioactive concentration at the end of irradiation (EOI) of 2.26 – 5.31 Ci/mg and 3.84 – 9.03 mCi/mL, respectively. 161 TbCl 3 solution stable for 3 weeks at room temperature with a radiochemical purity of 98.41 ± 0.42%. 161 TbCl 3 solution from irradiated natural gadolinium oxide target has the physico-chemical characteristic that meets the requirements for use as a precursor in preparation of radiopharmaceuticals. (author)
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Policy. 161.2 Section 161.2 Foreign Relations... environmental review procedures with the Department's decisionmaking process; (d) Invite and facilitate, when appropriate, Federal, State and local governmental authorities and public involvement in decisions which...
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Definitions. 161.153 Section 161.153 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS..., destroy, repel or mitigate any pest, or that functions as a plant regulator, desiccant, or defoliant...
36 CFR 406.161-406.169 - [Reserved
2010-07-01
... 36 Parks, Forests, and Public Property 3 2010-07-01 2010-07-01 false [Reserved] 406.161-406.169 Section 406.161-406.169 Parks, Forests, and Public Property AMERICAN BATTLE MONUMENTS COMMISSION... BATTLE MONUMENTS COMMISSION §§ 406.161-406.169 [Reserved] ...
International Nuclear Information System (INIS)
Kobayashi, Satoru
2013-01-01
We report low-field magnetic hysteresis scaling in thulium with strong uniaxial anisotropy. A power-law hysteresis scaling with an exponent of 1.13±0.02 is found between hysteresis loss and remanent flux density of minor loops in the low-temperature ferrimagnetic phase. This exponent value is slightly lower than 1.25–1.4 observed previously for ferromagnets and helimagnets. Unlike spiral and/or Bloch walls with a finite transition width, typical for Dy, Tb, and Ho with planar anisotropy, a soliton wall with a sudden phase shift between neighboring domains may dominate in Tm due to its Ising-like character. The observations imply the presence of universality class of hysteresis scaling that depends on the type of magnetic anisotropy. - Highlights: ► We observe magnetic hysteresis scaling in thulium with a power law exponent of 1.13. ► Irreversibility of soliton walls dominates owing to its strong uniaxial anisotropy. ► The exponent is lower than those for Bloch wall and spiral wall. ► The results imply the presence of universality class that depends on the wall type.
2010-01-01
... 16 Commercial Practices 1 2010-01-01 2010-01-01 false Injunctions. 1.61 Section 1.61 Commercial Practices FEDERAL TRADE COMMISSION ORGANIZATION, PROCEDURES AND RULES OF PRACTICE GENERAL PROCEDURES... believe that it would be to the interest of the public, the Commission will apply to the courts for...
45 CFR 2490.161-2490.169 - [Reserved
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false [Reserved] 2490.161-2490.169 Section 2490.161-2490.169 Public Welfare Regulations Relating to Public Welfare (Continued) JAMES MADISON MEMORIAL... CONDUCTED BY THE JAMES MADISON MEMORIAL FELLOWSHIP FOUNDATION §§ 2490.161-2490.169 [Reserved] ...
28 CFR 39.161-39.169 - [Reserved
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false [Reserved] 39.161-39.169 Section 39.161-39.169 Judicial Administration DEPARTMENT OF JUSTICE ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF JUSTICE §§ 39.161-39.169 [Reserved] ...
40 CFR 161.340 - Toxicology data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Toxicology data requirements. 161.340... Toxicology data requirements. (a) Table. Sections 161.100 through 161.102 describe how to use this table to determine the toxicology data requirements and the substance to be tested. Kind of data required (b) Notes...
46 CFR 161.013-11 - Prototype test.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Prototype test. 161.013-11 Section 161.013-11 Shipping...: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Electric Distress Light for Boats § 161.013-11 Prototype test. (a) Each manufacturer must test a prototype light identical to the lights to be certified prior to...
7 CFR 1789.161 - Conflicts of interest.
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false Conflicts of interest. 1789.161 Section 1789.161... Consultant Services Funded by Borrowers-General § 1789.161 Conflicts of interest. The standard for determining organizational conflicts of interest shall be as set forth in the FAR subpart 9.5 (48 CFR part 9...
49 CFR 28.161-28.169 - [Reserved
2010-10-01
... 49 Transportation 1 2010-10-01 2010-10-01 false [Reserved] 28.161-28.169 Section 28.161-28.169 Transportation Office of the Secretary of Transportation ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY THE DEPARTMENT OF TRANSPORTATION §§ 28.161-28.169 [Reserved] ...
Intense upconversion luminescence in ytterbium-sensitized thulium-doped oxychloride germanate glass
International Nuclear Information System (INIS)
Sun Hongtao; Zhanga Liyan; Zhang Junjie; Wen Lei; Yu Chunlei; Duan Zhongchao; Dai Shixun; Hu Lili; Jiang Zhonghong
2005-01-01
Structural and upconversion fluorescence properties in ytterbium-sensitized thulium-doped oxychloride germanate glass have been studied. The structure of oxychloride germanate glass was investigated by peak-deconvolution of Raman spectrum, and the structural information was obtained from the peak wavenumbers. The Raman spectrum investigation indicates that PbCl 2 plays an important role in the formation of glass network, and has an important influence on the upconversion luminescence. Intense blue and weak red emissions centered at 477 and 650 nm, corresponding to the transitions 1 G 4 → 3 H 6 and 1 G 4 → 3 H 4 , respectively, were observed at room temperature. The possible upconversion mechanisms are discussed and estimated. Intense upconversion luminescence indicates that oxychloride germanate glass can be used as potential host material for upconversion lasers
21 CFR 161.170 - Canned Pacific salmon.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Canned Pacific salmon. 161.170 Section 161.170... § 161.170 Canned Pacific salmon. (a) Identity. (1) Canned Pacific salmon is the food prepared from one... forms of canned Pacific salmon are processed from fish prepared by removing the head, gills, and tail...
28 CFR 16.1 - General provisions.
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false General provisions. 16.1 Section 16.1 Judicial Administration DEPARTMENT OF JUSTICE PRODUCTION OR DISCLOSURE OF MATERIAL OR INFORMATION... administration of the Department of Justice. ...
Measurements of neutron capture cross sections of wolfram and thulium
International Nuclear Information System (INIS)
Xia Yijun; Wang Chunhao; Yang Jingfu; Yang Zhihua; Luo Xiaobing
1992-01-01
The neutron capture cross sections of wolfram and thulium were measured in the energy range from 10 to 100 KeV using gold as the standard. Kinematically collimated neutrons were produced via the 7 Li(p, n) 7 Be reaction with a 2.5 MV pulsed Van de Graaff accelerator at Sichuan University. The capture events were detected by a pair of Moxon-Rae detectors. Time-of-flight technique was used to improve the signal-background ratio. The present results are compared with data by other authors. The capture cross section were calculated from 10 to 100 KeV for two nuclides by the Hauser-Feshbach statistical theory with width fluctuation correction. The nonstatistical effects such as potential capture and radiative capture in elastic and inelastic channels of a compound nucleus were included in the calculations. The calculated results show that the nonstatistical contribution to the capture cross sections is negligible compared with that of the statistical effects
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Minor uses. 161.60 Section 161.60 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS... until it is applied to the major use registrations. (3) EPA will accept extrapolations and regional data...
Transition rates in {sup 161}Dy
Energy Technology Data Exchange (ETDEWEB)
Berg, V; Malmskog, S G
1969-06-15
The decay of {sup 161}Tb has been studied using a high resolution Ge(Li)-detector. Five new transitions were observed and fitted into the earlier proposed decay scheme. The half-life of the 131.8 keV level in {sup 161}Dy was determined in a delayed coincidence measurement to be 145 {+-} 15 psec. The low level scheme in {sup 161}Dy is discussed within a quasi-particle model allowing for Coriolis mixing. Special attention is given to the strongly retarded, K-allowed 131.8 keV E1 transition with a retardation factor F{sub W} > 1.5 x 10{sup 8}.
33 CFR 161.18 - Reporting requirements.
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Reporting requirements. 161.18 Section 161.18 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... call. H HOTEL Date, time and point of entry system Entry time expressed as in (B) and into the entry...
14 CFR 406.161 - Witness fees.
2010-01-01
... 14 Aeronautics and Space 4 2010-01-01 2010-01-01 false Witness fees. 406.161 Section 406.161 Aeronautics and Space COMMERCIAL SPACE TRANSPORTATION, FEDERAL AVIATION ADMINISTRATION, DEPARTMENT OF... the same fees and mileage expenses as are paid to a witness in a court of the United States in...
Tao, Joy; Champlain, Amanda; Weddington, Charles; Moy, Lauren; Tung, Rebecca
2018-01-01
Burn scars cause cosmetic disfigurement and psychosocial distress. We present two Fitzpatrick phototype (FP) III patients with burn scars successfully treated with combination pulsed dye laser (PDL) and non-ablative fractional lasers (NAFL). A 30-year-old, FP III woman with a history of a second-degree burn injury to the bilateral arms and legs affecting 30% body surface area (BSA) presented for cosmetic treatment. The patient received three treatments with 595 nm PDL (7 mm, 8 J, 6 ms), six with the 1550 nm erbium:glass laser (30 mJ, 14% density, 4-8 passes) and five with the 1927 nm thulium laser (10 mJ, 30% density, 4-8 passes). Treated burn scars improved significantly in thickness, texture and colour. A 33-year-old, FP III man with a history of a second-degree burn injury of the left neck and arm affecting 7% BSA presented for cosmetic treatment. The patient received two treatments with 595 nm PDL (5 mm, 7.5 J, 6 ms), four with the 1550 nm erbium:glass laser (30 mJ, 14% density, 4-8 passes) and two with the 1927 nm thulium laser (10 mJ, 30% density, 4-8 passes). The burn scars became thinner, smoother and more normal in pigmentation and appearance. Our patients' burn scars were treated with a combination of PDL and NAFL (two wavelengths). The PDL targets scar hypervascularity, the 1550 nm erbium:glass stimulates collagen remodelling and the 1927 nm thulium targets epidermal processes, particularly hyperpigmentation. This combination addresses scar thickness, texture and colour with a low side effect profile and is particularly advantageous in patients at higher risk of post-procedure hyperpigmentation. Our cases suggest the combination of 595nm PDL plus NAFL 1550 nm erbium:glass/1927 nm thulium device is effective and well-tolerated for burn scar treatment in skin of colour.
7 CFR 1260.161 - Establishment and membership.
2010-01-01
....161 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (MARKETING AGREEMENTS AND ORDERS; MISCELLANEOUS COMMODITIES), DEPARTMENT OF AGRICULTURE BEEF PROMOTION AND RESEARCH Beef Promotion and Research Order Beef Promotion Operating Committee § 1260.161...
40 CFR 161.55 - Agricultural vs. non-agricultural pesticides.
2010-07-01
... pesticides. 161.55 Section 161.55 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES General Provisions § 161.55 Agricultural vs. non-agricultural pesticides. Section 25(a)(1) of FIFRA instructs the...
Thulium-170 oxide heat source experimental and analytical radiation and shielding study
International Nuclear Information System (INIS)
Tse, A.; Nelson, C.A.
1970-05-01
Radiation dose rates from three thulium-170 oxide sources (20.7, 10.0 and 5.0 thermal watts) were measured through three thicknesses (1/4, 1/2 and 1 inch) of absorber by thermoluminescent dosimetry techniques. Absorber materials used were aluminium, stainless steel, lead, tungsten and depleted uranium. Resultant radiation doses were measured at 19 and 100 cm. Comparison of theoretical dose rates calculated by computer with measured dose rates validated the calculation technique for lead, tungsten and uranium absorbers but not for aluminum and stainless steel. Use of infinite medium build-up factors (B/sub ∞/) was thus validated in computation of dose rates for lead, tungsten and uranium absorbers; use of B/sub ∞/ in computation of dose rates for aluminum and stainless steel absorbers overestimated dose rates vis-a-vis experimentally determined dose rates by an approximate factor of 2
22 CFR 161.10 - Non-Federal applicants for permits.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Non-Federal applicants for permits. 161.10 Section 161.10 Foreign Relations DEPARTMENT OF STATE ENVIRONMENTAL PROTECTION REGULATIONS FOR IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) Coordination of Other Requirements of NEPA § 161...
Neutron capture cross sections of rhodium, thulium, iridium, and gold between 0.5 and 3.0 MeV
International Nuclear Information System (INIS)
Joly, S.; Voignier, J.; Grenier, G.; Drake, D.M.; Nilsson, L.
1979-01-01
Measurements of the neutron capture cross sections of rhodium, thulium, gold, and iridium were carried out in the 0.5- to 3.0-MeV energy range. The cross sections are deduced from the capture gamma-ray spectra recorded by a NaI spectrometer consisting of central and annulus detectors. Time-of-flight techniques are used to improve the signal-to-background ratio. When comparison is possible, the present results are found to be in general agreement with the previous data. 5 figures, 3 tables
International Nuclear Information System (INIS)
Kalinnikov, V.G.; Ibraheem, Y.S.; Stegailov, V.I.
2004-01-01
Full text: The study of odd-proton nuclei in rare-earth region has been performed to get more information on the nuclear structure of these nuclei. In the framework of a program at the ISOL complex of YASNAPP-2 at JINR to study the decay of odd-nuclei, 161 Er has been investigated. The experiments have been focused on the 161 Ho level scheme populated in the EC/β + decay of 161 Er for which a few results have been previously reported [1,2]. Spectra of single γ-ray, γ-γ coincidence and internal conversion electrons were measured. There are appreciable disagreements between results of some γ-ray intensities obtained by us and in [2]. The greatest difference was for relative γ-ray intensity of the 11.28 keV, which has reported value I γ ∼ 10 (I γ 211 =1000) in [2], but this leads to an overpopulation of the 211 keV level by 14% of the decay [3]. The relative intensities of transitions with Eγ γ211 =1000). Inaccuracy of Iγ in [2] is probably due to a sudden change in the efficiency curve of their Ge(Li) detector in the low energy region while our HPGe detector feature a much smoother variation in the efficiency curve in this γ-ray energy region. Besides, the levels earlier introduced by us in [4], three new levels in 161 Ho were proposed from γ-γ coincidences at energies 693.2 keV, 859.6 keV, and 957.97 keV. Spins, parities and Nilsson quantum characteristics of some 161 Ho levels were established
33 CFR 161.20 - Position Report (PR).
2010-07-01
... 33 Navigation and Navigable Waters 2 2010-07-01 2010-07-01 false Position Report (PR). 161.20 Section 161.20 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED... Report (PR). A vessel must report its name and position: (a) Upon point of entry into a VMRS area; (b) At...
24 CFR 982.161 - Conflict of interest.
2010-04-01
... 24 Housing and Urban Development 4 2010-04-01 2010-04-01 false Conflict of interest. 982.161... and PHA Administration of Program § 982.161 Conflict of interest. (a) Neither the PHA nor any of its... prospective interest to the PHA and HUD. (c) The conflict of interest prohibition under this section may be...
2010-04-01
... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Use of wine. 1.61 Section..., NONINDUSTRIAL USE OF DISTILLED SPIRITS AND WINE, BULK SALES AND BOTTLING OF DISTILLED SPIRITS Nonindustrial Use of Distilled Spirits and Wine Uses Regarded As Industrial § 1.61 Use of wine. The following uses of...
12 CFR 410.161-410.169 - [Reserved
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false [Reserved] 410.161-410.169 Section 410.161-410.169 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES ENFORCEMENT OF NONDISCRIMINATION ON THE BASIS OF HANDICAP IN PROGRAMS OR ACTIVITIES CONDUCTED BY EXPORT-IMPORT BANK OF THE UNITED STATES §§ 410...
33 CFR 161.60 - Vessel Traffic Service Prince William Sound.
2010-07-01
... William Sound. 161.60 Section 161.60 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND... Movement Reporting System Areas and Reporting Points § 161.60 Vessel Traffic Service Prince William Sound... Cape Hinchinbrook Light to Schooner Rock Light, comprising that portion of Prince William Sound between...
38 CFR 3.161 - Expedited Claims Adjudication Initiative-Pilot Program.
2010-07-01
... Adjudication Initiative-Pilot Program. 3.161 Section 3.161 Pensions, Bonuses, and Veterans' Relief DEPARTMENT... Claims § 3.161 Expedited Claims Adjudication Initiative—Pilot Program. Rules pertaining to the Expedited Claims Adjudication Initiative Pilot Program are set forth in part 20, subpart P, of this chapter...
40 CFR 161.490 - Wildlife and aquatic organisms data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Wildlife and aquatic organisms data... § 161.490 Wildlife and aquatic organisms data requirements. (a) Table. Sections 161.100 through 161.102 describe how to use this table to determine the wildlife and aquatic organisms data requirements and the...
Gpr161 anchoring of PKA consolidates GPCR and cAMP signaling.
Bachmann, Verena A; Mayrhofer, Johanna E; Ilouz, Ronit; Tschaikner, Philipp; Raffeiner, Philipp; Röck, Ruth; Courcelles, Mathieu; Apelt, Federico; Lu, Tsan-Wen; Baillie, George S; Thibault, Pierre; Aanstad, Pia; Stelzl, Ulrich; Taylor, Susan S; Stefan, Eduard
2016-07-12
Scaffolding proteins organize the information flow from activated G protein-coupled receptors (GPCRs) to intracellular effector cascades both spatially and temporally. By this means, signaling scaffolds, such as A-kinase anchoring proteins (AKAPs), compartmentalize kinase activity and ensure substrate selectivity. Using a phosphoproteomics approach we identified a physical and functional connection between protein kinase A (PKA) and Gpr161 (an orphan GPCR) signaling. We show that Gpr161 functions as a selective high-affinity AKAP for type I PKA regulatory subunits (RI). Using cell-based reporters to map protein-protein interactions, we discovered that RI binds directly and selectively to a hydrophobic protein-protein interaction interface in the cytoplasmic carboxyl-terminal tail of Gpr161. Furthermore, our data demonstrate that a binary complex between Gpr161 and RI promotes the compartmentalization of Gpr161 to the plasma membrane. Moreover, we show that Gpr161, functioning as an AKAP, recruits PKA RI to primary cilia in zebrafish embryos. We also show that Gpr161 is a target of PKA phosphorylation, and that mutation of the PKA phosphorylation site affects ciliary receptor localization. Thus, we propose that Gpr161 is itself an AKAP and that the cAMP-sensing Gpr161:PKA complex acts as cilium-compartmentalized signalosome, a concept that now needs to be considered in the analyzing, interpreting, and pharmaceutical targeting of PKA-associated functions.
Directory of Open Access Journals (Sweden)
Saturnin Enzonga Yoca
2017-09-01
Full Text Available A new set of radiative decay parameters (oscillator strengths, transition probabilities for spectral lines in triply ionized thulium (Tm IV has been obtained within the framework of the pseudo-relativistic Hartree-Fock (HFR approach. The effects of configuration interaction and core-polarization have been investigated in detail and the quality of the results has been assessed through a comparison between different HFR physical models. The spectroscopic data listed in the present paper cover electric dipole as well as magnetic dipole and electric quadrupole transitions in a wide range of wavelengths from extreme ultraviolet to near infrared.
21 CFR 516.161 - Modifications to indexed drugs.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Modifications to indexed drugs. 516.161 Section 516.161 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS NEW ANIMAL DRUGS FOR MINOR USE AND MINOR SPECIES Index...
12 CFR 563.161 - Management and financial policies.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Management and financial policies. 563.161... ASSOCIATIONS-OPERATIONS Financial Management Policies § 563.161 Management and financial policies. (a)(1) For... corporation must be well managed and operate safely and soundly. Each also must pursue financial policies that...
Measurement of 160Tb and 161Tb in nuclear forensics samples
International Nuclear Information System (INIS)
Jiang, J.; Davies, A.V.; Britton, R.E.
2017-01-01
160 Tb and 161 Tb are important radionuclides to measure when analysing a Nuclear Forensics sample. An analytical method for the measurement of both 160 Tb and 161 Tb was developed in this study. Terbium was separated and purified using exchange resin and TrisKem LN Resin. The purified fraction containing 160 Tb and 161 Tb was measured by gamma spectrometry and liquid scintillation counting. The counting efficiencies of 160 Tb and 161 Tb were determined using the CIEMAT/NIST efficiency tracing method. The LSC count rate ratio, R160 Tb /R161 Tb , on the reference date was determined by sequential counting and calculated using a custom script based on their half-lives. (author)
30 CFR 75.161 - Plans for training programs.
2010-07-01
... 30 Mineral Resources 1 2010-07-01 2010-07-01 false Plans for training programs. 75.161 Section 75... Provision] § 75.161 Plans for training programs. Each operator must submit to the district manager, of the Coal Mine Safety and Health District in which the mine is located, a program or plan setting forth what...
21 CFR 161.175 - Frozen raw breaded shrimp.
2010-04-01
... additives as defined in section 201(s) of the Federal Food, Drug, and Cosmetic Act; or if they are food... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Frozen raw breaded shrimp. 161.175 Section 161.175 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD...
2010-10-01
... Bluefish Fishery § 648.161 Closures. (a) EEZ closure. NMFS shall close the EEZ to fishing for bluefish by... dealer permit holders that no commercial quota is available for landing bluefish in that state. ...
Structural and optical study on antimony-silicate glasses doped with thulium ions.
Dorosz, D; Zmojda, J; Kochanowicz, M; Miluski, P; Jelen, P; Sitarz, M
2015-01-05
Structural, spectroscopic and thermal properties of SiO₂-Al₂O₃-Sb₂O₃-Na₂O glass system doped with 0.2 mol% Tm₂O₃ have been presented. Synthesis of antimony-silicate glasses with relatively low phonon energy (600 cm(-1), which implicates a small non-radiative decay rate) was performed by conventional high-temperature melt-quenching methods. The effect of SiO₂/Sb₂O₃ ratio in fabricated Tm(3+) doped glass on thermal, structural and luminescence properties was investigated. On the basis of structural investigations decomposition of absorption bands in the infrared FTIR region was performed, thus determining that antimony ions are the only glass-forming ions, setting up the lattice of fabricated glasses. Luminescence band at the wavelength of 1.8 μm corresponding to (3)F₄→(3)H₆ transition in thulium ions was obtained under 795 nm laser pumping. It was observed that combination of relatively low phonon energy and greater separation of optically active centers in the fabricated glasses influenced in decreasing the luminescence intensity at 1800 nm. Copyright © 2014 Elsevier B.V. All rights reserved.
40 CFR 161.35 - Flexibility of the data requirements.
2010-07-01
... 40 Protection of Environment 23 2010-07-01 2010-07-01 false Flexibility of the data requirements. 161.35 Section 161.35 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) PESTICIDE... periodically to reflect new scientific knowledge, new trends in pesticide development, and new Agency policies...
7 CFR 1150.161 - Promotion, research and nutrition education.
2010-01-01
... 7 Agriculture 9 2010-01-01 2009-01-01 true Promotion, research and nutrition education. 1150.161... MARKETING SERVICE (Marketing Agreements and Orders; Milk), DEPARTMENT OF AGRICULTURE DAIRY PROMOTION PROGRAM Dairy Promotion and Research Order Promotion, Research and Nutrition Education § 1150.161 Promotion...
Wavelength-tunable thulium-doped fiber laser by employing a self-made Fabry-Perot filter
Wang, Y. P.; Ju, Y. L.; Wu, C. T.; Liu, W.; Yang, C.
2017-06-01
In this demonstration, we proposed a novel wavelength-tunable thulium-doped fiber laser (TDFL) with a self-made Fabry-Perot (F-P) filter. When the F-P filter was not inserted, the maximum output power of 11.1 W was achieved when the pump power was 70.2 W. The corresponding optical-to-optical conversion efficiency was 15.8% and the slope efficiency was 22.1%. When the F-P filter was inserted, the output wavelength could be tuned from 1952.9 to 1934.9 nm with the change of cavity length of F-P filter which was fixed on a piezoelectric ceramic transducer (PZT) controlled by the voltage applied to it. The full width at half maximum (FWHM) was no more than 0.19 nm. Furthermore, the wavelength fluctuations of the tunable fiber laser were kept within ±0.2 nm.
Directory of Open Access Journals (Sweden)
Jinlin Miao
2015-01-01
Full Text Available Objective. CD161 has been identified as a marker of human IL-17-producing T cells that are implicated in the pathogenesis of rheumatoid arthritis (RA. This study aimed to investigate the potential link between the percentage of CD161+ T cells and disease activity in RA patients. Methods. Peripheral blood (PB from 54 RA patients and 21 healthy controls was evaluated. Paired synovial fluid (SF (n = 17 was analyzed. CD161 expression levels on CD4+, CD8+, and CD4−CD8− T cells were assessed by flow cytometry. Results. The percentage of CD4+CD161+ T cells in RA SF was higher than RA PB, and it was positively correlated with DAS28, erythrocyte sedimentation rate (ESR, and C-reactive protein (CRP. CD4−CD8−CD161+ T cell percentage was decreased in RA PB and was further reduced in RA SF, and its level in SF was inversely correlated with DAS28, ESR, and CRP. However, CD8+CD161+ T cell percentage was neither changed in RA PB and SF nor correlated with disease activity indices. Conclusion. An increased CD4+CD161+ T cell percentage and a decreased CD4−CD8−CD161+ T cell percentage are present in RA SF and are associated with disease activity, and the accumulation of CD4+CD161+ T cells in SF may contribute to the local inflammation of RA.
29 CFR 1910.161 - Fixed extinguishing systems, dry chemical.
2010-07-01
... 29 Labor 5 2010-07-01 2010-07-01 false Fixed extinguishing systems, dry chemical. 1910.161 Section... § 1910.161 Fixed extinguishing systems, dry chemical. (a) Scope and application. This section applies to all fixed extinguishing systems, using dry chemical as the extinguishing agent, installed to meet a...
22 CFR 161.11 - Environmental review and consultation requirements.
2010-04-01
... requirements. 161.11 Section 161.11 Foreign Relations DEPARTMENT OF STATE ENVIRONMENTAL PROTECTION REGULATIONS FOR IMPLEMENTATION OF THE NATIONAL ENVIRONMENTAL POLICY ACT (NEPA) Coordination of Other Requirements... comments. (d) Fish and Wildlife Coordination Act, 16 U.S.C. 661 et seq. (e) Section 309 of the Clean Air...
International Nuclear Information System (INIS)
Pal, Atasi; Chen, Shu Ying; Sun, Tong; Grattan, K T V; Sen, Ranjan
2013-01-01
A high-Q and low threshold laser resonator, operating in the 2 μm wavelength region, has been demonstrated by coupling a thulium-doped silica microsphere to a tapered fibre. Microspheres with diameters ranging from fifty to a few hundred micrometres were carefully fabricated for this purpose by melting an etched-clad thulium-doped silica fibre tip using a focused beam from a CO 2 laser, while the tapered fibre with waist diameter in the desired range of 2 μm was fabricated by using heating and stretching of standard single-mode telecommunication fibre. The tapered fibre served the dual purpose of transporting pump power into the sphere and allowing the extraction of the resulting laser emission. Under excitation at a wavelength of ∼1.6 μm, lasing occurred at wavelengths over the range from 1.9 to 2.0 μm. Single-mode laser operation was obtained by exciting the fundamental whispering gallery mode resonance of the microsphere, while multi-mode lasing occurred for non-fundamental mode excitation. The threshold power of the laser was measured to be about 50 μW delivered pump power, and a maximum laser power of 0.8 mW at around 1.94 μm was observed for a 6 mW pump power, operating at wavelengths around 1.6 μm. The laser was designed as a low threshold and compact source for miniaturized gas sensing devices operating over this important wavelength region. (letter)
2010-04-01
... water. Before packing into the containers for shipment or other delivery for consumption the oysters are... FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION FISH AND SHELLFISH Requirements for Specific Standardized Fish and Shellfish § 161.130 Oysters. (a...
2010-04-01
....161 Alcohol, Tobacco Products and Firearms ALCOHOL AND TOBACCO TAX AND TRADE BUREAU, DEPARTMENT OF THE... organized to enable appropriate TTB officers to trace each operation or transaction, monitor compliance with... invoices and cost accounting records, are acceptable if they show the required information or are annotated...
2010-07-01
... FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES Product Chemistry Data Requirements § 161.150 General. (a) Applicability. This subpart describes the product chemistry data that are required to support the registration... characteristics must be considered. (iv) Certain data are needed as basic or supportive evidence in initiating or...
43 CFR 16.1 - Agreements to dispose of helium in natural gas.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Agreements to dispose of helium in natural gas. 16.1 Section 16.1 Public Lands: Interior Office of the Secretary of the Interior CONSERVATION OF HELIUM § 16.1 Agreements to dispose of helium in natural gas. (a) Pursuant to his authority and...
Magnetic and Structural Phase Transitions in Thulium under High Pressures and Low Temperatures
Energy Technology Data Exchange (ETDEWEB)
Vohra, Yogesh K.; Tsoi, Georgiy M.; Samudrala, Gopi K. [UAB
2017-10-01
The nature of 4f electrons in many rare earth metals and compounds may be broadly characterized as being either "localized" or "itinerant", and is held responsible for a wide range of physical and chemical properties. The pressure variable has a very dramatic effect on the electronic structure of rare earth metals which in turn drives a sequence of structural and magnetic transitions. We have carried out four-probe electrical resistance measurements on rare earth metal Thulium (Tm) under high pressures to 33 GPa and low temperatures to 10 K to monitor the magnetic ordering transition. These studies are complemented by angle dispersive x-ray diffraction studies to monitor crystallographic phase transitions at high pressures and low temperatures. We observe an abrupt increase in magnetic ordering temperature in Tm at a pressure of 17 GPa on phase transition from ambient pressure hcp-phase to α-Sm phase transition. In addition, measured equation of state (EOS) at low temperatures show anomalously low thermal expansion coefficients likely linked to magnetic transitions.
28 CFR 35.161 - Telecommunication devices for the deaf (TDD's).
2010-07-01
... 28 Judicial Administration 1 2010-07-01 2010-07-01 false Telecommunication devices for the deaf (TDD's). 35.161 Section 35.161 Judicial Administration DEPARTMENT OF JUSTICE NONDISCRIMINATION ON THE... devices for the deaf (TDD's). Where a public entity communicates by telephone with applicants and...
21 CFR 150.161 - Artificially sweetened fruit preserves and jams.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Artificially sweetened fruit preserves and jams. 150.161 Section 150.161 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN... karaya, gum tragacanth, algin (sodium alginate), sodium carboxymethylcellulose (cellulose gum...
34 CFR 668.161 - Scope and purpose (cash management rules).
2010-07-01
... 34 Education 3 2010-07-01 2010-07-01 false Scope and purpose (cash management rules). 668.161... POSTSECONDARY EDUCATION, DEPARTMENT OF EDUCATION STUDENT ASSISTANCE GENERAL PROVISIONS Cash Management § 668.161 Scope and purpose (cash management rules). (a) General. (1) This subpart establishes the rules and...
46 CFR 161.002-15 - Sample extraction smoke detection systems.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Sample extraction smoke detection systems. 161.002-15..., CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Fire-Protective Systems § 161.002-15 Sample extraction smoke detection systems. The smoke detecting system must consist of a means for...
25 CFR 1000.161 - What is a self-governance compact?
2010-04-01
... 25 Indians 2 2010-04-01 2010-04-01 false What is a self-governance compact? 1000.161 Section 1000... EDUCATION ACT Negotiation Process for Annual Funding Agreements Negotiating A Self-Governance Compact § 1000.161 What is a self-governance compact? A self-governance compact is an executed document that affirms...
49 CFR 173.161 - Chemical kits and first aid kits.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Chemical kits and first aid kits. 173.161 Section... Class 7 § 173.161 Chemical kits and first aid kits. (a) Chemical kits and First aid kits must conform to... 10 kg. (b) Chemical kits and First aid kits are excepted from the specification packaging...
2010-10-01
..., DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-1 Scope. (a) This subpart... approving personal flotation device lights fitted on Coast Guard approved life preservers, bouyant vests...
26 CFR 1.501(c)(16)-1 - Corporations organized to finance crop operations.
2010-04-01
... 26 Internal Revenue 7 2010-04-01 2010-04-01 true Corporations organized to finance crop operations. 1.501(c)(16)-1 Section 1.501(c)(16)-1 Internal Revenue INTERNAL REVENUE SERVICE, DEPARTMENT OF THE TREASURY (CONTINUED) INCOME TAX (CONTINUED) INCOME TAXES (CONTINUED) Exempt Organizations § 1.501(c)(16)-1 Corporations organized to finance crop...
46 CFR 161.012-3 - Definitions.
2010-10-01
... GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) EQUIPMENT, CONSTRUCTION, AND MATERIALS: SPECIFICATIONS AND APPROVAL ELECTRICAL EQUIPMENT Personal Flotation Device Lights § 161.012-3 Definitions. (a) As used in this subpart, PFD means Coast Guard approved personal flotation device. (b) For the purpose of...
50 CFR 14.161 - Primary enclosures.
2010-10-01
... Wild Mammals and Birds to the United States Specifications for Other Terrestrial Mammals § 14.161... primary enclosure shall provide adequate space for the animal to stand upright in a normal posture with... lie in a full prone position. Specifications for Birds ...
Mimouni-Bloch, Aviva; Yeshaya, Josepha; Kahana, Sarit; Maya, Idit; Basel-Vanagaite, Lina
2015-11-01
Microdeletions of various sizes in the 2p16.1-p15 chromosomal region have been grouped together under the 2p16.1-p15 microdeletion syndrome. Children with this syndrome generally share certain features including microcephaly, developmental delay, facial dysmorphism, urogenital and skeletal abnormalities. We present a child with a de-novo interstitial 1665 kb duplication of 2p16.1-p15. Clinical features of this child are distinct from those of children with the 2p16.1-p15 microdeletion syndrome, specifically the head circumference which is within the normal range and mild intellectual disability with absence of autistic behaviors. Microduplications many times bear milder clinical phenotypes in comparison with corresponding microdeletion syndromes. Indeed, as compared to the microdeletion syndrome patients, the 2p16.1-p15 microduplication seems to have a milder cognitive effect and no effect on other body systems. Limited information available in genetic databases about cases with overlapping duplications indicates that they all have abnormal developmental phenotypes. The involvement of genes in this location including BCL11A, USP34 and PEX13, affecting fundamental developmental processes both within and outside the nervous system may explain the clinical features of the individual described in this report. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.
46 CFR 161.006-1 - Applicable specifications.
2010-10-01
... Nickel Plus Chromium and Nickel Plus Chromium—161.006-4 You may obtain these standards from The American...) Underwriters' Laboratories, Inc.: Standard for flexible cord and fixture wire, third edition, October, 1935. (b...
36 CFR 13.161 - Permit application.
2010-07-01
... Section 13.161 Parks, Forests, and Public Property NATIONAL PARK SERVICE, DEPARTMENT OF THE INTERIOR... blueprint, sketch or photograph of the cabin or structure; (d) A map that shows the geographic location of... cabin or structure. All information may be provided orally except the cabin blueprint, sketch or...
Directory of Open Access Journals (Sweden)
Nicolai J. Wewer Albrechtsen
2017-11-01
Full Text Available Glucagon is secreted from pancreatic α cells, and hypersecretion (hyperglucagonemia contributes to diabetic hyperglycemia. Molecular heterogeneity in hyperglucagonemia is poorly investigated. By screening human plasma using high-resolution-proteomics, we identified several glucagon variants, among which proglucagon 1-61 (PG 1-61 appears to be the most abundant form. PG 1-61 is secreted in subjects with obesity, both before and after gastric bypass surgery, with protein and fat as the main drivers for secretion before surgery, but glucose after. Studies in hepatocytes and in β cells demonstrated that PG 1-61 dose-dependently increases levels of cAMP, through the glucagon receptor, and increases insulin secretion and protein levels of enzymes regulating glycogenolysis and gluconeogenesis. In rats, PG 1-61 increases blood glucose and plasma insulin and decreases plasma levels of amino acids in vivo. We conclude that glucagon variants, such as PG 1-61, may contribute to glucose regulation by stimulating hepatic glucose production and insulin secretion.
Hindered El Transitions in Eu155 and Tb161
International Nuclear Information System (INIS)
Malmskog, Sven G.
1965-02-01
The absolute E1 transition probabilities from the 3/2 + (411), 5/2 - (532) and 7/2 - (523) single particle levels in Eu 155 and Tb 161 have been measured by the method of delayed coincidences. This gave half lives of T 1/2 1/2 = (1.38 ± 0.06) ns for the 104.4 and 246 keV levels in Eu 155 . T 1/2 = (0.84 ± 0.04) ns and T 1/2 161 . The result has been compared with the calculations of a single particle in a deformed potential made by Nilsson
Thulium fiber laser lithotripsy using a muzzle brake fiber tip
Hutchens, Thomas C.; Gonzalez, David A.; Irby, Pierce B.; Fried, Nathaniel M.
2017-02-01
The Thulium fiber laser (TFL) is being explored as an alternative to Holmium:YAG laser for lithotripsy. TFL beam profile allows coupling of higher power into smaller fibers than multimode Holmium laser beam, without proximal fiber tip degradation. A smaller fiber provides more space in ureteroscope working channel for increased saline irrigation and allows maximum ureteroscope flexion. However, distal fiber tip burnback increases as fiber diameter decreases. Previous studies utilizing hollow steel sheaths around recessed distal fiber tips reduced fiber burnback, but increased retropulsion. In this study, a "fiber muzzle brake" was tested for reducing fiber burnback and stone retropulsion. TFL lithotripsy studies were performed at 1908 nm, 35 mJ, 500 μs, and 300 Hz using a 100-μm-core fiber. The optimal stainless steel muzzle brake tip tested consisted of a 1-cm-long, 560-μm-OD, 360-μm-ID tube with 275-μm thru hole located 250-μm from the distal end. The fiber tip was recessed a distance of 500 μm. Stone phantom retropulsion, fiber tip burnback, and calcium oxalate stone ablation studies were performed, ex vivo. Small stones with a mass of 40 +/- 4 mg and 4-mm-diameter were ablated over a 1.5-mm sieve in 25 +/- 4 s (n=10), without distal fiber tip burnback. Reduction in stone phantom retropulsion distance by 50% and 85% was observed when using muzzle brake tips versus 100-μm-core bare fibers and hollow steel tip fibers. The muzzle brake fiber tip provided efficient stone ablation, reduced stone retropulsion, and minimal fiber degradation during TFL lithotripsy.
14 CFR 61.161 - Aeronautical experience: Rotorcraft category and helicopter class rating.
2010-01-01
... category and helicopter class rating. 61.161 Section 61.161 Aeronautics and Space FEDERAL AVIATION... helicopter class rating. (a) A person who is applying for an airline transport pilot certificate with a rotorcraft category and helicopter class rating, must have at least 1,200 hours of total time as a pilot that...
DEFF Research Database (Denmark)
Wewer Albrechtsen, Nicolai J.; Kuhre, Rune E.; Hornburg, Daniel
2017-01-01
that PG 1-61 dose-dependently increases levels of cAMP, through the glucagon receptor, and increases insulin secretion and protein levels of enzymes regulating glycogenolysis and gluconeogenesis. In rats, PG 1-61 increases blood glucose and plasma insulin and decreases plasma levels of amino acids in......Glucagon is secreted from pancreatic α cells, and hypersecretion (hyperglucagonemia) contributes to diabetic hyperglycemia. Molecular heterogeneity in hyperglucagonemia is poorly investigated. By screening human plasma using high-resolution-proteomics, we identified several glucagon variants, among...... which proglucagon 1-61 (PG 1-61) appears to be the most abundant form. PG 1-61 is secreted in subjects with obesity, both before and after gastric bypass surgery, with protein and fat as the main drivers for secretion before surgery, but glucose after. Studies in hepatocytes and in β cells demonstrated...
Lehenberger, Silvia; Barkhausen, Christoph; Cohrs, Susan; Fischer, Eliane; Grünberg, Jürgen; Hohn, Alexander; Köster, Ulli; Schibli, Roger; Türler, Andreas; Zhernosekov, Konstantin
2011-08-01
The low-energy β(-) emitter (161)Tb is very similar to (177)Lu with respect to half-life, beta energy and chemical properties. However, (161)Tb also emits a significant amount of conversion and Auger electrons. Greater therapeutic effect can therefore be expected in comparison to (177)Lu. It also emits low-energy photons that are useful for gamma camera imaging. The (160)Gd(n,γ)(161)Gd→(161)Tb production route was used to produce (161)Tb by neutron irradiation of massive (160)Gd targets (up to 40 mg) in nuclear reactors. A semiautomated procedure based on cation exchange chromatography was developed and applied to isolate no carrier added (n.c.a.) (161)Tb from the bulk of the (160)Gd target and from its stable decay product (161)Dy. (161)Tb was used for radiolabeling DOTA-Tyr3-octreotate; the radiolabeling profile was compared to the commercially available n.c.a. (177)Lu. A (161)Tb Derenzo phantom was imaged using a small-animal single-photon emission computed tomography camera. Up to 15 GBq of (161)Tb was produced by long-term irradiation of Gd targets. Using a cation exchange resin, we obtained 80%-90% of the available (161)Tb with high specific activity, radionuclide and chemical purity and in quantities sufficient for therapeutic applications. The (161)Tb obtained was of the quality required to prepare (161)Tb-DOTA-Tyr3-octreotate. We were able to produce (161)Tb in n.c.a. form by irradiating highly enriched (160)Gd targets; it can be obtained in the quantity and quality required for the preparation of (161)Tb-labeled therapeutic agents. Copyright © 2011 Elsevier Inc. All rights reserved.
Etching of enamel for direct bonding with a thulium fiber laser
Kabaş Sarp, Ayşe S.; Gülsoy, Murat
2011-03-01
Background: Laser etching of enamel for direct bonding can decrease the risk of surface enamel loss and demineralization which are the adverse effects of acid etching technique. However, in excess of +5.5°C can cause irreversible pulpal responses. In this study, a 1940- nm Thulium Fiber Laser in CW mode was used for laser etching. Aim: Determination of the suitable Laser parameters of enamel surface etching for direct bonding of ceramic brackets and keeping that intrapulpal temperature changes below the threshold value. Material and Method: Polycrystalline ceramic orthodontic brackets were bonded on bovine teeth by using 2 different kinds of etching techniques: Acid and Laser Etching. In addition to these 3 etched groups, there was also a group which was bonded without etching. Brackets were debonded with a material testing machine. Breaking time and the load at the breaking point were measured. Intrapulpal temperature changes were recorded by a K-type Thermocouple. For all laser groups, intrapulpal temperature rise was below the threshold value of 5.5°C. Results and Conclusion: Acid-etched group ( 11.73 MPa) significantly required more debonding force than 3- second- irradiated ( 5.03 MPa) and non-etched groups ( 3.4 MPa) but the results of acid etched group and 4- second- irradiated group (7.5 MPa) showed no significant difference. Moreover, 4- second irradiated group was over the minimum acceptable value for clinical use. Also, 3- second lasing caused a significant reduction in time according to acid-etch group. As a result, 1940- nm laser irradiation is a promising method for laser etching.
International Nuclear Information System (INIS)
He Hong; Li Wenlian; Su Zisheng; Chu Bei; Bi Defeng; Chen Yiren; Wang Dan; Su Wenming; Li Bin
2009-01-01
The authors demonstrate the interfacial exciplex electroluminescence (EL) between tris(acetylacetonato)-(mono-phenothroline) thulium [Tm(AcA) 3 phen] and two diamine derivatives with starburst molecular structure- 4,4',4''-tris[2-naphthyl(phenyl)amino]triphenylamine (2-TNATA) and 4,4',4''-tris[3-methyl-pheny(phenyl)-amino]triphenyl-amine (m-MTDATA), both of which have the same ionization potential (IP) (approximately 5.1 eV). When the Tm-complex and the two diamine derivatives are respectively used as the electron accepter and donors, the two EL devices exhibit different exciplex emissions, which verifies our previously reported opinion regarding the effect of the different substitutes on exciplex emission [W.M. Su, W.L. Li, Q. Xin, Z.S. Su, B. Chu, D.F. Bi, H. He, J.H. Niu, Appl. Phys. Lett. 91 (2007) 043508]. When the mixture of the two diamine derivatives is used as a donor, a white EL device with the Commission International de l'Eclairage (CIE) coordinates of (0.277, 0.323) is achieved. The exciplex formation mechanisms of the devices with the two different donors are discussed
Eestist osaleb rahvusvahelisel reklaamifestivalil 161 reklaami / Sergo Selder
Selder, Sergo
2005-01-01
Riias toimuvast kuuendast Baltimaade reklaamifestivalist "Kuldne haamer" ("Golden Hammer"). Eestist on esitatud 161 reklaami. Žüriisse kuulub eestlastest Jaanus Vahtra reklaamifirmast Saatchi & Saatchi, kelle Diseli õllereklaam võitis möödunud aastal telereklaamide Kuldhaamri
33 CFR 161.12 - Vessel operating requirements.
2010-07-01
....0′ N. extending eastward through the Golden Gate, and the navigable waters of San Francisco Bay and... safety beyond that provided by other means. The bridge-to-bridge navigational frequency, 156.650 MHz (Ch... Measures, and Operating Requirements § 161.12 Vessel operating requirements. (a) Subject to the exigencies...
75 FR 81417 - Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes
2010-12-28
... Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes AGENCY: Federal Aviation Administration... new airworthiness directive (AD): 2010-26-04 Piper Aircraft, Inc: Amendment 39-16543; Docket No. FAA... times may be Airplane approved for this part. Maintenance Manual Piper PA28-161 TAE 125-01, Doc. No...
Zhao, Ruizhe; Wang, Xingjie; Jiang, Chenyi; Shi, Fei; Zhu, Yiping; Yang, Boyu; Zhuo, Jian; Jing, Yifeng; Luo, Guangheng; Xia, Shujie; Han, Bangmin
2018-06-01
Urinary tract infection, urinary frequency, urgency, urodynia and haemorrhage are common post-operative complications of thulium laser resection of the prostate (TmLRP). Our study mainly focuses on the role of finasteride in prostate wound healing through AR signalling. TmLRP beagles were randomly distributed into different treatment groups. Serum and intra-prostatic testosterone and DHT level were determined. Histological analysis was conducted to study the re-epithelialization and inflammatory response of the prostatic urethra in each group. We investigated the role of androgen in proliferation and inflammatory response in prostate. In addition, the effects of TNF-α on prostate epithelium and stromal cells were also investigated. Testosterone and DHT level increased in testosterone group and DHT decreased in finasteride group. Accelerated wound healing of prostatic urethra was observed in the finasteride group. DHT suppressed proliferation of prostate epithelium and enhanced inflammatory response in prostate. We confirmed that DHT enhanced macrophages TNF-α secretion through AR signalling. TNF-α suppressed proliferation of prostate epithelial cells and retarded cell migration. TNF-α also played a pivotal role in suppressing fibroblasts activation and contraction. Testosterone treatment repressed re-epithelialization and wound healing of prostatic urethra. Finasteride treatment may be an effective way to promote prostate re-epithelialization. © 2017 John Wiley & Sons Ltd.
75 FR 61655 - Airworthiness Directives; Piper Aircraft, Inc. Model PA-28-161 Airplanes
2010-10-06
...-1006; Directorate Identifier 2009-CE-057-AD] RIN 2120-AA64 Airworthiness Directives; Piper Aircraft... airworthiness directive (AD) for all Piper Aircraft, Inc. (Piper) Model PA-28-161 airplanes equipped with.... Piper Model PA-28-161 airplanes modified by STC No. SA03303AT have a similar unsafe design feature that...
An Amphiphysin-Like Domain in Fus2p Is Required for Rvs161p Interaction and Cortical Localization
Directory of Open Access Journals (Sweden)
Richard A. Stein
2016-02-01
Full Text Available Cell–cell fusion fulfils essential roles in fertilization, development and tissue repair. In the budding yeast, Saccharomyces cerevisiae, fusion between two haploid cells of opposite mating type generates the diploid zygote. Fus2p is a pheromone-induced protein that regulates cell wall removal during mating. Fus2p shuttles from the nucleus to localize at the shmoo tip, bound to Rvs161p, an amphiphysin. However, Rvs161p independently binds a second amphiphysin, Rvs167p, playing an essential role in endocytosis. To understand the basis of the Fus2p–Rvs161p interaction, we analyzed Fus2p structural domains. A previously described N-terminal domain (NTD is necessary and sufficient to regulate nuclear/cytoplasmic trafficking of Fus2p. The Dbl homology domain (DBH binds GTP-bound Cdc42p; binding is required for cell fusion, but not localization. We identified an approximately 200 amino acid region of Fus2p that is both necessary and sufficient for Rvs161p binding. The Rvs161p binding domain (RBD contains three predicted alpha-helices; structural modeling suggests that the RBD adopts an amphiphysin-like structure. The RBD contains a 13-amino-acid region, conserved with Rvs161p and other amphiphysins, which is essential for binding. Mutations in the RBD, predicted to affect membrane binding, abolish cell fusion without affecting Rvs161p binding. We propose that Fus2p/Rvs161p form a novel heterodimeric amphiphysin required for cell fusion. Rvs161p binding is required but not sufficient for Fus2p localization. Mutations in the C-terminal domain (CTD of Fus2p block localization, but not Rvs161p binding, causing a significant defect in cell fusion. We conclude that the Fus2p CTD mediates an additional, Rvs161p-independent interaction at the shmoo tip.
2010-07-01
... Guidance and Counseling Programs? 403.161 Section 403.161 Education Regulations of the Offices of the... the Special Programs? Comprehensive Career Guidance and Counseling Programs § 403.161 How must funds be used under the Comprehensive Career Guidance and Counseling Programs? (a) A State shall use not...
33 CFR 165.161 - Safety zones: Coast Guard Captain of the Port New York annual fireworks displays.
2010-07-01
... of the Port New York annual fireworks displays. 165.161 Section 165.161 Navigation and Navigable... Coast Guard District § 165.161 Safety zones: Coast Guard Captain of the Port New York annual fireworks displays. (a) Safety zones. The following areas are designated safety zones: (1) Bar Beach fireworks...
33 CFR 161.4 - Requirement to carry the rules.
2010-07-01
... (CONTINUED) PORTS AND WATERWAYS SAFETY VESSEL TRAFFIC MANAGEMENT Vessel Traffic Services General Rules § 161... the Local Notice to Mariners. The VTS User's Manual and the World VTS Guide, an International Maritime...
Energy Technology Data Exchange (ETDEWEB)
He Hong [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China); Li Wenlian [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China)], E-mail: wllioel@yahoo.com.cn; Su Zisheng; Chu Bei; Bi Defeng; Chen Yiren; Wang Dan; Su Wenming; Li Bin [Key Laboratory of Excited State Processes, Changchun Institute of Optics, Fine Mechanics and Physics, Chinese Academy of Sciences, Changchun 130033 (China)
2009-02-20
The authors demonstrate the interfacial exciplex electroluminescence (EL) between tris(acetylacetonato)-(mono-phenothroline) thulium [Tm(AcA){sub 3}phen] and two diamine derivatives with starburst molecular structure- 4,4',4''-tris[2-naphthyl(phenyl)amino]triphenylamine (2-TNATA) and 4,4',4''-tris[3-methyl-pheny(phenyl)-amino]triphenyl-amine (m-MTDATA), both of which have the same ionization potential (IP) (approximately 5.1 eV). When the Tm-complex and the two diamine derivatives are respectively used as the electron accepter and donors, the two EL devices exhibit different exciplex emissions, which verifies our previously reported opinion regarding the effect of the different substitutes on exciplex emission [W.M. Su, W.L. Li, Q. Xin, Z.S. Su, B. Chu, D.F. Bi, H. He, J.H. Niu, Appl. Phys. Lett. 91 (2007) 043508]. When the mixture of the two diamine derivatives is used as a donor, a white EL device with the Commission International de l'Eclairage (CIE) coordinates of (0.277, 0.323) is achieved. The exciplex formation mechanisms of the devices with the two different donors are discussed.
Energy Technology Data Exchange (ETDEWEB)
Matos, Paulo Sergio Fabris de
2006-07-01
Tunable lasers emitting around 2.3 mum region are important in many areas, like gas detection, remote sensing and medical applications. Thulium has a large emission spectra around 2.3 mum with demonstrated tuning range of 2.2-2.45 mum using the YLF host. For efficient pump absorption, a high concentration sensitizer like ytterbium can be used. We demonstrate quasi-cw operation of the Yb:Tm:YLF laser, pumped at 960 nm with a 20 W diode bar achieving the highest output power reported so far of 620 mW. Simultaneous pumping of the 2.3 mm Yb:Tm:YLF laser at 685 nm and 960 nm is demonstrated, showing higher slope efficiency than 960 nm alone. Numerical simulations and analytical models show the best ratio of pump power between both wavelengths. (author)
González-Hernández, Y; Pedraza-Sánchez, S; Blandón-Vijil, V; del Río-Navarro, B E; Vaughan, G; Moreno-Lafont, M; Escobar-Gutiérrez, A
2007-04-01
In humans, T cells expressing the CD161 molecule NKR-P1A constitute around 20% of the circulating CD3(+) cells and are potentially immunoregulatory in several diseases. Their role in asthma is not well known, but they could participate in asthma attacks. To determinate whether activation of CD161(+) T cells and their cytokine production correlate with clinical status of asthma, we analysed blood samples from asthma attack patients (AAP) and stable asthma patients (SAP) in comparison with healthy non-atopic controls (HC). There was a significant higher baseline expression of CD69 on T cells from AAP and the difference was more notorious on CD161(+) T cells; upregulation of CD69 was observed on both CD161(-) and CD161(+) T cells driven by Dermatophagoides pteronyssinus crude extract, whereas polyclonal stimulation with phorbol 12-myristate 13-acetate plus ionomycin predominantly induced IFN-gamma but no IL-4, IL-5 and IL-13 by CD161(+) T cells in all groups; upon polyclonal stimulation, there were more CD161(+) T cells producing IFN-gamma and less CD161(-) T cells producing this cytokine, contrasting with the opposite results observed in SAP and HC groups. Our results indicate that, during asthma attack, CD161(+) T cells are activated and are able to produce predominantly IFN-gamma but no Th2 cytokines. We hypothesize that during an asthma attack, IFN-gamma produced by CD161(+) T cells could help to reestablish the Th1/Th2 equilibrium. These observations may contribute to the understanding of the immune mechanisms involved in asthma attacks.
Lv, Minghua; Miao, Jinlin; Zhao, Peng; Luo, Xing; Han, Qing; Wu, Zhenbiao; Zhang, Kui; Zhu, Ping
2018-01-01
CD161 is used as a surrogate marker for Th17 cells, which are implicated in the pathogenesis of rheumatoid arthritis (RA). In this study, we evaluated the percentage, clinical significance, and CD98 and CD147 expression of CD4 + CD161 + T cells. The potential role of CD147 and CD98 in cyclophilin A-induced chemotaxis of CD4 + CD161 + T cells was analyzed. Thirty-seven RA patients, 15 paired synovial fluid (SF) of RA, and 22 healthy controls were recruited. The cell populations and surface expression of CD98 and CD147 were analyzed by flow cytometry. Spearman's rank correlation coefficient and multiple linear regression were applied to calculate the correlations. Chemotaxis assay was used to investigate CD4 + CD161 + T cell migration. We found that the percentage of CD4 + CD161 + T cells and their expression of CD147 and CD98 in SF were higher than in the peripheral blood of RA patients. Percentage of SF CD4 + CD161 + T cells was positively correlated with 28-Joint Disease Activity Score (DAS28). CD147 monoclonal antibody (HAb18) attenuated the chemotactic ability of CD4 + CD161 + T cells. An increased CD4 + CD161 + T cell percentage and expression of CD147 and CD98 were shown in RA SF. Percentage of SF CD4 + CD161 + T cells can be used as a predictive marker of disease activity in RA. CD147 block significantly decreased the chemotactic index of CD4 + CD161 + cells induced by cyclophilin A (CypA). These results imply that the accumulation of CD4 + CD161 + T cells in SF and their high expression of CD147 may be associated with CypA-mediated chemotaxis and contribute to local inflammation in RA.
Spectroscopic properties of 1.8 μm emission of thulium ions in germanate glass
Xu, R. R.; Tian, Y.; Wang, M.; Hu, L. L.; Zhang, J. J.
2011-01-01
A new type host of germanate glass (GeO2- BaO-BaF2-Ga2O3-La2O3) codoped with Tm2O3 has been investigated for application as laser material. It possesses a large emission cross section with the value of 9.3×10-21 cm2 at 1.8 μm. Judd-Ofelt intensity parameters and radiative transition probability are calculated and analyzed by Judd-Ofelt theory and absorption spectra. The infrared emission spectra at 1.8 μm have been obtained by using a 794 nm laser diode as excitation resource. The emission intensity ratio of 1.8 (3F4→3H6) to 1.47 μm (3H4→3F4) increases, while the experimental lifetime of the Tm3+:3H4 level decreases by increasing Tm2O3 concentration, which is attributed to the presence of a cross relaxation process. The most intensive emission at 1.8 μm is achieved from the germanate glass with the concentration of Tm2O3 reaches 1.0 wt%. The extended overlap integral method is used to calculate the microparameter of the energy transfer and the critical distance, which are derived to better understand the energy transfer process of thulium ions in the germanate glass responsible for emission at 1.8 μm.
21 CFR 161.30 - Declaration of quantity of contents on labels for canned oysters.
2010-04-01
... canned oysters. 161.30 Section 161.30 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH....30 Declaration of quantity of contents on labels for canned oysters. (a) For many years packers of canned oysters in the Gulf area of the United States have labeled their output with a declaration of the...
Expression of LLT1 and its receptor CD161 in lung cancer is associated with better clinical outcome.
Braud, Véronique M; Biton, Jérôme; Becht, Etienne; Knockaert, Samantha; Mansuet-Lupo, Audrey; Cosson, Estelle; Damotte, Diane; Alifano, Marco; Validire, Pierre; Anjuère, Fabienne; Cremer, Isabelle; Girard, Nicolas; Gossot, Dominique; Seguin-Givelet, Agathe; Dieu-Nosjean, Marie-Caroline; Germain, Claire
2018-01-01
Co-stimulatory and inhibitory receptors expressed by immune cells in the tumor microenvironment modulate the immune response and cancer progression. Their expression and regulation are still not fully characterized and a better understanding of these mechanisms is needed to improve current immunotherapies. Our previous work has identified a novel ligand/receptor pair, LLT1/CD161, that modulates immune responses. Here, we extensively characterize its expression in non-small cell lung cancer (NSCLC). We show that LLT1 expression is restricted to germinal center (GC) B cells within tertiary lymphoid structures (TLS), representing a new hallmark of the presence of active TLS in the tumor microenvironment. CD161-expressing immune cells are found at the vicinity of these structures, with a global enrichment of NSCLC tumors in CD161 + CD4 + and CD8 + T cells as compared to normal distant lung and peripheral blood. CD161 + CD4 + T cells are more activated and produce Th1-cytokines at a higher frequency than their matched CD161-negative counterparts. Interestingly, CD161 + CD4 + T cells highly express OX40 co-stimulatory receptor, less frequently 4-1BB, and display an activated but not completely exhausted PD-1-positive Tim-3-negative phenotype. Finally, a meta-analysis revealed a positive association of CLEC2D (coding for LLT1) and KLRB1 (coding for CD161) gene expression with favorable outcome in NSCLC, independently of the size of T and B cell infiltrates. These data are consistent with a positive impact of LLT1/CD161 on NSCLC patient survival, and make CD161-expressing CD4 + T cells ideal candidates for efficient anti-tumor recall responses.
12 CFR 16.1 - Authority, purpose, and scope.
2010-01-01
....1 Banks and Banking COMPTROLLER OF THE CURRENCY, DEPARTMENT OF THE TREASURY SECURITIES OFFERING DISCLOSURE RULES § 16.1 Authority, purpose, and scope. (a) Authority. This part is issued under the general... 12 U.S.C. 93a. (b) Purpose. This part sets forth rules governing the offer and sale of securities...
Energy Technology Data Exchange (ETDEWEB)
Kabalci, Idris [Department of Physics Education, Education Faculty, Harran University, Sanliurfa (Turkey); Tay, Turgay [Department of Chemistry, Science Faculty, Anadolu University, Eskisehir (Turkey); Oezen, Goenuel [Department of Physics, Science and Arts Faculty, Istanbul Technical University, Istanbul (Turkey)
2011-09-15
A type of thulium doped tellurite based optical glasses was prepared through conventional melt quenching technique. In the experiments, the effect of different Tm{sup 3+} ion concentration and glass composition on optical properties of (TeO{sub 2}){sub (1-x-y)}(Nb{sub 2}O{sub 5}){sub (x)}(TiO{sub 2}){sub (y)} (x=0.05, 0.10, 0.15, and 0.20 mol) glasses have been investigated by using UV-VIS-NIR optical spectrophotometry measurements in a wavelength range 400-2000 nm. Considering absorption measurements for the 1.0mol% Tm{sup 3+} doped of (TeO{sub 2}){sub 0.9}(Nb{sub 2}O{sub 5}){sub 0.05}(TiO{sub 2}){sub 0.05} glass, {sup 1}G{sub 4}, {sup 3}F{sub 2}, {sup 3}F{sub 3}, {sup 3}F{sub 4}, {sup 3}H{sub 5}, and {sup 3}H{sub 4} absorption bands were observed from the {sup 3}H{sub 6} ground level, at 463, 660, 687, 793, 1211 and 1700 nm wavelengths, respectively. Furthermore, spontaneous emission probabilities, and the radiative lifetimes for the 4f-4f transitions of the Tm{sup 3+} ions were calculated. The spectral intensities were determined in terms of Judd-Ofelt parameters ({omega}{sub 2}, {omega}{sub 4}, {omega}{sub 6}). Luminescence analysis was realized for the different Tm{sup 3+} ion concentration (0.002, 0.005 and 0.01mol) at room temperature. The luminescence band intensity of the {sup 3}F{sub 4}{yields}{sup 3}H{sub 4} transition was measured as a function of Tm{sup 3+} ion concentration (0.002, 0.005 and 0.01mol). Furthermore, luminescence data of the thulium doped glass samples were used to determine the compositional dependence of the emission cross sections at 1470 nm (copyright 2011 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim) (orig.)
A dual enzyme functionalized nanostructured thulium oxide based interface for biomedical application
Singh, Jay; Roychoudhury, Appan; Srivastava, Manish; Solanki, Pratima R.; Lee, Dong Won; Lee, Seung Hee; Malhotra, B. D.
2013-12-01
In this paper, we present results of the studies related to fabrication of a rare earth metal oxide based efficient biosensor using an interface based on hydrothermally prepared nanostructured thulium oxide (n-Tm2O3). A colloidal solution of prepared nanorods has been electrophoretically deposited (EPD) onto an indium-tin-oxide (ITO) glass substrate. The n-Tm2O3 nanorods are found to provide improved sensing characteristics to the electrode interface in terms of electroactive surface area, diffusion coefficient, charge transfer rate constant and electron transfer kinetics. The structural and morphological studies of n-Tm2O3 nanorods have been carried out by X-ray diffraction (XRD), scanning electron microscopy (SEM), transmission electron microscopy (TEM), X-ray photoelectron spectroscopy (XPS) and Fourier transform infrared (FTIR) spectroscopic techniques. This interfacial platform has been used for fabrication of a total cholesterol biosensor by immobilizing cholesterol esterase (ChEt) and cholesterol oxidase (ChOx) onto a Tm2O3 nanostructured surface. The results of response studies of the fabricated ChEt-ChOx/n-Tm2O3/ITO bioelectrode show a broad linear range of 8-400 mg dL-1, detection limit of 19.78 mg (dL cm-2)-1, and high sensitivity of 0.9245 μA (mg per dL cm-2)-1 with a response time of 40 s. Further, this bioelectrode has been utilized for estimation of total cholesterol with negligible interference (3%) from analytes present in human serum samples. The utilization of this n-Tm2O3 modified electrode for enzyme-based biosensor analysis offers an efficient strategy and a novel interface for application of the rare earth metal oxide materials in the field of electrochemical sensors and bioelectronic devices.In this paper, we present results of the studies related to fabrication of a rare earth metal oxide based efficient biosensor using an interface based on hydrothermally prepared nanostructured thulium oxide (n-Tm2O3). A colloidal solution of prepared
14 CFR 121.161 - Airplane limitations: Type of route.
2010-01-01
... 14 Aeronautics and Space 3 2010-01-01 2010-01-01 false Airplane limitations: Type of route. 121... OPERATING REQUIREMENTS: DOMESTIC, FLAG, AND SUPPLEMENTAL OPERATIONS Aircraft Requirements § 121.161 Airplane... specifications, no certificate holder may operate a turbine-engine-powered airplane over a route that contains a...
African Journal of Drug & Alcohol Studies, 16(1), 2017 Copyright ...
African Journals Online (AJOL)
African Journal of Drug & Alcohol Studies, 16(1), 2017. Copyright © 2017 ... Linear regression showed that males are more likely to abuse alcohol than females. (β= -.17; t = -3.47; ..... gerians through depression, suicide, road traffic accidents ...
Hindered El Transitions in Eu{sup 155} and Tb{sup 161}
Energy Technology Data Exchange (ETDEWEB)
Malmskog, Sven G
1965-02-15
The absolute E1 transition probabilities from the 3/2{sup +} (411), 5/2{sup -} (532) and 7/2{sup -} (523) single particle levels in Eu{sup 155} and Tb{sup 161} have been measured by the method of delayed coincidences. This gave half lives of T{sub 1/2} < 0.2 ns and T{sub 1/2} = (1.38 {+-} 0.06) ns for the 104.4 and 246 keV levels in Eu{sup 155}. T{sub 1/2} = (0.84 {+-} 0.04) ns and T{sub 1/2} < 0. 2 ns for the 417.6 and 480.6 keV levels in Tb{sup 161}. The result has been compared with the calculations of a single particle in a deformed potential made by Nilsson.
Directory of Open Access Journals (Sweden)
Fakhri Hassouneh
2017-06-01
Full Text Available Immunosenescence is a progressive deterioration of the immune system with aging. It affects both innate and adaptive immunity limiting the response to pathogens and to vaccines. As chronic cytomegalovirus (CMV infection is probably one of the major driving forces of immunosenescence, and its persistent infection results in functional and phenotypic changes to the T-cell repertoire, the aim of this study was to analyze the effect of CMV-seropositivity and aging on the expression of CD300a and CD161 inhibitory receptors, along with the expression of CD57 marker on CD4+, CD8+, CD8+CD56+ (NKT-Like and CD4−CD8− (DN T-cell subsets. Our results showed that, regardless of the T-cell subset, CD57−CD161−CD300a+ T-cells expand with age in CMV-seropositive individuals, whereas CD57−CD161+CD300a+ T-cells decrease. Similarly, CD57+CD161−CD300a+ T-cells expand with age in CMV-seropositive individuals in all subsets except in DN cells and CD57−CD161+CD300a− T-cells decrease in all T-cell subsets except in CD4+ T-cells. Besides, in young individuals, CMV latent infection associates with the expansion of CD57+CD161−CD300a+CD4+, CD57−CD161−CD300a+CD4+, CD57+CD161−CD300a+CD8+, CD57−CD161−CD300a+CD8+, CD57+CD161−CD300a+NKT-like, and CD57+CD161−CD300a+DN T-cells. Moreover, in young individuals, CD161 expression on T-cells is not affected by CMV infection. Changes of CD161 expression were only associated with age in the context of CMV latent infection. Besides, CD300a+CD57+CD161+ and CD300a−CD57+CD161+ phenotypes were not found in any of the T-cell subsets studied except in the DN subpopulation, indicating that in the majority of T-cells, CD161 and CD57 do not co-express. Thus, our results show that CMV latent infection impact on the immune system depends on the age of the individual, highlighting the importance of including CMV serology in any study regarding immunosenescence.
Chen, Hai-Jing; Xie, Wei-Yan; Hu, Fang; Zhang, Ying; Wang, Jun; Wang, Yun
2012-04-01
Our previous study identified Threonine 161 (Thr-161), located in the second intracellular loop of the δ-opioid receptor (DOR), as the only consensus phosphorylation site for cyclin-dependent kinase 5 (Cdk5). The aim of this study was to assess the function of DOR phosphorylation by Cdk5 in complete Freund's adjuvant (CFA)-induced inflammatory pain and morphine tolerance. Dorsal root ganglion (DRG) neurons of rats with CFA-induced inflammatory pain were acutely dissociated and the biotinylation method was used to explore the membrane localization of phosphorylated DOR at Thr-161 (pThr-161-DOR), and paw withdrawal latency was measured after intrathecal delivery of drugs or Tat-peptide, using a radiant heat stimulator in rats with CFA-induced inflammatory pain. Both the total amount and the surface localization of pThr-161-DOR were significantly enhanced in the ipsilateral DRG following CFA injection. Intrathecal delivery of the engineered Tat fusion-interefering peptide corresponding to the second intracellular loop of DOR (Tat-DOR-2L) increased inflammatory hypersensitivity, and inhibited DOR- but not µ-opioid receptor-mediated spinal analgesia in CFA-treated rats. However, intrathecal delivery of Tat-DOR-2L postponed morphine antinociceptive tolerance in rats with CFA-induced inflammatory pain. Phosphorylation of DOR at Thr-161 by Cdk5 attenuates hypersensitivity and potentiates morphine tolerance in rats with CFA-induced inflammatory pain, while disruption of the phosphorylation of DOR at Thr-161 attenuates morphine tolerance.
Directory of Open Access Journals (Sweden)
Johanna Maria Eberhard
Full Text Available Mucosal-associated invariant T (MAIT cells are characterized by the combined expression of the semi-invariant T cell receptor (TCR Vα7.2, the lectin receptor CD161, as well as IL-18R, and play an important role in antibacterial host defense of the gut. The current study characterized CD161(+ MAIT and CD161-TCRVα7.2(+ T cell subsets within a large cohort of HIV patients with emphasis on patients with slow disease progression and elite controllers. Mononuclear cells from blood and lymph node samples as well as plasma from 63 patients and 26 healthy donors were analyzed by multicolor flow cytometry and ELISA for IL-18, sCD14 and sCD163. Additionally, MAIT cells were analyzed after in vitro stimulation with different cytokines and/or fixed E.coli. Reduced numbers of CD161(+ MAIT cells during HIV infection were detectable in the blood and lymph nodes of all patient groups, including elite controllers. CD161+ MAIT cell numbers did not recover even after successful antiretroviral treatment. The loss of CD161(+ MAIT cells was correlated with higher levels of MAIT cell activation; an increased frequency of the CD161-TCRVα7.2(+T cell subset in HIV infection was observed. In vitro stimulation of MAIT cells with IL-18 and IL-12, IL-7 and fixed E.coli also resulted in a rapid and additive reduction of the MAIT cell frequency defined by CD161, IL-18R and CCR6. In summary, the irreversible reduction of the CD161(+ MAIT cell subset seems to be an early event in HIV infection that is independent of later stages of the disease. This loss appears to be at least partially due to the distinctive vulnerability of MAIT cells to the pronounced stimulation by microbial products and cytokines during HIV-infection.
An integrated fiber and stone basket device for use in Thulium fiber laser lithotripsy
Wilson, Christopher R.; Hutchens, Thomas C.; Hardy, Luke A.; Irby, Pierce B.; Fried, Nathaniel M.
2014-03-01
The Thulium fiber laser (TFL) is being explored as an alternative laser lithotripter to the Holmium:YAG laser. The TFL's superior near-single mode beam profile enables higher power transmission through smaller fibers with reduced proximal fiber tip damage. Recent studies have also reported that attaching hollow steel tubing to the distal fiber tip decreases fiber degradation and burn-back without compromising stone ablation rates. However, significant stone retropulsion was observed, which increased with pulse rate. In this study, the hollow steel tip fiber design was integrated with a stone basket to minimize stone retropulsion during ablation. A device was constructed consisting of a 100-μm-core, 140-μm-OD silica fiber outfitted with 5-mm-long stainless steel tubing at the distal tip, and integrated with a 1.3-Fr (0.433-mm-OD) disposable nitinol wire basket, to form an overall 1.9-Fr (0.633-mm- OD) integrated device. This compact design may provide several potential advantages including increased flexibility, higher saline irrigation rates through the ureteroscope working channel, and reduced fiber tip degradation compared to separate fiber and stone basket manipulation. TFL pulse energy of 31.5 mJ with 500 μs pulse duration and pulse rate of 500 Hz was delivered through the integrated fiber/basket device in contact with human uric acid stones, ex vivo. TFL stone ablation rates measured 1.5 +/- 0.2 mg/s, comparable to 1.7 +/- 0.3 mg/s (P > 0.05) using standard bare fiber tips separately with a stone basket. With further development, this device may be useful for minimizing stone retropulsion, thus enabling more efficient TFL lithotripsy at higher pulse rates.
2010-07-01
... Deputy Attorney General or Associate Attorney General, as appropriate. 0.161 Section 0.161 Judicial... certain offers by the Deputy Attorney General or Associate Attorney General, as appropriate. (a) In all... § 0.160, the Assistant Attorney General concerned shall, when he is of the opinion that the proposed...
Compounds of divalent thulium, neodymium, and dysprosium
International Nuclear Information System (INIS)
Bochkarev, M.N.; Fedushkin, I.L.; Trifonov, A.A.; Fagin, A.A.; Kirillov, E.N.
1998-01-01
Full text: Judging on the Ln(II)/Ln(III) potentials Tm, Nd, and Dy are the first candidates after Sm, Eu, and Yb for the preparation of Ln(II) compounds. The first molecular Tm(II) derivatives, TmI 2 (DME) 3 (I), has been obtained recently by the reduction of TmI 3 with thulium metal in DME (1,2-dimethoxyethane). The tetrahydrofuran (THF) analogue, TmI 2 (THF) 5 , was synthesized similarly. In the case of TmBI 3 and TmCl 3 the same reaction does not occur. The compound I is inert toward naphthalene, anthracene, phenylacetylene, CpH, (Me 3 Si) 2 NH, 2,4,6-t-Bu 3 C 6 H 2 OH, Cp 2 V, Cp 2 Fe, or Cp 3 Er. The reactions of I with PhOH, Ph 3 COH, 3,6-t-Bu 2 C 6 H 2 (OH) 2 -1,2 (Cat), and calixarene (Cal) produce, Ph 3 COTmI 2 (DME) 2 , (Cat)TmI(DME) 2 , and (Cal)TmI, correspondingly. The attempts to use I for preparation of the other Tm(II) complexes failed. In all cases (reactions with C 10 H 8 Li, CpK, [1,3-(Me 3 Si) 2 C 5 H 3 ]MgCl, and [Cp'-SiMe 2 -Ind']K 2 ) the Tm(III) derivatives (respectively, (C 10 H 8 Tm) 2 C 10 H 8 , Cp 3 Tm, [1,3-(Me 3 Si) 2 C 5 H 3 ] 2 TmCl, and Cp'-SiMe 2 -Ind')TmI) were obtained. The new stable Tm(II) complex, PhOTmI(DME) 2 (II), has been synthesized by the reduction of I with potassium metal in DME. The product was isolated as the green crystals with μ eff 4.6 BM. Unlike TmI 3 , NdI 3 and DyI 3 can not be reduced by metallic neodymium, dysprosium or sodium in DME or THF. Re-investigation of the product formed in the reaction of NdCl 3 with a lack of Li and naphthalene which was claimed before as NdCl 2 (THF) 2 has shown that this is a mixture of Nd(III) naphthalene complexes of the type [(NdCl 2 (THF) 2 ]nC 10 H 8 (n = 4- 7) (III). Nevertheless the product may be used instead of NdCl 2 for the preparation of RNdCl 2 type complexes. The reactions of III with t-BuNCH=CHNBu-t (DAD), PhCH=CHCH=CHPh (DBD), and PhCH=CHPh afford (DAD)NdCl 2 (THF) 2 , (DBD)[NdCl 2 (THF) 2 ] 2 , and (PhCHCHPh)[NdCl 2 ] 2 (THF) 3 , respectively. The iodides of Nd
22 CFR 161.12 - Environmental effects abroad of major departmental actions.
2010-04-01
... 22 Foreign Relations 1 2010-04-01 2010-04-01 false Environmental effects abroad of major... Requirements of NEPA § 161.12 Environmental effects abroad of major departmental actions. Departmental officials shall analyze actions under their cognizance with due regard for the environmental effects in the...
International Nuclear Information System (INIS)
Adib, M.; Maayouf, R.M.A.; Abdel-Kawy, A.; Abu-Elnour, F.; Hamouda, I.
1979-01-01
Total neutron cross-section measurements have been carried out for cerium and thulium in the energy range from 1.8 meV to 1.8 eV. The measurements were performed using the time-of-flight spectrometer installed in front of one of the horizontal channels of the ET-RR-1 reactor. The obtained total neutron cross-sections were analyzed using the single level Breit-Wigner formula and the magnetic form factor. The potential scattering cross-section of Ce was found to be (3.14 +- 0.3) barns. Its coherent scattering amplitude was determined from the Bragg reflections observed in the total neutron cross-section of CeO 2 and found to be (4,8 +- 0.2) fm. The potential scattering and absorption cross-sections of Tm, at E = 0.025 eV, were found to be (7.5 +- 0.7) barns and (89.1 +- 4.1) barns respectively. (orig.) [de
40 CFR 65.161 - Continuous records and monitoring system data handling.
2010-07-01
... section. (D) Owners and operators shall retain the current description of the monitoring system as long as... Routing to a Fuel Gas System or a Process § 65.161 Continuous records and monitoring system data handling...) Monitoring system breakdowns, repairs, preventive maintenance, calibration checks, and zero (low-level) and...
2012-05-14
... DEPARTMENT OF LABOR Employee Benefits Security Administration 161st Meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans; Notice of Meeting Pursuant to the authority... 161st open meeting of the Advisory Council on Employee Welfare and Pension Benefit Plans (also known as...
42 CFR 84.161 - Man test for gases and vapors; Type B and Type BE respirators; test requirements.
2010-10-01
... 42 Public Health 1 2010-10-01 2010-10-01 false Man test for gases and vapors; Type B and Type BE respirators; test requirements. 84.161 Section 84.161 Public Health PUBLIC HEALTH SERVICE, DEPARTMENT OF HEALTH AND HUMAN SERVICES OCCUPATIONAL SAFETY AND HEALTH RESEARCH AND RELATED ACTIVITIES APPROVAL OF RESPIRATORY PROTECTIVE DEVICES Supplied-Air...
Turtle, Cameron J; Delrow, Jeff; Joslyn, Rochelle C; Swanson, Hillary M; Basom, Ryan; Tabellini, Laura; Delaney, Colleen; Heimfeld, Shelly; Hansen, John A; Riddell, Stanley R
2011-09-08
Type 17 programmed CD161(hi)CD8α(+) T cells contribute to mucosal immunity to bacteria and yeast. In early life, microbial colonization induces proliferation of CD161(hi) cells that is dependent on their expression of a semi-invariant Vα7.2(+) TCR. Although prevalent in adults, CD161(hi)CD8α(+) cells exhibit weak proliferative and cytokine responses to TCR ligation. The mechanisms responsible for the dichotomous response of neonatal and adult CD161(hi) cells, and the signals that enable their effector function, have not been established. We describe acquired regulation of TCR signaling in adult memory CD161(hi)CD8α(+) T cells that is absent in cord CD161(hi) cells and adult CD161(lo) cells. Regulated TCR signaling in CD161(hi) cells was due to profound alterations in TCR signaling pathway gene expression and could be overcome by costimulation through CD28 or innate cytokine receptors, which dictated the fate of their progeny. Costimulation with IL-1β during TCR ligation markedly increased proinflammatory IL-17 production, while IL-12-induced Tc1-like function and restored the response to TCR ligation without costimulation. CD161(hi) cells from umbilical cord blood and granulocyte colony stimulating factor-mobilized leukaphereses differed in frequency and function, suggesting future evaluation of the contribution of CD161(hi) cells in hematopoietic stem cell grafts to transplant outcomes is warranted.
46 CFR 161.002-10 - Automatic fire detecting system control unit.
2010-10-01
... 46 Shipping 6 2010-10-01 2010-10-01 false Automatic fire detecting system control unit. 161.002-10...-10 Automatic fire detecting system control unit. (a) General. The fire detecting system control unit... and the battery to be charged. (h) Automatic fire detecting system, battery charging and control—(1...
Energy Technology Data Exchange (ETDEWEB)
Mueller, Cristina; Reber, Josefine; Haller, Stephanie [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger; Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Laboratory of Radiochemistry and Environmental Chemistry, Department of Chemistry and Biochemistry, Bern (Switzerland); Bernhardt, Peter [The Sahlgrenska Academy, University of Gothenburg, Department of Radiation Physics, Gothenburg (Sweden); Sahlgrenska University Hospital, Department of Medical Physics and Medical Bioengeneering, Gothenburg (Sweden); Zhernosekov, Konstantin [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)
2014-03-15
The radiolanthanide {sup 161}Tb (T{sub 1/2} = 6.90 days, Eβ{sup -}{sub av} = 154 keV) was recently proposed as a potential alternative to {sup 177}Lu (T{sub 1/2} = 6.71 days, Eβ{sup -}{sub av} = 134 keV) due to similar physical decay characteristics but additional conversion and Auger electrons that may enhance the therapeutic efficacy. The goal of this study was to compare {sup 161}Tb and {sup 177}Lu in vitro and in vivo using a tumour-targeted DOTA-folate conjugate (cm09). {sup 161}Tb-cm09 and {sup 177}Lu-cm09 were tested in vitro on folate receptor (FR)-positive KB and IGROV-1 cancer cells using a 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide (MTT) viability assay. In vivo {sup 161}Tb-cm09 and {sup 177}Lu-cm09 (10 MBq, 0.5 nmol) were investigated in two different tumour mouse models with regard to the biodistribution, the possibility for single photon emission computed tomography (SPECT) imaging and the antitumour efficacy. Potentially undesired side effects were monitored over 6 months by determination of plasma parameters and examination of kidney function with quantitative SPECT using {sup 99m}Tc-dimercaptosuccinic acid (DMSA). To obtain half-maximal inhibition of tumour cell viability a 4.5-fold (KB) and 1.7-fold (IGROV-1) lower radioactivity concentration was required for {sup 161}Tb-cm09 (IC{sub 50} ∝0.014 MBq/ml and ∝2.53 MBq/ml) compared to {sup 177}Lu-cm09 (IC{sub 50} ∝0.063 MBq/ml and ∝4.52 MBq/ml). SPECT imaging visualized tumours of mice with both radioconjugates. However, in therapy studies {sup 161}Tb-cm09 reduced tumour growth more efficiently than {sup 177}Lu-cm09. These findings were in line with the higher absorbed tumour dose for {sup 161}Tb-cm09 (3.3 Gy/MBq) compared to {sup 177}Lu-cm09 (2.4 Gy/MBq). None of the monitored parameters indicated signs of impaired kidney function over the whole time period of investigation after injection of the radiofolates. Compared to {sup 177}Lu-cm09 we demonstrated equal imaging
CD3+CD8+CD161high Tc17 cells are depleted in HIV-infection
DEFF Research Database (Denmark)
Gaardbo, Julie Christine; Hartling, Hans Jakob; Thorsteinsson, Kristina
2012-01-01
CD8+ Tc17 cells with pro-inflammatory properties have only recently been acknowledged, and Tc17 cells in HIV-infection are undescribed. CD3+CD8+CD161 Tc17 cells and the production of Interleukin-17 were examined in untreated and treated HIV-infected patients, HIV-HCV co-infected patients...... and healthy controls. Depletion of CD3+CD8+CD161 Tc17 cells and diminished production of Interleukin-17 in HIV-infected patients was found. The level of Tc17 cells was associated with the level of the CD4+ count in treated patients....
Ahmad, H.; Samion, M. Z.; Sharbirin, A. S.; Norizan, S. F.; Aidit, S. N.; Ismail, M. F.
2018-05-01
Graphene, a 2D material, has been used for generation of pulse lasers due to the presence of its various fascinating optical properties compared to other materials. Hence in this paper, we report the first demonstration of a thulium doped fiber laser with a wavelength-tunable, passive Q-switched output using a graphene-polyvinyl-alcohol composite film for operation in the 2.0 µm region. The proposed laser has a wavelength-tunable output spanning from 1932.0 nm to 1946.0 nm, giving a total tuning range of 14.0 nm. The generated pulse has a maximum repetition rate and average output power of 36.29 kHz and 0.394 mW at the maximum pump power of 130.87 mW, as well as a pulse width of 6.8 µs at this pump power. The generated pulses have a stable output, having a signal-to-noise ratio of 31.75 dB, and the laser output is stable when tested over a period of 60 min. The proposed laser would have multiple applications for operation near the 2.0 micron region, especially for bio-medical applications and range-finding.
International Nuclear Information System (INIS)
Takahashi, Ryouta; Ishiguro, Shin-ichi
1991-01-01
The formation of chloro, bromo and iodo complexes of yttrium(III), and bromo and iodo complexes of lanthanum(III), neodymium(III), terbium(III) and thulium(III) has been studied by precise titration calorimetry in N,N-dimethylformamide (DMF) at 25 o C. The formation of [YCl] 2+ , [YCl 2 ] + , [YCl 3 ] and [YCl 4 ] - , and [MBr] 2+ and [MBr 2 ] + (M = Y, La, Nd, Tb, Tm) was revealed, and their formation constants, enthalpies and entropies were determined. It is found that the formation enthalpies change in the sequence ΔH o (Cl) > ΔH o (l), which is unusual for hard metal (III) ions. This implies that, unlike the chloride ion, the bromide ion forms outer-sphere complexes with the lanthanide(III) and yttrium(III) ions in DMF. Evidence for either an inner- or outer-sphere complex was obtained from 89 Y NMR spectra for Y(ClO 4 ) 3 , YCl 3 and YBr 3 DMF solutions at room temperature. (author)
Evaluation and application of the low energy electron emitter 161Tb
International Nuclear Information System (INIS)
Lehenberger, Silvia M.
2010-01-01
The low energy electron emitter 161 Tb was produced n.c.a. in quantities sufficient for therapeutic applications and successfully used for labeling of peptides and antibodies. Furthermore, these compounds have been compared to n.c.a. 177 Lu labeled mAbs via cell experiments, a radionuclide that is already used in clinical nuclear oncology.
27 CFR 31.161 - Conversion between metric and U.S. units.
2010-04-01
... Wholesale Dealers' Records and Reports § 31.161 Conversion between metric and U.S. units. When liters are... number of cases to be converted, as follows: (a) If the conversion from liters to U.S. units is made... 27 Alcohol, Tobacco Products and Firearms 1 2010-04-01 2010-04-01 false Conversion between metric...
20 CFR 702.161 - Liens against assets of insurance carriers and employers.
2010-04-01
... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Liens against assets of insurance carriers... AND PROCEDURE General Provisions Liens on Compensation § 702.161 Liens against assets of insurance..., be subrogated to all the rights of the person receiving such payments. The Secretary may institute...
Energy Storage Analysis of a Mixed R161/MOF-5 Nanoparticle Nanofluid Based on Molecular Simulations.
Wang, Qiang; Tang, Shengli; Li, Leilei
2018-05-20
The thermal properties of refrigerants can be modified by adding porous nanoparticles into them. Here, molecular simulations, including molecular dynamics and grand canonical Monte Carlo, were employed to study the thermal energy storage properties of an R161/MOF-5 nanofluid. The results show that the thermodynamic energy change of MOF-5 nanoparticles is linear to the temperature. The adsorption heat calculated by grand canonical Monte Carlo is close to that calculated by the Clausius⁻Clapeyron equation. Additionally, a negative enhancement of the thermal energy storage capacity of the R161/MOF-5 nanofluid is found near the phase transition area.
25 CFR 161.610 - What will BIA do if livestock is not removed when a permit expires or is cancelled?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false What will BIA do if livestock is not removed when a permit expires or is cancelled? 161.610 Section 161.610 Indians BUREAU OF INDIAN AFFAIRS, DEPARTMENT OF... will BIA do if livestock is not removed when a permit expires or is cancelled? If the livestock is not...
Van Schil, Kristof; Klevering, B. Jeroen; Leroy, Bart P.; Pott, Jan Willem R.; Bandah-Rozenfeld, Dikla; Zonneveld-Vrieling, Marijke N.; Sharon, Dror; den Hollander, Anneke I.; Cremers, Frans P. M.; De Baere, Elfride; Collin, Rob W. J.; van den Born, L. Ingeborgh
PURPOSE. To identify mutations in FAM161A underlying autosomal recessive retinitis pigmentosa (arRP) in the Dutch and Belgian populations and to investigate whether common FAM161A-associated phenotypic features could be identified. METHODS. Homozygosity mapping, amplification-refractory mutation
International Nuclear Information System (INIS)
Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane; Dorrer, Holger; Zhernosekov, Konstantin; Koester, Ulli; Tuerler, Andreas; Schibli, Roger
2014-01-01
The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with 67 Cu- and 177 Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide 177 Lu and the potential alternative 161 Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched 160 Gd targets. 161 Tb and 177 Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of 177 Lu- and 161 Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. 177 Lu- and 161 Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. 161 Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the 177 Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the 161 Tb-DOTA-chCE7 than the 177 Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM 161 Tb RIT is more effective compared to 177 Lu RIT in ovarian cancer xenografts. These results suggest that 161 Tb is a promising candidate for future clinical
Preparation of extractive resins for producing terbium-161
International Nuclear Information System (INIS)
De la Cruz B, C. C.; Monroy G, F.
2009-10-01
This paper presents the development of a methodology for extractive resins preparation to base of HDEHP, which allows to separation of Tb from Gd generating an own technology of preparation of these resins. The study included the extractive resins preparation from 6 different supports: kieselguhr Dg, alumina, red volcanic rock, chiluca, quarry and fluorite; two treatment types of of supports and varied concentrations of HDEHP extractant (di(2-etil hexyl) orthophosphoric acid), in order to determine which resin has improved efficiency of Gd and Tb separation, and radionuclide purity of 161 Tb. Resins were prepared to base of kieselguhr to determine the most appropriate silicon deposition process. Two silicon deposition treatments were realized: treatment I , by contact with silicon deposition solution (dimethyldichlorosilane / heptane 1:30) and treatment II by contact with vapors of dimethyldichlorosilane in vacuum. The extractant retention was carried out to different concentrations of HDEHP / acetone: 1:4, 1:8, 1:15, 1:20, 1:30 and 1:40. According to the results, there is not direct relation of HDEHP concentration used in extractive resins preparation to base of kieselguhr over the efficiency of Gd and Tb separation and of radionuclide purity of 161 Tb. The effect of support in the efficiency of Gd and Tb separation was studied to prepare resins with the supports kieselguhr, alumina, quarry, chiluca, volcanic rock and fluorite, using the silicon deposition treatment II for the supports and a concentration of HDEHP / acetone 1:20, for extractant retention. Only resins based on kieselguhr could separate to Gd from Tb quantitatively, the resin at a concentration of HDEHP / Acetone 1:20 was the best results obtained in Gd and Tb separation, achieving a separation efficiency greater than 90% and a radionuclide purity higher than 99%. (Author)
The unpaired spectroscopy of sup 161,162 Er at spins up to 50 Dirac h
Energy Technology Data Exchange (ETDEWEB)
Riley, M.A.; Roberts, J.W.; Alderson, A.; Ali, I.; Cullen, D.M.; Fallon, P.; Forsyth, P.D.; Sharpey-Schafer, J.F. (Liverpool Univ. (UK). Oliver Lodge Lab.); Simpson, J.; Bentley, M.A.; Bruce, A.M. (Science and Engineering Research Council, Daresbury (UK). Daresbury Lab.); Chapman, R.; Lisle, J.C.; Mo, J.N. (Manchester Univ. (UK). Schuster Lab.)
1990-12-24
High spin states in {sup 161}Er and {sup 162}Er have been populated using the {sup 130}Te+{sup 36}S reaction at a bombarding energy of 170 MeV. In {sup 161}Er, three rotational bands were extended from I {approx equal} 35{Dirac h} to I {approx equal} 50{Dirac h}. In {sup 162}Er the positive parity yrast band was observed to I=44{Dirac h}. These rotational sequences are compared to a simple unpaired model which was successful in predicting the behaviour of similar high spin data on {sup 159,160}Er. These studies of the light Er isotopes constitute the highest spins observed in normal deformed nuclei and yield direct and specific information on the single-neutron spectrum of states. (orig.).
International Nuclear Information System (INIS)
Lerner, Mikael; Harada, Masako; Loven, Jakob; Castro, Juan; Davis, Zadie; Oscier, David; Henriksson, Marie; Sangfelt, Olle; Grander, Dan; Corcoran, Martin M.
2009-01-01
The microRNAs miR-15a and miR-16-1 are downregulated in multiple tumor types and are frequently deleted in chronic lymphocytic leukemia (CLL), myeloma and mantle cell lymphoma. Despite their abundance in most cells the transcriptional regulation of miR-15a/16-1 remains unclear. Here we demonstrate that the putative tumor suppressor DLEU2 acts as a host gene of these microRNAs. Mature miR-15a/miR-16-1 are produced in a Drosha-dependent process from DLEU2 and binding of the Myc oncoprotein to two alterative DLEU2 promoters represses both the host gene transcript and levels of mature miR-15a/miR-16-1. In line with a functional role for DLEU2 in the expression of the microRNAs, the miR-15a/miR-16-1 locus is retained in four CLL cases that delete both promoters of this gene and expression analysis indicates that this leads to functional loss of mature miR-15a/16-1. We additionally show that DLEU2 negatively regulates the G1 Cyclins E1 and D1 through miR-15a/miR-16-1 and provide evidence that these oncoproteins are subject to miR-15a/miR-16-1-mediated repression under normal conditions. We also demonstrate that DLEU2 overexpression blocks cellular proliferation and inhibits the colony-forming ability of tumor cell lines in a miR-15a/miR-16-1-dependent way. Together the data illuminate how inactivation of DLEU2 promotes cell proliferation and tumor progression through functional loss of miR-15a/miR-16-1.
β-decay spectroscopy of neutron-rich 160,161,162Sm isotopes
Directory of Open Access Journals (Sweden)
Patel Z.
2016-01-01
Full Text Available Neutron-rich 160,161,162Sm isotopes have been populated at the RIBF, RIKEN via β first time. β-coincident γ rays were observed in all three isotopes including γ rays from the isomeric decay of 160Sm and 162Sm. The isomers in 160Sm and 162Sm have previously been observed but have been populated via β decay for the first time. The isomeric state in 162Sm is assigned a 4−v72+[ 633 ]⊗v12−[ 521 ]${4^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes v{{1 \\over 2}^ - }\\left[ {521} \\right]$ configuration based on the decay pattern. The level schemes of 160Sm and 162Sm are presented. The ground states in the parent nuclei 160Pm and 162Pm are both assigned a 6−v72+[633]⊗π52−[532]${6^ - }v{{7 \\over 2}^ + }\\left[ {633} \\right] \\otimes \\pi {{5 \\over 2}^ - }\\left[ {532} \\right]$ configuration based on the population of states in the daughter nuclei. Blocked BCS calculations were performed to further investigate the spin-parities of the ground states in 160Pm, 161Pm, and 162Pm, and the isomeric state in 162Sm
Williams, Emily L; Jones, Hollie S; Andy Sparks, S; Marchant, David C; Midgley, Adrian W; Mc Naughton, Lars R
2015-07-01
Whilst the presence of a competitor has been found to improve performance, the mechanisms influencing the change in selected work rates during direct competition have been suggested but not specifically assessed. The aim was to investigate the physiological and psychological influences of a visual avatar competitor during a 16.1-km cycling time trial performance, using trained, competitive cyclists. Randomised cross-over design. Fifteen male cyclists completed four 16.1km cycling time trials on a cycle ergometer, performing two with a visual display of themselves as a simulated avatar (FAM and SELF), one with no visual display (DO), and one with themselves and an opponent as simulated avatars (COMP). Participants were informed the competitive avatar was a similar ability cyclist but it was actually a representation of their fastest previous performance. Increased performance times were evident during COMP (27.8±2.0min) compared to SELF (28.7±1.9min) and DO (28.4±2.3min). Greater power output, speed and heart rate were apparent during COMP trial than SELF (pperformance. Competitive cyclists performed significantly faster during a 16.1-km competitive trial than when performing maximally, without a competitor. The improvement in performance was elicited due to a greater external distraction, deterring perceived exertion. Copyright © 2014 Sports Medicine Australia. Published by Elsevier Ltd. All rights reserved.
Energy Technology Data Exchange (ETDEWEB)
Gruenberg, Juergen; Lindenblatt, Dennis; Cohrs, Susan; Fischer, Eliane [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); Dorrer, Holger [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); Zhernosekov, Konstantin [ITG Isotope Technologies Garching GmbH, Garching (Germany); Koester, Ulli [Institut Laue-Langevin, Grenoble (France); Tuerler, Andreas [Paul Scherrer Institute, Laboratory of Radiochemistry and Environmental Chemistry, Villigen (Switzerland); University of Bern, Department of Chemistry and Biochemistry, Berne (Switzerland); Schibli, Roger [Paul Scherrer Institute, Center for Radiopharmaceutical Sciences ETH-PSI-USZ, Villigen (Switzerland); ETH Zurich, Department of Chemistry and Applied Biosciences, Zurich (Switzerland)
2014-10-15
The L1 cell adhesion molecule (L1CAM) is considered a valuable target for therapeutic intervention in different types of cancer. Recent studies have shown that anti-L1CAM radioimmunotherapy (RIT) with {sup 67}Cu- and {sup 177}Lu-labelled internalising monoclonal antibody (mAb) chCE7 was effective in the treatment of human ovarian cancer xenografts. In this study, we directly compared the therapeutic efficacy of anti-L1CAM RIT against human ovarian cancer under equitoxic conditions with the radiolanthanide {sup 177}Lu and the potential alternative {sup 161}Tb in an ovarian cancer therapy model. Tb was produced by neutron bombardment of enriched {sup 160}Gd targets. {sup 161}Tb and {sup 177}Lu were used for radiolabelling of DOTA-conjugated antibodies. The in vivo behaviour of the radioimmunoconjugates (RICs) was assessed in IGROV1 tumour-bearing nude mice using biodistribution experiments and SPECT/CT imaging. After ascertaining the maximal tolerated doses (MTD) the therapeutic impact of 50 % MTD of {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 was evaluated in groups of ten mice by monitoring the tumour size of subcutaneous IGROV1 tumours. The average number of DOTA ligands per antibody was 2.5 and maximum specific activities of 600 MBq/mg were achieved under identical radiolabelling conditions. RICs were stable in human plasma for at least 48 h. {sup 177}Lu- and {sup 161}Tb-DOTA-chCE7 showed high tumour uptake (37.8-39.0 %IA/g, 144 h p.i.) with low levels in off-target organs. SPECT/CT images confirmed the biodistribution data. {sup 161}Tb-labelled chCE7 revealed a higher radiotoxicity in nude mice (MTD: 10 MBq) than the {sup 177}Lu-labelled counterpart (MTD: 12 MBq). In a comparative therapy study with equitoxic doses, tumour growth inhibition was better by 82.6 % for the {sup 161}Tb-DOTA-chCE7 than the {sup 177}Lu-DOTA-chCE7 RIT. Our study is the first to show that anti-L1CAM {sup 161}Tb RIT is more effective compared to {sup 177}Lu RIT in ovarian cancer xenografts
Participation of CD161(+) and invariant natural killer T cells in pediatric asthma exacerbations.
Carpio-Pedroza, Juan C; Vaughan, Gilberto; del Rio-Navarro, Blanca E; del Río-Chivardí, Jaime M; Vergara-Castañeda, Arely; Jiménez-Zamudio, Luis A; Morales-Flores, Amelia; Rodríguez-Moreno, Guadalupe; Ruiz-Tovar, Karina; Fonseca-Coronado, Salvador; Gonçalves Rossi, Livia M; Escobar-Gutiérrez, Alejandro
2013-01-01
Asthma has been defined as a disease of chronic airway inflammation in which many cells and cellular products participate with variable degrees of airflow obstruction and hyperresponsiveness that lead to recurrent episodes of wheezing, breathlessness, chest tightness, and coughing. Prominent among these cellular elements are two cell types referred to as the invariant natural killer T (iNKT) cells and a subpopulation of T cells expressing the molecule CD161, which are both thought to play a role in the pathogenesis of asthma. Although the presence of iNKT and other CD161(+) cells in murine models has been associated with asthma, relatively few studies have been performed in the adult patient with asthma that have been often conflicting and even fewer studies are available in children. The present study was performed to investigate the peripheral blood frequencies of iNKT and CD161(+) T cells in children with asthma. A total of 35 children, 19 stable asthmatic patients, 6 who had experienced an asthmatic attack within 24 hours and had not received any treatment, and 10 healthy controls, aged 6-12 years, were enrolled in the study. iNKT and CD161(+) T-cell frequencies in blood were measured together with quantitative levels of IL-4 and interferon (IFN) γ using a cytofluorimetric approach. The results show that iNKT cells are increased in pediatric asthmatic patients undergoing exacerbations of asthma. These cells also produced less IFN-γ and more IL-4 than children with stable asthma and in healthy control children. These results suggest that iNKT cells might participate in the development of the asthmatic exacerbations. The increased production of IL-4 in conjunction with the decrease of IFN-γ may be mechanistically responsible, at least partially, for the heightening of the immunologic response leading to the asthmatic attack in children. Knowledge of these interactive mechanisms involving the iNKT cell and our understanding of its role in the exacerbation of
Musi, Gennaro; Mistretta, Francesco A; Marenghi, Carlo; Russo, Andrea; Catellani, Michele; Nazzani, Sebastiano; Conti, Andrea; Luzzago, Stefano; Ferro, Matteo; Matei, Deliu V; Carmignani, Luca; de Cobelli, Ottavio
2018-03-01
To evaluate the efficacy and safety of ureteroscopic thulium laser (TL) treatment of upper urinary tract carcinoma (UTUC). Forty-two consecutive patients underwent conservative TL treatment for UTUC at two referral institutions. All patients underwent preliminary biopsy and then laser vaporization. A 272 μm and 365 μm laser fibers were used with a flexible and semirigid scope, respectively. Ablation was carried out with a 10 to 20 W power. Mean age at surgery was 68 years (SD 10.7). Mean tumor size was 14.3 mm (range 2-30 mm). Preliminary biopsy revealed the presence of low-grade disease in 29 (69.1%) patients, high-grade disease in 4 (9.5%) and 1 carcinoma in situ 1 (2.4%), whereas it was not conclusive in 8 (19%) cases. Final stage was pTa and pTis in 41 (97.6%) and 1 (2.4%) patients, respectively. Thirty eight percent (16) experienced Clavien-Dindo grade I complication, 47.6% (20) grade II, and 2.4% (1) grade III. Five (12%) patients underwent a second-look procedure due to residual disease. Eight (19%) patients experienced clinical recurrence. The median estimated recurrence-free survival was 44 months (SE 3.68). Four patients (9.5%) underwent a nephroureterectomy. Final pathological stage was pTis, pT3 high grade, pTa low grade, and pT0. Median follow-up was 26.3 months (range 2-54 months), and no progression or upstaging of disease occurred. TL management of UTUC is a safe and efficacious conservative treatment. Our experience shows optimal vaporization and hemostatic control in the absence of major complications.
9 CFR 161.4 - Suspension or revocation of veterinary accreditation; criminal and civil penalties.
2010-01-01
... 9 Animals and Animal Products 1 2010-01-01 2010-01-01 false Suspension or revocation of veterinary... REVOCATION OF SUCH ACCREDITATION § 161.4 Suspension or revocation of veterinary accreditation; criminal and... to practice veterinary medicine in at least one State. (c) Accreditation shall be automatically...
Development of a 170Tm source for mercury monitoring studies in humans using XRF
International Nuclear Information System (INIS)
Timmaraju, K. Phanisree; Fajurally, Bibi Najah; Armstrong, Andrea F.; Chettle, David R.
2016-01-01
The goals of the present study were to develop a 170 Tm radioisotope and generate a K XRF spectrum of mercury. Thulium foil and thulium oxide powder were both tested for impurities and the latter was found to be a better prospect for further studies. The 170 Tm radioisotope was developed from thulium oxide powder following the method of disolution and absorption. A suitable source holder and collimator were also designed based on Monte Carlo simulations. Using the radioisotope thus developed, a mercury XRF spectrum was successfully generated. - Highlights: • We tested the purity of thulium samples by XRF and NAA techniques. • Developed a procedure to generate Tm-170 isotope out of thulium oxide powder. • Designed a collimator and source holder • Generated XRF spectrum of mercury using the Tm-170 isotope. • Compared the highlights in mercury spectra from Tm-170 and Cd-109 isotopes.
Hardy, Luke A.; Gonzalez, David A.; Irby, Pierce B.; Fried, Nathaniel M.
2018-02-01
Previous Thulium fiber laser lithotripsy (TFL) studies were limited to a peak power of 70 W (35 mJ / 500 μs), requiring operation in dusting mode with low pulse energy (35 mJ) and high pulse rate (300 Hz). In this study, a novel, compact, air-cooled, TFL capable of operating at up to 500 W peak power, 50 W average power, and 2000 Hz, was tested. The 1940-nm TFL was used with pulse duration (500 μs), average power (10 W), and fiber (270- μm-core) fixed, while pulse energy and pulse rate were changed. A total of 23 large uric acid (UA) stones and 16 large calcium oxalate monohydrate (COM) stones were each separated into 3 modes (Group 1-"Dusting"- 33mJ/300Hz; Group 2-"Fragmentation"-200mJ/50Hz; Group 3-"Dual mode"-Fragmentation then Dusting). The fiber was held manually in contact with stone on a 2-mm-mesh sieve submerged in a flowing saline bath. UA ablation rates were 2.3+/-0.8, 2.3+/-0.2, and 4.4+/-0.8 mg/s and COM ablation rates were 0.4+/-0.1, 1.0+/-0.1, and 0.9+/-0.4 mg/s, for Groups 1, 2, and 3. Dual mode provided 2x higher UA ablation rates than other modes. COM ablation threshold is 3x higher than UA, so dusting provided lower COM ablation rates than other modes. Future studies will explore higher average laser power than 10 W for rapid TFL ablation of large stones.
Hutchens, Thomas C.; Gonzalez, David A.; Irby, Pierce B.; Fried, Nathaniel M.
2017-01-01
The experimental thulium fiber laser (TFL) is being explored as an alternative to the current clinical gold standard Holmium:YAG laser for lithotripsy. The near single-mode TFL beam allows coupling of higher power into smaller optical fibers than the multimode Holmium laser beam profile, without proximal fiber tip degradation. A smaller fiber is desirable because it provides more space in the ureteroscope working channel for increased saline irrigation rates and allows maximum ureteroscope deflection. However, distal fiber tip burnback increases as fiber diameter decreases. Previous studies utilizing hollow steel sheaths around recessed distal fiber tips reduced fiber burnback but increased stone retropulsion. A "fiber muzzle brake" was tested for reducing both fiber burnback and stone retropulsion by manipulating vapor bubble expansion. TFL lithotripsy studies were performed at 1908 nm, 35 mJ, 500 μs, and 300 Hz using a 100-μm-core fiber. The optimal stainless steel muzzle brake tip tested consisted of a 1-cm-long, 560-μm-outer-diameter, 360-μm-inner-diameter tube with a 275-μm-diameter through hole located 250 μm from the distal end. The fiber tip was recessed a distance of 500 μm. Stone phantom retropulsion, fiber tip burnback, and calcium oxalate stone ablation studies were performed ex vivo. Small stones with a mass of 40±4 mg and 4-mm-diameter were ablated over a 1.5-mm sieve in 25±4 s (n=10) without visible distal fiber tip burnback. Reduction in stone phantom retropulsion distance by 50% and 85% was observed when using muzzle brake tips versus 100-μm-core bare fibers and hollow steel tip fibers, respectively. The muzzle brake fiber tip simultaneously provided efficient stone ablation, reduced stone retropulsion, and minimal fiber degradation during TFL lithotripsy.
Engin, Doruk; Mathason, Brian; Storm, Mark
2017-08-01
Global wind measurements are critically needed to improve and extend NOAA weather forecasting that impacts U.S. economic activity such as agriculture crop production, as well as hurricane forecasting, flooding, and FEMA disaster planning.1 NASA and the 2007 National Research Council (NRC) Earth Science Decadal Study have also identified global wind measurements as critical for global change research. NASA has conducted aircraft-based wind lidar measurements using 2 um Ho:YLF lasers, which has shown that robust wind measurements can be made. Fibertek designed and demonstrated a high-efficiency, 100 W average power continuous wave (CW) 1940 nm thulium (Tm)- doped fiber laser bread-board system meeting all requirements for a NASA Earth Science spaceflight 2 μm Ho:YLF pump laser. Our preliminary design shows that it is possible to package the laser for high-reliability spaceflight operation in an ultra-compact 2″x8″x14″ size and weight <8.5 lbs. A spaceflight 100 W polarization maintaining (PM) Tm laser provides a path to space for a pulsed, Q-switched 2 μm Ho:YLF laser with 30-80 mJ/pulse range at 100-200 Hz repletion rates.
A 16:1 Serializer ASIC for Data Transmission at 5 Gbps
Gong, D; The ATLAS collaboration
2010-01-01
A high speed, low power 16:1 serializer has been developed with a commercial 0.25 μm silicon-on-sapphire CMOS technology. The serializer operates from 4.0 to 5.7 Gbps. Total jitter is 62 ps and the eye openning of the bathtub curve is 122 ps at bit rate error of 10-12 at 5 Gbps. Power consumption is 463 mW at 5 Gbps. A proton beam test indicates the serializer is suitable for applications in high energy physics experiments.
2012-06-12
... DEPARTMENT OF COMMERCE Foreign-Trade Zones Board [Docket T-4-2012] Foreign-Trade Zone 161; Temporary/Interim Manufacturing Authority; Siemens Energy, Inc., (Wind Turbine Nacelles and Hubs); Notice of... temporary/interim manufacturing (T/IM) authority, on behalf of Siemens Energy, Inc., to manufacture wind...
Roots, Fideelia-Signe, 1976-
2014-01-01
Fideelia-Signe Roots oma aktsioonist tegevuskunstiürituse "Äng" raames, mille käigus kunstnik kõndis jalgsi alasti ülakehaga 161 kilomeetrit Tartust Karepale eesmärgiga testida naise kehakuvandi piire. Kangelase ja superkangelase mõistest
A 16:1 Serializer ASIC for Data Transmission at 5 Gbps
Gong, D; The ATLAS collaboration
2010-01-01
A high speed, low power 16:1 serializer is developed using a commercial 0.25 μm silicon-on-sapphire CMOS technology. It operates from 4.0 to 5.8 Gbps in the lab test. Its total jitter is measured to be 62 ps and the bathtub scan demonstrates a 122 ps opening at BER of less than 10-12 level at 5 Gbps. The measured power consumption is 507 mW at this data rate. A proton test of this chip is scheduled in June and test results will be discussed when available.
Kotake, Shigeru; Nanke, Yuki; Yago, Toru; Kawamoto, Manabu; Kobashigawa, Tsuyoshi; Yamanaka, Hisashi
2016-01-01
Rheumatoid arthritis (RA) is a chronic inflammatory disease characterized by the destruction of articular cartilage and bone with elevated levels of proinflammatory cytokines. It has been reported that IL-17 and Th17 cells play important roles in the pathogenesis of RA. Recently, plasticity in helper T cells has been demonstrated; Th17 cells can convert to Th1 cells. It remains to be elucidated whether this conversion occurs in the early phase of RA. Here, we tried to identify Th17 cells, Th1 cells, and Th17 cell-derived Th1 cells (CD161(+)Th1 cells) in the peripheral blood of early-onset RA patients. We also evaluated the effect of methotrexate on the ratio of Th17 cells in early-onset RA patients. The ratio of Th17 cell-derived Th1 cells to CD161(+)Th17 cells was elevated in the peripheral blood of early-onset RA patients. In addition, MTX reduced the ratio of Th17 cells but not Th1 cells. These findings suggest that IL-17 and Th17 play important roles in the early phase of RA; thus, anti-IL-17 antibodies should be administered to patients with RA in the early phase.
2010-01-01
... Planning Criteria § 63.161 Emergency plan for the geologic repository operations area through permanent... 10 Energy 2 2010-01-01 2010-01-01 false Emergency plan for the geologic repository operations area... may occur at the geologic repository operations area, at any time before permanent closure and...
Starbuck, John M; Dutka, Tara; Ratliff, Tabetha S; Reeves, Roger H; Richtsmeier, Joan T
2014-08-01
Trisomy 21 results in gene-dosage imbalance during embryogenesis and throughout life, ultimately causing multiple anomalies that contribute to the clinical manifestations of Down syndrome. Down syndrome is associated with manifestations of variable severity (e.g., heart anomalies, reduced growth, dental anomalies, shortened life-span). Craniofacial dysmorphology and cognitive dysfunction are consistently observed in all people with Down syndrome. Mouse models are useful for studying the effects of gene-dosage imbalance on development. We investigated quantitative changes in the skull and brain of the Dp(16)1Yey Down syndrome mouse model and compared these mice to Ts65Dn and Ts1Cje mouse models. Three-dimensional micro-computed tomography images of Dp(16)1Yey and euploid mouse crania were morphometrically evaluated. Cerebellar cross-sectional area, Purkinje cell linear density, and granule cell density were evaluated relative to euploid littermates. Skulls of Dp(16)1Yey and Ts65Dn mice displayed similar changes in craniofacial morphology relative to their respective euploid littermates. Trisomy-based differences in brain morphology were also similar in Dp(16)1Yey and Ts65Dn mice. These results validate examination of the genetic basis for craniofacial and brain phenotypes in Dp(16)1Yey mice and suggest that they, like Ts65Dn mice, are valuable tools for modeling the effects of trisomy 21 on development. © 2014 Wiley Periodicals, Inc.
Directory of Open Access Journals (Sweden)
Barry J. Connell
2012-01-01
Full Text Available Background. Lipoic acid (LA, which has significant antioxidant properties, may also function as a potent neuroprotectant. The synthetic compounds INV-155, INV-157, INV-159, and INV-161 are physiochemical combinations of lipoic acid and captopril. We sought to determine if these compounds have neuroprotective potential following middle cerebral artery occlusion (MCAO in rats. Methods. Male Sprague-Dawley rats were injected intravenously with captopril (1–50 mg/kg 30 minutes prior to MCAO. Blood pressure, heart rate, baroreceptor reflex sensitivity, and infarct size were measured. In addition, dose response effect on infarct size and cardiovascular parameters was determined using INV-155, INV-157, INV-159, and INV-161 and compared to captopril and LA. Results. Pretreatment with captopril and LA at all doses tested was neuroprotective. The compounds INV-159 (0.5–10 mg/kg and INV-161 (1–10 mg/kg produced a significant,dose-dependent decrease in infarct size. In contrast, INV-155 and INV-157 had no effect on infarct size. Conclusions. Combined pretreatment with captopril potentiated the neuroprotective benefit observed following LA alone. Both INV-159 and INV-161 were also neuroprotective. These results suggest that patients taking combinations of captopril and LA, either as combination therapy or in the form of INV-159 or INV-161, may also benefit from significant protection against cerebral infarction.
International Nuclear Information System (INIS)
Rinkleff, R.H.
1977-01-01
Using the method of optical double resonance, the 5s5p 3 P 1 level tensor polarizability of Cadmium has been measured. For this state, various authors have published different results, using different experimental methods. The experimental result presented here is in excellent agreement with the value of Happer, based on level crossing investigations, and agrees well with the theoretical result of Robinson based on a modified Sternheimer approximation, and so gives a reliable value for the tensor polarizability. Furthermore the tensor polarizability of the 6s6p 3 P 1 - level of the even Ytterbium isotopes and the odd Ytterbium 171 nucleus have been measured with the optical double resonance method, and the Stark constant has been calculated based on a given theory and oscillator strengths. Using the methods of optical double resonance and level crossing, the tensor polarizability of 5 excited levels of the Thulium configurations 4f 13 6s6p + 4f 12 5d6s 2 have been measured. From the experimental Stark constants and the angular coefficients of the eigenfunctions calculated by Camus, the radial integrals I(5d, 5p) and I(6p, 5d) are calculated for electric dipole transitions between levels of the configurations 4f 12 5d6s 2 + 4f 13 6s6p and levels of the 4f 12 6p6s 2 + 4f 13 6s5d configurations. The tensor polarizability calculated with these radial integrals show very good agreement with the experimental values. (orig./LH) [de
Hardy, Luke A.; Irby, Pierce B.; Fried, Nathaniel M.
2018-02-01
We investigated proposed mechanisms of laser lithotripsy, specifically for the novel, experimental Thulium fiber laser (TFL). Previous lithotripsy studies with the conventional Holmium:YAG laser noted a primary photothermal mechanism (vaporization). Our hypothesis is that an additional mechanical effect (fragmentation) occurs due to vaporization of water in stone material from high absorption of energy, called micro-explosions. The TFL irradiated calcium oxalate monohydrate (COM) and uric acid (UA) stones, as well as artificial stones (Ultracal30 and BegoStone), in air and water environments. TFL energy was varied to determine the relative effect on the ablation mechanism. Scanning electron microscopy (SEM) was used to study qualitative and characteristic changes in surface topography with correlation to presumed ablation mechanisms. Laser irradiation of stones in air produced charring and melting of the stone surface consistent with a photothermal effect and minimal fragmentation, suggesting no mechanical effect from micro-explosions. For COM stones ablated in water, there was prominent fragmentation in addition to recognized photothermal effects, supporting dual mechanisms during TFL lithotripsy. For UA stones, there were minimal photothermal effects, and dominant effects were mechanical. By increasing TFL pulse energy, a greater mechanical effect was demonstrated for both stone types. For artificial stones, there was no significant evidence of mechanical effects. TFL laser lithotripsy relies on two prominent mechanisms for stone ablation, photothermal and mechanical. Water is necessary for the mechanical effect which can be augmented by increasing pulse energy. Artificial stones may not provide a predictive model for mechanical effects during laser lithotripsy.
Musi, Gennaro; Russo, Andrea; Conti, Andrea; Mistretta, Francesco A; Di Trapani, Ettore; Luzzago, Stefano; Bianchi, Roberto; Renne, Giuseppe; Ramoni, Stefano; Ferro, Matteo; Matei, Deliu Victor; Cusini, Marco; Carmignani, Luca; de Cobelli, Ottavio
2018-02-01
To evaluate the oncological and functional outcomes of patients diagnosed with penile cancer undergoing conservative treatment through thulium-yttrium-aluminium-garnet (Tm:YAG) laser ablation. Twenty-six patients with a penile lesion underwent ablation with a RevoLix 200 W continuous-wave laser. The procedure was carried out with a pen-like laser hand piece, using a 360 μm laser fiber and 15-20 W of power. Median (IQR) follow-up time was 24 (15-30) months. Recurrence rate and post-operative sexual function were assessed. Median age at surgery was 61 years. Median (inter quartile range) size of the lesions was 15 [10-20] mm. Overall, 11 (47.8%) and 12 (52.2%) at the final pathology presented in situ and invasive squamous cell carcinoma (SCC), respectively. The final pathological stage was pTis, pT1a, pT2, and pT3 in 11 (47.8%), 7 (30.4%), 3 (13.0%), and 2 (8.7%) patients, respectively. Moreover, four (17.4%) patients had a recurrence of which three (13.0%) and one (4.3%) patients developed an invasive or in situ recurrence, respectively. After treatment 6 (26.1%) patients reported a conserved penile sensitivity, while 13 (56.5%) and 4 (17.4%) patients experienced a better or worse sensitivity after ablation, respectively. Post-treatment sexual activity was achieved within the first month after laser ablation in 82.6% of the patients. Early stage penile carcinomas can be effectively treated with an organ preservation strategy. Tm:YAG conservative laser treatment is easy, safe and offers good functional outcome, with a minor impact on patient's quality of life.
Timmins, Amy; de Visser, Sam P.
2017-01-01
Prolyl-4-hydroxylase is a vital enzyme for human physiology involved in the biosynthesis of 4-hydroxyproline, an essential component for collagen formation. The enzyme performs a unique stereo- and regioselective hydroxylation at the C4 position of proline despite the fact that the C5 hydrogen atoms should be thermodynamically easier to abstract. To gain insight into the mechanism and find the origin of this regioselectivity, we have done a quantum mechanics/molecular mechanics (QM/MM) study on wildtype and mutant structures. In a previous study (Timmins et al., 2017) we identified several active site residues critical for substrate binding and positioning. In particular, the Glu127 and Arg161 were shown to form multiple hydrogen bonding and ion-dipole interactions with substrate and could thereby affect the regio- and stereoselectivity of the reaction. In this work, we decided to test that hypothesis and report a QM/MM and molecular dynamics (MD) study on prolyl-4-hydroxylase and several active site mutants where Glu127 or Arg161 are mutated for Asp, Gln, or Lys. Thus, the R161D and R161Q mutants give very high barriers for hydrogen atom abstraction from any proline C–H bond and therefore will be inactive. The R161K mutant, by contrast, sees the regio- and stereoselectivity of the reaction change but still is expected to hydroxylate proline at room temperature. By contrast, the Glu127 mutants E127D and E127Q show possible changes in regioselectivity with the former being more probable to react compared to the latter. PMID:29170737
Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick; Kristiansson, Kati; Mattsson, Hannele; Nõukas, Margit; Sapkota, Yadav; Schick, Ursula; Porcu, Eleonora; Rüeger, Sina; McDaid, Aaron F; Porteous, David; Winkler, Thomas W; Salvi, Erika; Shrine, Nick; Liu, Xueping; Ang, Wei Q; Zhang, Weihua; Feitosa, Mary F; Venturini, Cristina; van der Most, Peter J; Rosengren, Anders; Wood, Andrew R; Beaumont, Robin N; Jones, Samuel E; Ruth, Katherine S; Yaghootkar, Hanieh; Tyrrell, Jessica; Havulinna, Aki S; Boers, Harmen; Mägi, Reedik; Kriebel, Jennifer; Müller-Nurasyid, Martina; Perola, Markus; Nieminen, Markku; Lokki, Marja-Liisa; Kähönen, Mika; Viikari, Jorma S; Geller, Frank; Lahti, Jari; Palotie, Aarno; Koponen, Päivikki; Lundqvist, Annamari; Rissanen, Harri; Bottinger, Erwin P; Afaq, Saima; Wojczynski, Mary K; Lenzini, Petra; Nolte, Ilja M; Sparsø, Thomas; Schupf, Nicole; Christensen, Kaare; Perls, Thomas T; Newman, Anne B; Werge, Thomas; Snieder, Harold; Spector, Timothy D; Chambers, John C; Koskinen, Seppo; Melbye, Mads; Raitakari, Olli T; Lehtimäki, Terho; Tobin, Martin D; Wain, Louise V; Sinisalo, Juha; Peters, Annette; Meitinger, Thomas; Martin, Nicholas G; Wray, Naomi R; Montgomery, Grant W; Medland, Sarah E; Swertz, Morris A; Vartiainen, Erkki; Borodulin, Katja; Männistö, Satu; Murray, Anna; Bochud, Murielle; Jacquemont, Sébastien; Rivadeneira, Fernando; Hansen, Thomas F; Oldehinkel, Albertine J; Mangino, Massimo; Province, Michael A; Deloukas, Panos; Kooner, Jaspal S; Freathy, Rachel M; Pennell, Craig; Feenstra, Bjarke; Strachan, David P; Lettre, Guillaume; Hirschhorn, Joel; Cusi, Daniele; Heid, Iris M; Hayward, Caroline; Männik, Katrin; Beckmann, Jacques S; Loos, Ruth J F; Nyholt, Dale R; Metspalu, Andres; Eriksson, Johan G; Weedon, Michael N; Salomaa, Veikko; Franke, Lude; Reymond, Alexandre; Frayling, Timothy M; Kutalik, Zoltán
2017-01-01
There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations at
Directory of Open Access Journals (Sweden)
Amy Timmins
2017-11-01
Full Text Available Prolyl-4-hydroxylase is a vital enzyme for human physiology involved in the biosynthesis of 4-hydroxyproline, an essential component for collagen formation. The enzyme performs a unique stereo- and regioselective hydroxylation at the C4 position of proline despite the fact that the C5 hydrogen atoms should be thermodynamically easier to abstract. To gain insight into the mechanism and find the origin of this regioselectivity, we have done a quantum mechanics/molecular mechanics (QM/MM study on wildtype and mutant structures. In a previous study (Timmins et al., 2017 we identified several active site residues critical for substrate binding and positioning. In particular, the Glu127 and Arg161 were shown to form multiple hydrogen bonding and ion-dipole interactions with substrate and could thereby affect the regio- and stereoselectivity of the reaction. In this work, we decided to test that hypothesis and report a QM/MM and molecular dynamics (MD study on prolyl-4-hydroxylase and several active site mutants where Glu127 or Arg161 are mutated for Asp, Gln, or Lys. Thus, the R161D and R161Q mutants give very high barriers for hydrogen atom abstraction from any proline C–H bond and therefore will be inactive. The R161K mutant, by contrast, sees the regio- and stereoselectivity of the reaction change but still is expected to hydroxylate proline at room temperature. By contrast, the Glu127 mutants E127D and E127Q show possible changes in regioselectivity with the former being more probable to react compared to the latter.
Thermodynamic analysis and experimental investigation of a Solo V161 Stirling cogeneration unit
International Nuclear Information System (INIS)
Rogdakis, E.D.; Antonakos, G.D.; Koronaki, I.P.
2012-01-01
In order to investigate the Stirling engine implementation technology, a Solo Stirling Engine V161 cogeneration module has been installed at the Laboratory of Applied Thermodynamics of National Technical University of Athens. A special thermodynamic analysis of the engine's performance has been conducted introducing and utilizing specially designed computing codes along with the thermal balance study of the unit. Measurements were conducted under different operational conditions concerning various heat load stages of the engine, working pressure, as well as electric power production. Analysis of the experimental results has shown that the overall performance of the Stirling unit proved very promising and quite adequate for various areal applications, equally competing with other CHP systems. The performance of the unit experienced significant stability all over the operating range. The power stand ratio 0.35 differentiates Stirling cogeneration units from others that use diverging technologies significantly. The energy savings using a Stirling CHP unit, in respect to the concurrent use of a thermal and an electrical system at the same equivalent power has revealed 36.8%. -- Highlights: ► Thermodynamic analysis of an a-type Stirling engine. ► Development of generated electrical and thermal power of the m-CHP Solo Stirling Unit to engine's load comparison. ► Stirling m-CHP until heat balance analysis. ► Evaluation of the Solo Stirling V161 unit efficiency.
International Nuclear Information System (INIS)
Hungate, F.P.; Riemath, W.F.; Bunnell, L.R.
1975-01-01
A tissue irradiator is provided for the in-vivo irradiation of body tissue. The irradiator comprises a radiation source material contained and completely encapsulated within vitreous carbon. An embodiment for use as an in-vivo blood irradiator comprises a cylindrical body having an axial bore therethrough. A radioisotope is contained within a first portion of vitreous carbon cylindrically surrounding the axial bore, and a containment portion of vitreous carbon surrounds the radioisotope containing portion, the two portions of vitreous carbon being integrally formed as a single unit. Connecting means are provided at each end of the cylindrical body to permit connections to blood-carrying vessels and to provide for passage of blood through the bore. In a preferred embodiment, the radioisotope is thulium-170 which is present in the irradiator in the form of thulium oxide. A method of producing the preferred blood irradiator is also provided, whereby nonradioactive thulium-169 is dispersed within a polyfurfuryl alcohol resin which is carbonized and fired to form the integral vitreous carbon body and the device is activated by neutron bombardment of the thulium-169 to produce the beta-emitting thulium-170
Blue luminescence in Tm3+-doped KGd(WO4)2 single crystals
International Nuclear Information System (INIS)
Gueell, F.; Mateos, X.; Gavalda, Jna.; Sole, R.; Aguilo, M.; Diaz, F.; Massons, J.
2004-01-01
Up-conversion blue emissions of trivalent thulium ions in monoclinic KGd(WO 4 ) 2 single crystals at 454 and 479 nm are reported for a single pump laser source at 688 nm. We grew thulium-doped KGd(WO 4 ) 2 single crystals at several concentrations from 0.1% to 10%. We recorded a polarized optical absorption spectrum for the 3 F 2 + 3 F 3 energy levels of thulium at room temperature and low temperature (6 K). From the low temperature emission spectra we determined the splitting of the 3 H 6 ground state. The blue emissions are characterized as a function of the dopant concentration and temperature from 10 K to room temperature. To our knowledge, this is the first time that sequential two-photon excitation process (STEP) generated blue emissions in thulium-doped single crystals with a single excitation wavelength
Nicol, Bryan; Salou, Marion; Vogel, Isabel; Garcia, Alexandra; Dugast, Emilie; Morille, Jeremy; Kilens, Stéphanie; Charpentier, Eric; Donnart, Audrey; Nedellec, Steven; Jacq-Foucher, Marylène; Le Frère, Fabienne; Wiertlewski, Sandrine; Bourreille, Arnaud; Brouard, Sophie; Michel, Laure; David, Laurent; Gourraud, Pierre-Antoine; Degauque, Nicolas; Nicot, Arnaud B; Berthelot, Laureline; Laplaud, David-Axel
2018-03-01
Several lines of evidence support a key role for CD8 + T cells in central nervous system tissue damage of patients with multiple sclerosis. However, the precise phenotype of the circulating CD8 + T cells that may be recruited from the peripheral blood to invade the CNS remains largely undefined to date. It has been suggested that IL-17 secreting CD8 (Tc17) T cells may be involved, and in humans these cells are characterized by the expression of CD161. We focused our study on a unique and recently described subset of CD8 T cells characterized by an intermediate expression of CD161 as its role in neuroinflammation has not been investigated to date. The frequency, phenotype, and function of CD8 + T cells with an intermediate CD161 expression level were characterized ex-vivo, in vitro, and in situ using RNAseq, RT-PCR, flow cytometry, TCR sequencing, and immunohistofluorescence of cells derived from healthy volunteers (n = 61), MS subjects (n = 90), as well as inflammatory (n = 15) and non-inflammatory controls (n = 6). We report here that CD8 + CD161 int T cells present characteristics of effector cells, up-regulate cell-adhesion molecules and have an increased ability to cross the blood-brain barrier and to secrete IL-17, IFNγ, GM-CSF, and IL-22. We further demonstrate that these cells are recruited and enriched in the CNS of MS subjects where they produce IL-17. In the peripheral blood, RNAseq, RT-PCR, high-throughput TCR repertoire analyses, and flow cytometry confirmed an increased effector and transmigration pattern of these cells in MS patients, with the presence of supernumerary clones compared to healthy controls. Our data demonstrate that intermediate levels of CD161 expression identifies activated and effector CD8 + T cells with pathogenic properties that are recruited to MS lesions. This suggests that CD161 may represent a biomarker and a valid target for the treatment of neuroinflammation. Copyright © 2017 The Authors. Published by Elsevier Ltd
Alterations of in vivo CA1 network activity in Dp(16)1Yey Down syndrome model mice.
Raveau, Matthieu; Polygalov, Denis; Boehringer, Roman; Amano, Kenji; Yamakawa, Kazuhiro; McHugh, Thomas J
2018-02-27
Down syndrome, the leading genetic cause of intellectual disability, results from an extra-copy of chromosome 21. Mice engineered to model this aneuploidy exhibit Down syndrome-like memory deficits in spatial and contextual tasks. While abnormal neuronal function has been identified in these models, most studies have relied on in vitro measures. Here, using in vivo recording in the Dp(16)1Yey model, we find alterations in the organization of spiking of hippocampal CA1 pyramidal neurons, including deficits in the generation of complex spikes. These changes lead to poorer spatial coding during exploration and less coordinated activity during sharp-wave ripples, events involved in memory consolidation. Further, the density of CA1 inhibitory neurons expressing neuropeptide Y, a population key for the generation of pyramidal cell bursts, were significantly increased in Dp(16)1Yey mice. Our data refine the 'over-suppression' theory of Down syndrome pathophysiology and suggest specific neuronal subtypes involved in hippocampal dysfunction in these model mice. © 2018, Raveau et al.
Directory of Open Access Journals (Sweden)
Spruds Andris
2017-08-01
Full Text Available The article analyses China’s 16+1 and Belt and Road initiatives from Latvia’s perspective. Although the initiatives provide engagement on a large scale, it is challenging to achieve the task of achieving a synergy between a variety of stakeholders and interests in the context of a diversity of visions and agendas. The strategic dimension of transcontinental initiatives complicates further the building of synergy. Connectivity is an important and promising principle of both initiatives and transcontinental infrastructural linkages are especially high on the agenda. Mutually beneficial progress, however, must yet be achieved. In times of uncertainty, Central and Eastern European countries, including Latvia, are engaged in a balancing process of potential economic benefits and strategic implications of the 16+1 and Belt and Road initiatives.
Harshaw, Richard
2018-04-01
In the winter and spring of 2017, an aggressive observing program of measuring close double stars with speckle interferometry and CCD imaging was undertaken at Brilliant Sky Observatory, my observing site in Cave Creek, Arizona. A total of 596 stars were observed, 8 of which were rejected for various reasons, leaving 588 pairs. Of these, 427 were observed and measured with speckle interferometry, while the remaining 161 were measured with a CCD. This paper reports the results of the observations of the 161 CCD cases. A separate paper in this issue will report the speckle measurements of the 427 other pairs.
25 CFR 161.603 - Can mediation be used in the event of a permit violation or dispute?
2010-04-01
... 25 Indians 1 2010-04-01 2010-04-01 false Can mediation be used in the event of a permit violation... AND WATER NAVAJO PARTITIONED LANDS GRAZING PERMITS Permit Violations § 161.603 Can mediation be used... to be resolved with the District Grazing Committee through mediation. (a) The District Grazing...
International Nuclear Information System (INIS)
Amanai, H.; Onodera, H.; Ohashi, M.; Matsuo, S.; Yamauchi, H.
1995-01-01
The magnetic properties of DyCoC 2 have been investigated by means of magnetization measurements, powder neutron diffraction and 161 Dy Moessbauer spectroscopy. The magnetization versus temperature curves of a single-crystalline sample reveal that the magnetic structure of DyCoC 2 is a simple collinear ferromagnetic one below T C =10.0 K. At 4.2 K, the magnitude of the Dy moment is 8.7(1)μ B , whose direction is defined by an angle of 38.0(5) from the a-axis toward the c-axis. The magnetic structure and the magnitude of the moment are also confirmed by the results of powder neutron diffraction experiments and 161 Dy Moessbauer spectroscopy, respectively. ((orig.))
Almannai, Mohammed; Marom, Ronit; Divin, Kristian; Scaglia, Fernando; Sutton, V Reid; Craigen, William J; Lee, Brendan; Burrage, Lindsay C; Graham, Brett H
2017-09-01
Cobalamin C disease is a multisystemic disease with variable manifestations and age of onset. Genotype-phenotype correlations are well-recognized in this disorder. Here, we present a large cohort of individuals with cobalamin C disease, several of whom are heterozygous for the c.482G>A pathogenic variant (p.Arg161Gln). We compared clinical characteristics of individuals with this pathogenic variant to those who do not have this variant. To our knowledge, this study represents the largest single cohort of individuals with the c.482G>A (p.Arg161Gln) pathogenic variant. A retrospective chart review of 27 individuals from 21 families with cobalamin C disease who are followed at our facility was conducted. 13 individuals (48%) are compound heterozygous with the c.482G>A (p.Arg161Gln) on one allele and a second pathogenic variant on the other allele. Individuals with the c.482G>A (p.Arg161Gln) pathogenic variant had later onset of symptoms and easier metabolic control. Moreover, they had milder biochemical abnormalities at presentation which likely contributed to the observation that 4 individuals (31%) in this group were missed by newborn screening. The c.482G>A (p.Arg161Gln) pathogenic variant is associated with milder disease. These individuals may not receive a timely diagnosis as they may not be identified on newborn screening or because of unrecognized, late onset symptoms. Despite the milder presentation, significant complications can occur, especially if treatment is delayed. Copyright © 2017 Elsevier Inc. All rights reserved.
Directory of Open Access Journals (Sweden)
Zohreh Rahimi
2018-05-01
Full Text Available Background The aim of present study was to clarify the role of the peroxisome proliferator-activated receptor (PPAR γ Pro12Ala and C161T polymorphisms in the pathogenesis of polycystic ovary syndrome (PCOS and their influence on lipid and lipoprotein profiles of patients. Materials and Methods The present cross-sectional study consisted of 50 women with PCOS, who referred to the Kermanshah University of Medical Sciences Clinic between April and October 2015, and 233 unrelated age-matched healthy women from the same region (West Iran. The PPARγ Pro12Ala and PPARγ C161T polymorphisms were gen- otyped using the polymerase chain reaction-restriction fragment length polymorphism method. Fasting blood sugar (FBS, serum triglycerides (TG, cholesterol, low density lipoprotein- cholesterol (LDL-C, high density lipoprotein- cholesterol (HDL-C and estradiol levels were measured. Results The serum level of estradiol was significantly lower in PCOS patients compared to healthy women. The PPARγ Pro12Ala (CG genotype increased the risk of PCOS 2.96-fold. The frequency of the PPARγ T allele (at C161T was 21% in patients and 17.2% in controls with no significant difference (P=0.52. In all studied individuals, the PPARγ CG geno- type was associated with significantly higher levels of TG. However, significantly lower levels of total cholesterol and LDL-C were observed in PPARγ TT individuals compared with those with the CC genotype. Within the PCOS group, the PPARγ CG genotype was significantly associated with lower levels of estradiol compared with the CC genotype. Also, the CG genotype was significantly associated with higher levels of TG when compared with the CC genotype. Conclusion Our study shows that, unlike PPARγ C161T, PPARγ Pro12Ala is associated with the risk of PCOS. Also, we found that the lipid and lipoprotein profiles significantly vary based on PPARγ Pro12Ala and C161T genotypes.
Lu, Y; Wang, J; Deng, Z; Wu, H; Deng, Q; Tan, H; Cao, L
2013-09-01
An actinomycete producing oil-like mixtures was isolated and characterized. The strain was isolated from sheep faeces and identified as Streptomyces sp. S161 based on 16S rRNA gene sequence analysis. The strain showed cellulase and xylanase activities. The (1) H nuclear magnetic resonance (NMR) spectra of the mixtures showed that the mixtures were composed of fatty acid methyl esters (52·5), triglycerides (13·7) and monoglycerides (9·1) (mol.%). Based on the gas chromatography-mass spectrometry (GC-MS) analysis, the fatty acid methyl esters were mainly composed of C14-C16 long-chain fatty acids. The results indicated that Streptomyces sp. S161 could produce fatty acid methyl esters (FAME) directly from starch. To our knowledge, this is the first isolated strain that can produce biodiesel (FAME) directly from starch. © 2013 The Society for Applied Microbiology.
Energy Technology Data Exchange (ETDEWEB)
Kim, Jinseong; Kim, Dowan; Noh, Taimin [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of); Ahn, Byungmin [Department of Chemical Engineering and Materials Science, University of Southern California, Los Angeles, CA 90089-0241 (United States); Lee, Heesoo, E-mail: heesoo@pusan.ac.kr [School of Materials Science and Engineering, Pusan National University, Busan 609-735 (Korea, Republic of)
2011-09-15
Highlights: > Dy/Tm co-doping method in BaTiO{sub 3} was suggested to improve electrical properties and temperature stability simultaneously. > We examined these properties in terms of microstructural analysis and substitution rate. > Increase of Dy{sub 2}O{sub 3} addition enhanced dielectric constant. > Increase of Tm{sub 2}O{sub 3} addition enhanced temperature stability. > Improved electrical properties and temperature stability through Dy/Tm co-doping were deduced from formation of electrons and core-shell structure. - Abstract: The co-doping characteristics on microstructure and thermal properties of barium titanate (BaTiO{sub 3}) were investigated to elucidate formation of core-shell structure by dysprosium (Dy) and thulium (Tm) addition in the BaTiO{sub 3}-Dy{sub 2}O{sub 3}-Tm{sub 2}O{sub 3} system. The dielectrics co-doped with 0.7 mol% Dy{sub 2}O{sub 3} and 0.3 mol% Tm{sub 2}O{sub 3} had the dielectric constant up to 2200 as a function of temperature, which was 30% higher than that of specimen containing only Tm{sub 2}O{sub 3} at the room temperature. It could be explained by the fact that the increase of Dy{sub 2}O{sub 3} addition contributed to the improvement of dielectric constant. On the other hand, the rapid diffusion rate of Dy{sup 3+} ions in BaTiO{sub 3} showed an adverse effect on temperature stability caused by destruction of core-shell. As the compensation for shell expansion in BaTiO{sub 3}, the reinforcement of the core-shell structure through the addition of Tm{sub 2}O{sub 3} was confirmed by TEM-EDS analysis and attributed the temperature coefficient of capacitance (TCC) in a reliability condition (-55 deg. C to 125 deg. C, {Delta}C = {+-}15% or less). The enhanced electrical properties and temperature stability could be deduced from the generation of electrons and the formation core-shell structure in co-doped BaTiO{sub 3} system respectively.
Gonzalez, David A.; Hardy, Luke A.; Hutchens, Thomas C.; Irby, Pierce B.; Fried, Nathaniel M.
2018-03-01
This study characterizes laser-induced vapor bubble dynamics for five different distal fiber optic tip configurations, to provide insight into stone retropulsion commonly experienced during laser ablation of kidney stones. A thulium fiber laser with 1908-nm wavelength delivered 34-mJ energy per pulse at 500-μs pulse duration through five different fibers such as 100-μm-core / 170-μm-OD bare fiber tip, 150- to 300-μm-core tapered fiber tip, 100-μm-core / 300-μm-OD ball tip fiber, 100-μm-core / 340-μm-OD hollow steel tip fiber, and 100-μm-core / 560-μm-OD muzzle brake fiber tip. A high-speed camera with 10-μm-spatial and 9.5-μs-temporal resolution was used to image the vapor bubble dynamics. A needle hydrophone measured pressure transients in the forward (0 deg) and side (90 deg) directions while placed at a 6.8 ± 0.4 mm distance from the distal fiber tip. Maximum bubble dimensions (width/length) averaged 0.7/1.5, 1.0/1.6, 0.5/1.1, 0.8/1.9, and 0.7 / 1.5 mm, for bare, tapered, ball, hollow steel, and muzzle brake fiber tips, respectively (n = 5). The hollow steel tip exhibited the most elongated vapor bubble shape, translating into increased forward pressure in this study and consistent with higher stone retropulsion in previous reports. Relative pressures (a.u.) in (forward/side) directions averaged 1.7/1.6, 2.0/2.0, 1.4/1.2, 6.8/1.1, and 0.3/1.2, for each fiber tip (n = 5). For the hollow steel tip, forward pressure was 4 × higher than for the bare fiber. For the muzzle brake fiber tip, forward pressure was 5 × lower than the bare fiber. Bubble dimensions and pressure measurements demonstrated that the muzzle brake fiber tip reduced forward pressure by partially venting vapors through the portholes, which is consistent with the observation of lower stone retropulsion in previous reports.
Search for the Standard Model Higgs Boson in $e^+ e^-$ Collisions at $\\sqrt{s}$ = 161-172 GeV
Ackerstaff, K; Allison, J; Altekamp, N; Anderson, K J; Anderson, S; Arcelli, S; Asai, S; Axen, D A; Azuelos, Georges; Ball, A H; Barberio, E; Barlow, R J; Bartoldus, R; Batley, J Richard; Baumann, S; Bechtluft, J; Beeston, C; Behnke, T; Bell, A N; Bell, K W; Bella, G; Bentvelsen, Stanislaus Cornelius Maria; Bethke, Siegfried; Biebel, O; Biguzzi, A; Bird, S D; Blobel, Volker; Bloodworth, Ian J; Bloomer, J E; Bobinski, M; Bock, P; Bonacorsi, D; Boutemeur, M; Bouwens, B T; Braibant, S; Brigliadori, L; Brown, R M; Burckhart, Helfried J; Burgard, C; Bürgin, R; Capiluppi, P; Carnegie, R K; Carter, A A; Carter, J R; Chang, C Y; Charlton, D G; Chrisman, D; Clarke, P E L; Cohen, I; Conboy, J E; Cooke, O C; Cuffiani, M; Dado, S; Dallapiccola, C; Dallavalle, G M; Davis, R; De Jong, S; del Pozo, L A; Desch, Klaus; Dienes, B; Dixit, M S; do Couto e Silva, E; Doucet, M; Duchovni, E; Duckeck, G; Duerdoth, I P; Eatough, D; Edwards, J E G; Estabrooks, P G; Evans, H G; Evans, M; Fabbri, Franco Luigi; Fanti, M; Faust, A A; Fiedler, F; Fierro, M; Fischer, H M; Fleck, I; Folman, R; Fong, D G; Foucher, M; Fürtjes, A; Futyan, D I; Gagnon, P; Gary, J W; Gascon, J; Gascon-Shotkin, S M; Geddes, N I; Geich-Gimbel, C; Geralis, T; Giacomelli, G; Giacomelli, P; Giacomelli, R; Gibson, V; Gibson, W R; Gingrich, D M; Glenzinski, D A; Goldberg, J; Goodrick, M J; Gorn, W; Grandi, C; Gross, E; Grunhaus, Jacob; Gruwé, M; Hajdu, C; Hanson, G G; Hansroul, M; Hapke, M; Hargrove, C K; Hart, P A; Hartmann, C; Hauschild, M; Hawkes, C M; Hawkings, R; Hemingway, Richard J; Herndon, M; Herten, G; Heuer, R D; Hildreth, M D; Hill, J C; Hillier, S J; Hobson, P R; Homer, R James; Honma, A K; Horváth, D; Hossain, K R; Howard, R; Hüntemeyer, P; Hutchcroft, D E; Igo-Kemenes, P; Imrie, D C; Ingram, M R; Ishii, K; Jawahery, A; Jeffreys, P W; Jeremie, H; Jimack, Martin Paul; Joly, A; Jones, C R; Jones, G; Jones, M; Jost, U; Jovanovic, P; Junk, T R; Karlen, D A; Kartvelishvili, V G; Kawagoe, K; Kawamoto, T; Kayal, P I; Keeler, Richard K; Kellogg, R G; Kennedy, B W; Kirk, J; Klier, A; Kluth, S; Kobayashi, T; Kobel, M; Koetke, D S; Kokott, T P; Kolrep, M; Komamiya, S; Kress, T; Krieger, P; Von Krogh, J; Kyberd, P; Lafferty, G D; Lahmann, R; Lai, W P; Lanske, D; Lauber, J; Lautenschlager, S R; Layter, J G; Lazic, D; Lee, A M; Lefebvre, E; Lellouch, Daniel; Letts, J; Levinson, L; Lloyd, S L; Loebinger, F K; Long, G D; Losty, Michael J; Ludwig, J; Macchiolo, A; MacPherson, A L; Mannelli, M; Marcellini, S; Markus, C; Martin, A J; Martin, J P; Martínez, G; Mashimo, T; Mättig, P; McDonald, W J; McKenna, J A; McKigney, E A; McMahon, T J; McPherson, R A; Meijers, F; Menke, S; Merritt, F S; Mes, H; Meyer, J; Michelini, Aldo; Mikenberg, G; Miller, D J; Mincer, A; Mir, R; Mohr, W; Montanari, A; Mori, T; Morii, M; Müller, U; Mihara, S; Nagai, K; Nakamura, I; Neal, H A; Nellen, B; Nisius, R; O'Neale, S W; Oakham, F G; Odorici, F; Ögren, H O; Oh, A; Oldershaw, N J; Oreglia, M J; Orito, S; Pálinkás, J; Pásztor, G; Pater, J R; Patrick, G N; Patt, J; Pearce, M J; Pérez-Ochoa, R; Petzold, S; Pfeifenschneider, P; Pilcher, J E; Pinfold, J L; Plane, D E; Poffenberger, P R; Poli, B; Posthaus, A; Rees, D L; Rigby, D; Robertson, S; Robins, S A; Rodning, N L; Roney, J M; Rooke, A M; Ros, E; Rossi, A M; Routenburg, P; Rozen, Y; Runge, K; Runólfsson, O; Ruppel, U; Rust, D R; Rylko, R; Sachs, K; Saeki, T; Sarkisyan-Grinbaum, E; Sbarra, C; Schaile, A D; Schaile, O; Scharf, F; Scharff-Hansen, P; Schenk, P; Schieck, J; Schleper, P; Schmitt, B; Schmitt, S; Schöning, A; Schröder, M; Schultz-Coulon, H C; Schumacher, M; Schwick, C; Scott, W G; Shears, T G; Shen, B C; Shepherd-Themistocleous, C H; Sherwood, P; Siroli, G P; Sittler, A; Skillman, A; Skuja, A; Smith, A M; Snow, G A; Sobie, Randall J; Söldner-Rembold, S; Springer, R W; Sproston, M; Stephens, K; Steuerer, J; Stockhausen, B; Stoll, K; Strom, D; Szymanski, P; Tafirout, R; Talbot, S D; Tanaka, S; Taras, P; Tarem, S; Teuscher, R; Thiergen, M; Thomson, M A; Von Törne, E; Towers, S; Trigger, I; Trócsányi, Z L; Tsur, E; Turcot, A S; Turner-Watson, M F; Utzat, P; Van Kooten, R; Verzocchi, M; Vikas, P; Vokurka, E H; Voss, H; Wäckerle, F; Wagner, A; Ward, C P; Ward, D R; Watkins, P M; Watson, A T; Watson, N K; Wells, P S; Wermes, N; White, J S; Wilkens, B; Wilson, G W; Wilson, J A; Wolf, G; Wyatt, T R; Yamashita, S; Yekutieli, G; Zacek, V; Zer-Zion, D
1998-01-01
This paper describes a search for the Standard Model Higgs boson using data from e^+e^- collisions collected at center-of-mass energies of 161, 170 and 172 GeV by the OPAL detector at LEP. The data collected at these energies correspond to integrated luminosities of 10.0, 1.0 and 9.4 pb^-1, respectively. The search is sensitive to the main final states from the process in which the Higgs boson is produced in association with a fermion anti-fermion pair, namely four jets, two jets with missing energy, and two jets produced together with a pair of electron, muon or tau leptons. One candidate event is observed, in agreement with the Standard Model background expectation. In combination with previous OPAL searches at center-of-mass energies close to the Z^0 resonance and the revised previous OPAL searches at 161 GeV, we derive a lower limit of 69.4 GeV for the mass of the Standard Model Higgs boson at the 95% confidence level.
Directory of Open Access Journals (Sweden)
Yu-Hoi eKang
2012-11-01
Full Text Available Hepatitis C virus infection is a major cause of chronic liver disease. CD4+ T cells play a key role in disease outcome. However, the critical functions and associated phenotypes of intrahepatic CD4+ T cells are not well defined. We have previously shown that CD8+ T cells expressing the C type lectin CD161 are highly enriched in the human liver, especially during chronic hepatitis. These cells are associated with a type 17 differentiation pattern and express cytokines including IL-17A, IL-22 and IFNγ. We therefore analysed expression of CD161 on CD4+ T cells in blood and liver and addressed the relevant phenotype and functional capacity of these populations. We observed marked enrichment of CD161+CD4+ T cells in the liver during chronic hepatitis such that they are the dominant subtype (mean 55% of CD4+ T cells. IL-22 and IL-17 secreting CD4+ cells were readily found in the livers of HCV+ and NASH donors, although not enriched compared to blood. There was, however, specific enrichment of a novel subset of IL-22/IFN-γ dual secretors (p=0.02 compared to blood, a result reconfirmed with direct ex vivo analyses. These data indicate the dominance of CD161+ expressing lymphocyte populations within the hepatic infiltrate, associated with a distinct cytokine profile. Given their documented roles as antiviral and hepatoprotective cytokines respectively, the impact of co-secretion of IFNγ and IL-22 in the liver may be particularly significant.
Held, Kathrin; Beltrán, Eduardo; Moser, Markus; Hohlfeld, Reinhard; Dornmair, Klaus
2015-09-01
Mucosal-associated invariant T (MAIT) cells are a T-cell subset that expresses a conserved TRAV1-2 (Vα7.2) T-cell receptor (TCR) chain and the surface marker CD161. They are involved in the defence against microbes as they recognise small organic molecules of microbial origin that are presented by the non-classical MHC molecule 1 (MR1). MAIT cells express a semi-restricted TCR α chain with TRAV1-2 preferentially linked to TRAJ33, TRAJ12, or TRAJ20 which pairs with a limited set of β chains. To investigate the TCR repertoire of human CD161(hi)TRAV1-2(+) T cells in depth we analysed the α and β chains of this T-cell subset by next generation sequencing. Concomitantly we analysed 132 paired α and β chains from single cells to assess the αβ pairing preferences. We found that the CD161(hi)TRAV1-2(+) TCR repertoire in addition to the typical MAIT TCRs further contains polyclonal elements reminiscent of classical αβ T cells. Copyright © 2015 American Society for Histocompatibility and Immunogenetics. Published by Elsevier Inc. All rights reserved.
Similarities and Differences in Pacing Patterns in a 161-km and 101-km Ultra-Distance Road Race.
Tan, Philip L S; Tan, Frankie H Y; Bosch, Andrew N
2016-08-01
Tan, PLS, Tan, FHY, and Bosch, AN. Similarities and differences in pacing patterns in a 161-km and 101-km ultra-distance road race. J Strength Cond Res 30(8): 2145-2155, 2016-The purpose of this study was to establish and compare the pacing patterns of fast and slow finishers in a tropical ultra-marathon. Data were collected from the Craze Ultra-marathon held on the 22nd and 21st of September in 2012 and 2013, respectively. Finishers of the 161-km (N = 47) and 101-km (N = 120) categories of the race were divided into thirds (groups A-C) by merit of finishing time. Altogether, 17 and 11 split times were recorded for the 161-km and 101-km finishers, respectively, and used to calculate the mean running speed for each distance segment. Running speed for the first segment was normalized to 100, with all subsequent splits adjusted accordingly. Running speed during the last 5 km was calculated against the mean race pace to establish the existence of an end spurt. A reverse J-shaped pacing profile was demonstrated in all groups for both distance categories and only 38% of the finishers executed an end spurt. In the 101-km category, in comparison with groups B and C, group A maintained a significantly more even pace (p = 0.013 and 0.001, respectively) and completed the race at a significantly higher percent of initial starting speed (p = 0.001 and 0.001, respectively). Descriptive data also revealed that the top 5 finishers displayed a "herd-behavior" by staying close to the lead runner in the initial portion of the race. These findings demonstrate that to achieve a more even pace, recreational ultra-runners should adopt a patient sustainable starting speed, with less competitive runners setting realistic performance goals whereas competitive runners with a specific time goal to consider running in packs of similar pace.
Hard-photon production at $\\sqrt{s}$ = 161 and 172 GeV at LEP
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We have studied the process $e^+e^-{\\rightarrow}\\rm n {\\gamma}$ $(\\rm n{\\ge}2)$ at centre-of-mass energies of 161.3 GeV and 172.1 GeV. The analysis is based on a sample of events collected by the L3 detector in 1996 corresponding to total integrated luminosities of 10.7 ${\\rm pb^{-1}}$ and 10.1 ${\\rm pb^{-1}}$ respectively. The observed rates of events with two and more photons and the characteristic distributions are in good agreement with the Standard Model expectations. This is used to set lower limits on contact interaction energy scale parameters, on the QED cut-off parameters and on the mass of excited electrons.
Abbiendi, G.; Alexander, G.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; De Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
2000-01-01
A selection of di-lepton events with significant missing transverse momentum has been performed using a total data sample of 77.0 pb-1 at e+e- centre-of-mass energies of 161 GeV, 172 GeV and 183 GeV. The observed numbers of events: four at 161 GeV, nine at 172 GeV, and 78 at 183 GeV, are consistent with the numbers expected from Standard Model processes, which arise predominantly from W+W- production with each W decaying leptonically. This topology is an experimental signature also for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Further event selection criteria are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is apparent and model independent limits on the production cross-section times branching ratio squared for various new physics processes are presented. Assuming a 100% branching ratio for the decay of a right-handed charged slepton to a charged lepton and the lightest neutr...
Energy Technology Data Exchange (ETDEWEB)
Hasnimulyati, L. [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400, UPM, Serdang, Selangor (Malaysia); Halimah, M.K., E-mail: halimahmk@upm.edu.my [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400, UPM, Serdang, Selangor (Malaysia); Zakaria, A.; Halim, S.A. [Department of Physics, Faculty of Science, Universiti Putra Malaysia, 43400, UPM, Serdang, Selangor (Malaysia); Ishak, M. [Technical Support Division, Malaysian Institute for Nuclear Technology Research (MINT), Bangi, 43000 Kajang (Malaysia)
2017-05-01
A series of glass samples with composition {[(TeO_2)_0_._7(B_2O_3)_0_._3]_0_._7[ZnO]_0_._3}{sub 1-x}{Tm_2O_3}{sub x} was prepared by using the melt-quenching technique. Then, the samples were characterized by using the densimeter, FTIR and ultrasound technique. The variations of density, molar volume, ultrasonic velocity, elastic moduli, and Poisson’s ratio were discussed and correlated with the composition of the glass samples and the FTIR spectra. It was found that the addition of thulium caused bridging and non-bridging oxygen to be formed at the same time due to the different effect that occur to tellurite and borate network as thulium is added. As thulium is varied from 1 until 3 mol%, bridging oxygens had been found to occur at a high rate and caused the ultrasonic velocity to increase. Nonetheless, when thulium oxide exceeded 3 mol%, non-bridging oxygens formed at a high rate. As a result, ultrasonic velocity was reduced. Furthermore, the values of elastic moduli (including bulk, shear, Young’s modulus, and Poisson’s ratio) were compared with the data that were calculated theoretically by using bulk compression, Makishima-Mackenzie, and Rocherulle models. - Highlights: • Bridging and non-bridging oxygen produced concurrently with the addition of Tm{sub 2}O{sub 3}. • All elastic moduli are increase with the increment of thulium oxide. • The three theoretical models are found invalid to be used in this study.
Energy Technology Data Exchange (ETDEWEB)
Kiselev, Yu.M.; Goryachenkov, S.A.; Martynenko, L.I.; Spitsyn, V.I. (Moskovskij Gosudarstvennyj Univ. (USSR))
It is shown by the DTA method that the CsTmCl/sub 6/ and Cs/sub 3/TmF/sub 6/ interaction with XeF/sub 2/ reagents ratio (1:6) proceeds exothermally respectively below 100 deg C and at 380 deg C. The results of IR-spectroscopic investigation and magnetic moment measurement have shown that in the first case in fluorination products there are about 50% of Tm(4) in the TmF/sub 7//sup 3 -/ form, in the second 20-30%. Lesser percent of Tm(4) in Tm(3) fluorocomplex fluorination products as compared with the Tm(3) chlorocomplex fluorination products is caused by kinetic reasons. Radiographically the Cs/sub 3/TmF/sub 6/ and Cs/sub 3/TmF/sub 7/ cubic structures similarity is shown which can be a reason of additional stabilization of the system containing Tm(4) for account of formation of solid solutions.
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
A search for single and multi-photon events with missing energy is performed using data collected at centre-of-mass energies between 161 GeV and 172 GeV for a total of 20.9 pb$^{-1}$ of integrated luminosity. The results obtained are used to derive the value for the $\
Bozzini, G; Seveso, M; Melegari, S; de Francesco, O; Buffi, N M; Guazzoni, G; Provenzano, M; Mandressi, A; Taverna, G
2017-06-01
To compare clinical intra and early postoperative outcomes between thulium laser transurethral enucleation of the prostate (ThuLEP) and transurethral bipolar resection of the prostate (TURis) for treating benign prostatic hyperplasia (BPH) in a prospective randomized trial. The study randomized 208 consecutive patients with BPH to ThuLEP (n=102) or TURis (n=106). For all patients were evaluated preoperatively with regards to blood loss, catheterization time, irrigation volume, hospital stay and operative time. At 3 months after surgery they were also evaluated by International Prostate Symptom Score (IPSS), maximum flow rate (Qmax), and postvoid residual urine volume (PVR). The patients in each study arm each showed no significant difference in preoperative parameters. Compared with TURIS, ThuLEP had same operative time (53.69±31.44 vs 61.66±18.70minutes, P=.123) but resulted in less hemoglobin decrease (0.45 vs 2.83g/dL, P=.005). ThuLEP also needed less catheterization time (1.3 vs 4.8 days, P=.011), irrigation volume (29.4 vs 69.2 L, P=.002), and hospital stay (1.7 vs 5.2 days, P=.016). During the 3 months of follow-up, the procedures did not demonstrate a significant difference in Qmax, IPSS, PVR, and QOLS. ThuLEP and TURis both relieve lower urinary tract symptoms equally, with high efficacy and safety. ThuLEP was statistically superior to TURis in blood loss, catheterization time, irrigation volume, and hospital stay. However, procedures did not differ significantly in Qmax, IPSS, PVR, and QOLS through 3 months of follow-up. Copyright © 2016 AEU. Publicado por Elsevier España, S.L.U. All rights reserved.
International Nuclear Information System (INIS)
Rabatin, J.G.
1984-01-01
Rare earth oxyhalide phosphors activated with thulium ion are employed in X-ray intensifying screens having modified ultraviolet emission characteristics which reduce crossover effects without significant reduction in film speed and further increases screen brightness. Relatively low concentration levels of the thulium activator ion have been found to shift the ultraviolet emission of said phosphor when excited by X-rays to lower wavelengths in both the ultraviolet and near-ultraviolet spectral regions
Ackerstaff, K.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Beeston, C.; Behnke, T.; Bell, A.N.; Bell, Kenneth Watson; Bella, G.; Bentvelsen, S.; Bethke, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bloomer, J.E.; Bobinski, M.; Bock, P.; Bonacorsi, D.; Boutemeur, M.; Bouwens, B.T.; Braibant, S.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Clarke, P.E.L.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Cuffiani, M.; Dado, S.; Dallapiccola, C.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; Desch, K.; Dienes, B.; Dixit, M.S.; do Couto e Silva, E.; Doucet, M.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Edwards, J.E.G.; Estabrooks, P.G.; Evans, H.G.; Evans, M.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fischer, H.M.; Fleck, I.; Folman, R.; Fong, D.G.; Foucher, M.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Geddes, N.I.; Geich-Gimbel, C.; Geralis, T.; Giacomelli, G.; Giacomelli, P.; Giacomelli, R.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Goodrick, M.J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hajdu, C.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Hargrove, C.K.; Hart, P.A.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Hutchcroft, D.E.; Igo-Kemenes, P.; Imrie, D.C.; Ingram, M.R.; Ishii, K.; Jawahery, A.; Jeffreys, P.W.; Jeremie, H.; Jimack, M.; Joly, A.; Jones, C.R.; Jones, G.; Jones, M.; Jost, U.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Kirk, J.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kress, T.; Krieger, P.; von Krogh, J.; Kyberd, P.; Lafferty, G.D.; Lahmann, R.; Lai, W.P.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lefebvre, E.; Lellouch, D.; Letts, J.; Levinson, L.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Macchiolo, A.; Macpherson, A.; Mannelli, M.; Marcellini, S.; Markus, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mikenberg, G.; Miller, D.J.; Mincer, A.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Morii, M.; Muller, U.; Mihara, S.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oh, A.; Oldershaw, N.J.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Pearce, M.J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Poli, B.; Posthaus, A.; Rees, D.L.; Rigby, D.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Rooke, A.; Ros, E.; Rossi, A.M.; Routenburg, P.; Rozen, Y.; Runge, K.; Runolfsson, O.; Ruppel, U.; Rust, D.R.; Rylko, R.; Sachs, K.; Saeki, T.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schenk, P.; Schieck, J.; Schleper, P.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schultz-Coulon, H.C.; Schumacher, M.; Schwick, C.; Scott, W.G.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skillman, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Springer, Robert Wayne; Sproston, M.; Stephens, K.; Steuerer, J.; Stockhausen, B.; Stoll, K.; Strom, David M.; Szymanski, P.; Tafirout, R.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Utzat, P.; Van Kooten, Rick J.; Verzocchi, M.; Vikas, P.; Vokurka, E.H.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilkens, B.; Wilson, G.W.; Wilson, J.A.; Wolf, G.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
1998-01-01
Events containing a pair of charged leptons and significant missing transverse momentum are selected from a data sample corresponding to a total integrated luminosity of 20.6 pb^-1 at centre-of-mass energies of 161 GeV and 172 GeV. The observed number of events, four at 161 GeV and nine at 172 GeV, is consistent with the number expected from Standard Model processes, predominantly arising from W+W- production with each W decaying leptonically. This topology is also an experimental signature for the pair production of new particles that decay to a charged lepton accompanied by one or more invisible particles. Further event selection criteria are described that optimise the sensitivity to particular new physics channels. No evidence for new phenomena is observed and limits on the production of scalar charged lepton pairs and other new particles are presented.
International Nuclear Information System (INIS)
Segre, S.E.
1998-01-01
Errors in the main text, the appendix and two curves are corrected in this corrigendum to the paper entitled ''On the use of polarization modulation in combined interferometry and polarimetry'', written by S.E. Segre and published in 1998 Plasma Phys. Control. Fusion, v. 40 p. 153-161
International Nuclear Information System (INIS)
Dartevelle, S.
2006-01-01
Since the multiphase system is made up of a large number of particles, it is impractical to solve the motion of each individual particle; hence GMFIX v1.61 is based upon the Implicit Multi-Field formalism (IMF) which treats all phases in the system as interpenetrating continua. Each instantaneous local point variable (mass, velocity, temperature, pressure, so forth) must be treated to acknowledge the fact that any given arbitrary volume can be shared by different phases at the same time. This treatment may involve, for instance, an averaging or a smoothing process. GMFIX is the geophysical version of MFIX codes developed by NETL and ORNL. MFIX comes after 30 years of continuous developments and improvements from K-FIX codes from LANL. At the time this manuscript was ready for publication (March 2005), some differences exist between the current versions of GMFIX (v. 1.61) and MFIX (v: 1.60) regarding the exact formulation of the energy and momentum equations, the interfacial closures, and the turbulence formulation. Yet both GMFIX and MFIX are being improved, and developed tightly sides by sides
Search for sleptons in $e^+ e^-$ collisions at centre-of-mass energies of 161 GeV and 172 GeV
Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Miquel, R; Mir, L M; Orteu, S; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Bazarko, A O; Becker, U; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rizzo, G; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Siotis, I; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Schmidt, M; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Morawitz, P; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Stacey, A M; Williams, M D; Ghete, V M; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Sloan, Terence; Whelan, E P; Williams, M I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Calvet, D; Carr, J; Coyle, P; Diaconu, C A; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Serin, L; Simion, S; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Bozzi, C; Calderini, G; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Steinberger, Jack; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G
1997-01-01
The data recorded by the ALEPH experiment at LEP at centre-of-mass energies of 161 GeV and 172 GeV were analysed to search for sleptons, the supersymmetric partners of leptons. No evidence for the production of these particles was found. The number of candidates observed is consistent with the background expected from four-fermion processes and gammagamma-interactions. Improved mass limits at 95% C.L. are reported.
Search for sleptons in e+e- collisions at centre-of-mass energies of 161 GeV and 172 GeV
Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Miquel, R.; Mir, Ll. M.; Orteu, S.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Bazarko, A. O.; Becker, U.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rizzo, G.; Rolandi, L.; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J. C.; Machefert, F.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Turnbull, R. M.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Schmidt, M.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Spagnolo, P.; Stacey, A. M.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W.; Sloan, T.; Whelan, E. P.; Williams, M. I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Calvet, D.; Carr, J.; Coyle, P.; Diaconu, C.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Schune, M.-H.; Serin, L.; Simion, S.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Ciulli, V.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A.; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Sau, Lan Wu; Wu, X.; Yamartino, J. M.; Zobernig, G.
1997-02-01
The data recorded by the ALEPH experiment at LEP at centre-of-mass energies of 161 GeV and 172 GeV were analysed to search for sleptons, the supersymmetric partners of leptons. No evidence for the production of these particles was found. The number of candidates observed is consistent with the background expected from four-fermion processes and yy-interactions. Improved mass limits at 95% C.L. are reported.
Zobor, Ditta; Balousha, Ghassan; Baumann, Britta; Wissinger, Bernd
2014-01-01
Retinitis pigmentosa (RP) is a heterogenous group of inherited retinal degenerations caused by mutations in at least 45 genes. Recently, the FAM161A gene was identified as the causative gene for RP28, an autosomal recessive form of RP. We performed a clinical and molecular genetic study of a consanguineous Palestinian family with two three siblings affected with retinitis pigmentosa. DNA samples were collected from the index patient, his father, his affected sister, and two non-affected brothers. DNA sample from the index was subjected to high resolution genome-wide SNP array. Assuming identity-by-descent in this consanguineous family we applied homozygosity mapping to identify disease causing genes. The index patient reported night blindness since the age of 20 years, followed by moderate disease progression with decrease of peripheral vision, the development of photophobia and later on reduced central vision. At the age of 40 his visual acuity was counting fingers (CF) for both eyes, color discrimination was not possible and his visual fields were severely constricted. Funduscopic examination revealed a typical appearance of advanced RP with optic disc pallor, narrowed retinal vessels, bone-spicule like pigmentary changes in the mid-periphery and atrophic changes in the macula. His younger affected brother (37 years) was reported with overall milder symptoms, while the youngest sister (21 years) reported problems only with night vision. Applying high-density SNP arrays we identified several homozygous genomic regions one of which included the recently identified FAM161A gene mutated in RP28-linked autosomal recessive RP. Sequencing analysis revealed the presence of a novel homozygous nonsense mutation, c.1003C>T/p.R335X in the index patient and the affected sister. We identified an RP28-linked RP family in the Palestinian population caused by a novel nonsense mutation in FAM161A. RP in this family shows a typical disease onset with moderate to rapid progression
Pair-Production of W Bosons in $e^+ e^-$ Interactions at $\\sqrt{s}$ = 161 GeV
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alpat, B; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Antreasyan, D; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banicz, K; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Caria, M; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chan, A; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Choi, M T; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Drago, E; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Fernández, D; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee Jae Sik; Lee, K Y; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lieb, E H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nagy, E; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Opitz, H; Organtini, G; Ostonen, R; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Ro, S; Robohm, A; Rodin, J; Rodríguez-Calonge, F J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Santocchia, A; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We report on the measurement of W-boson pair-production with the L3 detector at LEP at a centre-of-mass energy of 161.34~\\GeV. In a data sample corresponding to a total luminosity of 11~pb$^{-1}$, we select four-fermion events with high invariant masses of pairs of hadronic jets or leptons. Combining all final states, the measured total cross section for W-pair production is: $\\SWW = 2.89^{+0.81}_{-0.70}~(stat.)\\pm0.14~(syst.)$~pb. Within the Standard Model, this corresponds to a mass of the W boson of: $\\MW = 80.80^{+0.48}_{-0.42}~(exp.)\\pm 0.03$~(LEP)~\\GeV. Limits on anomalous triple-vector-boson couplings are derived. \\end{abstract}
Measurement of hadron and lepton pair production at 161 GeV < $\\sqrt{s}$ < 172 GeV at LEP
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Sauvage, G; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schultze, K; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We report on measurements of $\\mathrm{e^+e^-}$ annihilation into hadrons and lepton pairs. The data have been taken with the L3 detector at LEP at centre--of--mass energies between 161~$\\mathrm{Ge\\kern -0.12em V}$ and 172~$\\mathrm{Ge\\kern -0.12em V}$. In a data sample corresponding to 21.2~pb$^{-1}$ of integrated luminosity 2728 hadronic and 868 lepton--pair events are selected. The measured cross sections and leptonic forward--backward asymmetries agree well with the Standard Model predictions. \\end{abstract}
MicroRNA-15a and -16-1 act via MYB to elevate fetal hemoglobin expression in human trisomy 13
Sankaran, Vijay G.; Menne, Tobias F.; Šćepanović, Danilo; Vergilio, Jo-Anne; Ji, Peng; Kim, Jinkuk; Thiru, Prathapan; Orkin, Stuart H.; Lander, Eric S.; Lodish, Harvey F.
2011-01-01
Many human aneuploidy syndromes have unique phenotypic consequences, but in most instances it is unclear whether these phenotypes are attributable to alterations in the dosage of specific genes. In human trisomy 13, there is delayed switching and persistence of fetal hemoglobin (HbF) and elevation of embryonic hemoglobin in newborns. Using partial trisomy cases, we mapped this trait to chromosomal band 13q14; by examining the genes in this region, two microRNAs, miR-15a and -16-1, appear as t...
Petit Cocault, Laurence; Fleury, Maud; Clay, Denis; Larghero, Jérôme; Vanneaux, Valérie; Souyri, Michèle
2016-04-01
Thrombopoietin (TPO) and its receptor Mpl (CD110) play a crucial role in the regulation of hematopoietic stem cells (HSCs). Functional study of Mpl-expressing HSCs has, however, been hampered by the lack of efficient monoclonal antibodies, explaining the very few data available on Mpl(+) HSCs during human embryonic development and after birth. Investigating the main monoclonal antibodies used so far to sort CD110(+) cells from cord blood (CB) and adult bone marrow (BM), we found that only the recent monoclonal antibody 1.6.1 engineered by Immunex Corporation was specific. Using in vitro functional assays, we found that this antibody can be used to sort a CD34(+)CD38(-)CD110(+) population enriched in hematopoietic progenitor stem cells, both in CB and in adult BM. In vivo injection into NSG mice further indicated that the CB CD34(+)CD38(-)CD110(+) population is highly enriched in HSCs compared with both CD34(+)CD38(-)CD110(-) and CD34(+)CD38(-) populations. Together our results validate MAb1.6.1 as an important tool, which has so far been lacking, in the HSC field. Copyright © 2016 ISEH - International Society for Experimental Hematology. Published by Elsevier Inc. All rights reserved.
161Dy Moessbauer spectroscopy of the intermetallic compounds DyNi2Si2, DyNi2Ge2 and DyAg2Si2
International Nuclear Information System (INIS)
Onodera, Hideya; Murata, Akifumi; Koizuka, Masaaki; Ohashi, Masayoshi; Yamaguchi, Yasuo
1994-01-01
161 Dy Moessbauer spectroscopic study has been performed on DyNi 2 Si 2 , DyNi 2 Ge 2 and DyAg 2 Si 2 in order to clarify microscopic properties of antiferromagnets with incommensurate and sinusoidally moment-modulated structure. The experiments were done using the standard 161 Tb Moessbauer sources prepared by neutron irradiation at the Japan Material Testing Reactor. The Moessbauer spectra of DyNi 2 Si 2 are analyzed satisfactorily by a single set of hyperfine parameters, and hence the sinusoidal moment-modulation is considered to be realized through a distribution of spin relaxation rate. The broadened spectra of DyNi 2 Ge 2 are fitted tentatively by three subspectra. It seems for DyNi 2 Ge 2 that the incommensurate arrangement of Dy moments differed in magnitude as well as the distribution of spin relaxation rate originates the moment modulation. The fact that the spectrum of DyAg 2 Si 2 at 3 K consists of two distinct subspectra ensures the complicated antiferromagnetic structure where two kinds of Dy moments differed in magnitude are arranged noncollinearly. (author)
Sinclair, Archibald R; Mace, William D
1956-01-01
A limited calibration of a combined pitot-static tube and vane-type flow-angularity indicator has been made in the Langley 4- by 4-foot supersonic pressure tunnel at Mach numbers of 1.61 and 2.01. The results indicated that the angle-of-yaw indications were affected by unsymmetric shock effects at low angles of attack.
Thulium oxide fuel characterization study (thulium-170 fueled capsule parametric design)
Energy Technology Data Exchange (ETDEWEB)
DesChamps, N.H.
1968-10-01
A doubly encapsulated thulia wafer, i.e., individually lined wafers stacked one upon another inside a fuel capsule was studied. The temperature profiles were determined for thulia power densities ranging from 8 to 24 W/cc and fuel capsule surface temperatures ranging from 1000/sup 0/F (538/sup 0/C) to 2000/sup 0/F (1093/sup 0/C). Parametric studies were also carried out on a singly encapsulated configuration in which the thulia wafers were stacked face to face in an infinitely long, lined cylinder. The doubly encapsulated wafer configuration yielded a lower centerline temperature than the singly encapsulated capsule. Only in extreme cases of a large wafer diameter in combination with a high thulia power density did the fuel capsule centerline temperature exceed the thulia melt temperature of 4172/sup 0/F (2300/sup 0/C). Results are also given for the maximum radius attainable without having centerline melting when using a thulia microsphere fuel form.
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Schneegans, M; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
A search for the Standard Model Higgs boson has been performed with the L3 detector at LEP. The data sample was collected at three centre-of-mass energies, 161.3, 170.3 and 172.3 GeV with integrated luminosities of 10.8, 1.0 and 9.2 $pb^-1$, respectively. No Higgs signal is observed. In combination with previous data taken at the Z resonance, a lower Higgs mass limit, $M_H > 69.5$ GeV, is obtained at 95\\% confidence level.
Yb3+ sensitized Tm3+ upconversion in tellurite lead oxide glass.
Mohanty, Deepak Kumar; Rai, Vineet Kumar; Dwivedi, Y
2012-04-01
Triply ionized thulium/thulium--ytterbium doped/codoped TeO2-Pb3O4 (TPO) glasses have been fabricated by classical quenching method. The upconversion emission spectra in the Tm3+/Tm3+-Yb3+ doped/codoped glasses upon excitation with a diode laser lasing at ∼980 nm has been studied. Effect of the addition of the Yb3+ on the upconversion emission intensity in the visible and near infrared regions of the Tm3+ doped in TPO glass has been studied and the processes involved explored. Copyright © 2011 Elsevier B.V. All rights reserved.
Non-stochastic effects of different energy beta emitters on pig and mouse skin
International Nuclear Information System (INIS)
Peel, D.M.; Hopewell, J.W.; Hansen, L.S.; Coggle, J.E.; Charles, M.W.; Wells, J.
1982-01-01
In this collaborative study skin areas of various sizes were irradiated with different energy beta emitters. In the post-irradiation period fields were examined for erythema, desquamation, ulceration and dermal necrosis. The aim of the study is to determine the threshold doses for the different biological reactions as a function of the energy of the radiation and the size of skin field irradiated. At St. Bartholomew's Hospital and Oxford the irradiation of mouse and pig skin was carried out using strontium-90 and thulium-170 sources. In addition, mice were irradiated with thallium-204, a slightly lower energy beta emitter than thulium. (author)
Spectral properties and laser performance of Tm, Ho: LuLF4 crystal
Peng, Haiyan; Zhang, Kun; Zhang, Lianhan; Hang, Yin; Xu, Jianqiu; Tang, Yulong; Cheng, Yan; Xiong, Jing
2008-12-01
LuLiF4 single crystals co-doped with thulium (5%) and holmium (0.5%), which had large size, intact shape and high optical quality, were successfully grown by the medium frequency induction heating Czochralski Technique. The absorption spectrum of the crystals showed that the main absorption peak located at 686 nm and 792nm. At room temperature, LuLiF4 single crystals co-doped with thulium (5%) and holmium (0.5%) were end-pumped by a fiber-coupled laser diode system with pumping wavelength of 795 nm. We achieved power of 50 mw continuous laser output at 2.05 μm wavelength.
High pulse energy sub-nanosecond Tm-doped fiber laser
Cserteg, Andras; Guillemet, Sebastien; Hernandez, Yves; Giannone, Domenico
2012-02-01
We report a core pumped thulium-doped fiber amplifier that generates 1.4 μJ pulses at 1980 nm with a repetition rate of 3.6 MHz preserving the original spectral bandwidth of the oscillator. The amplifier chain is seeded by a passively modelocked fiber laser with 5 mW output power and the pulses are stretched to 800 picoseconds. The amplifier is core pumped by a single mode erbium fiber laser. The slope efficiency is 35%. To the best of our knowledge, this is the first demonstration of sub nanosecond pulses with energies higher than 1 μJ coming out of a thulium-doped fiber amplifier.
DEFF Research Database (Denmark)
Macé, Aurélien; Tuke, Marcus A; Deelen, Patrick
2017-01-01
There are few examples of robust associations between rare copy number variants (CNVs) and complex continuous human traits. Here we present a large-scale CNV association meta-analysis on anthropometric traits in up to 191,161 adult samples from 26 cohorts. The study reveals five CNV associations......-scale genome-wide meta-analysis of structural variation and find rare CNVs associated with height, weight and BMI with large effect sizes.......)). Burden analysis shows a 0.41 cm decrease in height, a 0.003 increase in waist-to-hip ratio and increase in BMI by 0.14 kg/m(2) for each Mb of total deletion burden (P = 2.5 × 10(-10), 6.0 × 10(-5), and 2.9 × 10(-3)). Our study provides evidence that the same genes (e.g., MC4R, FIBIN, and FMO5) harbor...
Saredi, Giovanni; Pirola, Giacomo Maria; Pacchetti, Andrea; Lovisolo, Jon Alexander; Borroni, Giacomo; Sembenini, Federico; Marconi, Alberto Mario
2015-06-09
The aim of this study was to determine the learning curve for thulium laser enucleation of the prostate (ThuLEP) for two surgeons with different levels of urological endoscopic experience. From June 2012 to August 2013, ThuLEP was performed on 100 patients in our institution. We present the results of a prospective evaluation during which we analyzed data related to the learning curves for two surgeons of different levels of experience. The prostatic adenoma volumes ranged from 30 to 130 mL (average 61.2 mL). Surgeons A and B performed 48 and 52 operations, respectively. Six months after surgery, all patients were evaluated with the International Prostate Symptom Score questionnaire, uroflowmetry, and prostate-specific antigen test. Introduced in 2010, ThuLEP consists of blunt enucleation of the prostatic apex and lobes using the sheath of the resectoscope. This maneuver allows clearer visualization of the enucleation plane and precise identification of the prostatic capsule. These conditions permit total resection of the prostatic adenoma and coagulation of small penetrating vessels, thereby reducing the laser emission time. Most of the complications in this series were encountered during morcellation, which in some cases was performed under poor vision because of venous bleeding due to surgical perforation of the capsule during enucleation. Based on this analysis, we concluded that it is feasible for laser-naive urologists with endoscopic experience to learn to perform ThuLEP without tutoring. Those statements still require further validation in larger multicentric study cohort by several surgeon. The main novelty during the learning process was the use of a simulator that faithfully reproduced all of the surgical steps in prostates of various shapes and volumes.
Di-Jet Production in Photon-Photon Collisions at $\\sqrt{s}_{ee}$ = 161 and 172 GeV
Abbiendi, G.; Alexander, G.; Allison, John; Altekamp, N.; Anderson, K.J.; Anderson, S.; Arcelli, S.; Asai, S.; Ashby, S.F.; Axen, D.; Azuelos, G.; Ball, A.H.; Barberio, E.; Barillari, T.; Barlow, Roger J.; Bartoldus, R.; Batley, J.R.; Baumann, S.; Bechtluft, J.; Behnke, T.; Bell, Kenneth Watson; Bella, G.; Bellerive, A.; Bentvelsen, S.; Bethke, S.; Betts, S.; Biebel, O.; Biguzzi, A.; Bird, S.D.; Blobel, V.; Bloodworth, I.J.; Bobinski, M.; Bock, P.; Bohme, J.; Bonacorsi, D.; Boutemeur, M.; Braibant, S.; Bright-Thomas, P.; Brigliadori, L.; Brown, Robert M.; Burckhart, H.J.; Burgard, C.; Burgin, R.; Capiluppi, P.; Carnegie, R.K.; Carter, A.A.; Carter, J.R.; Chang, C.Y.; Charlton, David G.; Chrisman, D.; Ciocca, C.; Clarke, P.E.L.; Clay, E.; Cohen, I.; Conboy, J.E.; Cooke, O.C.; Couyoumtzelis, C.; Coxe, R.L.; Cuffiani, M.; Dado, S.; Dallavalle, G.Marco; Davis, R.; De Jong, S.; del Pozo, L.A.; De Roeck, A.; Desch, K.; Dienes, B.; Dixit, M.S.; Dubbert, J.; Duchovni, E.; Duckeck, G.; Duerdoth, I.P.; Eatough, D.; Estabrooks, P.G.; Etzion, E.; Evans, H.G.; Fabbri, F.; Fanti, M.; Faust, A.A.; Fiedler, F.; Fierro, M.; Fleck, I.; Folman, R.; Furtjes, A.; Futyan, D.I.; Gagnon, P.; Gary, J.W.; Gascon, J.; Gascon-Shotkin, S.M.; Gaycken, G.; Geich-Gimbel, C.; Giacomelli, G.; Giacomelli, P.; Gibson, V.; Gibson, W.R.; Gingrich, D.M.; Glenzinski, D.; Goldberg, J.; Gorn, W.; Grandi, C.; Gross, E.; Grunhaus, J.; Gruwe, M.; Hanson, G.G.; Hansroul, M.; Hapke, M.; Harder, K.; Hargrove, C.K.; Hartmann, C.; Hauschild, M.; Hawkes, C.M.; Hawkings, R.; Hemingway, R.J.; Herndon, M.; Herten, G.; Heuer, R.D.; Hildreth, M.D.; Hill, J.C.; Hillier, S.J.; Hobson, P.R.; Hocker, James Andrew; Homer, R.J.; Honma, A.K.; Horvath, D.; Hossain, K.R.; Howard, R.; Huntemeyer, P.; Igo-Kemenes, P.; Imrie, D.C.; Ishii, K.; Jacob, F.R.; Jawahery, A.; Jeremie, H.; Jimack, M.; Jones, C.R.; Jovanovic, P.; Junk, T.R.; Karlen, D.; Kartvelishvili, V.; Kawagoe, K.; Kawamoto, T.; Kayal, P.I.; Keeler, R.K.; Kellogg, R.G.; Kennedy, B.W.; Klier, A.; Kluth, S.; Kobayashi, T.; Kobel, M.; Koetke, D.S.; Kokott, T.P.; Kolrep, M.; Komamiya, S.; Kowalewski, Robert V.; Kress, T.; Krieger, P.; von Krogh, J.; Kuhl, T.; Kyberd, P.; Lafferty, G.D.; Lanske, D.; Lauber, J.; Lautenschlager, S.R.; Lawson, I.; Layter, J.G.; Lazic, D.; Lee, A.M.; Lellouch, D.; Letts, J.; Levinson, L.; Liebisch, R.; List, B.; Littlewood, C.; Lloyd, A.W.; Lloyd, S.L.; Loebinger, F.K.; Long, G.D.; Losty, M.J.; Ludwig, J.; Lui, D.; Macchiolo, A.; Macpherson, A.; Mader, W.; Mannelli, M.; Marcellini, S.; Markopoulos, C.; Martin, A.J.; Martin, J.P.; Martinez, G.; Mashimo, T.; Mattig, Peter; McDonald, W.John; McKenna, J.; Mckigney, E.A.; McMahon, T.J.; McPherson, R.A.; Meijers, F.; Menke, S.; Merritt, F.S.; Mes, H.; Meyer, J.; Michelini, A.; Mihara, S.; Mikenberg, G.; Miller, D.J.; Mir, R.; Mohr, W.; Montanari, A.; Mori, T.; Nagai, K.; Nakamura, I.; Neal, H.A.; Nellen, B.; Nisius, R.; O'Neale, S.W.; Oakham, F.G.; Odorici, F.; Ogren, H.O.; Oreglia, M.J.; Orito, S.; Palinkas, J.; Pasztor, G.; Pater, J.R.; Patrick, G.N.; Patt, J.; Perez-Ochoa, R.; Petzold, S.; Pfeifenschneider, P.; Pilcher, J.E.; Pinfold, J.; Plane, David E.; Poffenberger, P.; Polok, J.; Przybycien, M.; Rembser, C.; Rick, H.; Robertson, S.; Robins, S.A.; Rodning, N.; Roney, J.M.; Roscoe, K.; Rossi, A.M.; Rozen, Y.; Runge, K.; Runolfsson, O.; Rust, D.R.; Sachs, K.; Saeki, T.; Sahr, O.; Sang, W.M.; Sarkisian, E.K.G.; Sbarra, C.; Schaile, A.D.; Schaile, O.; Scharf, F.; Scharff-Hansen, P.; Schieck, J.; Schmitt, B.; Schmitt, S.; Schoning, A.; Schroder, Matthias; Schumacher, M.; Schwick, C.; Scott, W.G.; Seuster, R.; Shears, T.G.; Shen, B.C.; Shepherd-Themistocleous, C.H.; Sherwood, P.; Siroli, G.P.; Sittler, A.; Skuja, A.; Smith, A.M.; Snow, G.A.; Sobie, R.; Soldner-Rembold, S.; Sproston, M.; Stahl, A.; Stephens, K.; Steuerer, J.; Stoll, K.; Strom, David M.; Strohmer, R.; Surrow, B.; Talbot, S.D.; Tanaka, S.; Taras, P.; Tarem, S.; Teuscher, R.; Thiergen, M.; Thomson, M.A.; von Torne, E.; Torrence, E.; Towers, S.; Trigger, I.; Trocsanyi, Z.; Tsur, E.; Turcot, A.S.; Turner-Watson, M.F.; Van Kooten, Rick J.; Vannerem, P.; Verzocchi, M.; Voss, H.; Wackerle, F.; Wagner, A.; Ward, C.P.; Ward, D.R.; Watkins, P.M.; Watson, A.T.; Watson, N.K.; Wells, P.S.; Wermes, N.; White, J.S.; Wilson, G.W.; Wilson, J.A.; Wyatt, T.R.; Yamashita, S.; Yekutieli, G.; Zacek, V.; Zer-Zion, D.
1999-01-01
Di-jet production is studied in collisions of quasi-real photons radiated by the LEP beams at e+e- centre-of-mass energies 161 and 172 GeV. The jets are reconstructed using a cone jet finding algorithm. The angular distributions of direct and double-resolved processes are measured and compared to the predictions of leading order and next-to-leading order perturbative QCD. The jet energy profiles are also studied. The inclusive two-jet cross-section is measured as a function of transverse energy and rapidity and compared to next-to-leading order perturbative QCD calculations. The inclusive two-jet cross-section as a function of rapidity is compared to the prediction of the leading order Monte Carlo generators PYTHIA and PHOJET. The Monte Carlo predictions are calculated with different parametrisations of the parton distributions of the photon. The influence of the `underlying event' has been studied to reduce the model dependence of the predicted jet cross-sections from the Monte Carlo generators.
International Nuclear Information System (INIS)
1995-11-01
This Final Environmental Impact Statement (EIS) covers the proposed 1996 Gulf of Mexico OCS oil and gas lease sales [Central Gulf of Mexico Sale 157 (March 1996) and Western Gulf of Mexico Sale 161 (August 1996)]. This document includes the purpose and background of the proposed actions, the alternatives, the descriptions of the affected environment, and the potential environmental impacts of the proposed actions and alternatives. Proposed mitigating measures and their potential effects are analyzed, in addition to potential cumulative impacts resulting from proposed activities
Wang, Xiao; Yu, Shuhuai; Zhang, Tao; Jiang, Bo; Mu, Wanmeng
2015-04-08
Difructose dianhydride III (DFA III) is a functional carbohydrate produced from inulin by inulin fructotransferase (IFTase, EC 4.2.2.18). In this work, an IFTase gene from Arthrobacter sp. 161MFSha2.1 was cloned and expressed in Escherachia coli. The recombinant enzyme was purified by metal affinity chromatography. It showed significant inulin hydrolysis activity, and the produced main product from inulin was determined as DFA III by nuclear magnetic resonance analysis. The molecular mass of the purified protein was calculated to be 43 and 125 kDa by sodium dodecyl sulfate-polyacrylamide gel electrophoresis and gel filtration, respectively, suggesting the native enzyme might be a homotrimer. The recombinant enzyme showed maximal activity as 2391 units/mg at pH 6.5 and 55 °C. It displayed the highest thermostability among previously reported IFTases (DFA III forming) and was stable up to 80 °C for 4 h of incubation. The smallest substrate was determined as nystose. The conversion ratio of inulin to DFA III reached 81% when 100 g/L inulin was catalyzed by 80 nM recombinant enzyme for 20 min at pH 6.5 and 55 °C. All of these data indicated that the IFTase (DFA III forming) from Arthrobacter sp. 161MFSha2.1 had great potential for industrial DFA III production.
12 nJ 2 μm dissipative soliton fiber laser
International Nuclear Information System (INIS)
Yang, Nan; Huang, Chongyuan; Tang, Yulong; Xu, Jianqiu
2015-01-01
We report high-energy 2 μm dissipative soliton generation from a passively mode-locked thulium-doped fiber laser with a semiconductor saturable absorber mirror. Self-starting stable mode-locking has been achieved with pulse energy of 12.07 nJ, pulse width of 43 ps and average power of 263 mW at a repetition rate of 21.79 MHz. The laser spectral width is ∼2.65 nm with a center wavelength of 1928.2 nm. To the best of our knowledge, this is the highest single pulse energy reported to date directly from a passively mode-locked thulium-doped fiber laser. (letter)
Different lasers in the treatment of benign prostatic hyperplasia: a network meta-analysis
Zhang, Xingming; Shen, Pengfei; He, Qiying; Yin, Xiaoxue; Chen, Zhibin; Gui, Haojun; Shu, Kunpeng; Tang, Qidun; Yang, Yaojing; Pan, Xiuyi; Wang, Jia; Chen, Ni; Zeng, Hao
2016-01-01
All available surgical treatments for benign prostatic hyperplasia (BPH) have their individual advantages or disadvantages. However, the lack of head-to-head studies comparing different surgeries makes it unavailable to conduct direct analysis. To compare the efficacy and safety among different lasers and transurethral resection of prostate (TURP) for BPH, randomized controlled trials were searched in MEDLINE, EMBASE, Cochrane library, WHO International Clinical Trial Registration Platform, and Clinical Trial.gov by 2015.5; and the effectiveness-, perioperation- and complication-related outcomes were assessed by network meta-analysis. 36 studies involving 3831 patients were included. Holmium laser through resection and enucleation had the best efficacy in maximum flow rate. Thulium laser through vapo-resection was superior in improving international prostate symptom score and holmium laser through enucleation was the best for post-voiding residual volume improvement. Diode laser through vaporization was the rapidest in removing postoperative indwelling catheter, while TURP was the longest. TURP required the longest hospitalization and thulium laser through vapo-resection was relatively shorter. Holmium and thulium lasers seem to be relatively better in surgical efficacy and safety, so that these two lasers might be preferred in selection of optimal laser surgery. Actually, more large-scale and high quality head-to-head RCTs are suggested to validate the conclusions. PMID:27009501
Measurement and interpretation of the W-pair cross-section in $e^+ e^-$ interactions at 161 GeV
Abreu, P; Adye, T; Adzic, P; Ajinenko, I; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbi, M S; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Belous, K S; Benvenuti, Alberto C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bizouard, M A; Bloch, D; Blume, M; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chen, M; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Chudoba, J; Cindro, V; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Djannati, A; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Durand, J D; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Erzen, B; Falk, E; Fanourakis, G K; Fassouliotis, D; Feindt, Michael; Ferrari, P; Ferrer, A; Fichet, S; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gerdyukov, L N; Gokieli, R; Golob, B; Gonçalves, P; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Green, C; Grefrath, A; Gris, P; Grosdidier, G; Grzelak, K; Gumenyuk, S A; Gunnarsson, P; Günther, M; Guy, J; Hahn, F; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karafasoulis, K; Karlsson, M; Katsanevas, S; Katsoufis, E C; Keränen, R; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klapp, O; Klein, H; Klovning, A; Kluit, P M; Knoblauch, D; Kokkinias, P; Konoplyannikov, A K; Koratzinos, M; Korcyl, K; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leisos, A; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Libby, J; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Mahon, J R; Maio, A; Malmgren, T G M; Malychev, V; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Masik, J; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Merk, M; Meroni, C; Meyer, S; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Orazi, G; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Pain, R; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernegger, H; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Podobnik, T; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sahr, O; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schneider, H; Schwickerath, U; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Serbelloni, L; Shellard, R C; Siegrist, P; Silvestre, R; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Sokolov, A; Solovyanov, O; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stavitski, I; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Terranova, F; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vlasov, E; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Waldner, F; Weilhammer, Peter; Weiser, C; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Wlodek, T; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zucchelli, G C; Zumerle, G
1997-01-01
In 1996 LEP ran at a centre-of-mass energy of 161~GeV, just above the threshold of W-pair production. DELPHI accumulated data corresponding to an integrated luminosity of $9.93 {\\mathrm{~pb^{-1}}}$, and observed 29 events that are considered as candidates for W-pair production. From these, a cross-section for the doubly resonant $e^+e^-\\to\\mathrm{WW}$ process of $3.67~^{+0.97}_{-0.85} \\pm 0.19{\\mathrm{~pb}}$ has been measured. Within the Standard Model, this cross-section corresponds to a mass of the W-boson of ${\\mathrm{80.40~\\pm~0.44~(stat.)~\\pm~0.09~(syst.) ~\\pm 0.03~(LEP)~GeV}}/c^2$. Alternatively, if $m_{\\mathrm{W}}$ is held fixed at its current value determined by other experiments, the observed cross-section is used to obtain limits on trilinear ${\\mathrm{WWV (V \\equiv \\gamma, Z)}}$ couplings.
Precursory activity of the 161 ka Kos Plateau Tuff eruption, Aegean Sea (Greece)
Piper, David J. W.; Pe-Piper, Georgia; Lefort, Darren
2010-08-01
The Kos Plateau Tuff (KPT) eruption of 161 ka was the largest explosive Quaternary eruption in the eastern Mediterranean. We have discovered an uplifted beach deposit of abraded pumice cobbles, directly overlain by the KPT. The pumice cobbles resemble pumice from the KPT in petrography and composition and differ from Plio-Pleistocene rhyolites on the nearby Kefalos Peninsula. The pumice contains enclaves of basaltic andesite showing chilled lobate margins, suggesting co-existence of two magmas. The deposit provides evidence that the precursory phase of the KPT eruption produced pumice rafts, and defines the paleoshoreline for the KPT, which elsewhere was deposited on land. The beach deposit has been uplifted about 120 m since the KPT eruption, whereas the present marine area south of Kos has subsided several hundred metres, as a result of regional neotectonics. The basaltic andesite is more primitive than other mafic rocks known from the Kos-Nisyros volcanic centre and contains phenocrysts of Fo89 olivine, bytownite, enstatite and diopside. Groundmass amphibole suggests availability of water in the final stages of magma evolution. Geochemical and mineralogical variation in the mafic products of the KPT eruption indicate that fractionation of basaltic magma in a base-of-crust magma chamber was followed by mixing with rhyolitic magma during eruption. Low eruption rates during the precursory activity may have minimised the extent of mixing and preserved the end-member magma types.
Spaceflight 2 um Tm Fiber MOPA Amplifier, Phase I
National Aeronautics and Space Administration — Fibertek proposes to design, develop, and test a spaceflight prototype 2051 nm thulium (Tm)-doped fiber amplifier (TDFA) optical master oscillator power amplifier...
Choi, H.; Kim, S.; Park, S.
2013-12-01
From 2011 to 2013, Korea Polar Research Institute (KOPRI) conducted a series of geophysical and geochemical expeditions on the longest and easternmost segment of Australian-Antarctic Ridge, located at 61°-63°S, and 156°-161°E. This ridge segment plays an important role in constraining the tectonics of the Antarctic plate. Using IBRV ARAON, the detailed bathymetric data and eleven total magnetic profiles were collected. The studied ridge has spread NNW-SSE direction and tends to be shallower to the west and deeper to the east. The western side of the ridge (156°-157.50°E) shows a broad axial high and a plenty of seamounts as an indicative of massive volcanism. Near the center of the ridge (158°-159°E), a seamount chain is formed stretching toward the south from the ridge. Also, the symmetric seafloor fabric is clearly observed at the eastern portion (158.50°-160°E) of the seamount chain. From the topographic change along the ridge axis, the western part of the ridge appears to have a sufficient magma supply. On the contrary, the eastern side of the ridge (160°-161°E) is characterized by axial valley and relatively deeper depth. Nevertheless, the observed total magnetic field anomalies exhibit symmetric patterns across the ridge axis. Although there have not been enough magnetic survey lines, the spreading rates of the ridge are estimated as the half-spreading rate of 37.7 mm/y and 35.3 mm/y for the western portion of the ridge and 42.3 mm/y for the eastern portion. The studied ridge can be categorized as an intermediate spreading ridge, confirming previous studies based on the spreading rate of global ridge system. Here we will present the preliminary results on bathymetric changes along the ridge axis and its relationship with melt supply distribution, and detailed magnetic properties of the ridge constrained by the observed total field anomalies.
Directory of Open Access Journals (Sweden)
Bartosz Kowalski
2017-04-01
Full Text Available This article discusses the “16+1” format initiated in 2012 as a platform for economic, trade, and cultural cooperation between Central and Eastern Europe (CEE and China. As Chinese authorities claim, the “16+1” initiative is complementary to the “New Silk Road” strategy, being a pragmatic formula without political goals, whose main rationale is to bring mutual benefits to all of its participants (win–win. However, despite the Chinese narratives concerning cooperation with the CEE countries as an economic bridgehead of the “One Road, One Belt” (OBOR initiative, some signs of the political dimension of the project can be noticed. Since at least the 1950s, active participation and promotion of the South–South cooperation has become an important component of China’s foreign relations. Although for Chinese policy makers Sino–South relations have been traditionally defined within the frame of, mostly postcolonial, developing countries of Southeast Asia, Central Asia, Africa, and Latin America, this article tries to examine the “South–South” pattern of China’s diplomacy towards Central and Eastern European states with a focus on the Czech Republic and Hungary.
Searches for charginos and neutralinos in $e^+ e^-$ collisions at $\\sqrt{s}$ = 161 and 172 GeV
Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Bazarko, A O; Becker, U; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Gianotti, F; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kneringer, E; Lehraus, Ivan; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rizzo, G; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Teubert, F; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Valassi, Andrea; Videau, H L; Boccali, T; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Morawitz, P; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Stacey, A M; Williams, M D; Ghete, V M; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Buck, P G; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Sloan, Terence; Whelan, E P; Williams, M I; Giehl, I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Diaconu, C A; Ealet, A; Fouchez, D; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Marumi, M; Schune, M H; Serin, L; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Bozzi, C; Calderini, G; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Sguazzoni, G; Steinberger, Jack; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; Gao, Y; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G
1998-01-01
The data recorded by the ALEPH detector at centre-of-mass energies of 161, 170, and 172 GeV are analysed for signals of chargino and neutralino production. No evidence of a signal is found, although candidate events consistent with the expectations from Standard Model processes are observed. Limits at 95% C.L. on the production cross sections are derived and bounds on the parameters of the Minimal Supersymmetric Standard Model are set. The lower limit on the mass of the lightest chargino is 85.5 GeV/c^2 for gaugino-like charginos (mu = -500 GeV/c^2), and 85.0 GeV/c^2 for Higgsino-like charginos (M_2 = 500 GeV/c^2), for heavy sneutrinos (M(snu) > 200 GeV/c^2) and tanb = sqrt(2). The effect of light sleptons on chargino and neutralino limits is investigated. The assumptions of a universal slepton mass and a universal gaugino mass are relaxed, allowing less model-dependent limits to be obtained.
Spaceflight 1.94 Micron Tm Fiber Laser Transmitter, Phase II
National Aeronautics and Space Administration — Fibertek will develop a spaceflight prototype 1940 nm, 100 W thulium (Tm) laser suitable for NASA spaceflight and long-duration unmanned aerial vehicle (UAV)...
Barate, R; Décamp, D; Ghez, P; Goy, C; Lees, J P; Lucotte, A; Minard, M N; Nief, J Y; Pietrzyk, B; Casado, M P; Chmeissani, M; Comas, P; Crespo, J M; Delfino, M C; Fernández, E; Fernández-Bosman, M; Garrido, L; Juste, A; Martínez, M; Merino, G; Miquel, R; Mir, L M; Padilla, C; Park, I C; Pascual, A; Perlas, J A; Riu, I; Sánchez, F; Teubert, F; Colaleo, A; Creanza, D; De Palma, M; Gelao, G; Iaselli, Giuseppe; Maggi, G; Maggi, M; Marinelli, N; Nuzzo, S; Ranieri, A; Raso, G; Ruggieri, F; Selvaggi, G; Silvestris, L; Tempesta, P; Tricomi, A; Zito, G; Huang, X; Lin, J; Ouyang, Q; Wang, T; Xie, Y; Xu, R; Xue, S; Zhang, J; Zhang, L; Zhao, W; Abbaneo, D; Alemany, R; Bazarko, A O; Becker, U; Bright-Thomas, P G; Cattaneo, M; Cerutti, F; Dissertori, G; Drevermann, H; Forty, Roger W; Frank, M; Hagelberg, R; Hansen, J B; Harvey, J; Janot, P; Jost, B; Kneringer, E; Knobloch, J; Lehraus, Ivan; Lutters, G; Mato, P; Minten, Adolf G; Moneta, L; Pacheco, A; Pusztaszeri, J F; Ranjard, F; Rizzo, G; Rolandi, Luigi; Rousseau, D; Schlatter, W D; Schmitt, M; Schneider, O; Tejessy, W; Tomalin, I R; Wachsmuth, H W; Wagner, A; Ajaltouni, Ziad J; Barrès, A; Boyer, C; Falvard, A; Ferdi, C; Gay, P; Guicheney, C; Henrard, P; Jousset, J; Michel, B; Monteil, S; Montret, J C; Pallin, D; Perret, P; Podlyski, F; Proriol, J; Rosnet, P; Rossignol, J M; Fearnley, Tom; Hansen, J D; Hansen, J R; Hansen, P H; Nilsson, B S; Rensch, B; Wäänänen, A; Daskalakis, G; Kyriakis, A; Markou, C; Simopoulou, Errietta; Vayaki, Anna; Blondel, A; Brient, J C; Machefert, F P; Rougé, A; Rumpf, M; Valassi, Andrea; Videau, H L; Focardi, E; Parrini, G; Zachariadou, K; Cavanaugh, R J; Corden, M; Georgiopoulos, C H; Hühn, T; Jaffe, D E; Antonelli, A; Bencivenni, G; Bologna, G; Bossi, F; Campana, P; Capon, G; Casper, David William; Chiarella, V; Felici, G; Laurelli, P; Mannocchi, G; Murtas, F; Murtas, G P; Passalacqua, L; Pepé-Altarelli, M; Curtis, L; Dorris, S J; Halley, A W; Knowles, I G; Lynch, J G; O'Shea, V; Raine, C; Scarr, J M; Smith, K; Teixeira-Dias, P; Thompson, A S; Thomson, E; Thomson, F; Turnbull, R M; Buchmüller, O L; Dhamotharan, S; Geweniger, C; Graefe, G; Hanke, P; Hansper, G; Hepp, V; Kluge, E E; Putzer, A; Sommer, J; Tittel, K; Werner, S; Wunsch, M; Beuselinck, R; Binnie, David M; Cameron, W; Dornan, Peter J; Girone, M; Goodsir, S M; Martin, E B; Morawitz, P; Moutoussi, A; Nash, J; Sedgbeer, J K; Spagnolo, P; Stacey, A M; Williams, M D; Ghete, V M; Girtler, P; Kuhn, D; Rudolph, G; Betteridge, A P; Bowdery, C K; Colrain, P; Crawford, G; Finch, A J; Foster, F; Hughes, G; Jones, R W L; Sloan, Terence; Whelan, E P; Williams, M I; Hoffmann, C; Jakobs, K; Kleinknecht, K; Quast, G; Renk, B; Rohne, E; Sander, H G; Van Gemmeren, P; Zeitnitz, C; Aubert, Jean-Jacques; Benchouk, C; Bonissent, A; Bujosa, G; Carr, J; Coyle, P; Diaconu, C A; Ealet, A; Fouchez, D; Konstantinidis, N P; Leroy, O; Motsch, F; Payre, P; Talby, M; Sadouki, A; Thulasidas, M; Tilquin, A; Trabelsi, K; Aleppo, M; Antonelli, M; Ragusa, F; Berlich, R; Blum, Walter; Büscher, V; Dietl, H; Ganis, G; Gotzhein, C; Kroha, H; Lütjens, G; Lutz, Gerhard; Männer, W; Moser, H G; Richter, R H; Rosado-Schlosser, A; Schael, S; Settles, Ronald; Seywerd, H C J; Saint-Denis, R; Stenzel, H; Wiedenmann, W; Wolf, G; Boucrot, J; Callot, O; Chen, S; Cordier, A; Davier, M; Duflot, L; Grivaz, J F; Heusse, P; Höcker, A; Jacholkowska, A; Jacquet, M; Kado, M; Kim, D W; Le Diberder, F R; Lefrançois, J; Lutz, A M; Nikolic, I A; Schune, M H; Serin, L; Simion, S; Tournefier, E; Veillet, J J; Videau, I; Zerwas, D; Azzurri, P; Bagliesi, G; Bettarini, S; Bozzi, C; Calderini, G; Ciulli, V; Dell'Orso, R; Fantechi, R; Ferrante, I; Giassi, A; Gregorio, A; Ligabue, F; Lusiani, A; Marrocchesi, P S; Messineo, A; Palla, Fabrizio; Sanguinetti, G; Sciabà, A; Steinberger, Jack; Tenchini, Roberto; Vannini, C; Venturi, A; Verdini, P G; Blair, G A; Bryant, L M; Chambers, J T; Gao, Y; Green, M G; Medcalf, T; Perrodo, P; Strong, J A; Von Wimmersperg-Töller, J H; Botterill, David R; Clifft, R W; Edgecock, T R; Haywood, S; Maley, P; Norton, P R; Thompson, J C; Wright, A E; Bloch-Devaux, B; Colas, P; Fabbro, B; Kozanecki, Witold; Lançon, E; Lemaire, M C; Locci, E; Pérez, P; Rander, J; Renardy, J F; Rosowsky, A; Roussarie, A; Schuller, J P; Schwindling, J; Trabelsi, A; Vallage, B; Black, S N; Dann, J H; Kim, H Y; Litke, A M; McNeil, M A; Taylor, G; Booth, C N; Boswell, R; Brew, C A J; Cartwright, S L; Combley, F; Kelly, M S; Lehto, M H; Newton, W M; Reeve, J; Thompson, L F; Affholderbach, K; Böhrer, A; Brandt, S; Cowan, G D; Foss, J; Grupen, Claus; Saraiva, P; Smolik, L; Stephan, F; Apollonio, M; Bosisio, L; Della Marina, R; Giannini, G; Gobbo, B; Musolino, G; Pütz, J; Rothberg, J E; Wasserbaech, S R; Williams, R W; Armstrong, S R; Charles, E; Elmer, P; Ferguson, D P S; González, S; Greening, T C; Hayes, O J; Hu, H; Jin, S; McNamara, P A; Nachtman, J M; Nielsen, J; Orejudos, W; Pan, Y B; Saadi, Y; Scott, I J; Walsh, J; Wu Sau Lan; Wu, X; Yamartino, J M; Zobernig, G
1997-01-01
The reaction e+e- -> HZ is used to search for the Standard Model Higgs boson. The data sample consists of integrated luminosities of 10.9pb-1 1.1pb-1 and 9.5pb-1 collected by the ALEPH experiment at LEP during 1996, at centre-of-mass energies of 161, 170 and 172GeV, respectively. No candidate events were found, in agreement with the expected background of 0.84 events from all Standard Model processes. This search results in a 95%C.L. lower limit on the Higgs boson mass of 69.4GeV. When combined with earlier ALEPH searches performed at energies at and around the Z peak, this limit increases to 70.7GeV
Search for the Standard Model Higgs boson in e+e- collisions at sqrt(s)=161, 170 and 172GeV
ALEPH Collaboration; Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Comas, P.; Crespo, J. M.; Delfino,, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll. M.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Teubert, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Bazarko, A. O.; Becker, U.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Knobloch, J.; Lehraus, I.; Lutters, G.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rizzo, G.; Rolandi, L.; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Tomalin, I. R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J. C.; Machefert, F.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Turnbull, R. M.; Buchmüller, O.; Dhamotharan, S.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Spagnolo, P.; Stacey, A. M.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W.; Sloan, T.; Whelan, E. P.; Williams, M. I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Carr, J.; Coyle, P.; Diaconu, C.; Ealet, A.; Fouchez, D.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kado, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Schune, M.-H.; Serin, L.; Simion, S.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Ciulli, V.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A., III; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zobernig, G.
1997-10-01
The reaction e+e--->HZ is used to search for the Standard Model Higgs boson. The data sample consists of integrated luminosities of 10.9pb-1, 1.1pb-1, and 9.5pb-1 collected by the ALEPH experiment at LEP during 1996, at centre-of-mass energies of 161, 170 and 172GeV, respectively. No candidate events were found, in agreement with the expected background of 0.84 events from all Standard Model processes. This search results in a 95% C.L. lower limit on the Higgs boson mass of 69.4GeV/c2. When combined with earlier ALEPH searches performed at energies at and around the Z peak, this limit increases to 70.7GeV/c2.
Spaceflight 1.94 micron Tm Fiber Laser Transmitter, Phase I
National Aeronautics and Space Administration — Fibertek proposes to develop a spaceflight prototype 1940 nm, 100 W thulium (Tm) laser suitable for NASA spaceflight and long-duration unmanned aerial vehicle (UAV)...
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
We present a study of the structure of hadronic events recorded by the L3 detector at LEP at the center of mass energies of 161 and 172 GeV. The data sample corresponds to an integrated luminosity of 21.25 pb-1 collected during the high energy runs of 1996. The distributions of event shape variables and the energy dependence of their mean values are well reproduced by QCD models. From a comparison of the data with resummed second order QCD calculations, we determine the strong coupling constant at the two energies. Combining with our earlier measurements we find that the strong coupling constant decreases with increasing energy as expected in QCD.
Directory of Open Access Journals (Sweden)
George Cornel Dumitrescu
2016-04-01
Full Text Available This paper aims at analysing the projects and the initiatives of the Central and Eastern European countries that have been finalised, are in progress or will be developed in the near future with the help of the existing or future financial instruments specific to the 16+1 platform and the One Belt, One Road complex program. For our research we selected four countries, namely: Poland, Romania, Serbia and Hungary, the group being relevant from the perspective of the transportation corridors connected to the ”One Belt, One Road” initiative: (1 - Piraeus, Skopje, Belgrade, Budapest, Western Europe; (2 - Suez Canal, Constanta and then Danube, Western Europe, or through Moldova towards Ukraine and Poland; (3 – Constanta, through the Black Sea and Caspian Sea and then the corridors mentioned at the previous point. We based our analysis on the data provided by the National Bureau of Statistics of China, China-CEEC think-tank network and the literature in the field.
International Nuclear Information System (INIS)
Fogdall, S.P.; Anderson, J.L.
1983-01-01
A series of countercurrent flow limiting (CCFL) experiments has been performed by EG and G Idaho, Inc. in the Steam-Air-Water (SAW) test facility at the Idaho National Engineering Laboratory on behalf of the US Nuclear Regulatory Commission (NRC). Tests were performed in a mockup of the vessel for the 161-Rod Systems Effects Test (SET) facility of the FLECHT-SEASET program, conducted by the Westinghouse Electric Corporation. Westinghouse and the NRC will use the test results to provide a CCFL correlation to predict the flooding behavior in the upper plenum of the SET vessel. This paper presents a description of the experimental system and the test conduct, including data validation and uncertainty analysis. The test objectives centered on experimentally obtaining coefficients in the Wallis correlation for flooding with the specific vessel geometry. The test conditions and vessel configuration are described and the design of the test loop, instrumentation, and data acquisition are discussed. The establishment of a test point and the resultant data are described
Magnetic excitations in thulium metal
International Nuclear Information System (INIS)
Fernandez-Baca, J.A.; Nicklow, R.M.; Rhyne, J.J.
1989-01-01
We have performed inelastic neutron scattering measurements on a single crystal specimen of Tm at wavevectors rvec κ = (1,1, ζ) and (0,0,2 + ζ) (ζ = 0, hor-ellipsis, 1). Most of the measurements have been made at T = 5K, where Tm exhibits a seven layer ferrimagnetic-antiphase-domain structure (four moments up, parallel to the c-axis, followed by three moments down). At this temperature the excitation spectra consist of three peaks. The two lower energy excitations have been identified as originating from magneto-vibrational scattering from the TA phonon, while the higher energy excitation is magnetic and exhibits only a weak dispersion (between 8.3 and 9.6 meV). At T = 50K, a temperature at which the system exhibits a c-axis sinusoidally modulated structure, the magnetic mode shows significant softening and broadening. The magneto-vibrational scattering vanishes above the Neel temperature (T N = 58.5K) while the magnetic mode persists at least up to T = 70K. These results suggest that the Hamiltonian in this system is dominated by the crystal-field-anistropy energy, and that the exchange interaction is relatively weak. 9 refs., 2 figs
International Nuclear Information System (INIS)
Zamani, Hassan Ali; Feizyzadeh, Babak; Faridbod, Farnoush; Ganjali, Mohammad Reza
2011-01-01
A thulium(III) membrane sensor was made using 2% sodium tetraphenyl borate (NaTPB), 65% dibutylphthalate (DBP), 30% poly(vinyl chloride) (PVC) and 3% 1-ethyl-3-(2,5-dihydro-4-(3,5-dimethyl-1H-pyrazol-4-yl) -5-oxo-1H-pyrazol-3-yl)thiourea (ET) as an ionophore. Conductometric study shows selectivity of the Et toward Tm 3+ ions. Nernstian response of 19.6 ± 0.4 mV per decade of thulium concentration was observed, and the electrode worked well in concentration range of 1.0 x 10 -6 to 1.0 x 10 -2 mol L -1 with a lower detection limit (LDL) of 7.2 x 10 -7 mol L -1 , in a pH range of 4.3-10.4. The selectivity of the sensor over alkaline, alkaline earth, transition and heavy metal ions was also found to be in a satisfactory range. To check the analytical applicability of the proposed Tm 3+ sensor, it was successfully used as an indicator electrode in analysis of thulium in certified reference materials. - Research highlights: → This work reports development of polymeric membrane sensor for Tm3+ determination in certified reference materials. → The novelty of this work is based on the high affinity of the ionophore toward the Tm3+ ions which causes the high selectivity of the sensor. → The newly developed sensor is superior to the formerly reported Tm3+ sensors in terms of selectivity and detection limit.
Energy Technology Data Exchange (ETDEWEB)
Silvestre, O.; Pujol, M.C.; Sole, R.; Bolanos, W.; Carvajal, J.J.; Massons, J.; Aguilo, M. [Fisica i Cristal.lografia de Materials (FiCMA), Universitat Rovira i Virgili, Campus Sescelades c/Marcel.li Domingo, s/n E-43007 Tarragona (Spain); Diaz, F. [Fisica i Cristal.lografia de Materials (FiCMA), Universitat Rovira i Virgili, Campus Sescelades c/Marcel.li Domingo, s/n E-43007 Tarragona (Spain)], E-mail: f.diaz@urv.cat
2008-01-15
Monoclinic epitaxial layers of single doped KLu{sub 1-x}Ln{sub x}(WO{sub 4}){sub 2} (Ln{sup 3+} = Yb{sup 3+} and Tm{sup 3+}) have been grown on optically passive KLuW substrates by liquid phase epitaxy (LPE) technique using K{sub 2}W{sub 2}O{sub 7} as solvent. The ytterbium content in the layer is in the range of 0.05 < x < 0.75 atomic substitution and the studied thulium concentrations are 0.05 < x < 0.10. The grown epitaxies are free of macroscopic defects and only in highly ytterbium-doped epilayers do some cracks or inclusions appear. The refractive indices of the epilayers were determined. The absorption and emission cross sections of ytterbium and thulium in KLuW are characterised and laser generation results are presented and discussed.
Savannah River Laboratory isotopic power and heat sources. Monthly report, June 1966
International Nuclear Information System (INIS)
1966-06-01
Progress in research and development is described for the following: preparation of Tm 2 O 3 ; properties of thulium-171; reduction of Pu-236 in Pu-238; 238 Pu oxide with low neutron emission; and encapsulation of cobalt-60 heat sources
Barate, R.; Decamp, D.; Ghez, Philippe; Goy, C.; Lees, J.P.; Lucotte, A.; Minard, M.N.; Nief, J.Y.; Pietrzyk, B.; Casado, M.P.; Chmeissani, M.; Comas, P.; Crespo, J.M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, L.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, L.M.; Padilla, C.; Park, I.C.; Pascual, A.; Perlas, J.A.; Riu, I.; Sanchez, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Bazarko, A.O.; Becker, U.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R.W.; Frank, M.; Hagelberg, R.; Hansen, J.B.; Harvey, John; Janot, P.; Jost, B.; Kneringer, E.; Lehraus, I.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.F.; Ranjard, F.; Rizzo, G.; Rolandi, Gigi; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Teubert, F.; Tomalin, I.R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barres, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.M.; Fearnley, T.; Hansen, J.D.; Hansen, J.R.; Hansen, P.H.; Nilsson, B.S.; Rensch, B.; Waananen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J.C.; Machefert, F.; Rouge, A.; Rumpf, M.; Valassi, A.; Videau, H.; Boccali, T.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D.E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G.P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S.J.; Halley, A.W.; Knowles, I.G.; Lynch, J.G.; O'Shea, V.; Raine, C.; Scarr, J.M.; Smith, K.; Teixeira-Dias, P.; Thompson, A.S.; Thomson, Evelyn J.; Thomson, F.; Turnbull, R.M.; Buchmuller, O.; Dhamotharan, S.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E.E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D.M.; Cameron, W.; Dornan, P.J.; Girone, M.; Goodsir, S.; Martin, E.B.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J.K.; Spagnolo, P.; Stacey, A.M.; Williams, M.D.; Ghete, V.M.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A.P.; Bowdery, C.K.; Buck, P.G.; Colrain, P.; Crawford, G.; Finch, A.J.; Foster, F.; Hughes, G.; Jones, R.W.L.; Sloan, T.; Whelan, E.P.; Williams, M.I.; Giehl, I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J.J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Carr, J.; Coyle, P.; Diaconu, C.; Ealet, A.; Fouchez, D.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Blum, W.; Buescher, Volker; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lutjens, G.; Lutz, G.; Manner, W.; Moser, H.G.; Richter, Robert, 1; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, Richard Dante; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.F.; Heusse, Ph.; Hocker, Andreas; Jacholkowska, A.; Jacquet, M.; Kim, D.W.; Le Diberder, F.; Lefrancois, J.; Lutz, A.M.; Nikolic, Irina; Schune, M.H.; Serin, L.; Simion, S.; Tournefier, E.; Veillet, J.J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, Giuseppe; Bettarini, S.; Bozzi, C.; Calderini, G.; Ciulli, V.; Dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P.S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciaba, A.; Sguazzoni, G.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P.G.; Blair, G.A.; Bryant, L.M.; Chambers, J.T.; Gao, Y.; Green, M.G.; Medcalf, T.; Perrodo, P.; Strong, J.A.; von Wimmersperg-Toeller, J.H.; Botterill, D.R.; Clifft, R.W.; Edgecock, T.R.; Haywood, S.; Maley, P.; Norton, P.R.; Thompson, J.C.; Wright, A.E.; Bloch-Devaux, Brigitte; Colas, P.; Fabbro, B.; Kozanecki, W.; Lancon, E.; Lemaire, M.C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.F.; Rosowsky, A.; Roussarie, A.; Schuller, J.P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S.N.; Dann, J.H.; Kim, H.Y.; Litke, A.M.; McNeil, M.A.; Taylor, G.; Booth, C.N.; Boswell, R.; Brew, C.A.J.; Cartwright, S.; Combley, F.; Kelly, M.S.; Lehto, M.; Newton, W.M.; Reeve, J.; Thompson, L.F.; Affholderbach, K.; Boehrer, Armin; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Lutters, G.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; Della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R.W.; Armstrong, S.R.; Charles, E.; Elmer, P.; Ferguson, D.P.S.; Gonzalez, S.; Greening, T.C.; Hayes, O.J.; Hu, H.; Jin, S.; McNamara, P.A., III; Nachtman, J.M.; Nielsen, J.; Orejudos, W.; Pan, Y.B.; Saadi, Y.; Scott, I.J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J.M.; Zobernig, G.
1998-01-01
Searches for supersymmetric particles in channels with one or more photons and missing energy have been performed with data collected by the ALEPH detector at LEP. The data consist of 11.1 \\pb\\ at $\\sqrt{s} = 161 ~\\, \\rm GeV$, 1.1 \\pb\\ at 170 \\gev\\ and 9.5 \\pb\\ at 172 GeV. The \\eenunu\\ cross se ction is measured. The data are in good agreement with predictions based on the Standard Model, and are used to set upper limits on the cross sections for anomalous photon production. These limits are compared to two different SUSY models and used to set limits on the neutralino mass. A limit of 71 \\gevsq\\ at 95\\% C.L. is set on the mass of the lightest neutralin o ($\\tau_{\\chi_{1}^{0}} \\leq $ 3 ns) for the gauge-mediated supersymmetry breaking and LNZ models.
Directory of Open Access Journals (Sweden)
Yean K. Yong
2018-03-01
Full Text Available Mucosal-associated invariant T (MAIT cells, defined as CD161++TCR iVα7.2+ T cells, play an important role in the innate defense against bacterial infections, and their functionality is impaired in chronic viral infections. Here, we investigated the frequency and functional role of MAIT cells in chronic hepatitis B virus (HBV infection. The peripheral CD3+CD161++TCR iVα7.2+ MAIT cells in chronic HBV-infected patients and healthy controls were phenotypically characterized based on CD57, PD-1, TIM-3, and CTLA-4, as well as HLA-DR and CD38 expression. The frequency of MAIT cells was significantly decreased among chronic HBV-infected individuals as compared to controls. Expression of CD57, PD-1, CTLA-4, as well as HLA-DR and CD38 on MAIT cells was significantly elevated in chronic HBV-infected individuals relative to controls. The percentage of T cell receptor (TCR iVα7.2+ CD161+ MAIT cells did not correlate with HBV viral load but inversely with HLA-DR on CD4+ T cells and MAIT cells and with CD57 on CD8+ T cells suggesting that decrease of MAIT cells may not be attributed to direct infection by HBV but driven by HBV-induced chronic immune activation. The percentage and expression levels of PD-1 as well as CTLA-4 on MAIT cells inversely correlated with plasma HBV-DNA levels, which may suggest either a role for MAIT cells in the control of HBV infection or the effect of HBV replication in the liver on MAIT cell phenotype. We report that decrease of TCR iVα7.2+ MAIT cells in the peripheral blood and their functions were seemingly impaired in chronic HBV-infected patients likely because of the increased expression of PD-1.
Diode-pumped two micron solid-state lasers
International Nuclear Information System (INIS)
Elder, I.F.
1997-01-01
This thesis presents an investigation of diode-pumped two micron solid-state lasers, concentrating on a comparison of the cw room temperature operation of Tm:YAP, Tm,Ho:YAP and Tm,Ho:YLF. Dopant concentrations in YAP were 4.2% thulium and 0.28% holmium; in YLF they were 6% thulium and 0.4% holmium. Thermal modelling was carried out in order to provide an insight into the thermal lensing and population distributions in these materials. Laser operation was achieved utilising an end-pumping geometry with a simple two mirror standing wave resonator. The pump source for these experiments was a 3 W laser diode. Maximum output power was achieved with Tm:YAP, generating 730 mW of laser output, representing 42% conversion efficiency in terms of absorbed pump power. Upper bounds on the conversion efficiency of Tm,Ho:YAP and Tm,Ho:YLF laser crystal of 14% and 30% were obtained, with corresponding output powers of 270 and 660 mW. In all three cases, the output beam was TEM 00 in nature. Visible upconversion fluorescence bands in the green and red were identified in Tm,Ho:YAP and Tm,Ho:YLF, with additional blue emission from the latter, all assigned to transitions on holmium. The principal upconversion mechanisms in these materials all involved the holmium first excited state. Upconversion in Tm:YAP was negligible. The spectral output of Tm:YAP consisted of a comb of lines in the range 1.965 to 2.020 μm. For both the double-doped crystals, the laser output was multilongitudinal mode on a single transition, wavelength 2.120 μm in YAP, 2.065 μm in YLF. In the time domain the output of Tm:YAP was dominated by large amplitude spiking, unlike both of the double-doped laser crystals. The long lifetime of the thulium upper laser level (4.4 ms) provided very weak damping of the spiking. Excitation sharing between thulium and holmium, with a measured characteristic lifetime in YAP of 11.9 μs and YLF of 14.8 μs, provided strong damping of any spiking behaviour. (author)
International Nuclear Information System (INIS)
Boutaine, J.L.; Bujas, R.; Lemonnier, A.; Tortel, J.
1976-01-01
The principles of a radiometric method intended for controlling the positions of blind hole axes are given. A comparison is made between radiometry and radiography and the performances obtained using a thulium 170 source are described. The automation capabilities are discussed [fr
Efficient Ho:YLF laser pumped by a Tm:fiber laser
CSIR Research Space (South Africa)
Koen, W
2013-10-01
Full Text Available A thulium fiber laser pumped Ho:YLF laser delivering 45.1 W in a near diffraction limited beam when pumped with 84.7 W is demonstrated. The optical-to-optical efficiency of 53 % compares favorably with similar Ho:YAG lasers....
Energy Technology Data Exchange (ETDEWEB)
Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Feizyzadeh, Babak [Department of Applied Chemistry, Quchan branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Faridbod, Farnoush; Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of)
2011-10-10
A thulium(III) membrane sensor was made using 2% sodium tetraphenyl borate (NaTPB), 65% dibutylphthalate (DBP), 30% poly(vinyl chloride) (PVC) and 3% 1-ethyl-3-(2,5-dihydro-4-(3,5-dimethyl-1H-pyrazol-4-yl) -5-oxo-1H-pyrazol-3-yl)thiourea (ET) as an ionophore. Conductometric study shows selectivity of the Et toward Tm{sup 3+} ions. Nernstian response of 19.6 {+-} 0.4 mV per decade of thulium concentration was observed, and the electrode worked well in concentration range of 1.0 x 10{sup -6} to 1.0 x 10{sup -2} mol L{sup -1} with a lower detection limit (LDL) of 7.2 x 10{sup -7} mol L{sup -1}, in a pH range of 4.3-10.4. The selectivity of the sensor over alkaline, alkaline earth, transition and heavy metal ions was also found to be in a satisfactory range. To check the analytical applicability of the proposed Tm{sup 3+} sensor, it was successfully used as an indicator electrode in analysis of thulium in certified reference materials. - Research highlights: {yields} This work reports development of polymeric membrane sensor for Tm3+ determination in certified reference materials. {yields} The novelty of this work is based on the high affinity of the ionophore toward the Tm3+ ions which causes the high selectivity of the sensor. {yields} The newly developed sensor is superior to the formerly reported Tm3+ sensors in terms of selectivity and detection limit.
Fiocco, Ugo; Stramare, Roberto; Martini, Veronica; Coran, Alessandro; Caso, Francesco; Costa, Luisa; Felicetti, Mara; Rizzo, Gaia; Tonietto, Matteo; Scanu, Anna; Oliviero, Francesca; Raffeiner, Bernd; Vezzù, Maristella; Lunardi, Francesca; Scarpa, Raffaele; Sacerdoti, David; Rubaltelli, Leopoldo; Punzi, Leonardo; Doria, Andrea; Grisan, Enrico
2017-02-01
To develop quantitative imaging biomarkers of synovial tissue perfusion by pixel-based contrast-enhanced ultrasound (CEUS), we studied the relationship between CEUS synovial vascular perfusion and the frequencies of pathogenic T helper (Th)-17 cells in psoriatic arthritis (PsA) joints. Eight consecutive patients with PsA were enrolled in this study. Gray scale CEUS evaluation was performed on the same joint immediately after joint aspiration, by automatic assessment perfusion data, using a new quantification approach of pixel-based analysis and the gamma-variate model. The set of perfusional parameters considered by the time intensity curve includes the maximum value (peak) of the signal intensity curve, the blood volume index or area under the curve, (BVI, AUC) and the contrast mean transit time (MTT). The direct ex vivo analysis of the frequencies of SF IL17A-F + CD161 + IL23 + CD4 + T cells subsets were quantified by fluorescence-activated cell sorter (FACS). In cross-sectional analyses, when tested for multiple comparison setting, a false discovery rate at 10%, a common pattern of correlations between CEUS Peak, AUC (BVI) and MTT parameters with the IL17A-F + IL23 + - IL17A-F + CD161 + - and IL17A-F + CD161 + IL23 + CD4 + T cells subsets, as well as lack of correlation between both peak and AUC values and both CD4 + T and CD4 + IL23 + T cells, was observed. The pixel-based CEUS assessment is a truly measure synovial inflammation, as a useful tool to develop quantitative imaging biomarker for monitoring target therapeutics in PsA.
Post-irradiation examination of A1-61 wt % U3Si fuel rods from the NRU reactor
International Nuclear Information System (INIS)
Sears, D.F.; Wang, N.
1997-09-01
This paper describes the post-irradiation examination of 4 intact low-enrichment uranium (LEU) fuel rods from the national research universal (NRU) reactor at the Chalk River Laboratories of AECL. The rods were irradiated during the period 1993 through 1995, under typical driver fuel operating conditions in NRU, i.e., nominal D 2 0 coolant inlet temperature 37 degrees C, inlet pressure 654 kPa and mass flow 12.4 L/s. Irradiation exposures ranged from 147 to 251 full-power days, corresponding to 40 to 84 atom % 235 U burnup. The maximum rod power was ∼2 MW, with element linear power ratings up to 68 kW/m. Post-irradiation examinations, conducted in 1997, focused on optical metallography to measure cladding oxide thickness and fuel core and cladding microstructural examinations. The cladding oxide was approximately 24 μm thick at the mid-plane of fuel rods irradiated to 251 full-power days, with small areas up to 34 μm thick on the fins. The cladding retained significant ductility after irradiation, and its microstructure appeared unchanged. Fuel core diametral increases were small (up to 4%) and within the range previously observed on A1-61 wt % U 3 Si fuel irradiated in the NRU reactor. (author)
Is there a gender equity for women farmers? Reflections on public policy and social CONPES 161/2013.
Directory of Open Access Journals (Sweden)
Ximena Marin Hermann
2013-12-01
Full Text Available Domestic roles ( reproductive and productive Colombian rural women are different and are marked by the dynamics of their own territories , but also developed in the areas of public and private unevenly and unfairly compared to men rural sector. Considering the above, raises feminist economics "care economy" as an effort to validate and make visible the contribution of women to the economy. But this trend can go further, can contribute to the transformation of reproductive and productive roles, encouraging participation and democracy for women. Considering this, the equitable use of the time in the private ( family enters debate. Women no longer want and seek only equality in public but do not want to share your time at home on an unequal footing . Public policies are needed to contribute to these disparities disappear. To this extent it is possible to ask yourself the current Public Policy Of Gender Equity for Women ( SOCIAL CONPES 161/2013 , can guarantee the full enjoyment of the rights of Colombian women applying the principles of equality and non-discrimination? This reflection tries to do, from a gender perspective, an analytical reading of the impact of public policy on the transformation of the reality of the Colombian rural women.
International Nuclear Information System (INIS)
Iwasaki, S.; Matsuyama, S.; Ohkubo, T.; Fukuda, H.; Sakuma, M.; Kitamura, M.; Odano, N.
1995-01-01
Neutron activation cross-sections for cobalt, nickel, yttrium, niobium, thulium and gold have been measured in the neutron energies from 12 to 20 MeV with the reference cross section of NEA 93 Nb(n,2n) 92m Nb at Tohoku Dynamitron Facility. (author)
Best, Ivan; López, Giovanni; Talledo, Michael; MacNamara, Aidan; Verdonck, Kristien; González, Elsa; Tipismana, Martín; Asquith, Becca; Gotuzzo, Eduardo; Vanham, Guido; Clark, Daniel
2011-11-01
HTLV-1-associated myelopathy/tropical spastic paraparesis (HAM/TSP) is a chronic and progressive disorder caused by the human T-lymphotropic virus type 1 (HTLV-1). In HTLV-1 infection, a strong cytotoxic T cell (CTL) response is mounted against the immunodominant protein Tax. Previous studies carried out by our group reported that increased IFN-γ enzyme-linked immunospot (ELISPOT) responses against the region spanning amino acids 161 to 233 of the Tax protein were associated with HAM/TSP and increased HTLV-1 proviral load (PVL). An exploratory study was conducted on 16 subjects with HAM/TSP, 13 asymptomatic carriers (AC), and 10 HTLV-1-seronegative controls (SC) to map the HAM/TSP-associated CTL epitopes within Tax region 161-233. The PVL of the infected subjects was determined and the specific CTL response was evaluated with a 6-h incubation IFN-γ ELISPOT assay using peripheral blood mononuclear cells (PBMCs) stimulated with 16 individual overlapping peptides covering the Tax region 161-233. Other proinflammatory and Th1/Th2 cytokines were also quantified in the supernatants by a flow cytometry multiplex assay. In addition, a set of human leukocyte antigen (HLA) class I alleles that bind with high affinity to the CTL epitopes of interest was determined using computational tools. Univariate analyses identified an association between ELISPOT responses to two new CTL epitopes, Tax 173-185 and Tax 181-193, and the presence of HAM/TSP as well as an increased PVL. The HLA-A*6801 allele, which is predicted to bind to the Tax 181-193 peptide, was overpresented in the HAM/TSP patients tested.
Driver, Cornelius
1956-01-01
Tests have been made in the Langley 4- by 4-foot supersonic pressure tunnel at Mach numbers of 1.41, 1.61, and 2.01 to determine the static longitudinal stability and control characteristics of various arrangements of the Grumman F11F-1 airplane. Tests were made of the complete model and various combinations of its component parts and, in addition, the effects of various body modifications, a revised vertical tail, and wing fences on the longitudinal characteristics were determined. The results indicate that for a horizontal-tail incidence of -10 deg the trim lift coefficient varied from 0.29 at a Mach number of 1.61 to 0.23 at a Mach number of 2.01 with a corresponding decrease in lift-drag trim from 3.72 to 3.15. Stick-position instability was indicated in the low-supersonic-speed range. A photographic-type nose modification resulted in slightly higher values of minimum drag coefficient but did not significantly affect the static stability or lift-curve slope. The minimum drag coefficient for the complete model with the production nose remained essentially constant at 0.047 throughout the Mach number range investigated.
ALEPH Collaboration; Barate, R.; Buskulic, D.; Decamp, D.; Ghez, P.; Goy, C.; Lees, J.-P.; Lucotte, A.; Minard, M.-N.; Nief, J.-Y.; Pietrzyk, B.; Casado, M. P.; Chmeissani, M.; Comas, P.; Crespo, J. M.; Delfino, M.; Fernandez, E.; Fernandez-Bosman, M.; Garrido, Ll.; Juste, A.; Martinez, M.; Merino, G.; Miquel, R.; Mir, Ll. M.; Padilla, C.; Park, I. C.; Pascual, A.; Perlas, J. A.; Riu, I.; Sanchez, F.; Colaleo, A.; Creanza, D.; de Palma, M.; Gelao, G.; Iaselli, G.; Maggi, G.; Maggi, M.; Marinelli, N.; Nuzzo, S.; Ranieri, A.; Raso, G.; Ruggieri, F.; Selvaggi, G.; Silvestris, L.; Tempesta, P.; Tricomi, A.; Zito, G.; Huang, X.; Lin, J.; Ouyang, Q.; Wang, T.; Xie, Y.; Xu, R.; Xue, S.; Zhang, J.; Zhang, L.; Zhao, W.; Abbaneo, D.; Alemany, R.; Bazarko, A. O.; Becker, U.; Bright-Thomas, P.; Cattaneo, M.; Cerutti, F.; Dissertori, G.; Drevermann, H.; Forty, R. W.; Frank, M.; Hagelberg, R.; Hansen, J. B.; Harvey, J.; Janot, P.; Jost, B.; Kneringer, E.; Lehraus, I.; Mato, P.; Minten, A.; Moneta, L.; Pacheco, A.; Pusztaszeri, J.-F.; Ranjard, F.; Rizzo, G.; Rolandi, L.; Rousseau, D.; Schlatter, D.; Schmitt, M.; Schneider, O.; Tejessy, W.; Teubert, F.; Tomalin, I. R.; Wachsmuth, H.; Wagner, A.; Ajaltouni, Z.; Barrès, A.; Boyer, C.; Falvard, A.; Ferdi, C.; Gay, P.; Guicheney, C.; Henrard, P.; Jousset, J.; Michel, B.; Monteil, S.; Montret, J.-C.; Pallin, D.; Perret, P.; Podlyski, F.; Proriol, J.; Rosnet, P.; Rossignol, J.-M.; Fearnley, T.; Hansen, J. D.; Hansen, J. R.; Hansen, P. H.; Nilsson, B. S.; Rensch, B.; Wäänänen, A.; Daskalakis, G.; Kyriakis, A.; Markou, C.; Simopoulou, E.; Vayaki, A.; Blondel, A.; Brient, J. C.; Machefert, F.; Rougé, A.; Rumpf, M.; Valassi, A.; Videau, H.; Boccali, T.; Focardi, E.; Parrini, G.; Zachariadou, K.; Cavanaugh, R.; Corden, M.; Georgiopoulos, C.; Huehn, T.; Jaffe, D. E.; Antonelli, A.; Bencivenni, G.; Bologna, G.; Bossi, F.; Campana, P.; Capon, G.; Casper, D.; Chiarella, V.; Felici, G.; Laurelli, P.; Mannocchi, G.; Murtas, F.; Murtas, G. P.; Passalacqua, L.; Pepe-Altarelli, M.; Curtis, L.; Dorris, S. J.; Halley, A. W.; Knowles, I. G.; Lynch, J. G.; O'Shea, V.; Raine, C.; Scarr, J. M.; Smith, K.; Teixeira-Dias, P.; Thompson, A. S.; Thomson, E.; Thomson, F.; Turnbull, R. M.; Buchmüller, O.; Dhamotharan, S.; Geweniger, C.; Graefe, G.; Hanke, P.; Hansper, G.; Hepp, V.; Kluge, E. E.; Putzer, A.; Sommer, J.; Tittel, K.; Werner, S.; Wunsch, M.; Beuselinck, R.; Binnie, D. M.; Cameron, W.; Dornan, P. J.; Girone, M.; Goodsir, S.; Martin, E. B.; Morawitz, P.; Moutoussi, A.; Nash, J.; Sedgbeer, J. K.; Spagnolo, P.; Stacey, A. M.; Williams, M. D.; Ghete, V. M.; Girtler, P.; Kuhn, D.; Rudolph, G.; Betteridge, A. P.; Bowdery, C. K.; Buck, P. G.; Colrain, P.; Crawford, G.; Finch, A. J.; Foster, F.; Hughes, G.; Jones, R. W. L.; Sloan, T.; Whelan, E. P.; Williams, M. I.; Giehl, I.; Hoffmann, C.; Jakobs, K.; Kleinknecht, K.; Quast, G.; Renk, B.; Rohne, E.; Sander, H.-G.; van Gemmeren, P.; Zeitnitz, C.; Aubert, J. J.; Benchouk, C.; Bonissent, A.; Bujosa, G.; Carr, J.; Coyle, P.; Diaconu, C.; Ealet, A.; Fouchez, D.; Konstantinidis, N.; Leroy, O.; Motsch, F.; Payre, P.; Talby, M.; Sadouki, A.; Thulasidas, M.; Tilquin, A.; Trabelsi, K.; Aleppo, M.; Antonelli, M.; Ragusa, F.; Berlich, R.; Blum, W.; Büscher, V.; Dietl, H.; Ganis, G.; Gotzhein, C.; Kroha, H.; Lütjens, G.; Lutz, G.; Männer, W.; Moser, H.-G.; Richter, R.; Rosado-Schlosser, A.; Schael, S.; Settles, R.; Seywerd, H.; St. Denis, R.; Stenzel, H.; Wiedenmann, W.; Wolf, G.; Boucrot, J.; Callot, O.; Chen, S.; Cordier, A.; Davier, M.; Duflot, L.; Grivaz, J.-F.; Heusse, Ph.; Höcker, A.; Jacholkowska, A.; Jacquet, M.; Kim, D. W.; Le Diberder, F.; Lefrançois, J.; Lutz, A.-M.; Nikolic, I.; Schune, M.-H.; Serin, L.; Simion, S.; Tournefier, E.; Veillet, J.-J.; Videau, I.; Zerwas, D.; Azzurri, P.; Bagliesi, G.; Bettarini, S.; Bozzi, C.; Calderini, G.; Ciulli, V.; dell'Orso, R.; Fantechi, R.; Ferrante, I.; Giassi, A.; Gregorio, A.; Ligabue, F.; Lusiani, A.; Marrocchesi, P. S.; Messineo, A.; Palla, F.; Sanguinetti, G.; Sciabà, A.; Sguazzoni, G.; Steinberger, J.; Tenchini, R.; Vannini, C.; Venturi, A.; Verdini, P. G.; Blair, G. A.; Bryant, L. M.; Chambers, J. T.; Gao, Y.; Green, M. G.; Medcalf, T.; Perrodo, P.; Strong, J. A.; von Wimmersperg-Toeller, J. H.; Botterill, D. R.; Clifft, R. W.; Edgecock, T. R.; Haywood, S.; Maley, P.; Norton, P. R.; Thompson, J. C.; Wright, A. E.; Bloch-Devaux, B.; Colas, P.; Fabbro, B.; Kozanecki, W.; Lançon, E.; Lemaire, M. C.; Locci, E.; Perez, P.; Rander, J.; Renardy, J.-F.; Rosowsky, A.; Roussarie, A.; Schuller, J.-P.; Schwindling, J.; Trabelsi, A.; Vallage, B.; Black, S. N.; Dann, J. H.; Kim, H. Y.; Litke, A. M.; McNeil, M. A.; Taylor, G.; Booth, C. N.; Boswell, R.; Brew, C. A. J.; Cartwright, S.; Combley, F.; Kelly, M. S.; Lehto, M.; Newton, W. M.; Reeve, J.; Thompson, L. F.; Affholderbach, K.; Böhrer, A.; Brandt, S.; Cowan, G.; Foss, J.; Grupen, C.; Lutters, G.; Saraiva, P.; Smolik, L.; Stephan, F.; Apollonio, M.; Bosisio, L.; della Marina, R.; Giannini, G.; Gobbo, B.; Musolino, G.; Putz, J.; Rothberg, J.; Wasserbaech, S.; Williams, R. W.; Armstrong, S. R.; Charles, E.; Elmer, P.; Ferguson, D. P. S.; González, S.; Greening, T. C.; Hayes, O. J.; Hu, H.; Jin, S.; McNamara, P. A., III; Nachtman, J. M.; Nielsen, J.; Orejudos, W.; Pan, Y. B.; Saadi, Y.; Scott, I. J.; Walsh, J.; Wu, Sau Lan; Wu, X.; Yamartino, J. M.; Zobernig, G.
1998-02-01
Searches for supersymmetric particles in channels with one or more photons and missing energy have been performed with data collected by the ALEPH detector at LEP. The data consist of 11.1 pb-1 at sqrt(s)=161 GeV, 1.1 pb-1 at 170 GeV and 9.5 pb-1 at 172 GeV. The e+e--->νν¯γ(γ) cross section is measured. The data are in good agreement with predictions based on the Standard Model, and are used to set upper limits on the cross sections for anomalous photon production. These limits are compared to two different SUSY models and used to set limits on the neutralino mass. A limit of 71 GeV/c2 at 95% C.L. is set on the mass of the lightest neutralino (τχ10<= 3 ns) for the gauge-mediated supersymmetry breaking and LNZ models. © 1998
Stutzki, Fabian; Gaida, Christian; Gebhardt, Martin; Jauregui, Cesar; Limpert, Jens; Tünnermann, Andreas; Pupeza, Ioachim
2017-02-01
Ultrashort-pulse laser systems are an enabling technology for numerous applications. The stability of such systems is especially crucial for frequency metrology and high precision spectroscopy. Thulium-based fiber lasers are an ideal starting point as a reliable and yet powerful source for the nonlinear conversion towards the mid-IR region. Recently, we have demonstrated that nonlinear self-compression in a fused silica solid-core fiber allows for few-cycle pulse duration with up to 24 MW peak power using a high-repetition rate thulium-based fiber laser system operating at around 2 μm wavelength [1]. This experiment operates near the self-focusing limit of about 24 MW for circular polarization, which increases the requirements for the system stability due to the risk of a fiber damage. Here, we present a self-protecting nonlinear compression regime allowing for long-term operation and high output-pulse stability with very similar output performance.
Construction of Tm3+-PVC membrane sensor based on 1-(2-thiazolylazo)-2-naphthol as sensing material
International Nuclear Information System (INIS)
Zamani, Hassan Ali; Nekoei, Mehdi; Mohammadhosseini, Majid; Ganjali, Mohammad Reza
2010-01-01
In this study, a new thulium(III) membrane sensor was constructed. The proposed membrane sensor was fabricated based on a membrane containing 2% sodium tetraphenyl borate (NaTPB) as an anionic additive, 65% benzyl acetate (BA) as solvent mediator, 3% 1-(2-thiazolylazo)-2-naphthol (TN) as ionophore, and 30% poly(vinyl chloride) (PVC). The proposed Tm 3+ electrode exhibits a Nernstian response of 19.5 ± 0.2 mV per decade of thulium concentration, and has a lower detection limit of 8.7 x 10 -7 mol L -1 . The linear range of the sensors was 1.0 x 10 -6 to 1.0 x 10 -2 mol L -1 . It works well in the pH range of 3.2-9.5. Moreover, the recommended selective sensor revealed a comparatively satisfactory selectivity regarding most of the alkali, alkaline earth, some transition and heavy metal ions. The membrane sensor was applied to the determination of fluoride ions in mouth wash samples.
Midro, Alina T; Zollino, Marcella; Wiland, Ewa; Panasiuk, Barbara; Iwanowski, Piotr S; Murdolo, Marina; Śmigiel, Robert; Sąsiadek, Maria; Pilch, Jacek; Kurpisz, Maciej
2016-02-01
The purpose of this study was to compare meiotic segregation in sperm cells from two carriers with t(4;8)(p16;p23.1) reciprocal chromosome translocations (RCTs), differing in localization of the breakpoint positions at the 4p subband-namely, 4p16.3 (carrier 1) and 4p16.1 (carrier 2)-and to compare data of the pedigree analyses performed by direct method. Three-color fluorescent in situ hybridization (FISH) on sperm cells and FISH mapping for the evaluation of the breakpoint positions, data from pedigrees, and direct segregation analysis of the pedigrees were performed. Similar proportions of normal/balanced and unbalanced sperm cells were found in both carriers. The most common was an alternate type of segregation (about 52 % and about 48 %, respectively). Unbalanced adjacent I and adjacent II karyotypes were found in similar proportions about 15 %. The direct segregation analysis (following Stengel-Rutkowski) of the pedigree of carriers of t(4;8)(p16.1;p23.1) was performed and results were compared with the data of the pedigree segregation analysis obtained earlier through the indirect method. The probability of live-born progeny with unbalanced karyotype for carriers of t(4;8)(p16.1;p23.1) was moderately high at 18.8 %-comparable to the value obtained using the indirect method for the same carriership, which was 12 %. This was, however, markedly lower than the value of 41.2 % obtained through the pedigree segregation indirect analysis estimated for carriers of t(4;8)(p16.3;p23.1), perhaps due to the unique composition of genes present within the 4p16.1-4p 16.3 region. Revealed differences in pedigree segregation analysis did not correspond to the very similar profile of meiotic segregation patterns presented by carrier 1 and carrier 2. Most probably, such discordances may be due to differences in embryo survival rates arising from different genetic backgrounds.
Abreu, P; Adye, T; Ajinenko, I; Alekseev, G D; Alemany, R; Allport, P P; Almehed, S; Amaldi, Ugo; Amato, S; Andreazza, A; Andrieux, M L; Antilogus, P; Apel, W D; Åsman, B; Augustin, J E; Augustinus, A; Baillon, Paul; Bambade, P; Barão, F; Barbi, M S; Barbiellini, Guido; Bardin, Dimitri Yuri; Barker, G; Baroncelli, A; Bärring, O; Barrio, J A; Bartl, Walter; Bates, M J; Battaglia, Marco; Baubillier, M; Baudot, J; Becks, K H; Begalli, M; Beillière, P; Belokopytov, Yu A; Belous, K S; Benvenuti, Alberto C; Berggren, M; Bertini, D; Bertrand, D; Besançon, M; Bianchi, F; Bigi, M; Bilenky, S M; Billoir, P; Bizouard, M A; Bloch, D; Blume, M; Bolognese, T; Bonesini, M; Bonivento, W; Booth, P S L; Borisov, G; Bosio, C; Botner, O; Boudinov, E; Bouquet, B; Bourdarios, C; Bowcock, T J V; Bozzo, M; Branchini, P; Brand, K D; Brenke, T; Brenner, R A; Bricman, C; Brown, R C A; Brückman, P; Brunet, J M; Bugge, L; Buran, T; Burgsmüller, T; Buschmann, P; Cabrera, S; Caccia, M; Calvi, M; Camacho-Rozas, A J; Camporesi, T; Canale, V; Canepa, M; Cankocak, K; Cao, F; Carena, F; Carroll, L; Caso, Carlo; Castillo-Gimenez, M V; Cattai, A; Cavallo, F R; Chabaud, V; Charpentier, P; Chaussard, L; Checchia, P; Chelkov, G A; Chen, M; Chierici, R; Chliapnikov, P V; Chochula, P; Chorowicz, V; Cindro, V; Collins, P; Contri, R; Cortina, E; Cosme, G; Cossutti, F; Cowell, J H; Crawley, H B; Crennell, D J; Crosetti, G; Cuevas-Maestro, J; Czellar, S; Dahl-Jensen, Erik; Dahm, J; D'Almagne, B; Dam, M; Damgaard, G; Dauncey, P D; Davenport, Martyn; Da Silva, W; Defoix, C; Deghorain, A; Della Ricca, G; Delpierre, P A; Demaria, N; De Angelis, A; de Boer, Wim; De Brabandere, S; De Clercq, C; La Vaissière, C de; De Lotto, B; De Min, A; De Paula, L S; De Saint-Jean, C; Dijkstra, H; Di Ciaccio, Lucia; Di Diodato, A; Djama, F; Djannati, A; Dolbeau, J; Doroba, K; Dracos, M; Drees, J; Drees, K A; Dris, M; Durand, J D; Edsall, D M; Ehret, R; Eigen, G; Ekelöf, T J C; Ekspong, Gösta; Elsing, M; Engel, J P; Erzen, B; Espirito-Santo, M C; Falk, E; Fassouliotis, D; Feindt, Michael; Fenyuk, A; Ferrer, A; Fichet, S; Filippas-Tassos, A; Firestone, A; Fischer, P A; Föth, H; Fokitis, E; Fontanelli, F; Formenti, F; Franek, B J; Frenkiel, P; Fries, D E C; Frodesen, A G; Frühwirth, R; Fulda-Quenzer, F; Fuster, J A; Galloni, A; Gamba, D; Gandelman, M; García, C; García, J; Gaspar, C; Gasparini, U; Gavillet, P; Gazis, E N; Gelé, D; Gerber, J P; Gerdyukov, L N; Gokieli, R; Golob, B; Gopal, Gian P; Gorn, L; Górski, M; Guz, Yu; Gracco, Valerio; Graziani, E; Green, C; Grefrath, A; Gris, P; Grosdidier, G; Grzelak, K; Gumenyuk, S A; Gunnarsson, P; Günther, M; Guy, J; Hahn, F; Hahn, S; Hajduk, Z; Hallgren, A; Hamacher, K; Harris, F J; Hedberg, V; Henriques, R P; Hernández, J J; Herquet, P; Herr, H; Hessing, T L; Heuser, J M; Higón, E; Hilke, Hans Jürgen; Hill, T S; Holmgren, S O; Holt, P J; Holthuizen, D J; Hoorelbeke, S; Houlden, M A; Hrubec, Josef; Huet, K; Hultqvist, K; Jackson, J N; Jacobsson, R; Jalocha, P; Janik, R; Jarlskog, C; Jarlskog, G; Jarry, P; Jean-Marie, B; Johansson, E K; Jönsson, L B; Jönsson, P E; Joram, Christian; Juillot, P; Kaiser, M; Kapusta, F; Karafasoulis, K; Karlsson, M; Karvelas, E; Katsanevas, S; Katsoufis, E C; Keränen, R; Khokhlov, Yu A; Khomenko, B A; Khovanskii, N N; King, B J; Kjaer, N J; Klapp, O; Klein, H; Klovning, A; Kluit, P M; Kokkinias, P; Konoplyannikov, A K; Koratzinos, M; Korcyl, K; Kostyukhin, V; Kourkoumelis, C; Kuznetsov, O; Krammer, Manfred; Kreuter, C; Kronkvist, I J; Krumshtein, Z; Krupinski, W; Kubinec, P; Kucewicz, W; Kurvinen, K L; Lacasta, C; Laktineh, I; Lamsa, J; Lanceri, L; Lane, D W; Langefeld, P; Laugier, J P; Lauhakangas, R; Leder, Gerhard; Ledroit, F; Lefébure, V; Legan, C K; Leitner, R; Lemonne, J; Lenzen, Georg; Lepeltier, V; Lesiak, T; Libby, J; Liko, D; Lindner, R; Lipniacka, A; Lippi, I; Lörstad, B; Loken, J G; López, J M; Loukas, D; Lutz, P; Lyons, L; MacNaughton, J N; Maehlum, G; Mahon, J R; Malmgren, T G M; Malychev, V; Mandl, F; Marco, J; Marco, R P; Maréchal, B; Margoni, M; Marin, J C; Mariotti, C; Markou, A; Martínez-Rivero, C; Martínez-Vidal, F; Martí i García, S; Matorras, F; Matteuzzi, C; Matthiae, Giorgio; Mazzucato, M; McCubbin, M L; McKay, R; McNulty, R; Medbo, J; Merk, M; Meroni, C; Meyer, S; Meyer, W T; Michelotto, M; Migliore, E; Mirabito, L; Mitaroff, Winfried A; Mjörnmark, U; Moa, T; Møller, R; Mönig, K; Monge, M R; Morettini, P; Müller, H; Münich, K; Mulders, M; Mundim, L M; Murray, W J; Muryn, B; Myatt, Gerald; Naraghi, F; Navarria, Francesco Luigi; Navas, S; Nawrocki, K; Negri, P; Némécek, S; Neumann, W; Neumeister, N; Nicolaidou, R; Nielsen, B S; Nieuwenhuizen, M; Nikolaenko, V; Niss, P; Nomerotski, A; Normand, Ainsley; Novák, M; Oberschulte-Beckmann, W; Obraztsov, V F; Olshevskii, A G; Onofre, A; Orava, Risto; Österberg, K; Ouraou, A; Paganini, P; Paganoni, M; Pagès, P; Pain, R; Palka, H; Papadopoulou, T D; Papageorgiou, K; Pape, L; Parkes, C; Parodi, F; Passeri, A; Pegoraro, M; Peralta, L; Pernicka, Manfred; Perrotta, A; Petridou, C; Petrolini, A; Phillips, H T; Piana, G; Pierre, F; Pimenta, M; Podobnik, T; Podobrin, O; Pol, M E; Polok, G; Poropat, P; Pozdnyakov, V; Privitera, P; Pukhaeva, N; Pullia, Antonio; Radojicic, D; Ragazzi, S; Rahmani, H; Rames, J; Ratoff, P N; Read, A L; Reale, M; Rebecchi, P; Redaelli, N G; Regler, Meinhard; Reid, D; Reinhardt, R; Renton, P B; Resvanis, L K; Richard, F; Richardson, J; Rídky, J; Rinaudo, G; Ripp, I; Romero, A; Roncagliolo, I; Ronchese, P; Roos, L; Rosenberg, E I; Roudeau, Patrick; Rovelli, T; Ruhlmann-Kleider, V; Ruiz, A; Rybicki, K; Saarikko, H; Sacquin, Yu; Sadovskii, A; Sahr, O; Sajot, G; Salt, J; Sánchez, J; Sannino, M; Schimmelpfennig, M; Schneider, H; Schwickerath, U; Schyns, M A E; Sciolla, G; Scuri, F; Seager, P; Sedykh, Yu; Segar, A M; Seitz, A; Sekulin, R L; Serbelloni, L; Shellard, R C; Siegrist, P; Silvestre, R; Simonetti, S; Simonetto, F; Sissakian, A N; Sitár, B; Skaali, T B; Smadja, G; Smirnov, N; Smirnova, O G; Smith, G R; Solovyanov, O; Sosnowski, R; Souza-Santos, D; Spassoff, Tz; Spiriti, E; Sponholz, P; Squarcia, S; Stampfer, D; Stanescu, C; Stanic, S; Stapnes, Steinar; Stavitski, I; Stevenson, K; Stocchi, A; Strauss, J; Strub, R; Stugu, B; Szczekowski, M; Szeptycka, M; Tabarelli de Fatis, T; Tavernet, J P; Chernyaev, E; Thomas, J; Tilquin, A; Timmermans, J; Tkatchev, L G; Todorov, T; Todorova, S; Toet, D Z; Tomaradze, A G; Tomé, B; Tonazzo, A; Tortora, L; Tranströmer, G; Treille, D; Tristram, G; Trombini, A; Troncon, C; Tsirou, A L; Turluer, M L; Tyapkin, I A; Tyndel, M; Tzamarias, S; Überschär, B; Ullaland, O; Uvarov, V; Valenti, G; Vallazza, E; Van der Velde, C; van Apeldoorn, G W; van Dam, P; Van Doninck, W K; Van Eldik, J; Van Lysebetten, A; Vassilopoulos, N; Vegni, G; Ventura, L; Venus, W A; Verbeure, F; Verlato, M; Vertogradov, L S; Vilanova, D; Vincent, P; Vitale, L; Vodopyanov, A S; Vrba, V; Wahlen, H; Walck, C; Weierstall, M; Weilhammer, Peter; Weiser, C; Wetherell, Alan M; Wicke, D; Wickens, J H; Wielers, M; Wilkinson, G R; Williams, W S C; Winter, M; Witek, M; Wlodek, T; Woschnagg, K; Yip, K; Yushchenko, O P; Zach, F; Zaitsev, A; Zalewska-Bak, A; Zalewski, Piotr; Zavrtanik, D; Zevgolatakos, E; Zimin, N I; Zito, M; Zontar, D; Zucchelli, G C; Zumerle, G
1997-01-01
A search for stable or long-lived heavy charged particles in $e^+e^-$ interactions at energies of 130-136, 161 and 172 GeV has been performed using the data taken by the DELPHI experiment at LEP. The search is based on particle identification provided by the Time Projection Chamber and the Ring Imaging Cherenkov detector. Upper limits at 95\\% confidence level are derived on the cross-section for heavy long-lived pair-produced charge $\\pm e$ and $\\pm 2/3e$ particles in the range of 0.4-2.3 pb for masses from 45 to 84 GeV/$c^2$. Within supersymmetric extensions of the Standard Model, long-lived charginos with masses from 45 to 84 (80)~GeV/$c^2$ for high (low) sneutrino masses can be excluded at 95\\% confidence level. %Mass limits for long-lived sleptons are obtained. %For selectrons no general mass limits can be given. Left-handed (right-handed) long-lived or stable smuons and staus with masses between 45 and 68 (65)~GeV/$c^2$ can be excluded at 95\\% confidence level.
Tuning the activity of Pt alloy electrocatalysts by means of the lanthanide contraction
DEFF Research Database (Denmark)
Escribano, Maria Escudero; Malacrida, Paolo; Hansen, Martin Hangaard
2016-01-01
is lanthanum, cerium, samarium, gadolinium, terbium, dysprosium, thulium, or calcium. The materials are among the most active polycrystalline Pt-based catalysts reported, presenting activity enhancement by a factor of 3 to 6 over Pt. The active phase consists of a Pt overlayer formed by acid leaching. The ORR...
Tm-Yb Doped Optical Fiber Performance with Variation of Host-Glass Composition
Directory of Open Access Journals (Sweden)
Anirban Dhar
2014-01-01
Full Text Available The fabrication process of Thulium-Ytterbium doped optical fiber comprising different host glass through the Modified Chemical Vapor Deposition (MCVD coupled with solution doping technique is presented. The material and optical performance of different fibers are compared with special emphasis on their lasing efficiency for 2 µm application.
Temperature dependence of the absorption coefficient of water for midinfrared laser radiation
Jansen, E. D.; van Leeuwen, T. G.; Motamedi, M.; Borst, C.; Welch, A. J.
1994-01-01
The dynamics of the water absorption peak around 1.94 microns was examined. This peak is important for the absorption of holmium and thulium laser radiation. To examine the effect of temperature on the absorption coefficient, the transmission of pulsed Ho:YAG, Ho:YAG, Ho:YSGG, and Tm:YAG laser
International Nuclear Information System (INIS)
Toerne, E. von
1998-07-01
A search for the Standard Model Higgs boson using data from e + e - collisions collected at center-of-mass energies from 161 to 184 GeV with the OPAL detector at LEP is presented. The search is applied to events in the four-jet-channel, in which the Higgs boson decays into a bb pair and the associated Z 0 decays into quark and anti-quark. The data analyzed corresponds to an integrated luminosity of 75.0 pb -1 . Five candidate events are observed, in agreement with the Standard Model background expectation of 6.61±0.42 (stat.) ±1.72 (syst.) events. A lower limit of 74.0 GeV is derived for the mass of the Standard Model Higgs boson at the 95% confidence level. In combination with OPAL searches in other channels a limit of 86.9 GeV is obtained. (orig.)
Fan, Mei; Gong, Ren Rong; Lin, Jia; Jiang, Zhe; Li, Yuan Hao; Zhang, Rong Rong; Fang, Ding Zhi
2014-01-01
Changes in the ratios of plasma lipids and apolipoproteins may be associated with diets and the C161T polymorphism in the gene of peroxisome proliferators activated receptor gamma (PPARgamma). As a result, this study was to investigate the effects of this polymorphism on changes of the ratios induced by a high-carbohydrate (high-CHO) diet. After a washout diet of 54% carbohydrate for 7 days, 56 healthy young adults (22.89 +/- 1.80 years old) were given the high-CHO diet of 70% carbohydrate for 6 days. Height, weight, waist circumference (WC), glucose, triglyceride (TG), total cholesterol (TC), low-density lipoprotein cholesterol (LDL-C), high-density lipoprotein cholesterol (HDL-C), apolipoprotein (apo) AI, and apoB100 at baseline and before and after the high-CHO diet were measured. Body mass index (BMI), TG/HDL-C, log (TG/HDL-C), TC/HDL-C, LDL-C/HDL-C, and apoB100/apoAI were calculated. PPARgamma C161T was detected by a PCR-RFLP method. The relationship between the polymorphism and the ratios were analyzed. The female T carriers had higher BMI and WC than the female CC homozygotes at baseline and before and after the diet, higher glucose, TG/HDL-C and log (TG/HDL-C) before the diet. In males, when compared to the T carriers, the CC homozygotes had higher TG/HDL-C, log (TG/HDL-C) and apoB100/apoAI at baseline and before and after the diet, higher glucose at baseline, higher LDL-C/HDL-C and TC/HDL-C before and after the diet. Compared with those before the high-CHO diet, TC/HDL-C and LDL-C/HDL-C decreased after the diet regardless of gender and the genotypes. Decreased BMI and WC were observed in the male CC homozygotes but only decreased BMI in the female T carriers. Notably, decreased apoB100/apoAI was observed in the male T carriers, while elevated TG/HDL-C and log (TG/HDL-C) in the female CC homozygotes, and reduced glucose in the female T carriers. The results suggest that the interplay of gender, the PPARgamma C161T polymorphism and the high-CHO diet can
Complications of laser enucleation of the prostate: Results at two institutions
Directory of Open Access Journals (Sweden)
Chu-Hao Weng
2017-12-01
Conclusion: Laser enucleation of the prostate was a safe treatment with low significant complication rate, even for large-volume prostates. The complication rates between diode and thulium lasers were not significantly different. The reoperation rate of laser enucleation was very low but patients with extremely large prostate volume may have higher risk.
Mahmood, Khalid
2015-06-01
Significant efficiency improvements are reported in mesoscopic perovskite solar cells based on the development of a low-temperature solution-processed ZnO nanorod (NR) array exhibiting higher NR aspect ratio, enhanced electron density, and substantially reduced work function than conventional ZnO NRs. These features synergistically result in hysteresis-free, scan-independent, and stabilized devices with an efficiency of 16.1%. Electron-rich, nitrogen-doped ZnO (N:ZnO) NR-based electron transporting materials (ETMs) with enhanced electron mobility produced using ammonium acetate show consistently higher efficiencies by one to three power points than undoped ZnO NRs. Additionally, the preferential electrostatic interaction between the -nonpolar facets of N:ZnO and the conjugated polyelectrolyte polyethylenimine (PEI) has been relied on to promote the hydrothermal growth of high aspect ratio NR arrays and substantially improve the infiltration of the perovskite light absorber into the ETM. Using the same interactions, a conformal PEI coating on the electron-rich high aspect ratio N:ZnO NR arrays is -successfully applied, resulting in a favorable work function shift and altogether leading to the significant boost in efficiency from <10% up to >16%. These results largely surpass the state-of-the-art PCE of ZnO-based perovskite solar cells and highlight the benefits of synergistically combining mesoscale control with doping and surface modification. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Epidemiologia e distribuição de lesões extrarrenais de uremia em 161 cães
Directory of Open Access Journals (Sweden)
Isadora P. Silveira
2015-06-01
Full Text Available Resumo: Com o objetivo de determinar a epidemiologia e as características morfológicas, incluindo a localização anatômica, das lesões extrarrenais de uremia, bem como determinar as principais lesões do sistema urinário associadas à ocorrência de uremia, foram revisados os protocolos de necropsias de cães realizadas no Laboratório de Patologia Veterinária da Universidade Federal de Santa Maria de janeiro de 1996 a dezembro de 2012 (17 anos. Nesse período foram necropsiados 4.201 cães, sendo que 161 (3,8% apresentaram lesões extrarrenais de uremia. Em 134 cães (83,2% foram descritos sinais clínicos associados à uremia. As lesões extrarrenais mais frequentes, em ordem decrescente, foram: gastrite ulcerativa e hemorrágica (56,5%, mineralização de tecidos moles (55,9%, edema pulmonar (47,2%, estomatite e/ou glossite ulcerativa (30,4%, endocardite/trombose atrial e aórtica (28,6%, hiperplasia das paratireoides (9,3%, osteodistrofia fibrosa (8,1%, anemia (6,2%, laringite ulcerativa (5%, enterite ulcerativa/hemorrágica (3,7%, esofagite fibrinonecrótica (1,9% e pericardite fibrinosa (1.9%. Na maioria dos casos as lesões extrarrenais de uremia foram decorrentes de azotemia prolongada por lesões renais graves, sendo as mais prevalentes a nefrite intersticial e a glomerulonefrite.
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; Alessandro, R D; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Lee, H J; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Mil, A J W; Milcent, H; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1998-01-01
Events characterised by large hadronic energy and transverse momentum are selected from the data collected by the L3 detector at LEP at centre-of-mass energies between 161 and 172 GeV, corresponding to an integrated luminosity of 21 $\\rm pb^{-1}$. The visible mass and the missing mass distributions of the selected events are consistent with those expected from Standard Model processes. This result is combined with that from data taken at the Z resonance to set an upper limit on the production rate and decay into invisible final states of a non-minimal Higgs boson, as a function of the Higgs mass. Assuming the non-minimal Higgs production cross section to be the same as for the Standard Model Higgs boson and the decay branching fraction into invisible final states to be 100\\%, a Higgs mass lower limit of 69.6 GeV is derived at 95\\% confidence level.
Acciarri, M; Aguilar-Benítez, M; Ahlen, S P; Alcaraz, J; Alemanni, G; Allaby, James V; Aloisio, A; Alverson, G; Alviggi, M G; Ambrosi, G; Anderhub, H; Andreev, V P; Angelescu, T; Anselmo, F; Arefev, A; Azemoon, T; Aziz, T; Bagnaia, P; Baksay, L; Banerjee, S; Banerjee, Sw; Banicz, K; Barczyk, A; Barillère, R; Barone, L; Bartalini, P; Baschirotto, A; Basile, M; Battiston, R; Bay, A; Becattini, F; Becker, U; Behner, F; Berdugo, J; Berges, P; Bertucci, B; Betev, B L; Bhattacharya, S; Biasini, M; Biland, A; Bilei, G M; Blaising, J J; Blyth, S C; Bobbink, Gerjan J; Böck, R K; Böhm, A; Boldizsar, L; Borgia, B; Bourilkov, D; Bourquin, Maurice; Braccini, S; Branson, J G; Brigljevic, V; Brock, I C; Buffini, A; Buijs, A; Burger, J D; Burger, W J; Busenitz, J K; Button, A M; Cai, X D; Campanelli, M; Capell, M; Cara Romeo, G; Carlino, G; Cartacci, A M; Casaus, J; Castellini, G; Cavallari, F; Cavallo, N; Cecchi, C; Cerrada-Canales, M; Cesaroni, F; Chamizo-Llatas, M; Chang, Y H; Chaturvedi, U K; Chekanov, S V; Chemarin, M; Chen, A; Chen, G; Chen, G M; Chen, H F; Chen, H S; Chéreau, X J; Chiefari, G; Chien, C Y; Cifarelli, Luisa; Cindolo, F; Civinini, C; Clare, I; Clare, R; Cohn, H O; Coignet, G; Colijn, A P; Colino, N; Commichau, V; Costantini, S; Cotorobai, F; de la Cruz, B; Csilling, Akos; Dai, T S; D'Alessandro, R; De Asmundis, R; Degré, A; Deiters, K; Della Volpe, D; Denes, P; De Notaristefani, F; DiBitonto, Daryl; Diemoz, M; Van Dierendonck, D N; Di Lodovico, F; Dionisi, C; Dittmar, Michael; Dominguez, A; Doria, A; Dova, M T; Duchesneau, D; Duinker, P; Durán, I; Dutta, S; Easo, S; Efremenko, Yu V; El-Mamouni, H; Engler, A; Eppling, F J; Erné, F C; Ernenwein, J P; Extermann, Pierre; Fabre, M; Faccini, R; Falciano, S; Favara, A; Fay, J; Fedin, O; Felcini, Marta; Fenyi, B; Ferguson, T; Ferroni, F; Fesefeldt, H S; Fiandrini, E; Field, J H; Filthaut, Frank; Fisher, P H; Fisk, I; Forconi, G; Fredj, L; Freudenreich, Klaus; Furetta, C; Galaktionov, Yu; Ganguli, S N; García-Abia, P; Gau, S S; Gentile, S; Gheordanescu, N; Giagu, S; Goldfarb, S; Goldstein, J; Gong, Z F; Gougas, Andreas; Gratta, Giorgio; Grünewald, M W; Gupta, V K; Gurtu, A; Gutay, L J; Hartmann, B; Hasan, A; Hatzifotiadou, D; Hebbeker, T; Hervé, A; Van Hoek, W C; Hofer, H; Hong, S J; Hoorani, H; Hou, S R; Hu, G; Innocente, Vincenzo; Jenkes, K; Jin, B N; Jones, L W; de Jong, P; Josa-Mutuberria, I; Kasser, A; Khan, R A; Kamrad, D; Kamyshkov, Yu A; Kapustinsky, J S; Karyotakis, Yu; Kaur, M; Kienzle-Focacci, M N; Kim, D; Kim, D H; Kim, J K; Kim, S C; Kim, Y G; Kinnison, W W; Kirkby, A; Kirkby, D; Kirkby, Jasper; Kiss, D; Kittel, E W; Klimentov, A; König, A C; Kopp, A; Korolko, I; Koutsenko, V F; Krämer, R W; Krenz, W; Kunin, A; Ladrón de Guevara, P; Laktineh, I; Landi, G; Lapoint, C; Lassila-Perini, K M; Laurikainen, P; Lebeau, M; Lebedev, A; Lebrun, P; Lecomte, P; Lecoq, P; Le Coultre, P; Le Goff, J M; Leiste, R; Leonardi, E; Levchenko, P M; Li Chuan; Lin, C H; Lin, W T; Linde, Frank L; Lista, L; Liu, Z A; Lohmann, W; Longo, E; Lu, W; Lü, Y S; Lübelsmeyer, K; Luci, C; Luckey, D; Luminari, L; Lustermann, W; Ma Wen Gan; Maity, M; Majumder, G; Malgeri, L; Malinin, A; Maña, C; Mangeol, D J J; Mangla, S; Marchesini, P A; Marin, A; Martin, J P; Marzano, F; Massaro, G G G; McNally, D; McNeil, R R; Mele, S; Merola, L; Meschini, M; Metzger, W J; Von der Mey, M; Mi, Y; Mihul, A; Van Mil, A J W; Mirabelli, G; Mnich, J; Molnár, P; Monteleoni, B; Moore, R; Morganti, S; Moulik, T; Mount, R; Müller, S; Muheim, F; Muijs, A J M; Nahn, S; Napolitano, M; Nessi-Tedaldi, F; Newman, H; Niessen, T; Nippe, A; Nisati, A; Nowak, H; Oh, Yu D; Opitz, H; Organtini, G; Ostonen, R; Palomares, C; Pandoulas, D; Paoletti, S; Paolucci, P; Park, H K; Park, I H; Pascale, G; Passaleva, G; Patricelli, S; Paul, T; Pauluzzi, M; Paus, C; Pauss, Felicitas; Peach, D; Pei, Y J; Pensotti, S; Perret-Gallix, D; Petersen, B; Petrak, S; Pevsner, A; Piccolo, D; Pieri, M; Pinto, J C; Piroué, P A; Pistolesi, E; Plyaskin, V; Pohl, M; Pozhidaev, V; Postema, H; Produit, N; Prokofev, D; Prokofiev, D O; Rahal-Callot, G; Raja, N; Rancoita, P G; Rattaggi, M; Raven, G; Razis, P A; Read, K; Ren, D; Rescigno, M; Reucroft, S; Van Rhee, T; Riemann, S; Riles, K; Robohm, A; Rodin, J; Roe, B P; Romero, L; Rosier-Lees, S; Rosselet, P; Van Rossum, W; Roth, S; Rubio, Juan Antonio; Ruschmeier, D; Rykaczewski, H; Salicio, J; Sánchez, E; Sanders, M P; Sarakinos, M E; Sarkar, S; Sassowsky, M; Schäfer, C; Shchegelskii, V; Schmidt-Kärst, S; Schmitz, D; Schmitz, P; Scholz, N; Schopper, Herwig Franz; Schotanus, D J; Schwenke, J; Schwering, G; Sciacca, C; Sciarrino, D; Servoli, L; Shevchenko, S; Shivarov, N; Shoutko, V; Shukla, J; Shumilov, E; Shvorob, A V; Siedenburg, T; Son, D; Sopczak, André; Smith, B; Spillantini, P; Steuer, M; Stickland, D P; Stone, A; Stone, H; Stoyanov, B; Strässner, A; Strauch, K; Sudhakar, K; Sultanov, G G; Sun, L Z; Susinno, G F; Suter, H; Swain, J D; Tang, X W; Tauscher, Ludwig; Taylor, L; Ting, Samuel C C; Ting, S M; Tonutti, M; Tonwar, S C; Tóth, J; Tully, C; Tuchscherer, H; Tung, K L; Uchida, Y; Ulbricht, J; Uwer, U; Valente, E; Van de Walle, R T; Vesztergombi, G; Vetlitskii, I; Viertel, Gert M; Vivargent, M; Völkert, R; Vogel, H; Vogt, H; Vorobev, I; Vorobyov, A A; Vorvolakos, A; Wadhwa, M; Wallraff, W; Wang, J C; Wang, X L; Wang, Z M; Weber, A; Wittgenstein, F; Wu, S X; Wynhoff, S; Xu, J; Xu, Z Z; Yang, B Z; Yang, C G; Yao, X Y; Ye, J B; Yeh, S C; You, J M; Zalite, A; Zalite, Yu; Zemp, P; Zeng, Y; Zhang, Z; Zhang, Z P; Zhou, B; Zhu, G Y; Zhu, R Y; Zichichi, Antonino; Ziegler, F
1997-01-01
A search for unstable neutral and charged heavy leptons as well as for stable charged heavy leptons has been made at center-of-mass energies $\\sqrt{s}$ = 161 GeV and $\\sqrt{s}$ = 172 GeV with the L3 detector at LEP. No evidence for their existence was found. We exclude unstable neutral leptons of Dirac (Majorana) type for masses below 78.0 (66.7), 78.0 (66.7) and 72.2 (58.2) GeV, if the heavy neutrino couples to the electron, muon or tau family, respectively. We exclude unstable charged heavy leptons for masses below 81.0 GeV for a wide mass range of the associated neutral heavy lepton. The production of stable charged heavy leptons with a mass less than 84.2 GeV is also excluded. If the unstable charged heavy lepton decays via mixing into a massless neutrino, we exclude masses below 78.7 GeV.
Comparative laser-tissue interaction effects at 1.96 and 2.01 um of Cr; Tm:YAG laser
Pankratov, Michail M.; Perrault, Donald F., Jr.; Shapshay, Stanley M.; Pinto, Joseph F.; Esterowitz, Dina; Aretz, H. Thomas
1992-08-01
A pulsed spiking and nonspiking Cr; thulium (Tm):YAG flash lamp pumped laser operating at 1.96 and 2.01 μm was investigated in vitro in the clinically relevant power range for its basic laser-tissue interaction with soft, cartilaginous, and bone tissues. Some explanations of the differences and possible medical applications are discussed.
Energy Technology Data Exchange (ETDEWEB)
Zamani, Hassan Ali, E-mail: haszamani@yahoo.com [Department of Applied Chemistry, Quchan Branch, Islamic Azad University, Quchan (Iran, Islamic Republic of); Nekoei, Mehdi; Mohammadhosseini, Majid [Department of Chemistry, Faculty of Basic Sciences, Shahrood Branch, Islamic Azad University, Shahrood (Iran, Islamic Republic of); Ganjali, Mohammad Reza [Center of Excellence in Electrochemistry, Faculty of Chemistry, University of Tehran, Tehran (Iran, Islamic Republic of); Medical Nanotechnology Research Centre, Tehran University of Medical Sciences, Tehran, P.O. Box, 14155-6451 (Iran, Islamic Republic of)
2010-04-06
In this study, a new thulium(III) membrane sensor was constructed. The proposed membrane sensor was fabricated based on a membrane containing 2% sodium tetraphenyl borate (NaTPB) as an anionic additive, 65% benzyl acetate (BA) as solvent mediator, 3% 1-(2-thiazolylazo)-2-naphthol (TN) as ionophore, and 30% poly(vinyl chloride) (PVC). The proposed Tm{sup 3+} electrode exhibits a Nernstian response of 19.5 {+-} 0.2 mV per decade of thulium concentration, and has a lower detection limit of 8.7 x 10{sup -7} mol L{sup -1}. The linear range of the sensors was 1.0 x 10{sup -6} to 1.0 x 10{sup -2} mol L{sup -1}. It works well in the pH range of 3.2-9.5. Moreover, the recommended selective sensor revealed a comparatively satisfactory selectivity regarding most of the alkali, alkaline earth, some transition and heavy metal ions. The membrane sensor was applied to the determination of fluoride ions in mouth wash samples.
African Journals Online (AJOL)
Fr. Ikenga
the definition limits the understanding of a region to a country and does not in any way ..... in Nigeria under the Presidential Constitution (London: Sweet & Maxwell, 1983) pp. .... Sani Abacha & 3 Ors. v Chief Gani Fawehinmi.78 In that case, the.
Phonon-induced quadrupolar ordering of the magnetic superconductor TmNi2B2C
DEFF Research Database (Denmark)
Andersen, N.H.; Jensen, J.; Jensen, T.B.S.
2006-01-01
We present synchrotron x-ray diffraction studies revealing that the lattice of thulium borocarbide is distorted below T(Q)similar or equal to 13.5 K at zero field. T-Q increases and the amplitude of the displacements is drastically enhanced by a factor of 10 at 60 kOe when a magnetic field is app...
Monolithic tm-doped fiber laser at 1951 nm with deep-UV femtosecond-induced FBG pair
Czech Academy of Sciences Publication Activity Database
Peterka, Pavel; Honzátko, Pavel; Becker, M.; Todorov, Filip; Písařík, M.; Podrazký, Ondřej; Kašík, Ivan
2013-01-01
Roč. 25, č. 16 (2013), s. 1623-1625 ISSN 1041-1135 R&D Projects: GA ČR GAP205/11/1840; GA ČR GAP102/10/2139; GA MPO FR-TI4/734 Institutional support: RVO:67985882 Keywords : fiber Bragg gratings * fiber lasers * Thulium Subject RIV: JA - Electronics ; Optoelectronics, Electrical Engineering Impact factor: 2.176, year: 2013
Abdallah, J.; Adam, W.; Adzic, P.; Albrecht, T.; Alemany-Fernandez, R.; Allmendinger, T.; Allport, P.P.; Amaldi, U.; Amapane, N.; Amato, Sandra F.; Anashkin, E.; Andreazza, A.; Andringa, Sofia; Anjos, N.; Antilogus, Pierre; Apel, W-D.; Arnoud, Y.; Ask, S.; Asman, B.; Augustin, Jean-Eudes; Augustinus, A.; Baillon, P.; Ballestrero, A.; Bambade, P.; Barbier, R.; Bardin, D.; Barker, G.J.; Baroncelli, Antonio; Battaglia, Marco; Baubillier, M.; Becks, K-H.; Begalli, M.; Behrmann, A.; Ben-Haim, Eli; Benekos, N.; Benvenuti, A.; Berat, C.; Berggren, Mikael; Bertrand, D.; Besancon, Marc; Besson, N.; Bloch, Daniel; Blom, M.; Bluj, Michal; Bonesini, Maurizio; Boonekamp, M.; Booth, PSL; Borisov, G.; Botner, Olga; Bouquet, B.; Bowcock, T.J.V.; Boyko, I.; Bracko, Marko; Brenner, R.; Brodet, E.; Bruckman, P.; Brunet, J.M.; Buschbeck, B.; Buschmann, P.; Calvi, M.; Camporesi, Tiziano; Canale, V.; Carena, F.; Castro, Nuno Filipe; Cavallo, F.; Chapkin, M.; Charpentier, Ph.; Checchia, Paolo; Chierici, R.; Chliapnikov, P.; Chudoba, J.; Chung, Suh-Urk; Cieslik, K.; Collins, P.; Contri, Roberto; Cosme, G.; Cossutti, Fabio; Costa, M.J.; Crennell, D.; Cuevas, Javier; D'Hondt, J.; da Silva, T.; Da Silva, W.; Della Ricca, Giuseppe; De Angelis, Alessandro; De Boer, W.; De Clercq, C.; De Lotto, Barbara; De Maria, N.; De Min, A.; de Paula, L.; Di Ciaccio, L.; Di Simone, A.; Doroba, K.; Duperrin, A.; Eigen, G.; Ekelof, Tord; Ellert, Mattias; Elsing, M.; Espirito Santo, Maria Catarina; Fanourakis, George K.; Feindt, Michael; Fernandez, J.; Ferrer, Antonio; Ferro, F.; Flagmeyer, U.; Foeth, H.; Fokitis, E.; Fulda-Quenzer, F.; Fuster, J.; Gandelman, Miriam; Garcia, C.; Gavillet, Philippe; Gazis, Evangelos; Gomez-Ceballos, G.; Goncalves, P.; Graziani, E.; Grosdidier, G.; Grzelak, K.; Guy, J.; Haag, C.; Hallgren, A.; Hamacher, Klaus; Hamilton, K.; Haug, S.; Hauler, F.; Hedberg, Vincent; Hennecke, M.; Herr, H.; Hoffman, J.; Holmgren, S-O.; Holt, P.J.; Houlden, M.A.; Jackson, John Neil; Jarlskog, Goran; Jarry, P.; Jeans, D.; Johansson, Erik Karl; Jonsson, P.; Joram, C.; Jungermann, L.; Kapusta, Frederic; Katsanevas, S.; Katsoufis, E.; Kernel, Gabrijel; Kerzel, U.; King, B.T.; Kjaer, N.J.; Kluit, Peter; Kokkinias, P.; Kourkoumelis, C.; Kouznetsov, O.; Krumstein, Z.; Kucharczyk, M.; Lamsa, J.; Leder, G.; Ledroit, F.; Leinonen, L.; Leitner, R.; Lemonne, Jacques; Lepeltier, V.; Lesiak, T.; Liebig, W.; Liko, D.; Lipniacka, A.; Lopes, J.H.; Lopez, J.M.; Loukas, D.; Lutz, Pierre; Lyons, Louis; MacNaughton, J.; Malek, A.; Maltezos, S.; Mandl, F.; Marco, J.; Marco, R.; Marechal, B.; Margoni, M.; Marin, J-C.; Mariotti, C.; Markou, A.; Martinez-Rivero, C.; Masik, J.; Mastroyiannopoulos, N.; Matorras, F.; Matteuzzi, C.; Mazzucato, F.; Mazzucato, M.; Nulty, R.Mc; Meroni, C.; Migliore, E.; Mitaroff, W.; Mjoernmark, U.; Moa, T.; Moch, M.; Monge, R.; Montenegro, J.; Moraes, D.; Moreno, S.; Morettini, P.; Muller, Ulrich; Muenich, K.; Mulders, M.; Mundim Filho, Luiz Martins; Murray, W.; Muryn, B.; Myatt, G.; Myklebust, T.; Nassiakou, M.; Navarria, F.; Nawrocki, K.; Nicolaidou, R.; Oblakowska-Mucha, A.; Obraztsov, V.; Olshevski, A.; Onofre, A.; Orava, R.; Osterberg, K.; Ouraou, A.; Oyanguren, A.; Paganoni, M.; Paiano, S.; Palacios, J.P.; Palka, Henryk; Papadopoulou, Th.D.; Pape, L.; Parkes, C.; Parodi, F.; Parzefall, U.; Passeri, A.; Passon, O.; Peralta, L.; Perepelitsa, V.; Perrotta, Andrea; Petrolini, Alessandro; Piedra, Jonatan; Pieri, L.; Pierre, Francois; Pimenta, M.; Piotto, E.; Poireau, V.; Pol, M.E.; Polok, G.; Pozdniakov, V.; Pukhaeva, N.; Pullia, A.; Radojicic, D.; Rames, J.; Read, A.; Rebecchi, P.; Rehn, J.; Reid, D.; Reinhardt, R.; Renton, Peter; Richard, F.; Ridky, Jan; Rivero, M.; Rodriguez, D.; Romero, A.; Ronchese, Paolo; Roudeau, P.; Rovelli, T.; Ruhlmann, Vanina; Ryabtchikov, D.; Sadovsky, A.; Salmi, L.; Salt, J.; Sander, C.; Savoy-Navarro, A.; Schwickerath, U.; Segar, A.; Sekulin, R.; Siebel, Martin; Simard, L.; Sisakian, A.; Smadja, G.; Smirnova, O.; Sokolov, Andrei Valerevich; Sopczak, A.; Sosnowski, R.; Spassov, T.; Stanitzki, M.; Stocchi, A.; Strauss, J.; Stugu, B.; Szczekowski, M.; Szeptycka, M.; Szumlak, T.; Tabarelli de Fatis, T.; Taffard, A.C.; Tegenfeldt, F.; Thomas, J.; Timmermans, Jan; Tkatchev, L.; Tobin, M.; Todorovova, S.; Tome, B.; Tonazzo, A.; Tortosa, P.; Travnicek, Petr; Treille, D.; Tristram, G.; Trochimczuk, M.; Troncon, Clara; Turluer, M-L.; Tyapkin, I.A.; Tyapkin, P.; Tzamarias, S.; Uvarov, V.; Valenti, Giovanni; Van Dam, P.; Van Eldik, J.; van Remortel, N.; Van Vulpen, I.; Vegni, G.; Veloso, Filipe; Venus, W.; Verdier, Patrice; Verzi, V.; Vilanova, D.; Vitale, Lorenzo; Vrba, V.; Wahlen, H.; Washbrook, A.J.; Weiser, C.; Wicke, D.; Wickens, J.; Wilkinson, G.; Winter, M.; Witek, M.; Yushchenko, O.; Zalewska, A.; Zalewski, P.; Zavrtanik, Danilo; Zhuravlov, V.; Zimine, N.I.; Zintchenko, Alexandre
2008-01-01
A measurement of the W boson mass and width has been performed by the DELPHI collaboration using the data collected during the full LEP2 programme (1996-2000). The data sample has an integrated luminosity of 660 pb^-1 and was collected over a range of centre-of-mass energies from 161 to 209 GeV. Results are obtained by applying the method of direct reconstruction of the mass of the W from its decay products in both the W+W- -> lvqq and W+W- -> qqqq channels. The W mass result for the combined data set is M_W = 80.336 +/- 0.055 (Stat.) +/- 0.028 (Syst.) +/- 0.025 (FSI) +/- 0.009 (LEP) GeV/c^2, where FSI represents the uncertainty due to final state interaction effects in the qqqq channel, and LEP represents that arising from the knowledge of the collision energy of the accelerator. The combined value for the W width is Gamma_W = 2.404 +/- 0.140 (Stat.) +/- 0.077 (Syst.) +/- 0.065 (FSI) GeV/c^2. These results supersede all values previously published by the DELPHI collaboration. This paper is dedicated to the m...
Thulium doped crystals for quantum information storage
Energy Technology Data Exchange (ETDEWEB)
Lauro, R., E-mail: romain.lauro@lac.u-psud.f [Laboratoire Aime Cotton, CNRS-UPR 3321, Univ Paris Sud, Batiment 505, 91405 Orsay cedex (France); Ruggiero, J.; Louchet, A.; Alexander, A.; Chaneliere, T.; Lorgere, I.; Bretenaker, F.; Goldfarb, F.; Le Gouet, J.-L. [Laboratoire Aime Cotton, CNRS-UPR 3321, Univ Paris Sud, Batiment 505, 91405 Orsay cedex (France)
2009-12-15
Optically driving nuclear spin waves in a Tm:YAG crystal, we experimentally demonstrate the feasibility of a three-level {Lambda} system in this material, which is a foundation step in the prospect of quantum memory investigations. Varying the spin state splitting with an external magnetic field, we show that the nuclear spin coherence lifetime remains close to 350mus over a wide range of variation of this splitting. Finally, we demonstrate fast coherent population transfer between the spin states.
Maletz, J.; Zabolotnyy, V. B.; Evtushinsky, D. V.; Yaresko, A. N.; Kordyuk, A. A.; Shermadini, Z.; Luetkens, H.; Sedlak, K.; Khasanov, R.; Amato, A.; Krzton-Maziopa, A.; Conder, K.; Pomjakushina, E.; Klauss, H.-H.; Rienks, E. D. L.; Büchner, B.; Borisenko, S. V.
2013-10-01
In this study, we investigate the electronic and magnetic properties of Rb0.77Fe1.61Se2 (Tc = 32.6 K) in normal and superconducting states by means of photoemission and μSR spectroscopies as well as band-structure calculations. We demonstrate that the unusual behavior of these materials is the result of separation into metallic (˜12%) and insulating (˜88%) phases. Only the former becomes superconducting and has a usual electronic structure of electron-doped FeSe slabs. Our results thus imply that the antiferromagnetic insulating phase is just a by-product of Rb intercalation and its magnetic properties have no direct relation to the superconductivity. Instead, we find that also in this class of iron-based compounds, the key ingredient for superconductivity is a certain proximity of a Van Hove singularity to the Fermi level.
Generation of bound states of pulses in a SESAM mode-locked Cr:ZnSe laser
Bu, Xiangbao; Shi, Yuhang; Xu, Jia; Li, Huijuan; Wang, Pu
2018-06-01
We report on the generation of bound states of pulses in a SESAM mode-locked Cr:ZnSe laser around 2415 nm. A thulium-doped double-clad fiber laser at 1908 nm was used as the pump source. Bound states with various pulse separations at different dispersion regimes were obtained. Especially, in the anomalous dispersion regime, vibrating bound state of solitons exhibiting an evolving phase was obtained.
Improvements in x-ray image converters and phosphors
International Nuclear Information System (INIS)
Rabatin, J.G.
1981-01-01
Improvements to an X-ray image converter comprising crystals of rare earth phosphor admixtures are described. The phosphor admixtures utilize thulium-activated lanthanum and/or gadolinium oxyhalide phosphor material to increase the relative speed and resolution of an X-ray image compared with conventional rare earth phosphors. Examples of various radiographic screens containing one or more of the phosphor materials are given. (U.K.)
Energy Technology Data Exchange (ETDEWEB)
Kim, Dong Wook; Kim, Hyoung Jung; Kim, Kyung Won; Byun, Jae Ho; Kim, So Yeon [University of Ulsan College of Medicine, Department of Radiology and Research Institute of Radiology, Asan Medical Center, Seoul (Korea, Republic of); Song, Ki Byung [University of Ulsan College of Medicine, Department of Surgery, Asan Medical Center, Seoul (Korea, Republic of); Ramaiya, Nikhil H.; Tirumani, Sree Harsha [Harvard Medical School, Department of Imaging, Dana-Farber Cancer Institute, Brigham and Women' s Hospital, Boston, MA (United States); Hong, Seung-Mo [University of Ulsan College of Medicine, Department of Pathology, Asan Medical Center, Seoul (Korea, Republic of)
2016-05-15
To evaluate the prognostic value of CT to predict recurrence-free and overall survival in patients with pancreatic neuroendocrine neoplasms (PanNENs). Between January 2004 and December 2012, 161 consecutive patients who underwent preoperative triphasic CT and surgical resection with curative intent for PanNENs were identified. The tumour consistency, margin, presence of calcification, pancreatic duct dilatation, bile duct dilatation, vascular invasion, and hepatic metastases were evaluated. The tumour size, arterial enhancement ratio, and portal enhancement ratio were measured. The Cox proportional hazard model was used to determine the association between CT features and recurrence-free survival and overall survival. By multivariate analysis, tumour size (>3 cm) (hazard ratio, 3.314; p = 0.006), portal enhancement ratio (≤1.1) (hazard ratio, 2.718; p = 0.006), and hepatic metastases (hazard ratio, 4.374; p = 0.003) were independent significant variables for worse recurrence-free survival. Portal enhancement ratio (≤1.1) (hazard ratio, 5.951; p = 0.001) and hepatic metastases (hazard ratio, 4.122; p = 0.021) were independent significant variables for worse overall survival. Portal enhancement ratio (≤1.1) and hepatic metastases assessed on CT were common independent prognostic factors for worse recurrence-free survival and overall survival in patients with PanNENs. (orig.)
International Nuclear Information System (INIS)
Kim, Dong Wook; Kim, Hyoung Jung; Kim, Kyung Won; Byun, Jae Ho; Kim, So Yeon; Song, Ki Byung; Ramaiya, Nikhil H.; Tirumani, Sree Harsha; Hong, Seung-Mo
2016-01-01
To evaluate the prognostic value of CT to predict recurrence-free and overall survival in patients with pancreatic neuroendocrine neoplasms (PanNENs). Between January 2004 and December 2012, 161 consecutive patients who underwent preoperative triphasic CT and surgical resection with curative intent for PanNENs were identified. The tumour consistency, margin, presence of calcification, pancreatic duct dilatation, bile duct dilatation, vascular invasion, and hepatic metastases were evaluated. The tumour size, arterial enhancement ratio, and portal enhancement ratio were measured. The Cox proportional hazard model was used to determine the association between CT features and recurrence-free survival and overall survival. By multivariate analysis, tumour size (>3 cm) (hazard ratio, 3.314; p = 0.006), portal enhancement ratio (≤1.1) (hazard ratio, 2.718; p = 0.006), and hepatic metastases (hazard ratio, 4.374; p = 0.003) were independent significant variables for worse recurrence-free survival. Portal enhancement ratio (≤1.1) (hazard ratio, 5.951; p = 0.001) and hepatic metastases (hazard ratio, 4.122; p = 0.021) were independent significant variables for worse overall survival. Portal enhancement ratio (≤1.1) and hepatic metastases assessed on CT were common independent prognostic factors for worse recurrence-free survival and overall survival in patients with PanNENs. (orig.)
Development of blood irradiators
International Nuclear Information System (INIS)
Anon.
1981-01-01
This project is designed to improve the techniques of blood irradiation through the development of improved and portable blood irradiators. A portable blood irradiator, consisting of a vitreous carbon body and thulium-170 radiation source, was attached to dogs via a carotid-jugular shunt, and its effects on the immune system measured. The device has demonstrated both significant suppression of circulating lymphocytes and prolonged retention of skin allografts
Directory of Open Access Journals (Sweden)
Regina Ingrid Díaz Tolosa
2007-01-01
Full Text Available El artículo 161-A del Código Penal chileno es una muestra de los resultados que se obtienen al legislar materias tan importantes, como lo es la protección penal de la intimidad de las personas, de forma acelerada. La norma en análisis resiste innumerables críticas; su redacción es confusa e imprecisa, lo que conlleva arduas tareas de interpretación. Este trabajo pretende contribuir en esta labor, reflexionando acerca de puntuales problemas asociados a la tipificación de los delitos recogidos en la citada disposición, así respecto al inciso primero se analiza, especialmente, si se penaliza la indiscreción o deslealtad en las comunicaciones y actuaciones privadas, mientras que en cuanto al inciso segundo se medita acerca de si se exige el conocimiento de la obtención subrepticia del material por parte de quien lo difunde. Además, se destaca la necesaria interpretación restrictiva de estos tipos, se analiza el interés público como fundamento de la autorización legal o judicial para ejecutar las conductas tipificadas, y de ¡egeferendae, se indican las ventajas que tendría introducir un elemento subjetivo del tipo distinto del dolo como la finalidad de vulnerar ¡a intimidad de otro, a fin de salvar las incertidumbres que existen en la actual legislaciónThe article 161-A of the Chilean Penal Code is a sample of the results that are obtained when so important matters, like the penal protection of the privacy, are legislated precipitately. The norm in analysis resists innumerable critiques; its draft is confused and vague, giving us an arduous interpretation work. This paper tries to contribute in this analysis, thinking over punctual problems, for example, regarding to the first clause we studied, specially, if the indiscretion or disloyalty is penalized in the communications and private performances, while as for the second clause it is pondered if who diffuse the information must to know about that it was obtained illegally
Robinson, Deanne Mraz; Frulla, Ashton P
2017-07-01
INTRODUCTION: A topical proprietary procedural enhancement system (PES) containing a combination of active ingredients including a tripeptide and hexapeptide (TriHex Technology™, Alastin Procedure Enhancement Invasive System, ALASTIN Skincare™, Inc., Carlsbad, CA) has been used successfully to aid in healing and improve symptomatology following resurfacing procedures. METHODS: PES (Gentle Cleanser, Regenerating Skin Nectar with TriHex Technology™, Ultra Nourishing Moisturizer with TriHex Technology™, Soothe + Protect Recovery Balm, Broad Spectrum 30+ Sunscreen) was compared to a basic regimen (Aquaphor™, Cerave™ cleanser, Vanicream™, Alastin Broad Spectrum 30+ Sunscreen) in a split face/ décolleté trial following fractional non-ablative thulium-doped resurfacing treatment to the face or décolleté. The skin was pre-conditioned and treated during and after the procedure using the two regimens. RESULTS: A blinded investigator rated the PES statistically superior to the basic regimen on healing post-laser treatment on day 4 based on lentigines, texture, and Global Skin Quality. Subjects also reported 'better looking and feeling' skin on the PES side. CONCLUSION: PES appears to improve healing post-non ablative thulium-doped resurfacing treatment to the face/décolleté in comparison with standard of care. J Drugs Dermatol. 2017;16(7):707-710..
Photothermal effect of infrared lasers on ex vivo lamb brain tissues
Özgürün, Baturay; Gülsoy, Murat
2018-02-01
Here, the most suitable infrared laser for a neurosurgery operation is suggested, among 1940-nm thulium fiber, 1470-nm diode, 1070-nm ytterbium fiber and 980-nm diode lasers. Cortical and subcortical ex-vivo lamb brain tissues are exposed to the laser light with the combinations of some laser parameters such as output power, energy density, operation mode (continuous and pulsed-modulated) and operation time. In this way, the greatest ablation efficiency associated with the best neurosurgical laser type can be defined. The research can be divided into two parts; pre-dosimetry and dosimetry studies. The former is used to determine safe operation zones for the dosimetry study by defining coagulation and carbonization onset times for each of the brain tissues. The latter is the main part of this research, and both tissues are exposed to laser irradiation with various energy density levels associated with the output power and operation time. In addition, photo-thermal effects are compared for two laser operation modes, and then coagulation and ablation diameters to calculate the ablation efficiency are measured under a light microscope. Consequently, results are compared graphically and statistically, and it is found that thulium and 1470-nm diode lasers can be utilized as subcortical and cortical tissue ablator devices, respectively.
Measuring and analyzing excitation-induced decoherence in rare-earth-doped optical materials
International Nuclear Information System (INIS)
Thiel, C W; Macfarlane, R M; Cone, R L; Sun, Y; Böttger, T; Sinclair, N; Tittel, W
2014-01-01
A method is introduced for quantitatively analyzing photon echo decay measurements to characterize excitation-induced decoherence resulting from the phenomenon of instantaneous spectral diffusion. Detailed analysis is presented that allows fundamental material properties to be extracted that predict and describe excitation-induced decoherence for a broad range of measurements, applications and experimental conditions. Motivated by the need for a method that enables systematic studies of ultra-low decoherence systems and direct comparison of properties between optical materials, this approach employs simple techniques and analytical expressions that avoid the need for difficult to measure and often unknown material parameters or numerical simulations. This measurement and analysis approach is demonstrated for the 3 H 6 to 3 H 4 optical transition of three thulium-doped crystals, Tm 3+ :YAG, Tm 3+ :LiNbO 3 and Tm 3+ :YGG, that are currently employed in quantum information and classical signal processing demonstrations where minimizing decoherence is essential to achieve high efficiencies and large signal bandwidths. These new results reveal more than two orders of magnitude variation in sensitivity to excitation-induced decoherence among the materials studied and establish that the Tm 3+ :YGG system offers the longest optical coherence lifetimes and the lowest levels of excitation-induced decoherence yet observed for any known thulium-doped material. (paper)
Nylund, Adam M; Drury, Adam; Weir, Heather; Monnet, Eric
2017-07-01
OBJECTIVE To assess rates of intraoperative complications and conversion to laparotomy associated with supervised veterinary students performing laparoscopic ovariectomy in dogs. DESIGN Retrospective case series. ANIMALS 161 female shelter dogs for which elective laparoscopic ovariectomy had been performed by supervised senior (fourth-year) veterinary students from 2010 through 2014. PROCEDURES Medical records of all dogs were reviewed and data collected regarding duration of surgery, surgical complications and other characteristics, and whether conversion to laparotomy was required. RESULTS Laparoscopic ovariectomy was performed with a 2-cannula technique and a 10-mm vessel-sealing device for hemostasis in all dogs. A Veress needle was used for initial insufflation in 144 (89.4%) dogs; method of insufflation was not reported for the remaining 17 (10.6%) dogs. Mean ± SD duration of surgery was 114.90 ± 33.40 minutes. Surgical complications, all classified as minor blood loss, occurred in 24 (14.9%) dogs. These included splenic puncture during insertion of the Veress needle (n = 20 [12.4%]) and minor bleeding from the ovarian pedicle (4 [2.5%]). Splenic puncture required no intervention, and ovarian pedicle bleeding required application of the vessel-sealing device an additional time to control the bleeding. Two ovaries were dropped in the abdominal cavity at the time of removal. Both were retrieved without complication. Conversion to laparotomy was not required for any dog. All dogs were discharged from the hospital within 24 hours after surgery. CONCLUSIONS AND CLINICAL RELEVANCE Laparoscopic ovariectomy in dogs was performed safely by closely supervised novice surgeons, with only minor intraoperative complications encountered and no need for conversion to laparotomy.
Completion Report for Well ER-16-1 Corrective Action Unit 99: Rainier Mesa - Shoshone Mountain
Energy Technology Data Exchange (ETDEWEB)
NSTec Environmental Management
2006-12-01
Well ER-16-1 was drilled for the U.S. Department of Energy, National Nuclear Security Administration Nevada Site Office, in support of the Nevada Environmental Restoration Project at the Nevada Test Site, Nye County, Nevada. The well was drilled in June and July 2005 as part of a hydrogeologic investigation program for the Rainier Mesa-Shoshone Mountain Corrective Action Unit, Number 99. The overall purpose of the well was to gather subsurface data to better characterize the hydrogeology of the Shoshone Mountain area, especially in the older Tertiary and pre-Tertiary strata. The main 46.99-centimeter hole was drilled to a depth of 702.9 meters and cased with 33.97-centimeter casing to 663.7 meters. The hole diameter was then decreased to 31.1 centimeters, and the well was drilled to total depth of 1,220.7 meters. A completion string set at the depth of 1,162.4 meters consisted of 13.97-centimeter stainless-steel casing, with one continuous slotted interval open to the lower carbonate aquifer. The fluid level in the borehole soon dropped, so the borehole was deepened in July 2006. To deepen the borehole, the slotted section was cemented and a 12.1-centimeter hole was drilled through the bottom of the completion string to the new total depth of 1,391.7 meters, which is 171.0 meters deeper than the original borehole. A string of 6.03-centimeter carbon-steel tubing with one continuous slotted interval at 1,361.8 to 1,381.4 meters, and open to the lower carbonate aquifer, was installed in the well with no gravel packing or cement, to serve as a monitoring string. Data gathered during and shortly after hole construction include composite drill cuttings samples collected every 3 meters (extra cuttings samples were collected from the Paleozoic rocks for paleontological analyses), sidewall core samples from 37 depths, various geophysical logs, and water level measurements. These data indicate that the well penetrated 646.8 meters of Tertiary volcanic rocks and 744.9 meters
Design and commissioning of a 16.1 MHz multiharmonic buncher for the reaccelerator at NSCL
Alt, Daniel Maloney
The ReAccelerator (ReA) linear accelerator facility at the National Superconducting Cyclotron Laboratory is a unique resource for the nuclear physics community. The particle fragmentation beam production technique, combined with the ability to stop and then reaccelerate the beam to energies of astrophysical interest, give experimenters an unprecedented range of rare isotopes at energies of nuclear and astrophysical interest. The ReAccelerator also functions as a testbed for technology to be incorporated in the upcoming Facility for Rare Isotope Beams linear accelerator, which will eventually in turn become the beam source for ReA. This prototype nature of the ReAccelerator, however, dictated some design choices which have resulted in a final beam with a time structure that is less than ideal for certain classes of experiments. The cavities and RFQ used in ReA have an operating frequency of 80.5 MHz, which corresponds to a separation between particle bunches at the detectors of 12.4 ns. While this separation is acceptable for many experiments, sensitive time of flight measurements require a greater separation between pulses. As nuclear physics experiments rely on statistics, a solution to increasing bunch separation without simply discarding a large fraction of the beam particles was desired. This document describes the design and construction of such a device, a 16.1 MHz multiharmonic buncher. The first chapter provides backgound information on the NSCL and ReA, and some basic concepts in accelerator physics to lay the groundwork for the project.Next, more specifics are provided on the time structure of accelerated beams, and the experimental motivation for greater separation. The third chapter outlines the basic principles of multiharmonic bunching. In order to evaluate the feasibility of any buncher design, the exact acceptance of the Radiofrequency Quadrupole (RFQ) of the ReAccelerator needed to be empirically measured. Chapter 4 describes the results of that
Complexes of rare earths with hydrazide of salicylic acid
Energy Technology Data Exchange (ETDEWEB)
Abashmadze, M Sh; Pirtskhalava, N I; Kharitonov, Yu Ya; Machkhoshvili, R I [Tbilisskij Gosudarstvennyj Univ. (USSR); AN SSSR, Moscow. Inst. Obshchej i Neorganicheskoj Khimii; Moskovskij Khimiko-Tekhnologicheskij Inst. (USSR))
1978-10-01
Complex compounds M(HOC/sub 6/H/sub 4/CONNH/sub 2/)/sub 3/ xnH/sub 2/O, where M is one of the following metals and n=0 or 1, have been obtained in the reactions of salts (chlorides or nitrates) of praseodymium, neodymium, europium, gadolinium, erbium, thulium or lutecium with salicylic acid hydrazide in a weakly alkaline medium. Some properties and infrared absorption spectra of the compounds obtained have been studied.
International Nuclear Information System (INIS)
Popple, B.N.
1977-01-01
The author explains clearly what is radiography, enumerates four major factors in considering a practical source to use namely half-life, penetrating power, half value layer and specific activity and also the advantages and disadvantages in using isotopes. Common radioisotopes used in industrial radiography are iridium, cesium, cobalt and thulium. Main uses of the radioisotopes are for radiographic testing like welding castings, forgoings etc.; thickness, level or density measurement and tracing. (RTD)
Piccione, Maria; Salzano, Emanuela; Vecchio, Davide; Ferrara, Dante; Malacarne, Michela; Pierluigi, Mauro; Ferrara, Ines; Corsello, Giovanni
2015-07-01
Microscopically chromosome rearrangements of the short arm of chromosome 4 include the two known clinical entities: partial trisomy 4p and deletions of the Wolf-Hirschhorn critical regions 1 and 2 (WHSCR-1 and WHSCR-2, respectively), which cause cranio-facial anomalies, congenital malformations and developmental delay/intellectual disability. We report on clinical findings detected in a Chinese patient with a de novo 4p16.1-p15.32 duplication in association with a subtle 4p terminal deletion of 6 Mb in size. This unusual chromosome imbalance resulted in WHS classical phenotype, while clinical manifestations of 4p trisomy were practically absent. This observation suggests the hypothesis that haploinsufficiency of sensitive dosage genes with regulatory function placed in WHS critical region, is more pathogenic than concomitant 4p duplicated segment. Additionally clinical findings in our patient confirm a variable penetrance of major malformations and neurological features in Chinese children despite of WHS critical region's deletion. Copyright © 2015 European Paediatric Neurology Society. Published by Elsevier Ltd. All rights reserved.
International Nuclear Information System (INIS)
1983-06-01
During the 60-day period provided for comments on the ''Summary of the Results of the Evaluation of the WIPP Site and Preliminary Design Validation Program'' (WIPP-DOE-161), written submittals and hearing testimony from about 133 individuals, 7 citizens groups and 6 state agencies were received by the Department of Energy (DOE). Approximately 25% of the public comment submittals were positive statements supporting the WIPP, with the remaining 75% reflecting concern with one or more aspects of the project. A portion of the state's comment package (submitted by the Governor of New Mexico) contained concerns relevant to WIPP which were unrelated to site suitability. Supportive comments formed the majority of the submittals from the New Mexico Environmental Evaluation Group (EEG) which ''...is charged with the responsibility of evaluating the suitability of the site for carrying out the mission of WIPP by analyzing all the reports and other information which form the background to the DOE evaluation of the site''
Phosphor for thermoluminescent type radiation dosimeter
International Nuclear Information System (INIS)
Nada, N.; Yamashita, T.
1975-01-01
This has the accumulation effect of radiation energy and is mainly used as the element for thermoluminescent type radiation dosimeters. It has as the principal constituent a phosphor consisting of calcium sulfate as the principal constituent and other impurity elements such as dysprosium, thulium and the like. It is more sensitive by the order of 1 to 2 or more figures than the conventional ones and is excellent in the retention of absorbed radiation energy. (U.S.)
International Nuclear Information System (INIS)
Gavrishchuk, E.M.; Dzyubenko, N.G.; Martynenko, L.I.
1984-01-01
Mass spectra of adducts of tris-acetylacetonates of REE (REE, Ln, M) with O-phenanthroline (Phen) and α, α 1 -dipyridyl (Dipy) are obtained. A scheme of fragmentation is suggested. Peculiarities of dissociative ionization processes for samarium-, europium-thulium-, and ytterbium compounds are shown to be determined by a possibility of changing the oxidation state of a central ion. Energy characteristics of separation of the first and second ligands of compleXes in the entire REE series are compared
Efficient energy extraction from a diode-pumped Q-switched Tm,Ho:YLiF4 laser
Mcguckin, B. T.; Menzies, R. T.; Hemmati, H.
1991-01-01
The operation of a diode-laser pumped thulium, holmium yttrium-lithium-fluoride laser (Tm,Ho:YLF) in Q-switched mode is reported. Output energies of 200 microjoules in pulses of 22 ns duration are recorded at Q-switch frequencies commensurate with an effective upper laser level lifetime of 6 ms. This lifetime is appreciably longer than that observed in other hosts permitting stored energy extraction of 64 percent, close to the projected maximum performance from these materials.
Fully portable blood irradiator
International Nuclear Information System (INIS)
Hungate, F.P.; Riemath, W.F.; Bunnell, L.R.
1980-01-01
A fully portable blood irradiator was developed using the beta emitter thulium-170 as the radiation source and vitreous carbon as the body of the irradiator, matrix for isotope encapsulation, and blood interface material. These units were placed in exteriorized arteriovenous shunts in goats, sheep, and dogs and the effects on circulating lymphocytes and on skin allograft retention times measured. The present work extends these studies by establishing baseline data for skin graft rejection times in untreated animals
Velly, H; Fonseca, F; Passot, S; Delacroix-Buchet, A; Bouix, M
2014-09-01
To investigate the effects of fermentation parameters on the cell growth and on the resistance to each step of the freeze-drying process of Lactococcus lactis subsp. lactis TOMSC161, a natural cheese isolate, using a response surface methodology. Cells were cultivated at different temperatures (22, 30 and 38°C) and pH (5·6, 6·2 and 6·8) and were harvested at different growth phases (0, 3 and 6 h of stationary phase). Cultivability and acidification activity losses of Lc. lactis were quantified after freezing, drying, 1 and 3 months of storage at 4 and 25°C. Lactococcus lactis was not damaged by freezing but was sensitive to drying and to ambient temperature storage. Moreover, the fermentation temperature and the harvesting time influenced the drying resistance of Lc. lactis. Lactococcus lactis cells grown in a whey-based medium at 32°C, pH 6·2 and harvested at late stationary phase exhibited both an optimal growth and the highest resistance to freeze-drying and storage. A better insight on the individual and interaction effects of fermentation parameters made it possible the freeze-drying and storage preservation of a sensitive strain of technological interest. Evidence on the particularly damaging effect of the drying step and the high-temperature storage is presented. © 2014 The Society for Applied Microbiology.
Casualty Estimation for Nuclear and Radiological Weapons
2016-06-01
rate 2.69 d β Metal Polonium - 210 210Po Static eliminators 138 d α Metal foil Radium-226 226Ra Brachytherapy - low dose rate 1600 y α Salt...Promethium-147 153Gd Gadolinium-153 169Yb Ytterbium-169 170Tm Thulium-170 192Ir Iridium-192 210Po Polonium - 210 226Ra Radium-226 238Pu Plutonium-238...Brussels: NATO, in development). iv present in a large food irradiator facility, and constitutes about 34.5 kg of 137Cs. To illustrate alternative
Lifescience Database Archive (English)
Full Text Available VF (Link to library) VFC161 (Link to dictyBase) - - - Contig-U15456-1 VFC161P (Link... to Original site) VFC161F 564 VFC161Z 562 VFC161P 1126 - - Show VFC161 Library VF (Link to library) Clone ID VFC161 (Link to dict...yBase) Atlas ID - NBRP ID - dictyBase ID - Link to Contig Contig-U15456-1 Original site URL http://dict...Value N Y16962 |Y16962.1 Dictyostelium discoideum mRNA for cathepsin D. 1025 0.0 5 AJ243946 |AJ243946.1 Dict...plasma membrane 4.0 %: vesicles of secretory system >> prediction for VFC161 is nuc 5' end seq. ID VFC161F 5
Kramer, John K G; Hernandez, Marta; Cruz-Hernandez, Cristina; Kraft, Jana; Dugan, Michael E R
2008-03-01
Milk fat is a complex mixture of geometric and positional isomers of monounsaturated and polyunsaturated, including short-, long- and branch-chain fatty acids (FAs). There has been partial success to resolve this mixture of FAs using different GC temperature programs, or a combination of GC isothermal and temperature programs. To overcome the problem associated with overlapping isomers prior silver-ion separation was recommended. However, this procedure is time consuming and not practical for routine analysis. In addition, previous methods focused mainly on the trans and cis isomers of 18:1. The present method takes advantage of differences in the relative elution times between different types of FAs. The method involved analyzing each milk fat using the same highly polar 100-m capillary column and GC instrument, and conducting two separations using temperature programs that plateau at 175 and 150 degrees C. The relative shift among the geometric and positional isomers at these two temperature settings was enough to permit identification of most of the trans and cis 16:1, 18:1 and 20:1, the c/t-18:2 and the c/c/t-18:3 isomers found in milk fat. The identity of these FAs was confirmed by prior separation of the total fatty acid methyl esters (FAMEs) of milk fat using Ag(+)-SPE columns, and comparing the fractions to the total milk fat. The Ag(+)-SPE technique was modified to obtain pure saturated, trans- and cis-monounsaturated and diunsaturated FAMEs. By combining the results from these two separate GC analyses, knowing the elution order, it was possible to determine most of the geometric and positional isomers of 16:1, 18:1, 20:1, 18:2 and 18:3 without a prior silver-ion separation. Only few minor FAs could not be resolved, notable the conjugated linoleic acid isomers that still required the complimentary Ag(+)-HPLC separation. The two GC temperature programs have been successfully used to routinely analyze most FA isomers in total milk and beef fats in about 200
Experimental electron binding energies for thulium in different matrices
Czech Academy of Sciences Publication Activity Database
Inoyatov, A. K.; Kovalík, Alojz; Filosofov, D. V.; Ryšavý, Miloš; Perevoshchikov, L. L.; Yushkevich, Yu. V.; Zbořil, M.
2015-01-01
Roč. 202, JUL (2015), s. 46-55 ISSN 0368-2048 R&D Projects: GA MŠk LG14004; GA ČR(CZ) GAP203/12/1896 Institutional support: RVO:61389005 Keywords : Tm-169 * (169)yb * atomic environment * electron binding energy * chemical shift * natural atomic level width Subject RIV: BG - Nuclear, Atomic and Molecular Physics, Colliders Impact factor: 1.561, year: 2015
2016-04-21
cells: from complex nanostructure to planar heterojunction ”, Journal of Materials Chemistry A, 2, 5994 (2014). (featured on Cover of Journal of...naphthalenide solution. Trifluoroacetic acid (TFA, 99%), Yttrium(III) oxide (Y2O3, 99.99%), Ytterbium(III) oxide (Yb2O3, 99.9%), Erbium(III) oxide ...Er2O3, ≥99.99%) and Thulium(III) oxide (Tm2O3, 99.9%) were purchased from Sigma-Aldrich and used as received. Gold(III) chloride trihydrate (HAuCl4·3H2O
Vondran, Florian Wolfgang Rudolf; Timrott, Kai; Kollrich, Sonja; Klempnauer, Juergen; Schwinzer, Reinhard; Becker, Thomas
2012-04-01
Clinical trials have pointed out the promising role of co-stimulation blocker Belatacept for improvement of graft function and avoidance of undesired side-effects associated with calcineurin-inhibitors (CNI). However, due to the worldwide limited availability of appropriate patients, almost no data exist to assess the effects of sustained application of this immunomodulator on the recipient's immune system. The aim of this study was to reveal specific alterations in the composition of immunologic subpopulations potentially involved in development of tolerance or chronic graft rejection following long-term Belatacept therapy. For this, peripheral lymphocyte subsets of kidney recipients treated with Belatacept (n=5; average 7.8years) were determined by flow-cytometry and compared with cells from matched patients on CNI (n=9) and healthy controls (n=10). T cells capable of producing IL-17 and serum levels of soluble CD30 were quantified. Patients on CNI showed a higher frequency of CD4(+) CD161(+) Th(17) -precursors and IL-17-producing CD4(+) T cells than Belatacept patients and controls. Significantly higher serum levels of soluble CD30 were observed in CNI patients, indicating a possible involvement of the CD30/CD30L-system in Th(17) -differentiation. No differences were found concerning CD4(+) CD25(+) CD127(low) FoxP3(+) regulatory T cells. In conclusion, patients on therapy with Belatacept did not show a comparable Th(17) -profile to that seen in individuals with chronic intake of CNI. The distinct effects of Belatacept on Th(17) -immunity might prove beneficial for the long-term outcome following kidney transplantation. © 2012 The Authors. Transplant International © 2012 European Society for Organ Transplantation.
International Nuclear Information System (INIS)
Misiak, Małgorzata; Stręk, Wiesław; Arabasz, Sebastian; Bednarkiewicz, Artur
2016-01-01
Simple and effective ways to circumvent limited luminescence efficiency of up-converting nanoparticles (UCNPs) are sought. One of the methods relays on distorting the crystallographic structure of host material by co-doping the nanocrystals with optically inactive co-dopants. Here we study the influence of K + doping and surface passivation on the up-converting properties of the α-NaYF 4 nanocrystals co-doped with 20% Yb 3+ and 0.1 or 2% Tm 3+ . The intentionally chosen concentrations of K + ions, which were meant to replaced sodium ions were fixed to 0, 5, 10, 20 to 30%. Potassium ions modified the spectroscopic properties of both core and core–shell NPs, but the differences were noticed between samples doped with 0.1% Tm 3+ and 2% Tm 3+ ions. Replacement of sodium by potassium ions decreased up-conversion luminescence intensity as well as shortened thulium excited states lifetimes in the samples doped with 0.1% Tm 3+ , while the opposite behavior was found in the samples co-doped with higher 2% thulium concentration. - Highlights: • We studied the influence of K + doping on luminescent properties of α-NaYF 4 :YbTm. • The 0.1 and 2% Tm doped core and core–shell samples were investigated. • K + -doping influence on UC properties was different in low and highly Tm doped NPs. • The explanations of the observed variations were proposed.
International Nuclear Information System (INIS)
Chuveleva, Eh.A.; Kharitonov, O.V.; Firsova, L.A.
1994-01-01
Certain heavy rare earths, curium and americium were separated by the method of displacement complexing chromatography using DTPA solutions and solutions containing DTPA and citric acid as eluents. Separation factors of rare earths and curium (americium) were calculated. Imitators for curium and americium separation were suggested: thulium for curium elution using 0.025 mol/l DTPA, holmium-for curium elution using 0.025 mol/l DTPA in the presence of 0.025 mol/l citric acid; terbium can serve as the imitator in both cases. 5 refs., 5 figs
Neutron activation analysis of the rare earth elements in Nasu hot springs
International Nuclear Information System (INIS)
Ikeda, Nagao; Takahashi, Naruto.
1978-01-01
Eleven rare earth elements (lanthanum, cerium, neodymium, samarium, europium, gadolinium, terbium, holmium, thulium, ytterbium and lutetium) in hot spring waters and sinter deposits in the Nasu area were determined by the neutron activation method. The rare earth elements in hot spring water were preconcentrated in ferric hydroxide precipitate and neutron-irradiated. The rare earth elements were chemically separated into lighter and heavier groups and the activity of each group was measured with a Ge(Li) detector. Distribution of the rare earth elements between the hot spring water and the sinter deposit was also discussed. (auth.)
Metal oxide targets produced by the polymer-assisted deposition method
Energy Technology Data Exchange (ETDEWEB)
Garcia, Mitch A., E-mail: mitch@berkeley.ed [Department of Chemistry, Room 446 Latimer Hall, University of California Berkeley, Berkeley, CA 94720-1460 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Ali, Mazhar N.; Chang, Noel N.; Parsons-Moss, T. [Department of Chemistry, Room 446 Latimer Hall, University of California Berkeley, Berkeley, CA 94720-1460 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Ashby, Paul D. [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Gates, Jacklyn M. [Department of Chemistry, Room 446 Latimer Hall, University of California Berkeley, Berkeley, CA 94720-1460 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Stavsetra, Liv [Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States); Gregorich, Kenneth E.; Nitsche, Heino [Department of Chemistry, Room 446 Latimer Hall, University of California Berkeley, Berkeley, CA 94720-1460 (United States); Lawrence Berkeley National Laboratory, Berkeley, CA 94720 (United States)
2010-02-11
The polymer-assisted deposition (PAD) method was used to create crack-free homogenous metal oxide films for use as targets in nuclear science applications. Metal oxide films of europium, thulium, and hafnium were prepared as models for actinide oxides. Films produced by a single application of PAD were homogenous and uniform and ranged in thickness from 30 to 320 nm. Reapplication of the PAD method (six times) with a 10% by weight hafnium(IV) solution resulted in an equally homogeneous and uniform film with a total thickness of 600 nm.
Metal oxide targets produced by the polymer-assisted deposition method
International Nuclear Information System (INIS)
Garcia, Mitch A.; Ali, Mazhar N.; Chang, Noel N.; Parsons-Moss, T.; Ashby, Paul D.; Gates, Jacklyn M.; Stavsetra, Liv; Gregorich, Kenneth E.; Nitsche, Heino
2010-01-01
The polymer-assisted deposition (PAD) method was used to create crack-free homogenous metal oxide films for use as targets in nuclear science applications. Metal oxide films of europium, thulium, and hafnium were prepared as models for actinide oxides. Films produced by a single application of PAD were homogenous and uniform and ranged in thickness from 30 to 320 nm. Reapplication of the PAD method (six times) with a 10% by weight hafnium(IV) solution resulted in an equally homogeneous and uniform film with a total thickness of 600 nm.
Improving Reliability of High Power Quasi-CW Laser Diode Arrays Operating in Long Pulse Mode
Amzajerdian, Farzin; Meadows, Byron L.; Barnes, Bruce W.; Lockard, George E.; Singh, Upendra N.; Kavaya, Michael J.; Baker, Nathaniel R.
2006-01-01
Operating high power laser diode arrays in long pulse regime of about 1 msec, which is required for pumping 2-micron thulium and holmium-based lasers, greatly limits their useful lifetime. This paper describes performance of laser diode arrays operating in long pulse mode and presents experimental data of the active region temperature and pulse-to-pulse thermal cycling that are the primary cause of their premature failure and rapid degradation. This paper will then offer a viable approach for determining the optimum design and operational parameters leading to the maximum attainable lifetime.
Improving Lifetime of Quasi-CW Laser Diode Arrays for Pumping 2-Micron Solid State Lasers
Amzajerdian, Farzin; Meadows, Byron L.; Baker, Nathaniel R.; Barnes, Bruce W.; Singh, Upendra N.; Kavaya, Michael J.
2007-01-01
Operating high power laser diode arrays in long pulse regime of about 1 msec, which is required for pumping 2-micron thulium and holmium-based lasers, greatly limits their useful lifetime. This paper describes performance of laser diode arrays operating in long pulse mode and presents experimental data on the active region temperature and pulse-to-pulse thermal cycling that are the primary cause of their premature failure and rapid degradation. This paper will then offer a viable approach for determining the optimum design and operational parameters leading to the maximum attainable lifetime.
International Nuclear Information System (INIS)
Cherukuri, Durga Prasad; Chen, Xiao B.O.; Goulet, Anne-Christine; Young, Robert N.; Han, Yongxin; Heimark, Ronald L.; Regan, John W.; Meuillet, Emmanuelle; Nelson, Mark A.
2007-01-01
Accumulating evidence indicates that elevated levels of prostaglandin E 2 (PGE 2 ) can increase intestinal epithelial cell proliferation, and thus play a role in colorectal tumorigenesis. PGE 2 exerts its effects through four G-protein-coupled PGE receptor (EP) subtypes, named the EP1, EP2, EP3, and EP4. Increased phosphorylation of extracellular regulated kinases (ERK1/2) is required for PGE 2 to stimulate cell proliferation of human colon cancer cells. However, the EP receptor(s) that are involved in this process remain unknown. We provide evidence that L-161,982, a selective EP4 receptor antagonist, completely blocks PGE 2 -induced ERK phosphorylation and cell proliferation of HCA-7 cells. In order to identify downstream target genes of ERK1/2 signaling, we found that PGE 2 induces expression of early growth response gene-1 (EGR-1) downstream of ERK1/2 and regulates its expression at the level of transcription. PGE 2 treatment induces phosphorylation of cyclic AMP response element binding protein (CREB) at Ser133 residue and CRE-mediated luciferase activity in HCA-7 cells. Studies with dominant-negative CREB mutant (ACREB) provide clear evidence for the involvement of CREB in PGE 2 driven egr-1 transcription in HCA-7 cells. In conclusion, this study reveals that egr-1 is a target gene of PGE 2 in HCA-7 cells and is regulated via the newly identified EP4/ERK/CREB pathway. Finally our results support the notion that antagonizing EP4 receptors may provide a novel therapeutic approach to the treatment of colon cancer
Krypton recovery from reprocessing off-gases by cryogenic distillation
International Nuclear Information System (INIS)
Geens, L.P.; Goossens, W.R.A.; Marien, J.
1987-01-01
With the financial support of the C.E.C., krypton recovery by cryogenic distillation in presence of oxygen was investigated. Both oxygen and ozone behavior in the cryodistillation unit were observed. The ozone decay in the rectification column was studied in absence and in presence of a radiation source. Additionally a demonstration run with krypton-85 was performed. Experiments with different oxygen concentrations up to 21% volume in the feed gas were carried out. The oxygen was enriched up to 85% volume in a zone between the krypton layer and the entrance of the rectification column. No oxygen was found in the bottom product. On the other hand, the ozone accumulated in that bottom product. The decay of ozone in the bottom liquid was measured in absence and in presence of a 500 Ci thulium-170 source. Without the radiation source, it took almost 30 days to observe a decay from 0.90% volume to 0.45% volume. The decay rate decreased with decreasing ozone concentration. In presence of the 500 Ci thulium-170, a constant decay rate of 0.24% volume per day was measured. Finally, a demonstration run with 100 Ci krypton-85 was performed in the cryodistillation unit, with air as feed gas. The krypton-85 was fed at a concentration of 30 mCih -1 until the total krypton inventory of the rectification column amounted to 40-45 Ci. The active run had a duration of 900 hours, during which no operational problems occurred. (orig.)
Directory of Open Access Journals (Sweden)
D. V. Enikeev
2017-01-01
Full Text Available The latest guideline of the European Association of Urology (2016 for the management of lower urinary tract symptoms has a new term – endoscopic enucleation of the prostate. This term was introduced after the publication of latest meta-analyses showing that both laser enucleation and electroenucleation are effective in the treatment of infravesical obstruction caused by benign prostatic hyperplasia (BPH.Objective: to compare the methods of electroenucleation and laser enucleation (holmium and thulium of the prostate according to the literature data and own observations.Materials and methods. A total of 624 patients with BPH were included in the study; of them, 459 participants underwent holmium laser enucleation (HoLEP, 35 – monopolar enucleation, and 130 – thulium laser enucleation (ThuLEP. All patients were followed up for one month. We assessed the International Prostate Symptom Score (IPSS, patients’ quality of life (QoL, peak flow rate (Qmax, and residual urine volume prior to surgery and 1 month after it.Results. Functional characteristics have significantly improved by one month post surgery in all three groups. Moreover, the data obtained indicate similar efficacy of different endoscopic enucleation methods. None of the tested parameters demonstrated significant difference across the groups (p >0.05Conclusions. Our results of HoLEP and ThuLEP suggest high efficacy of these surgical techniques and low number of postoperative complications, which correlates with literature data and guidelines of the European Association of Urology. Monopolar enucleation of the prostate is as effective as ThuLEP or HoLEP; however it has higher frequency of postoperative complications.
Physico-chemical study of erbium, thulium ytterbium and lutetium butyrates
International Nuclear Information System (INIS)
Loginova, V.E.; Dvornikova, L.M.; Khazov, L.A.; Rubinshtejn, A.S.
1975-01-01
Er-Lu butyrates have been obtained. The crystals of the obtained salts had an identical shape of combinations of hexagonal prisms and pyramids. The values of the refraction index, measured by the method of circular screening and use of immersion liquids, were found to be close to each other in all the salts considered. The densities of the crystallohydrates of rare earth element butyrates, measured by the pycnometric method in isooctane, increases in the order of Er, Tm, Lu: 1.73; 1.74; 1.79 g/cm 3 , respectively. Infrared spectra of rare earth element butyrates were studied, and the main ware frequencies of maximum absorption were determined with a view of finding the character of the bond between the metal and the anion. A thermo-differential and a thermo-gravimetric investigation of rare earth element butyrates was carried out
Nichols, M. E.
1976-01-01
Results are presented of wind tunnel test 0A161 of a 0.030-scale model 45-0 of the configuration 140A/B (modified) space shuttle vehicle orbiter in the NASA Ames Research Center Unitary Plan Wind Tunnel facilities. The purpose of this test was to determine local total and static pressure environments for the air data probe locations and relative effectiveness of alternate flight-test probe configurations. Testing was done in the Mach number range from 0.30 to 3.5. Angle of attack was varied from -8 to 25 degrees while sideslip varied between -8 and 8 degrees.
Growth and optical properties of Tm:GdVO4 single crystal
International Nuclear Information System (INIS)
Urata, Y.; Akagawa, K.; Wada, S.; Tashiro, H.; Fukuda, T.
1999-01-01
Thulium-doped gadolinium vanadate (Tm:GdVO 4 ) single crystal has been successfully grown by a modified Czochralski (CZ) technique. Effective distribution coefficient of Tm was determined to be 0.74. Absorption characterization was performed in the 800 nm region and the maximum absorption peak was found at 799 nm for π polarization. Fluorescence spectra for tuning at the maximum absorption were obtained around 1.8-2.0 μm region with 100 nm bandwidth. This suggests that a Tm:GdVO 4 crystal is expected as a new promising LD pumped solid-state laser in the 2 μm region. (orig.)
Watt-level ~2 μm laser output in Tm3+-doped tungsten tellurite glass double-cladding fiber.
Li, Kefeng; Zhang, Guang; Hu, Lili
2010-12-15
We report, for the first time to the best of our knowledge, a watt level cw fiber laser at ~2 μm from a piece of 40-cm-long newly developed highly thulium-doped (3.76 × 10(20) ions/cm(3)) tungsten tellurite glass double cladding fiber pumped by a commercial 800 nm laser diode. The maximum output power of the fiber laser reaches 1.12 W. The slope efficiency and the optical-optical efficiency with respect to the absorbed pump are 20% and 16%, respectively. The lasing threshold is 1.46 W, and the lasing wavelength is centered at 1937 nm.
CSIR Research Space (South Africa)
Dhlamini, MS
2012-05-01
Full Text Available .physb.2011.09.091 Concentration effect of Tm3+ on cathodoluminescence properties of SiO2: Tm 3+ and SiO2:Ho 3+, Tm3+ systems M.S. Dhlamini, G.H. Mhlongo, H.C. Swart, O.M. Ntwaeaborwa, K.T. Hillie ABSTRACT: Cathodoluminescence (CL) properties of Si...O2 powders activated with thulium (Tm3+) and holmium (Ho3+) ions prepared by a sol–gel process were investigated. Different molar concentrations of Tm3+ co-doped with Ho3+ were studied. The 460 nm peak was monitored and the influence of the beam...
Hogg, Robert; Hogg, Robert; Hart, Trevor; Tan, Darrell; Hart, Trevor; Tan, Darrell; Boily-Larouche, Genevi?ve; Lajoie, Julie; Omollo, Kenneth O; Cheruiyot, Julianna; Njoki, Jane; Kimani, Makubo; Oyugi, Julius; Kimani, Joshua; Fowke, Keith R
2015-01-01
BACKGROUND: The C-type lectin CD161 is expressed by CD4+ and CD8+ T cells sharing conserved transcriptional and functional signature. CD4+ T cells with type-17 profiles derived from CD161+ precursors and CD161-expressing CD8+ T cells share the same differentiation profile and include the unique anti-bacterial CD161++ mucosal-associated invariant T cells (MAIT) expressing invariant TCR V?7.2. During HIV infection, circulating cells harbouring the signature of CD161+ cells are impaired in blood...
2010-01-01
...) Annual Statutory Financial Statement means the annual financial statement of an insurer prepared in accordance with Statutory Accounting Principles and submitted to the state insurance department if required... statement of an insurer prepared in accordance with Statutory Accounting Principles and submitted to the...
2010-07-01
... process; and/or transformed by chemical reaction into materials that are not organic hazardous air... good engineering judgement and standards, such as ANSI B31-3. In food/medical service means that a... meet written specifications, (2) An exothermic reaction which is a safety hazard, (3) The intended...
2010-04-01
....440(e) relating to the retention, recall, and destruction of human cells, tissues, and cellular and... a determination that a device is subject to a repair, replacement, or refund order or that a... standard or has a defect. § 1004.6, relating to plan for repurchase, repair, or replacement of an...
2010-07-01
.... (1) The primary purpose of this part is to specify the types and minimum amounts of data and...)(7). (2) This part also specifies the types and minimum amounts of data and information the Agency...) Finally, this part specifies the types and minimum amounts of data and information that an applicant for...
2010-01-01
... a form provided by the committee, for each week (Sunday through Saturday, or such other 7-day period...; (5) acidified; (6) Spanish olives; (7) Sicilian style olives; (8) Greek style olives; (9) olive oil...
2010-07-01
... conditioned to produce molten glass. The unit includes foundations, superstructure and retaining walls, raw... aerosols. Malfunction means any sudden failure of air pollution control equipment or process equipment or... melted by indirect heating. The openings of the vessels are in the outside wall of the furnace and are...
Yu, H; Yan, H; Li, J; Li, Z; Zhang, X; Ma, Y; Mei, L; Liu, C; Cai, L; Wang, Q; Zhang, F; Iwata, N; Ikeda, M; Wang, L; Lu, T; Li, M; Xu, H; Wu, X; Liu, B; Yang, J; Li, K; Lv, L; Ma, X; Wang, C; Li, L; Yang, F; Jiang, T; Shi, Y; Li, T; Zhang, D; Yue, W
2017-07-01
Many schizophrenia susceptibility loci have been identified through genome-wide association studies (GWASs) in European populations. However, until recently, schizophrenia GWASs in non-European populations were limited to small sample sizes and have yielded few loci associated with schizophrenia. To identify genetic risk variations for schizophrenia in the Han Chinese population, we performed a two-stage GWAS of schizophrenia comprising 4384 cases and 5770 controls, followed by independent replications of 13 single-nucleotide polymorphisms in an additional 4339 schizophrenia cases and 7043 controls of Han Chinese ancestry. Furthermore, we conducted additional analyses based on the results in the discovery stage. The combined analysis confirmed evidence of genome-wide significant associations in the Han Chinese population for three loci, at 2p16.1 (rs1051061, in an exon of VRK2, P=1.14 × 10 -12 , odds ratio (OR)=1.17), 6p22.1 (rs115070292 in an intron of GABBR1, P=4.96 × 10 -10 , OR=0.77) and 10q24.32 (rs10883795 in an intron of AS3MT, P=7.94 × 10 -10 , OR=0.87; rs10883765 at an intron of ARL3, P=3.06 × 10 -9 , OR=0.87). The polygenic risk score based on Psychiatric Genomics Consortium schizophrenia GWAS data modestly predicted case-control status in the Chinese population (Nagelkerke R 2 : 1.7% ~5.7%). Our pathway analysis suggested that neurological biological pathways such as GABAergic signaling, dopaminergic signaling, cell adhesion molecules and myelination pathways are involved in schizophrenia. These findings provide new insights into the pathogenesis of schizophrenia in the Han Chinese population. Further studies are needed to establish the biological context and potential clinical utility of these findings.
International Nuclear Information System (INIS)
Mueller, Carola J.; Schwarz, Ulrich; Doert, Thomas
2012-01-01
The polysulfides LnS_1_._9 and polyselenides LnSe_1_._9 of the lanthanide metals from gadolinium to thulium were prepared by high-pressure high-temperature synthesis. The compounds adopt the tetragonal CeSe_1_._9 structure type in space group P4_2/n (No. 86) with lattice parameters of 8.531 Aa ≤ a ≤ 8.654 Aa and 15.563 Aa ≤ c ≤ 15.763 Aa for the sulfides and 8.869 Aa ≤ a ≤ 9.076 Aa and 16.367 Aa ≤ c ≤ 16.611 Aa for the selenides. The atomic pattern consists of puckered double slabs [LnX]"+ and planar chalcogenide layers with ten possible chalcogen positions, of which eight are occupied by chalcogen atoms forming dinuclear X_2"2"- dianions, one by a single X"2"- ion and one remaining vacant. This resembles a √5 x √5 x 2 superstructure of the ZrSSi aristotype. Structural relationships to the aristotype and the related lanthanide polychalcogenides LnX_2_-_δ (Ln = La-Tm, X = S-Te, δ = 0 - 0.3) are discussed. The samples synthesized under high-pressure conditions (p > 1 GPa) decompose slowly under release of sulfur or selenium at ambient conditions. The crystal structure of a partially degraded thulium-polysulfide sample can be described as an incommensurate variant of the original TmS_1_._9 motif. Additionally, the isostructural ternary compound Gd(S_1_-_xSe_x)_1_._9 was synthesized and characterized by powder X-ray diffraction. (Copyright copyright 2012 WILEY-VCH Verlag GmbH and Co. KGaA, Weinheim)
Energy Technology Data Exchange (ETDEWEB)
Kisynska, K
1979-01-01
The Moessbauer technique was used to investigate the hyperfine interaction of /sup 161/Dy and /sup 151/Eu in cubic rare earth tungsten bronzes: Dysub(0.18)WO/sub 3/ and Eusub(0.18)WO/sub 3/. Well resolved hfs spectrum was obtained at 4.2 K for Dysub(0.18)WO/sub 3/. The effective hf field approximation sufficed to interpret the spectrum. The obtained hyperfine interaction parameters were: -g/sub 0/..beta..sub(N)Hsub(eff)=(805+-19) Mc/s and e/sup 2/qQ/sub 0//4 = (506+-56) Mc/s. These results imply that ground doublet of Dy/sup +3/ ion in bronze is a Kramers doublet Vertical Bar+-15/2> with asymmetrical hyperfine tensor Asub(z) non equal to 0, Asub(x) = Asub(y) = 0 and that local crystalline field at RE metal in tungsten bronze at 4.2 K cannot be cubic. From ME absorption spectra of Eusub(0.18)WO/sub 3/ taken at 4.2 K, 78 K and 300 K the values of quadrupole interaction constants for bronze lattice and its temperature dependence were obtained. These data indicate that a phase transition from the high temperature ideal perovskite structure to a distorted one occurs in RE bronzes and that the distortion concerns the nearest tungsten-oxygen environment of RE ion.
Development of new dosemeters of CaSO_4
International Nuclear Information System (INIS)
Santos, Ana Gabryele M. dos; Junot, Danilo O.; Souza, Divanizia N.
2016-01-01
Thermoluminescent dosimeters (TLDs) are widely used in in vivo dosimetry because of their simple production, viability for dose determination in difficult geometries and their reusability. The motivation of this work was to produce CaSO_4 crystals doped with thulium (Tm) and analyze their thermoluminescent (TL) properties. The crystals were produced by a variation of slow evaporation route, and TL curves showed emission peaks centered around 190 ° C and 320 ° C after irradiation with a "9"0Sr /"9"0Y source. Thermoluminescent properties such as linearity, reproducibility and fading were evaluated. The CaSO_4:Tm samples produced proved feasible for dosimetry purposes. (author)
Supercontinuum: broad as a lamp, bright as a laser, now in the mid-infrared
Moselund, Peter M.; Petersen, Christian; Dupont, Sune; Agger, Christian; Bang, Ole; Keiding, Søren R.
2012-06-01
Based on the experience gained developing our market leading visible spectrum supercontinuum sources NKT Photonics has built the first mid-infrared supercontinuum source based on modelocked picosecond fiber lasers. The source is pumped by a ~ 2 um laser based on a combination of erbium and thulium and use ZBLAN fibers to generate a 1.75-4.4 μm spectrum. We will present results obtained by applying the source for mid-infrared microscopy where absorption spectra can be used to identify the chemical nature of different parts of a sample. Subsequently, we discuss the possible application of a mid-IR supercontinuum source in other areas including infrared countermeasures.
Growth and optical properties of Tm:GdVO{sub 4} single crystal
Energy Technology Data Exchange (ETDEWEB)
Urata, Y.; Akagawa, K.; Wada, S.; Tashiro, H. [Photodynamics Research Center, Sendai (Japan). Inst. of Physical and Chemical Research; Suh, S.J.; Yoon, D.H. [Photodynamics Research Center, Sendai (Japan). Inst. of Physical and Chemical Research]|[Dept. of Metallurgical Engineering, Sung Kyun Kwan Univ. (Korea, Republic of); Fukuda, T. [Photodynamics Research Center, Sendai (Japan). Inst. of Physical and Chemical Research]|[Inst. for Materials Research, Tohoku Univ. (Japan)
1999-04-01
Thulium-doped gadolinium vanadate (Tm:GdVO{sub 4}) single crystal has been successfully grown by a modified Czochralski (CZ) technique. Effective distribution coefficient of Tm was determined to be 0.74. Absorption characterization was performed in the 800 nm region and the maximum absorption peak was found at 799 nm for {pi} polarization. Fluorescence spectra for tuning at the maximum absorption were obtained around 1.8-2.0 {mu}m region with 100 nm bandwidth. This suggests that a Tm:GdVO{sub 4} crystal is expected as a new promising LD pumped solid-state laser in the 2 {mu}m region. (orig.) 9 refs.
Reversed-phase thin-layer chromatography of the rare earth elements
International Nuclear Information System (INIS)
Kuroda, R.; Adachi, M.; Oguma, K.
1988-01-01
Partition chromatographic behaviour of the rare earth elements on C 18 bonded silica reversed-phase material has been investigated by thin-layer chromatography in methanol - lactate media. The rare earth lactato complexes are distributed and fractionated on bonded silica layers without ion-interaction reagents. The concentration and pH of lactate solution, methanol concentration and temperature have effects on the migration and resolution of the rare earth elements. The partition system is particularly suited to separate adjacent rare earths of middle atomic weight groups, allowing the separation of gadolinium, terbium, dysprosium, holmium, erbium and thulium to be achieved by development to 18 cm distance. (orig.)
TL process in europium doped alkaline earth sulphate phosphors- a review
International Nuclear Information System (INIS)
Bhatt, B.C.
2003-01-01
CaSO 4 doped with the rare earth (RE) ion dysprosium or thulium is used routinely as a thermoluminescent dosimeter (TLD) to monitor personal exposure to x- and γ-radiation. The CaSO 4 :Eu phosphor is potentially important for radio photoluminescence (RPL) and ultraviolet (UV) dosimetry. Eu 3+ → Eu 2+ conversion is suggested to play a pivotal role in UV and γ-ray induced thermoluminescence. However, there is disagreement among different workers on the mechanism of gamma and UV induced TL in this phosphor system. This paper will review the work reported on CaSO 4 :Eu and make effects to project overall picture on this phosphor system. (author)
The effect of La2O3 in Tm3+-doped germanate-tellurite glasses for ~2 μm emission
Peng, Ya-Pei; Yuan, Xinqiang; Zhang, Junjie; Zhang, Long
2014-01-01
A germanate-tellurite glass (GeO2-TeO2-K2O-Nb2O5-La2O3) with thulium doping has been investigated for application as a laser material around 2.0 μm regions. Under the 808 nm laser diode pumped, intense 1.8 μm emission is obtained. Based on the absorption spectra, radiative properties are predicted using Judd-Ofelt theory. The maximum value of emission cross-section of Tm3+ around 1.8 μm can reach 1.46 × 10−20 cm2, which indicated that the germanate-tellurite glass may provide high gain as a g...
International Nuclear Information System (INIS)
Kurcewicz, J.; Farinon, F.; Geissel, H.; Pietri, S.; Nociforo, C.; Prochazka, A.; Weick, H.; Winfield, J.S.; Estradé, A.; Allegro, P.R.P.; Bail, A.; Bélier, G.; Benlliure, J.; Benzoni, G.; Bunce, M.; Bowry, M.; Caballero-Folch, R.
2012-01-01
Using the high-resolution performance of the fragment separator FRS at GSI we have discovered 60 new neutron-rich isotopes in the atomic number range of 60⩽Z⩽78. The new isotopes were unambiguously identified in reactions with a 238 U beam impinging on a Be target at 1 GeV/nucleon. The production cross-section for the new isotopes have been measured down to the pico-barn level and compared with predictions of different model calculations. For elements above hafnium fragmentation is the dominant reaction mechanism which creates the new isotopes, whereas fission plays a dominant role for the production of the new isotopes up to thulium.
Review of structure damping values for elastic seismic analysis of nuclear power plants
International Nuclear Information System (INIS)
Hashimoto, P.S.; Steele, L.K.; Johnson, J.J.; Mensing, R.W.
1993-03-01
Current US Nuclear Regulatory Commission guidance on structure damping values for elastic seismic design analysis of nuclear power plants are contained in Regulatory Guide 1.61 (R.G. 1.61). The objectives of the study described in this report are to investigate the adequacy of R.G1.61 structure damping values based on currently available data, and to recommend revisions to R.G. 1.61 as appropriate. Measured structure damping values, and associated structure, foundation, excitation, and input/response parameters, were collected and compiled. These data were analyzed to identify the parameters that significantly influence structure damping and to quantify structure damping in terms of these parameters. Based on this study, current R.G. 1.61 damping values for structure design are either adequate, or require only minor revision, depending on the structure material. More explicit guidance on structure damping values for seismic analysis to determine input to equipment has been prepared, along with other recommendations to improve the applicability of R.G. 1.61
Kuriki, Kiyonori; Hirose, Kaoru; Matsuo, Keitaro; Wakai, Kenji; Ito, Hidemi; Kanemitsu, Yukihide; Hirai, Takashi; Kato, Tomoyuki; Hamajima, Nobuyuki; Takezaki, Toshiro; Suzuki, Takeshi; Saito, Toshiko; Tanaka, Rie; Tajima, Kazuo
2006-11-01
The peroxisome proliferator-activated receptor gamma (PPARgamma) gene plays important roles in energy homeostasis. To examine interactions between consumption of foods and fatty acids and the Pro12Ala and C161T (His447His) polymorphisms for colorectal cancer, we performed two case-control studies in Japanese. In study 1, there were 128 colorectal cancer cases and 238 non-cancer controls, and in study 2 there were 257 cases and 771 (age- and sex-matched) non-cancer controls. Assessment of food and nutrients consumption in study 1 was via a nine-item questionnaire, while in study 2 assessment of consumption was according to a more detailed semiquantitative food frequency questionnaire. Consumption of foods and fatty acids was divided into low, moderate and high groups. The overall frequency of the Ala allele was frequencies of the Pro/Pro + C/C and Pro/Pro + (C/T + T/T) genotypes were 70-73% and 20-26%, respectively. Compared with subjects with low meat intake and the Pro/Pro + C/C genotype, those with high meat consumption and the same genotype had a stronger increased risk in study 1 [OR, 2.88; 95% CI, 1.14-7.30; P for trend = 0.02], but a positive association with processed meat consumption was greatest in those with the Pro/Pro + (C/T + T/T) genotype (P for trend = 0.05) in study 2. Likewise, high consumption of saturated fatty acids and milk appeared to confer marginal increased risk and stronger decreased risk, respectively, in those with the Pro/Pro and Pro/Pro + C/C genotypes (OR, 1.35 and 0.65; 95% CI, 0.93-1.96 and 0.43-1.00; P for trend = 0.10 and 0.06). Further large-scale studies are needed to determine colorectal cancer risk according to relationships between the PPARgamma gene polymorphisms and dietary intakes of meat, processed meat, milk and saturated fatty acids in Japanese with very low frequency of the Ala allele.
Indian Academy of Sciences (India)
Plant Pathology
Supplementary data: Table 1. Identification of various virulence factors in R. solanacearum: Rs-09-161, Rs-10-244, GMI1000. Gene name Rs-09-161 locus tag*. Accession no. Rs-10-244 locus tag*. Accesion no. GMI1000 locus tag. Location. Gene description. Exopolysacharide. epsA. RALSO161_m00209880 KY661391 ...
High resolution Holocene paleomagnetic secular variation records from Bay of Bengal
Digital Repository Service at National Institute of Oceanography (India)
Usapkar, A.; Dewangan, P.; Badesab, F.K.; Mazumdar, A.; Ramprasad, T.; Krishna, K.S.; Basavaiah, N.
/8 probably due to local effects. Paleoinclination records of MD161/8, MD161/11 and MD161/13 show a low between ~2.4 and 2.0 cal. kyr BP, an increase between 2.0 and 1.4 cal. kyr BP and a decrease towards the present. To varying degrees these trends can...
Directory of Open Access Journals (Sweden)
Mauritz Vestberg
2012-03-01
Full Text Available The impact of host mycotrophy on arbuscular mycorrhizal fungal (AMF markers was studied in a temperate agricultural soil cropped with mycorrhizal barley, flax, reed canary-grass, timothy, caraway and quinoa and non-mycorrhizal buckwheat, dyer's woad, nettle and false flax. The percentage of AMF root colonization, the numbers of infective propagules by the Most Probable Number (MPN method, and the amounts of signature Phospholipid Fatty Acid (PLFA 16:1ω5 and Neutral Lipid Fatty Acid (NLFA 16:1ω5 were measured as AMF markers. Crop had a significant impact on MPN levels of AMF, on NLFA 16:1ω5 levels in bulk and rhizosphere soil and on PLFA 16:1ω5 levels in rhizosphere soil. Reed canary-grass induced the highest levels of AMF markers. Mycorrhizal markers were at low levels in all non-mycorrhizal crops. NLFA 16:1ω5 and the ratio of NLFA to PLFA 16:1ω5 from bulk soil are adequate methods as indicators of AMF biomass in soil.
Reference: 161 [Arabidopsis Phenome Database[Archive
Lifescience Database Archive (English)
Full Text Available ids, based on thin layer chromatography. The identity of the Ala, Asp, Phe, and T...rp conjugates was verified by gas chromatography-mass spectrometry. Insertional mutations in GH3.1, GH3.2, G
40 CFR 417.161 - Specialized definitions.
2010-07-01
... line to maintain minimal product quality. (f) The term BOD7 shall mean the biochemical oxygen demand as... apply to this subpart. (b) The term anhydrous product shall mean the theoretical product that would result if all water were removed from the actual product. (c) The term surfactant shall mean those...
29 CFR 1952.161 - Developmental schedule.
2010-07-01
... standards—July 1973. (e) Development of training program for employers and employees—October 1974. (f) Complete hiring of additional staff—April 1975. (g) Basic training of staff—May 1975. (h) Development of approved Manual MIS—July 1972. (i) Commencement of compliance activities—July 1972. (j) Development of...
21 CFR 161.145 - Canned oysters.
2010-04-01
... evenly over the meshes of a circular sieve which has been previously weighed. The diameter of the sieve... such quantity is 3 pounds or more. The bottom of the sieve is woven-wire cloth that complies with the specifications for such cloth set forth under “2.38 mm (No. 8)” in “Official Methods of Analysis of the...
Publications | Page 161 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The direction of healthcare service development, particularly at the. ... distance education : sub-project 6; quality assurance models, standards and key performance ... disaster response flood management and recovery, and whether the flood.
2010-04-01
.... (a) Identity. (1) Canned tuna is the food consisting of processed flesh of fish of the species... deemed to be safe if it is not a food additive as defined in section 201(s) of the Federal Food, Drug, and Cosmetic Act (the act), or if it is a food additive as so defined, it is used in conformity with...
Vegetation - Suisun Marsh 2000 [ds161
California Natural Resource Agency — This vegetation mapping project of Suisun Marsh blends ground-based classification, aerial photo interpretation, and GIS editing and processing. The method is based...
40 CFR 82.161 - Technician certification.
2010-07-01
... shall address the subject areas listed in appendix D. (c) Program Approval. Persons may seek approval of... the closed-book certification exam, within 30 days. Programs providing Type I certification using the... percent or higher on the certification exam, no later than 30 days after the program has received the exam...
African Journals Online (AJOL)
userpc
the constituents of volatile matter, long cha branched chain ... drugs have been isolated from natural sourc notably from plant ... retention time (RT), molecular formular, molecular weight .... Agilent. Technology) at Chemistry Department, Bayero.
Energy Technology Data Exchange (ETDEWEB)
None
2012-05-01
Biannual newsletter for the U.S. Department of Energy's Clean Cities initiative. The newsletter includes feature stories on advanced vehicle deployment, idle reduction, and articles on Clean Cities coalition successes across the country.
Dosimetric properties of Li2 B4 O7: Tm pellets
International Nuclear Information System (INIS)
Rzyski, B.M.; Morato, S.P.
1987-10-01
Pellets produced out of thulium doped lithium tetraborate, (Li 2 B 4 O 7 :Tm), for thermoluminescent, (TL), dosimetry present low sensibility to environment conditions. Humidity, ambiet temperature, fading and handling during TL reading have almost no influence on the TL properties of the pellets prepared according the receipt given in this paper. The structure of the TL glow curve for the irradiated Li 2 B 4 O 7 : Tm pellet is rather simple and the TL response is linear in the range of 3x10 -4 to 7x10 2 Gy. The dosimetric properties of Li 2 B 4 O 7 : Tm in pellet form makes it a competitor with other TL phosphors. (author) [pt
Comparison of different wavelength pump sources for Tm subnanosecond amplifier
Cserteg, Andras; Guillemet, Sébastien; Hernandez, Yves; Giannone, Domenico
2012-06-01
We report here a comparison of different pumping wavelengths for short pulse Thulium fibre amplifiers. We compare the results in terms of efficiency and required fibre length. As we operate the laser in the sub-nanosecond regime, the fibre length is a critical parameter regarding non linear effects. With 793 nm clad-pumping, a 4 m long active fibre was necessary, leading to strong spectral deformation through Self Phase Modulation (SPM). Core-pumping scheme was then more in-depth investigated with several wavelengths tested. Good results with Erbium and Raman shifted pumping sources were obtained, with very short fibre length, aiming to reach a few micro-joules per pulse without (or with limited) SPM.
Synthesis and thermoluminescence properties of CaF2:Tm,Ce nanoparticles
Directory of Open Access Journals (Sweden)
M Zahedifar
2013-10-01
Full Text Available Calcium fluoride nanoparticles doped with thulium and cerium were synthesized as a novel nanostructure by using the hydrothermal method. The prepared samples were characterized by X-ray diffraction (XRD and energy dispersive spectrometer (EDS. The crystallite size of about 36 nm was estimated employing Scherer’s formula. Its shape and size were also observed by scanning electron microscope (SEM. Computerized glow curve deconvolution (CGCD technique revealed two overlapping thermoluminescence glow peaks at around 402 and 457 K in the complex thermoluminescence glow curve of this phosphor. Other thermoluminescence characteristics of this phosphor such as fading, reuseability and dose response recommend it as a good candidate for high dose dosimetry.
The effect of La2O3 in Tm3+-doped germanate-tellurite glasses for ~2 μm emission
Peng, Ya-Pei; Yuan, Xinqiang; Zhang, Junjie; Zhang, Long
2014-06-01
A germanate-tellurite glass (GeO2-TeO2-K2O-Nb2O5-La2O3) with thulium doping has been investigated for application as a laser material around 2.0 μm regions. Under the 808 nm laser diode pumped, intense 1.8 μm emission is obtained. Based on the absorption spectra, radiative properties are predicted using Judd-Ofelt theory. The maximum value of emission cross-section of Tm3+ around 1.8 μm can reach 1.46 × 10-20 cm2, which indicated that the germanate-tellurite glass may provide high gain as a good medium for efficient 1.8 μm laser system.
Binary blend of carbon dioxide and fluoro ethane as working fluid in transcritical heat pump systems
Directory of Open Access Journals (Sweden)
Zhang Xian-Ping
2015-01-01
Full Text Available As an eco-friendly working fluid, carbon dioxide or R744 is expected to substitute for the existing working fluids used in heat pump systems. It is, however, challenged by the much higher heat rejection pressure in transcritical cycle compared with the traditional subcritical cycle using freons. There exists a worldwide tendency to utilize blend refrigerants as alternatives. Therefore, a new binary blend R744/R161 in this research is proposed in order to decrease the heat rejection pressure. Meanwhile, on mixing R744 with R161, the flammability and explosivity of R161 can be suppressed because of the extinguishing effect of R744. A transcritical thermodynamic model is developed, and then the system performances of heat pump using R744/R161 blend are investigated and compared with those of pure R744 system under the same operation conditions. The variations of heat rejection pressure, heating coefficient of performance, unit volumetric heating capacity, discharge temperature of compressor and the mass fraction of R744/R161 are researched. The results show that R744/R161 mixture can reduce the heat rejection pressure of transcritical heat pump system.
Directory of Open Access Journals (Sweden)
Joan Lluís Pérez Francesch
2008-01-01
Full Text Available El objeto del presente trabajo es estudiar el procedimiento de impugnación de disposiciones y resoluciones autonómicas, regulado en el Título V de la LOTC, en desarrollo del art. 161.2 CE. En dicho proceso, el Gobierno goza de la legitimación activa para impugnar cualquier actividad infralegal, normativa o no, de una Comunidad Autónoma, por motivo de una inconstitucionalidad no competencial. Se trata de una impugnación residual de otros procedimientos, como el recurso de inconstitucionalidad o los conflictos positivos de competencia, todos en manos del Gobierno para activarlos. Este ostenta, así, importantes instrumentos para frenar la actividad de las Comunidades Autónomas en su integridad, en una asimetría procesal que dota a los órganos centrales de unos poderes «preventivos» no imprescindibles. De esta manera, se manifiesta una concepción de la organización territorial del Estado español, no deferente con las Comunidades Autónomas. El desarrollo extensivo que se ha realizado del art. 161.2 CE, asignándose al Gobierno central un papel prepotente y asimétrico respecto de los órgano autonómicos, se estudia desde la perspectiva técnico-jurídica del procedimiento jurisdiccional concretado en el Título V de la LOTC y desde el trasfondo político del mismo, que tiene su máxima expresión en el auto que inadmite la impugnación contra el «Plan Ibarretxe » (Auto 135/2004, de 20 de abril. Se estudian todos los casos—realmente variados—en los que se ha realizado una impugnación al amparo del Título V de la LOTC, en los que, sin embargo, destaca la capacidad para suspender la disposición o resolución autonómica por el sólo hecho de iniciarse el procedimiento. Este efecto suspensivo inmediato le aleja de la figura de la medida cautelar. Por otro lado, la impugnación de disposiciones sin rango de ley y de resoluciones, disposiciones o actos autonómicos tiene su campo de acción en el seno de la jurisdicci
International Nuclear Information System (INIS)
Feng, Lejun; Zheng, Danxing; Huang, Weijia
2016-01-01
Highlights: • Three new working pairs are proposed for absorption power cycle. • Sync-measured the solubility and absorption enthalpy data at 303.15 K. • Thermokinetic experiment is consistent with the previous thermodynamics study. - Abstract: In this work, three new working pairs, {fluoroethane (HFC161) + dimethylether tetraethylene glycol (DMETEG)}, {HFC161 + dimethylether triethylene glycol (DMETrEG)} and {HFC161 + dimethylether diethylene glycol (DMEDEG)}, are proposed for absorption power cycle. The working pairs are assessed from both thermodynamics and thermokinetic perspective. By combining the microcalorimetry and isothermal synthesis methods, an experimental apparatus was developed to simultaneously obtain the microcalorimetry and vapour–liquid equilibrium data. Then, the solubility and absorption enthalpy data of the three new working pairs were sync-measured at 303.15 K by this sync-measurement experimental apparatus. The thermodynamics data indicated that the affinities of the three working pairs increased from strong to weak in the following order: HFC161 + DMETEG > HFC161 + DMETrEG > HFC161 + DMEDEG. Then the thermokinetic parameters of the absorption rate constant and activation energy were analysed based on the thermokinetic experiment at (303.15, 313.15, 323.15, and 333.15) K. As a result, the affinities of the three working pairs are consistent with the previous thermodynamics study. In addition, the intermolecular interactions within the three systems were analysed according to the intermolecular hydrogen bonds; overall, the (HFC161 + DMETEG) system is considered to be the potential option for applications.
Mechanism of the Ca2+-induced enhancement of the intrinsic factor VIIa activity
DEFF Research Database (Denmark)
Bjelke, Jais R; Olsen, Ole H; Fodje, Michel
2008-01-01
between the loop and Lys(161) in the N-terminal tail. In support of the first mechanism, the mutations E296V and D212N resulted in similar, about 2-fold, enhancements of the amidolytic activity. Moreover, mutation of the Lys(161)-interactive residue Asp(217) or Asp(219) to Ala reduced the amidolytic...... activity by 40-50%, whereas the K161A mutation resulted in 80% reduction. Hence one of these Asp residues in the Ca(2+)-binding loop appears to suffice for some residual interaction with Lys(161), whereas the more severe effect upon replacement of Lys(161) is due to abrogation of the interaction with the N......-terminal tail. However, Ca(2+) attenuation of the repulsion between Asp(212) and Glu(296) keeps the activity above that of apoFVIIa. Altogether, our data suggest that repulsion involving Asp(212) in the Ca(2+)-binding loop suppresses FVIIa activity and that optimal activity requires a favorable interaction...
DEFF Research Database (Denmark)
Olsson, P.A.; Bååth, E.; Jakobsen, I.
1997-01-01
The distribution of an arbuscular mycorrhizal (AM) fungus between soil and roots, and between mycelial and storage structures, was studied by use of the fatty acid signature 16:1 omega 5. Increasing the soil phosphorus level resulted in a decrease in the level of the fatty acid 16:1 omega 5...... in the soil and roots. A similar decrease was detected by microscopic measurements of root colonization and of the length of AM fungal hyphae in the soil. The fatty acid 16:1 omega 5 was estimated from two types of lipids, phospholipids and neutral lipids, which mainly represent membrane lipids and storage...... lipids, respectively. The numbers of spores of the AM fungus formed in the soil correlated most closely, with neutral lipid fatty acid 16:1 omega 5, whereas the hyphal length in the soil correlated most closely with phospholipid fatty acid 16:1 omega 5. The fungal neutral lipid/phospholipid ratio...
Directory of Open Access Journals (Sweden)
Lucy Jane Walker
2013-08-01
Full Text Available The T cell co-receptor CD8αβ enhances T cell sensitivity to antigen, however studies indicate CD8αα has the converse effect and acts as a co-repressor. Using a combination of Thymic Leukaemia antigen (TL tetramer, which directly binds CD8αα, anti-CD161 and anti-Vα7.2 antibodies we have been able for the first time to clearly define CD8αα expression on human CD8 T cells subsets. In healthy controls CD8αα is most highly expressed by CD161 bright (CD161++ mucosal associated invariant T (MAIT cells, with CD8αα expression highly restricted to the TCR Vα7.2+ cells of this subset. We also identified CD8αα-expressing populations within the CD161 mid (CD161+ and negative (CD161- non-MAIT CD8 T cell subsets and show TL-tetramer binding to correlate with expression of CD8β at low levels in the context of maintained CD8α expression (CD8α+CD8βlow. In addition, we found CD161-CD8α+CD8βlow populations to be significantly expanded in the peripheral blood of HIV-1 and hepatitis B (mean of 47% and 40% of CD161- T cells respectively infected individuals. Such CD8αα expressing T cells are an effector-memory population (CD45RA-, CCR7-, CD62L- that express markers of activation and maturation (HLA-DR+, CD28-, CD27-, CD57+ and are functionally distinct, expressing greater levels of TNF-α and IFN-γ on stimulation and perforin at rest than their CD8α+CD8βhigh counterparts. Antigen-specific T cells in HLA-B*4201+HIV-1 infected patients are found within both the CD161-CD8α+CD8βhigh and CD161-CD8α+CD8βlow populations. Overall we have clearly defined CD8αα expressing human T cell subsets using the TL-tetramer, and have demonstrated CD161-CD8α+CD8βlow populations, highly expanded in disease settings, to co-express CD8αβ and CD8αα. Co-expression of CD8αα on CD8αβ T cells may impact on their overall function in-vivo and contribute to the distinctive phenotype of highly differentiated populations in HBV and HIV-1 infection.
International Nuclear Information System (INIS)
Ukraintseva, Eh.A.; Sokolova, N.P.; Logvinenko, V.A.
1991-01-01
Temperature dependence of water vapour equilibrium pressure over the compounds of ErCl 3 ·6H-2O, TmCl 3 ·6H 2 O and LuCl 3 ·6H 2 O is studied by membrane method within the temperature range of 309-403 K. Dehydration process stoichiometry is determined thermogravimetrically under quasi-equilibrium conditions. All three compounds split off three molecules at the first stage of dehydration. ErCl 3 ·6H 2 O and TmCl 2 ·6H 2 O are very similar to terbium and disprosium chloride hexahydrates by vapour pressure value and dehydration enthalpy; enthalpy of the first dehydration stage is of the same character as those of nedymium, gadolinium and holmium chloride haxahydrates
Directory of Open Access Journals (Sweden)
Daniel Labrador Labrador
2009-12-01
Full Text Available La realización de este trabajo tiene como propósito lograr un acercamiento a un grupo poblacional que en estos momentos constituye uno de los más numerosos en nuestro país, el adulto mayor. En el trabajo se analizó la situación de salud de la población del consultorio médico161 perteneciente al área de salud del Policlínico Docente Comunitario Raúl Sánchez en Pinar Del Río..Nos posibilitó acercarnos a la realidad social de nuestro entorno, aportando un enriquecimiento espiritual al profundizar en el estudio de las conductas y de poder cooperar para erradicarlas y así modificar estilos de vida y hacer de nuestro medio social un espacio seguro. A través de métodos empíricos se realizó el acercamiento a la población, identificando las causas de uno de los principales problemas de la comunidad (la falta de incorporación de los adultos mayores al círculo de abuelos a través de lluvia de ideas se elaboró un plan de acción con participación intersectorial y comunitaria con el objetivo de que este problema dejara de ser uno de los principales de esta comunidad en el no solo se realizarán actividades físicas también otras donde estarán involucrados en su desarrollo médico, enfermera, representantes comunitarios apoyando al técnico de cultura física que se desempeña en ese consultorio.
Magnetic order and crystal fields in the Pnma phases of Tm2BaTO5(T=Co and Ni)
International Nuclear Information System (INIS)
Harker, S.J.; Stewart, G.A.
2000-01-01
The magnetic ordering and crystal field interactions of the Pnma phases of both Tm 2 BaCoO 5 and Tm 2 BaNiO 5 are investigated by 169 Tm Moessbauer spectroscopy and the temperature-dependent hyperfine interactions are compared with those obtained elsewhere for Tm 2 BaCuO 5 . The Pnma phases are shown to order magnetically at temperatures of 3.5(2) K (Tm 2 BaCoO 5 ) and 4.85(5) K (Tm 2 BaNiO 5 ), the order being induced by the transition metal. For Tm 2 BaNiO 5 an additional first-order transition observed at T≤1.4 K is identified with the independent magnetic order of the thulium sub-lattice. (orig.)
The effect of La2O3 in Tm3+-doped germanate-tellurite glasses for ~2 μm emission
Peng, Ya-Pei; Yuan, Xinqiang; Zhang, Junjie; Zhang, Long
2014-01-01
A germanate-tellurite glass (GeO2-TeO2-K2O-Nb2O5-La2O3) with thulium doping has been investigated for application as a laser material around 2.0 μm regions. Under the 808 nm laser diode pumped, intense 1.8 μm emission is obtained. Based on the absorption spectra, radiative properties are predicted using Judd-Ofelt theory. The maximum value of emission cross-section of Tm3+ around 1.8 μm can reach 1.46 × 10−20 cm2, which indicated that the germanate-tellurite glass may provide high gain as a good medium for efficient 1.8 μm laser system. PMID:24918516
Energy Technology Data Exchange (ETDEWEB)
Kurcewicz, J., E-mail: j.kurcewicz@gsi.de [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Farinon, F.; Geissel, H. [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, 35392 Giessen (Germany); Pietri, S.; Nociforo, C. [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Prochazka, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Justus-Liebig-Universitaet Giessen, 35392 Giessen (Germany); Weick, H.; Winfield, J.S. [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Estrade, A. [GSI Helmholtzzentrum fuer Schwerionenforschung, 64291 Darmstadt (Germany); Astronomy and Physics Department, Saint Mary' s University, Halifax, Nova Scotia B3H 3C3 (Canada); Allegro, P.R.P. [Institute of Physics, Universidade de Sao Paulo, CEP 05508-090 Cidade Universitaria, Sao Paulo (Brazil); Bail, A.; Belier, G. [CEA DAM DiF, 91290 Arpajon Cedex (France); Benlliure, J. [Universidad de Santiago de Compostela, E-15706 Santiago de Compostella (Spain); Benzoni, G. [INFN sezione di Milano, I-20133 Milano (Italy); Bunce, M.; Bowry, M. [Department of Physics, University of Surrey, Guildford, Surrey, GU2 7XH (United Kingdom); Caballero-Folch, R. [Universitat Politecnica de Catalunya, 08034 Barcelona (Spain); and others
2012-10-31
Using the high-resolution performance of the fragment separator FRS at GSI we have discovered 60 new neutron-rich isotopes in the atomic number range of 60 Less-Than-Or-Slanted-Equal-To Z Less-Than-Or-Slanted-Equal-To 78. The new isotopes were unambiguously identified in reactions with a {sup 238}U beam impinging on a Be target at 1 GeV/nucleon. The production cross-section for the new isotopes have been measured down to the pico-barn level and compared with predictions of different model calculations. For elements above hafnium fragmentation is the dominant reaction mechanism which creates the new isotopes, whereas fission plays a dominant role for the production of the new isotopes up to thulium.
Pervez, Anushey; Kinney, Janet S; Gwozdek, Anne; Farrell, Christine M; Inglehart, Marita R
2016-09-01
In 2005, Public Act No. 161 (PA 161) was passed in Michigan, allowing dental hygienists to practice in approved public dental prevention programs to provide services for underserved populations while utilizing a collaborative agreement with a supervising dentist. The aims of this study were to assess how well dental and dental hygiene students and faculty members and practicing dental hygienists have been educated about PA 161, what attitudes and knowledge about the act they have, and how interested they are in additional education about it. University of Michigan dental and dental hygiene students and faculty members, students in other Michigan dental hygiene programs, and dental hygienists in the state were surveyed. Respondents (response rate) were 160 dental students (50%), 63 dental hygiene students (82%), 30 dental faculty members (26%), and 12 dental hygiene faculty members (52%) at the University of Michigan; 143 dental hygiene students in other programs (20%); and 95 members of the Michigan Dental Hygienists' Association (10%). The results showed that the dental students were less educated about PA 161 than the dental hygiene students, and the dental faculty members were less informed than the dental hygiene faculty members and dental hygienists. Responding dental hygiene faculty members and dental hygienists had more positive attitudes about PA 161 than did the students and dental faculty members. Most of the dental hygiene faculty members and dental hygienists knew a person providing services in a PA 161 program. Most dental hygiene students, faculty members, and dental hygienists wanted more education about PA 161. Overall, the better educated about the program the respondents were, the more positive their attitudes, and the more interested they were in learning more.
African Journals Online (AJOL)
a tu N = 30 oca a una ve. Ref. 12. 164.3. 102.8". 182.28. 160.8. 99 1". 162.09. 104.1. 154.7. 104.0. 120.3. 128.3. 16.0. 161.I. 116.0. 128.3. 165.0. 103.5. 183.0. 161.9. 99.7. 162.7. 104.8. 155.3. 104.5. 120.8. 129.1. 116.6. 161.4. 116.6. 129.1. Chemical shifts with the same subscript are interchangeable. The 'H NMR spectrum ...
50 CFR 300.161 - Alternatives and exceptions.
2010-10-01
..., must reflect that number or label. (4) A conveyance (truck, plane, boat, etc.) is not considered a... shipping documents; (2) Fish or shellfish contained in retail consumer packages labeled pursuant to the...
Practice Bulletin No. 161: External Cephalic Version.
2016-02-01
In the United States, there is a widespread belief that the overall cesarean delivery rate is higher than necessary. Efforts are being directed toward decreasing the number of these procedures, in part by encouraging physicians to make changes in their management practices. Because breech presentations are associated with a high rate of cesarean delivery, there is renewed interest in techniques such as external cephalic version (ECV) and vaginal breech delivery. The purpose of this document is to provide information about ECV by summarizing the relevant evidence presented in published studies and to make recommendations regarding its use in obstetric practice.
22 CFR 161.7 - Categories of actions.
2010-04-01
... individuals, and facilitating trade opportunities abroad and U.S. business expansion in foreign markets; (2... documents and delivering retirement checks, social security payments and veterans benefits; (3) Conduct of... international bridges and pipeline (see Executive Order 11423 and the International Bridge Act of 1972 (Pub. L...
161 Teachers' Continuing Professional Development as Correlates ...
African Journals Online (AJOL)
User
development on universal basic education in Bayelsa State, Nigeria. Using descriptive ... constitutes an enduring career development process which is very crucial in the overall .... affect their roles and their student's production. Accordingly ...
Search Results | Page 161 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
... Apply Morocco filter · Thailand 35 Apply Thailand filter · Guatemala 33 Apply Guatemala filter .... ICTs for Micro, Small and Medium Enterprise Development in Egypt ... to craft policies for fruitful integration into the global economy and inclusive growth. ... However, poverty is still widespread and the government admits that ...
Navas, Javier; Sánchez-Coronilla, Antonio; Aguilar, Teresa; De los Santos, Desireé M; Hernández, Norge C; Alcántara, Rodrigo; Fernández-Lorenzo, Concha; Martín-Calleja, Joaquín
2014-11-07
This is an experimental and theoretical study of thulium doped TiO2 nanoparticles. From an experimental perspective, a method was used to synthesize thulium-doped TiO2 nanoparticles in which Tm(3+) replaces Ti(4+) in the lattice, which to our knowledge has neither been reported nor studied theoretically so far. Different proportions of anatase and rutile phases were obtained at different annealing temperatures, and XRD and Raman spectroscopy also revealed the presence of a pyrochlore phase (Tm2Ti2O7) at 1173 K. Thus, the structure of the Tm-doped nanoparticles was thermally-controlled. Furthermore, XPS showed the presence of Tm(3+) in the samples synthesized, which produces oxygen vacancies to maintain the local neutrality in the lattice. The presence of Tm(3+) in the samples led to changes in the UV-Vis absorption spectra, so they showed photoluminescence properties and new states in the band gap, which produce a new lower energy electronic transition than the main TiO2 one. Periodic DFT calculations were performed to understand the experimentally produced structures. The production of oxygen vacancies was analysed and the changes generated in the structure were fully detailed. The DOS and PDOS analyses confirmed the experimental results obtained using UV-Vis spectroscopy, and showed that the new electronic states in the band gap are due to interactions of the f state of Tm and the p state of O. Likewise, the charge study and the ELF analysis indicate that when Tm is introduced into the TiO2 structure, the Ti-O bond around the oxygen vacancy is strengthened. Finally, an example of a photocatalytic application was developed to show the high efficiency of the samples due to the heterojunction in the interfaces of the phases in the samples, which improved the charge separation and the good charge carrier mobility due to the presence of the pyrochlore phase, as was also shown theoretically.
Directory of Open Access Journals (Sweden)
Qin Ping Yu
2017-12-01
Full Text Available Objective This experiment investigated meat color, myoglobin content, enzyme activities, and expression of genes associated with oxidative potential of pigs slaughtered at different growth stages. Methods Sixty 4-week-old Duroc×Landrace×Yorkshire pigs were assigned to 6 replicate groups, each containing 10 pigs. One pig from each group was sacrificed at day 35, 63, 98, and 161 to isolate longissimus dorsi and triceps muscles. Results Meat color scores were higher in pigs at 35 d than those at 63 d and 98 d (p<0.05, and those at 98 d were lower than those at 161 d (p<0.05. The total myoglobin was higher on 161 d compared with those at 63 d and 98 d (p<0.05. Increase in the proportions of metmyoglobin and deoxymyoglobin and a decrease in oxymyoglobin were observed between days 35 and 161 (p<0.05. Meat color scores were correlated to the proportion of oxymyoglobin (r = 0.59, p<0.01, and negatively correlated with deoxymyoglobin and metmyoglobin content (r = −0.48 and −0.62, p<0.05. Malate dehydrogenase (MDH activity at 35 d and 98 d was higher than that at 161 d (p<0.05. The highest lactate dehydrogenase/MDH ratio was achieved at 161 d (p<0.05. Calcineurin mRNA expression decreased at 35 d compared to that at 63 d and 98 d (p<0.05. Myocyte enhancer factor 2 mRNA results indicated a higher expression at 161 d than that at 63 d and 98 d (p<0.05. Conclusion Porcine meat color, myoglobin content, enzyme activities, and genes associated with oxidative potential varied at different stages.
808-nm diode-pumped continuous-wave Tm:GdVO4 laser at room temperature
Urata, Yoshiharu; Wada, Satoshi
2005-05-01
A high-quality gadolinium vanadate (GdVO4) crystal with 7-at. % thulium as the starting material was grown by the Czochralski technique. The measured absorption spectra exhibited sufficient absorption coefficients for laser diodes (LDs) for neodymium laser pumping: 6.0 cm^-1 for pi polarization and 6.2 cm^-1 for sigma polarization at 808 nm. Laser oscillation was carried out with single-stripe 808-nm LDs in an end-pumping configuration. A slope efficiency of 28% and a threshold of 750 mW were exhibited with respect to the absorbed pump power. An output power of 420 mW was achieved at an absorbed power of 2.4 W. It was demonstrated that Tm:GdVO4 is a useful material for 2-μm lasers, particularly in a compact LD-pumped system.
Electrodeposition of Actinide and Lanthanide Elements
International Nuclear Information System (INIS)
Baerring, N.E.
1966-02-01
Some deposition parameters for the quantitative electrodeposition of hydrolysis products of plutonium were qualitatively studied at trace concentrations of plutonium. The hydrogen ion concentration, the current and the electrolysis time proved to be the determining factors in the quantitative electrolytic precipitation of plutonium, while other factors such as cathode material, the pretreatment of the cathode surface, the nature of the electrolytic anion, and the oxidation state of plutonium in the starting solution were found to be of less importance. The conditions selected for quantitative electrodeposition of plutonium from slightly acid nitrate solutions on a stainless steel cathode were successfully tried also with uranium, neptunium, americium, cerium and thulium. Details of a procedure used for plating mg amounts of plutonium and neptunium on small stainless steel cylinders are also given
Electrodeposition of Actinide and Lanthanide Elements
Energy Technology Data Exchange (ETDEWEB)
Baerring, N E
1966-02-15
Some deposition parameters for the quantitative electrodeposition of hydrolysis products of plutonium were qualitatively studied at trace concentrations of plutonium. The hydrogen ion concentration, the current and the electrolysis time proved to be the determining factors in the quantitative electrolytic precipitation of plutonium, while other factors such as cathode material, the pretreatment of the cathode surface, the nature of the electrolytic anion, and the oxidation state of plutonium in the starting solution were found to be of less importance. The conditions selected for quantitative electrodeposition of plutonium from slightly acid nitrate solutions on a stainless steel cathode were successfully tried also with uranium, neptunium, americium, cerium and thulium. Details of a procedure used for plating mg amounts of plutonium and neptunium on small stainless steel cylinders are also given.
Radioluminescence of rare-earth doped aluminum oxide
Energy Technology Data Exchange (ETDEWEB)
Santiago, M.; Molina, P. [Universidad Nacional del Centro de la Provincia de Buenos Aires, Instituto de Fisica Arroyo Seco, Pinto 399, 7000 Tandil (Argentina); Barros, V. S.; Khoury, H. J.; Elihimas, D. R., E-mail: msantiag@exa.unicen.edu.ar [Universidade Federal de Pernambuco, Departamento de Energia Nuclear, Av. Prof. Luiz Freire 1000, Recife, PE 50740-540 (Brazil)
2011-10-15
Carbon-doped aluminum oxide (Al{sub 2}O{sub 3}:C) is one of the most used radioluminescence (Rl) materials for fiberoptic dosimetry due to its high efficiency and commercial availability. However, this compound presents the drawback of emitting in the spectral region, where the spurious radioluminescence of fibers is also important. In this work, the radioluminescence response of rare-earth doped Al{sub 2}O{sub 3} samples has been evaluated. The samples were prepared by mixing stoichiometric amounts of aluminum nitrate, urea and dopants with different amounts of terbium, samarium, cerium and thulium nitrates varying from 0 to 0.15 mo 1%. The influence of the different activators on the Rl spectra has been investigated in order to determine the feasibility of using these compounds for Rl fiberoptic dosimetry. (Author)
High-pressure structural, elastic, and thermodynamic properties of zircon-type HoPO4 and TmPO4
International Nuclear Information System (INIS)
Gomis, O; Lavina, B; Rodríguez-Hernández, P; Muñoz, A; Errandonea, R; Errandonea, D; Bettinelli, M
2017-01-01
Zircon-type holmium phosphate (HoPO 4 ) and thulium phosphate (TmPO 4 ) have been studied by single-crystal x-ray diffraction and ab initio calculations. We report on the influence of pressure on the crystal structure, and on the elastic and thermodynamic properties. The equation of state for both compounds is accurately determined. We have also obtained information on the polyhedral compressibility which is used to explain the anisotropic axial compressibility and the bulk compressibility. Both compounds are ductile and more resistive to volume compression than to shear deformation at all pressures. Furthermore, the elastic anisotropy is enhanced upon compression. Finally, the calculations indicate that the possible causes that make the zircon structure unstable are mechanical instabilities and the softening of a silent B 1u mode. (paper)
Radioluminescence of rare-earth doped aluminum oxide
International Nuclear Information System (INIS)
Santiago, M.; Molina, P.; Barros, V. S.; Khoury, H. J.; Elihimas, D. R.
2011-10-01
Carbon-doped aluminum oxide (Al 2 O 3 :C) is one of the most used radioluminescence (Rl) materials for fiberoptic dosimetry due to its high efficiency and commercial availability. However, this compound presents the drawback of emitting in the spectral region, where the spurious radioluminescence of fibers is also important. In this work, the radioluminescence response of rare-earth doped Al 2 O 3 samples has been evaluated. The samples were prepared by mixing stoichiometric amounts of aluminum nitrate, urea and dopants with different amounts of terbium, samarium, cerium and thulium nitrates varying from 0 to 0.15 mo 1%. The influence of the different activators on the Rl spectra has been investigated in order to determine the feasibility of using these compounds for Rl fiberoptic dosimetry. (Author)
ISSN 2073 ISSN 2073 9990 East Cent. Afr. J. s 9990 East Cent. Afr.
African Journals Online (AJOL)
Hp 630 Dual Core
Most of these complications can be prevented by patientss education on self footcare .... 161(60.1%), smoking of cigarette causes poor circulation affecting the feet 161 .... This can be explained by the fact that higher level of education might.
The Mandovi-Zuari estuarine ecosystem
Digital Repository Service at National Institute of Oceanography (India)
Shetye, S.R.
stream_size 2 stream_content_type text/plain stream_name Fish_Curry_Rice_2002_161.pdf.txt stream_source_info Fish_Curry_Rice_2002_161.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset=ISO-8859-1 ...
Lifescience Database Archive (English)
Full Text Available 0558 LLC cDN... 572 e-162 BC099966_1( BC099966 |pid:none) Mus musculus dyskeratosis congenit... 572 e-161 FJ...236702_1( FJ236702 |pid:none) Sus scrofa dyskeratosis congenita ... 571 e-161 BC123284_1( BC123284 |pid:none
Biochemical composition of zooplankton from the offshore oil fields of Bombay
Digital Repository Service at National Institute of Oceanography (India)
Krishnakumari, L.; Nair, V.R.; Gajbhiye, S.N.
stream_size 7 stream_content_type text/plain stream_name Proc_Natl_Acad_Sci_India_63(B)_II_161.pdf.txt stream_source_info Proc_Natl_Acad_Sci_India_63(B)_II_161.pdf.txt Content-Encoding ISO-8859-1 Content-Type text/plain; charset...
Czech Academy of Sciences Publication Activity Database
Musial, W.; Michálek, Jiří
2015-01-01
Roč. 72, č. 1 (2015), s. 161-169 ISSN 0001-6837 Institutional support: RVO:61389013 Keywords : nanogel * N-isopropylacrylamide * thermosensitivity Subject RIV: CD - Macromolecular Chemistry Impact factor: 0.877, year: 2015 http://www.ptfarm.pl/pub/File/Acta_Poloniae/2015/1/161.pdf
Advanced lasers for fusion applications
International Nuclear Information System (INIS)
Krupke, W.F.
1978-11-01
Projections indicate that MJ/MW laser systems, operating with efficiencies in escess of 1 percent, are required to drive laser fusion power reactors. Moreover, a premium in pellet performance is anticipated as the wavelength of the driver laser system is decreased. Short wavelength laser systems based on atomic selenium (lambda = 0.49μ), terbium molcular vapors (0.55μ), thulium doped dielectric solids (0.46μ), and on pulse compressions of KrF excimer laser radiaton (0.27μ) have been proposed and studied for this purpose. The technological scalability and efficiency of each of these systems is examined in this paper. All of these systems are projected to meet minimum systems requirements. Amont them, the pulse-compressed KrF system is projected to have the highest potential efficiency (6%) and the widest range of systems design options
Energy Technology Data Exchange (ETDEWEB)
Junot, D.O.; Chagas, M.A.P.; Souza, D.N., E-mail: danilo.junot@hotmail.com, E-mail: mchagasfisica@gmail.com, E-mail: divanizi@ufs.br [Universidade Federal de Sergipe (UFS), Sao Cristovao, SE (Brazil). Departamento de Fisica
2013-07-01
Since the thermoluminescence started to be applied to the dosimetry of ionizing radiation in 1940 different materials detectors have been proposed, and one of the most common is CaSO{sub 4}. The motivation of this work was to produce crystals of CaSO{sub 4} doped with rare earth elements such as europium (Eu), neodymium (Nd) and thulium (Tm). It was also produced crystals of CaSO{sub 4}:Ag. The interest in the production of these materials was to investigate other methods of production of thermoluminescent materials. The results show that the CaSO{sub 4}:Tm is more suitable for use in the thermoluminescent dosimetry. Although not the most intense peak, the peak at 170 °C could be a dosimetric peak. Analyses showed that all samples have a TL response proportional to the dose absorbed. (author)
Distribution of rare-earths in solid solution crandalita- goyazita of Sapucaia (Bonito-Para)
International Nuclear Information System (INIS)
Costa, M.L. da; Melo Costa, W.A. de
1987-01-01
The Crandallite are predominant in the lateritic phosphates of Sapucaia, in the form of the solid solution Crandallite (Cn)- Goyazite (Gz)-Florencite (Fl). The Crandallite-Goyazite is predominant, where the maximum proportion of Florencite is Cn 60 Cz 34.8 Fl 5.2 - This proportion of Florencite is relatively high for laterites, and for this case having up to 1,374% weight of TR 2 O 3 in the total sample. The light rare elements are predominant over the heavy ores, and are illustrated in the distribution curve normalized for the chondrites. This curve is partially comparable with the curve for Apatite presents slight negative anomaly for the element Europium, and slight positive anomaly for The elements Thulium. The geochemical caracteristics for the rare earths in this group allow the prediction for the original rock for the laterites. (author) [pt
African Journals Online (AJOL)
Items 151 - 161 of 161 ... Vol 31, No 2 (2010), Quality Evaluation of Cookies Produced from Composite Blends of Wheat Flour and African LocustBean (Parkia biglobosa) ... Vol 32, No 1 (2011), The Determination of Lead, Arsenic, Mercury, Cadmium Contents in Some Edible Fish Species Retailed in Ibadan, Nigeria, Abstract.
Branscome, Ewell Caleb
of RIPTP components in available volume; close-contact melting in a medium with nonlinear thermodynamic properties; radiation shielding; radiation health physics; point source plume dispersal calculations; alternative technologies for production of radioisotopes; chemical and physical properties of isotope compounds; nuclear reactor characteristics; high temperature material stability and inter-material compatibility; weapon and delivery system integration; a variety of heat transfer regimes including radiation, conduction, convection, nucleate boiling, and film boiling; thermal/mechanical stress analysis (steady-state and transient); rock physical and thermodynamic properties as a function of temperature; detection/mapping of deeply buried facility spaces; and more. The following disciplinary analyses were composed into a multidisciplinary analysis code for a RIPTP: packing of RIPTP components in available volume; close-contact melting analysis; transmutation of isotope species by neutron activation; reactor neutron economy; radioisotope power generation through decay; metamodelled radiation shielding calculations for a RIPTP; and steady state thermal analyses for a RIPTP in various scenarios. Filtering of radioisotopes for potential suitability, their possible production mechanisms, state of technological development, and multidisciplinary analysis code predicted performance lead to the identification of Thulium-170 as the best isotope for powering a RIPTP using present-day technology and technical data. Ytterbium-169 was identified as an alternative isotope offering the potential for significant potential improvements over Thulium-170 in radiological safety as well as RIPTP performance and producibility. Production, however, was determined to require identification of a cost effective technology for highly enriching Ytterbium-168 from its low natural abundance. Performance analysis of the identified baseline Thulium-170 RIPTP suggested that the predicted low
Analysis of a commercial wind farm in Taiwan
DEFF Research Database (Denmark)
Wang, Li; Yeh, Tai-Her; Lee, Wei-Jen
2009-01-01
wind farm. With twenty-three 2-MW DFIG-type wind turbine generators, this wind farm is connected to the 161-kV extra high-voltage substation of Taiwan Power System through a 23/161-kV, 60-MVA step-up main transformer from six feeders. Through comparing field measured results, this paper establishes...
40 CFR 161.390 - Reentry protection data requirements.
2010-07-01
... could cause adverse effects on persons entering treated sites. In the last situation, reentry intervals... crop Nonfood Greenhouse Food crop Nonfood Forestry Domestic outdoor Indoor Test substance Data to... oncogenic effects or other adverse effects as evidenced by subchronic, chronic, and reproduction studies...
7 CFR 4279.161 - Filing preapplications and applications.
2010-01-01
... preapplications nor applications will be accepted or processed unless a lender has agreed to finance the proposal... description of collateral, with estimated values, to be offered as security for the loan. (vii) If a corporate...) Current personal and corporate financial statements of any guarantors. (11) A proposed Loan Agreement or a...
40 CFR 161.440 - Spray drift data requirements.
2010-07-01
... Nonfood Forestry Domestic outdoor Indoor Test substance Data to support MP Data to support EP Guidelines... organisms expected to be present would be exceeded. The nontarget organisms include humans, domestic animals...
Practice Bulletin No. 161 Summary: External Cephalic Version.
2016-02-01
In the United States, there is a widespread belief that the overall cesarean delivery rate is higher than necessary. Efforts are being directed toward decreasing the number of these procedures, in part by encouraging physicians to make changes in their management practices. Because breech presentations are associated with a high rate of cesarean delivery, there is renewed interest in techniques such as external cephalic version (ECV) and vaginal breech delivery. The purpose of this document is to provide information about ECV by summarizing the relevant evidence presented in published studies and to make recommendations regarding its use in obstetric practice.
7 CFR 966.161 - Reapportionment of Committee Membership.
2010-01-01
... MARKETING SERVICE (Marketing Agreements and Orders; Fruits, Vegetables, Nuts), DEPARTMENT OF AGRICULTURE... alternates. (c) District 3—four members and their alternates. (d) District 4—four members and their...
40 CFR 161.240 - Residue chemistry data requirements.
2010-07-01
.../feed (5), (14) [CR] [CR] [CR] [CR] EP EP 171-4 Meat/milk/poultry/eggs (6), (14) [CR] [CR] [CR] [CR... food/feed are required when detectable residues could concentrate on processing and thus require establishment of a food additive tolerance. (6) Livestock feeding studies are required whenever a pesticide...
40 CFR 51.161 - Public availability of information.
2010-07-01
... REQUIREMENTS FOR PREPARATION, ADOPTION, AND SUBMITTAL OF IMPLEMENTATION PLANS Review of New Sources and... advertisement in the area affected of the location of the source information and analysis specified in paragraph... would conflict with existing requirements for acting on requests for permission to construct or modify...
What we do | Page 161 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
The burden of disease caused by smoking, and the medical and social costs ... health, social, environmental and economic consequences of tobacco consumption and ... Eastern Africa has experienced more than its fair share of violent conflict ...
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... The theory is attractive to practical theologians for two reasons. ... They consider conforming to principles to be of more importance than cultivating harmony. ...... Francis, L.J. & Atkins, P., 2000, Exploring Luke's Gospel: A guide.
161 EVALUATION OF ON-SHORE OIL SPILL REMEDIATION ...
African Journals Online (AJOL)
EVALUATION OF ON-SHORE OIL SPILL REMEDIATION OPERATIONS IN. PORT HARCOURT ... study is an attempt to unravel the effectiveness of clean-up exercises undertaken by oil .... Research Design. The study ..... remediation as well as tilling and evacuation of affected soils would certainly be more productive.
40 CFR 161.590 - Nontarget insect data requirements.
2010-07-01
... pollinators (4) CR CR CR CR CR CR TEP TEP 141-5 Nontarget insect testing—aquatic insects Acute toxicity to aquatic insects (5) 142-1 Aquatic insect life-cycle study (5) 142-1 Simulated or actual field testing for aquatic insects (5) 142-3 Nontarget insect testing—predators and parasites (5) 143-1thru 143-3 Key: CR...
40 CFR 161.640 - Product performance data requirements.
2010-07-01
... or indirectly transmit diseases to humans. However, each registrant must ensure through testing that... microbial pests associated with human and animal wastes (1) CR EP* 91-7 Products for treating water systems...
Travel Policies in ARL Libraries. SPEC Kit 161.
Cramer, Michael D.
This kit examines the methods and policies currently used to provide travel funding for academic librarians. The results of a survey of Association of Research Libraries (ARL) libraries (n=73) conducted in Fall 1989 are presented as well as examples of travel policies and guidelines submitted by the following respondents: the Universities of…
40 CFR 161.540 - Plant protection data requirements.
2010-07-01
... phytotoxicity Tier I: Seed germination/seedling emergence (2) R R R TGAI TGAI 122-1 Vegetative vigor (2) R R R TGAI TGAI 122-1 Aquatic plant growth (2) R R R TGAI TGAI 122-2 Tier II: Seed germination/seedling... Nonfood Greenhouse Food crop Nonfood Forestry Domestic outdoor Indoor Test substance Data to support MP...
Lifescience Database Archive (English)
Full Text Available *tttxrslfikmptkt*m*i** sw*kmlckdsl**sl*frlw*rf*m*n*t*wfkmlcpfrkttpxxt*km**emptrp*m* s*stwkrmlrccp*tttkmifkmsx...kt*m*sqplw*rmlc*sspr*mfiemstrp*m*s* stwkrmlrccp*tttkmiikmsxkt*m*nqslw*rmlc*k*k*lfnl*rlkl*kkrftlc henctx** F
161---8 Dec 2009.indd [final version].indd
African Journals Online (AJOL)
2009-12-08
Dec 8, 2009 ... United Kingdom population norms, preachers within this sample were ... University of Warwick, .... hand, feeling types make judgements based on subjective, personal values. ... and female Bible College students (Francis, Penson & Jones. 2001) .... link between psychological type preference and choice of.
40 CFR 161.190 - Physical and chemical characteristics.
2010-07-01
...) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES Product Chemistry Data...) Basic manufacturers are required to provide the Agency with a sample of each TGAI used to formulate a...
What we do | Page 161 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
We collaborate with governments, research institutions, and global funders to develop .... Region(s): Americas, Canada, North And Central America, Asia, South And ... This project builds on previous investment in three rounds of a small grants ...
A study of the structure of 162Dy through the (n,γ) and (n,e-) reactions
International Nuclear Information System (INIS)
Warner, D.D.; Shi, Z.R.; Gelletly, W.; Borner, H.G.; Hoyler, F.; Schreckenbach, K.; van Isacker, P.
1987-01-01
The level structure below 2 MeV in 162 Dy has been investigated using the 161 Dy(n,γ) 162 Dy and 161 Dy(n,e - ) 162 Dy reactions. The results for the positive parity excitations are discussed within the framework of an Interacting Boson Approximation (IBA-2) calculation. 7 refs., 1 fig., 1 tab
Constructing two new crystalline metal–organic frameworks based on a mixed-donor ligand
Wang, Xiaofang; Xue, Ming; Wu, Gang; Pan, Ying; Qiu, Shilun
2016-01-01
© 2015 Elsevier B.V. All Rights Reserved. The self-assembly of a prominent ligand, 5-(4-(1H-tetrazolyl)phen)isophthalic acid (H3TZPI), with Zn2 +/Cu2 + centres generates two new MOFs, [Zn2(TZPI)(μ3-OH)(H2O)2]·2H2O (JUC-161) and [Cu(HTZPI)(μ2-H2O)0.5(H2O)1.5]·5(H2O) (JUC-162). JUC-161 exhibits fascinating three-dimensional structures containing rectangular channels with dimensions of 6.5 × 3.0 Å2, and JUC-162 displays 3D supramolecular structures with 12.5 × 14.6 Å2 hexagonal channels. The observed structural diversity in these frameworks is due to the two distinct coordinating moieties of the H3TZPI ligand. The photoluminescence of JUC-161 and the magnetic properties of JUC-162 are also measured at room temperature. Photoluminescence investigations reveal that JUC-161 displays a strong main emission spectrum peak at 388 nm. JUC-162 is found to exhibit an antiferromagnetic interaction between Cu2 + ions.
Reduced Gut Acidity Induces an Obese-Like Phenotype in Drosophila melanogaster and in Mice.
Directory of Open Access Journals (Sweden)
Wei-Sheng Lin
Full Text Available In order to identify genes involved in stress and metabolic regulation, we carried out a Drosophila P-element-mediated mutagenesis screen for starvation resistance. We isolated a mutant, m2, that showed a 23% increase in survival time under starvation conditions. The P-element insertion was mapped to the region upstream of the vha16-1 gene, which encodes the c subunit of the vacuolar-type H+-ATPase. We found that vha16-1 is highly expressed in the fly midgut, and that m2 mutant flies are hypomorphic for vha16-1 and also exhibit reduced midgut acidity. This deficit is likely to induce altered metabolism and contribute to accelerated aging, since vha16-1 mutant flies are short-lived and display increases in body weight and lipid accumulation. Similar phenotypes were also induced by pharmacological treatment, through feeding normal flies and mice with a carbonic anhydrase inhibitor (acetazolamide or proton pump inhibitor (PPI, lansoprazole to suppress gut acid production. Our study may thus provide a useful model for investigating chronic acid suppression in patients.
Constructing two new crystalline metal–organic frameworks based on a mixed-donor ligand
Wang, Xiaofang
2016-02-01
© 2015 Elsevier B.V. All Rights Reserved. The self-assembly of a prominent ligand, 5-(4-(1H-tetrazolyl)phen)isophthalic acid (H3TZPI), with Zn2 +/Cu2 + centres generates two new MOFs, [Zn2(TZPI)(μ3-OH)(H2O)2]·2H2O (JUC-161) and [Cu(HTZPI)(μ2-H2O)0.5(H2O)1.5]·5(H2O) (JUC-162). JUC-161 exhibits fascinating three-dimensional structures containing rectangular channels with dimensions of 6.5 × 3.0 Å2, and JUC-162 displays 3D supramolecular structures with 12.5 × 14.6 Å2 hexagonal channels. The observed structural diversity in these frameworks is due to the two distinct coordinating moieties of the H3TZPI ligand. The photoluminescence of JUC-161 and the magnetic properties of JUC-162 are also measured at room temperature. Photoluminescence investigations reveal that JUC-161 displays a strong main emission spectrum peak at 388 nm. JUC-162 is found to exhibit an antiferromagnetic interaction between Cu2 + ions.
Determination of ionophore antibiotics nactins produced by fecal Streptomyces from sheep.
Wang, Jun; Tan, Hongming; Lu, Yu; Cao, Lixiang
2014-04-01
To investigate the correlation between fecal actinobacteria and host animals, Streptomyces was isolated from fresh faeces of healthy sheep and secondary metabolites were analyzed. The most frequently isolated strain S161 with antibiotic activity against bacteria and fungi were analyzed. The S161 showed the highest 99 % similarity to Streptomyces canus DSB17 based on the 16S rRNA gene sequence analysis. Metabolite analysis based on MS and NMR spectra showed that S161 produces nactins, cyclotetralactones derived from nonactic acid and homononactic acid as building units of ionophoretic character. Due to ionophores are antimicrobial compounds that are commonly fed to ruminant animals to improve feed efficiency, stable beneficial interactions between Streptomyces bacteria and vertebrates have been demonstrated.
Thermodynamic properties of thulium and ytterbium in fused NaCl-KCl-CsCl eutectic
Energy Technology Data Exchange (ETDEWEB)
Novoselova, A., E-mail: A.Novoselova@ihte.uran.ru [Institute of High-Temperature Electrochemistry, Ural Division, Russian Academy of Science, S. Kovalevskaya Str., 22, Ekaterinburg 620990 (Russian Federation); Smolenski, V. [Institute of High-Temperature Electrochemistry, Ural Division, Russian Academy of Science, S. Kovalevskaya Str., 22, Ekaterinburg 620990 (Russian Federation)
2011-07-15
Research highlights: > Tm and Yb chloride compounds as fission products. > The investigation of electrochemical properties of lanthanides. > Determination of the apparent standard redox potentials of the couple Ln(III)/Ln(II) in fused NaCl-KCl-CsCl eutectic at (823 to 973) K. > The calculation of the basic thermodynamic properties of redox reaction in molten salt. - Abstract: This work presents the results of a study of the Tm{sup 3+}/Tm{sup 2+} and Yb{sup 3+}/Yb{sup 2+} couple redox potentials vs. Cl{sup -}/Cl{sub 2} reference electrode at the temperature range (823 to 973) K in fused NaCl-KCl-CsCl eutectic by direct potentiometric method. Initial concentrations of TmCl{sub 3} and YbCl{sub 3} in solvents did not exceed 5.0 mol%. Basic thermodynamic properties of the reactions TmCl{sub 2(l)} + 1/2 Cl{sub 2(g)} {r_reversible} TmCl{sub 3(l)} and YbCl{sub 2(l)} + 1/2 Cl{sub 2(g)} {r_reversible} YbCl{sub 3(l)} were calculated using the temperature dependencies of apparent standard potentials of the couples E{sub Tm{sup 3+}/Tm{sup 2+*}} and E{sub Yb{sup 3+}/Yb{sup 2+*}}.
Production of a tracer packet of heavier rare earth elements
International Nuclear Information System (INIS)
Lahiri, S.; Nayak, D.; Maji, S.
2004-01-01
Production of a tracer packet of heavier rare earth elements containing carrier-free radionuclides of 153,155 Tb, 153,155,157 Dy, 159 Ho, 159,161 Er, 161 Tm produced by medium energy 7 Li and 12 C irradiation on an europium oxide target and the subsequent separation of bulk europium from the carrier-free products is described. (author)
K-capture probabilities in the decay of /sup 133/Ba
Energy Technology Data Exchange (ETDEWEB)
Singh, K; Sahota, H S
1983-07-01
The K-capture probabilities in the decay of /sup 133/Ba to 437, 383, 161 and 81 keV levels have been determined from the analysis of the K X-ray-gamma ray sumpeaks observed with an intrinsic Ge detector. The measurements on 161 and 81 keV levels are reported for the first time in literature.
Analysis of a commercial wind farm in Taiwan
DEFF Research Database (Denmark)
Wang, Li; Yeh, Tai-Her; Lee, Wei-Jen
2010-01-01
) and load tap changers on power-quality improvement of the studied WF. With 23 2-MW DFIG-type wind turbine generators, this WF is connected to the 161-kV extra high-voltage substation of Taiwan Power System through a 23/161-kV 60-MVA step-up main transformer from six feeders with CLRs. Through comparing...
2010-07-01
... continuous process vent and a batch process vent. Combustion device burner means a device designed to mix and...) Research and development facility (§ 63.101) Routed to a process or route to a process (§ 63.161) Run (§ 63... vessel (§ 63.161) Temperature monitoring device (§ 63.111) Test method (§ 63.2) Treatment process (§ 63...
Directory of Open Access Journals (Sweden)
Yuste Jesus
2017-01-01
Full Text Available The knowledge of the behaviour of different grapevine rootstocks is basic to achieve a good adaptation of vine to its growing area. With the objective of knowing the agronomic and qualitative response of cv. Sauvignon Blanc to the use of several rootstocks, a trial was established in 2006 in the D.O. Rueda. The vines are vertical trellised, with bilateral Royat cordon pruning, and the vine spacing is 2.60 m × 1.25 m. The row orientation is NNW (N-25°. The experimental design consisted of randomized blocks with 4 replications and elemental plot of 60 vines. Over the period 2010–2014 it has been developed the study of the following 10 rootstocks (treatments: 110R, 101-14M, 420A, 3309C, 41B, 161-49C, 196-17C, Fercal, Gravesac and RGM. The rootstocks 420A and 41B showed a production higher than 50% with respect to 196-17C and 161-49C, and higher to 100% than RGM, due to the number of clusters per vine and, in greater amount, to the cluster weight. Fercal and Gravesac showed an increase of pruning wood weight of 24% with respect to 196-17C and 161-49C, and 90% with respect to RGM, mainly due to the shoot weight. The sugar concentration increased with 101-14M, 196-17C and Fercal, and became reduced with 161-49C, 41B and RGM. The pH of must was reduced with Fercal whereas the titratable acidity increased, which also showed increase with Gravesac and 161-49C. The tartaric acid hardly increased slightly with Fercal and 161-49C, whereas the malic acid increased with Gravesac and Fercal, and was reduced with 41B, 3309C, RGM and 101-14M. The potassium concentration increased with 196-17C, Gravesac and Fercal, and was reduced with 41B, 161-49C, 420A and 3309C. The effects observed show alternatives for rootstock election according to the growing conditions and objectives of the vineyard.
Directory of Open Access Journals (Sweden)
Nicholas M. Provine
2018-04-01
Full Text Available Mucosal-associated invariant T (MAIT cells are innate-like T cells abundant in humans that can be activated in a TCR-independent manner by inflammatory and antiviral cytokines. In humans, the capacity for TCR-independent activation is functionally linked to a transcriptional program that can be identified by the expression of the C-type lectin receptor, CD161. In addition to MAIT cells, it has been demonstrated that a subset of γδT cells expresses CD161 and can be activated by TCR-independent cytokine stimulation. In this study, we sought to clarify the nature of cytokine-responsive human γδT cells. We could link CD161 expression on Vδ2+ versus Vδ1+ γδT cells to the observation that Vδ2+ γδT cells, but not Vδ1+ γδT cells, robustly produced IFN-γ upon stimulation with a variety of cytokine combinations. Interestingly, both CD161+ and CD161− Vδ2+ γδT cells responded to these stimuli, with increased functionality within the CD161+ subset. This innate-like responsiveness corresponded to high expression of PLZF and IL-18Rα, analogous to MAIT cells. Vδ2+ γδT cells in human duodenum and liver maintained a CD161+ IL-18Rα+ phenotype and produced IFN-γ in response to IL-12 and IL-18 stimulation. In contrast to MAIT cells, we could not detect IL-17A production but observed higher steady-state expression of Granzyme B by Vδ2+ γδT cells. Finally, we investigated the frequency and functionality of γδT cells in the context of chronic hepatitis C virus infection, as MAIT cells are reduced in frequency in this disease. By contrast, Vδ2+ γδT cells were maintained in frequency and displayed unimpaired IFN-γ production in response to cytokine stimulation. In sum, human Vδ2+ γδT cells are a functionally distinct population of cytokine-responsive innate-like T cells that is abundant in blood and tissues with similarities to human MAIT cells.
Rodrigues, E V; Damasceno-Silva, K J; Rocha, M M; Bastos, E A
2016-05-13
The purpose of this study was to identify parents and obtain segregating populations of cowpea (Vigna unguiculata L. Walp.) with the potential for tolerance to water deficit. A full diallel was performed with six cowpea genotypes, and two experiments were conducted in Teresina, PI, Brazil in 2011 to evaluate 30 F2 populations and their parents, one under water deficit and the other under full irrigation. A triple-lattice experimental design was used, with six 2-m-long rows in each plot. Sixteen plants were sampled per plot. The data were subjected to analysis of variance, and general and specific combining ability estimates were obtained based on the means. Additive effects were more important than non-additive effects, and maternal inheritance had occurred. The genotypes BRS Xiquexique, Pingo de Ouro-1-2, and MNC99-510F-16-1 were the most promising for use in selection programs aimed at water deficit tolerance. The hybrid combinations Pingo de Ouro-1-2 x BRS Xiquexique, BRS Xiquexique x Santo Inácio, CNCx 698-128G x MNC99-510F-16-1, Santo Inácio x CNCx 698-128G, MNC99-510F-16-1 x BRS Paraguaçu, MNC99- 510F-16-1 x Pingo de Ouro-1-2, and MNC99-510F-16-1 x BRS Xiquexique have the potential to increase grain production and tolerate water deficit.
TRIGLYCERIDE COMPOSITION OF SIXTEEN STRAINS OF MARINE DIATOM
Directory of Open Access Journals (Sweden)
Lily M.G. Panggabean
2013-07-01
Full Text Available Trigliceride or triacylglicerol (TAG composition in crude oil of sixteen strain of marine diatom has been detected by spectra analyses on an Electrospray - Ion Trap – Mass Spectrometry (ESI-IT-MS HCT Bruker-Daltonic GmbH instrument with AgNO3 used as coordination ionization agent. Biomass samples of each microalga strain were taken from early and late stationary cultures in f/2 enriched seawater and algal oils were extracted according to Bligh and Dyer. Results from spectra analysis showed that P-Pt-P (C16:0-C16:1-C16:0 were distinguished in TAG from diatom strains Chaetoceros sp.1, Chaetoceros sp.2, Thalasiossira sp.1, Thalasiossira sp.2, Thalasiossira sp.3, Navicula sp. 1, Navicula sp. 2, Navicula sp. 3, Navicula sp. 4, Nitzschia sp. 2 and Amphora sp. In contrast, TAGs in Melosira sp. included P-P-P (C16:0-C16:0-C16:0 and P-P-O (C16:0-C16:0-C18:1 were identified. TAGs from Chaetoceros sp. were the most varies among samples, i.e. P-Pt-P (C16:0-C16:1-C16:0, A-P-M (C20:4-C16:0-C14:0, P-Pt-Lt (C16:0-C16:1-C18:3, P-Pt-A (C16:0-C16:1-C20:4, D-P-P (C22:6-C16:0-C16:0, A-Ln-P (C20:4-C18:2-C16:0. Various TAGs were also detected in Nitzschia sp.2, i.e. P-Pt-M (C16:0-C16:1-C14:0, P-Pt-P (C16:0-C16:1-C16:0, P-Pt-S (C16:0-C16:1-C18:0, P-Pt-A (C16:0-C16:1-C20:4. TAGs composition in Skeletonema strains that similar to those in Nitzschia sp.1 has longer carbon, i.e. P-P-O (C16:0-C16:0-C18:1, P-O-O (C16:0-C18:1-C18:1 and O-O-O (C18:1-C18:1-C18:1. TAGs with longer carbon chain and more double bond including highly unsaturated fatty acid C20:4 were increased with culture age in diatoms Chaetoceros sp.1, Chaetoceros sp.2, Thalasiossira sp.2, Navicula sp.1 and Nitzschia sp. 2.Keywords: diatom, TAG, ESI-IT-MS, f/2, early and late stationary
Improved performances of CIBER-X: a new tabletop laser-driven electron and x-ray source
Girardeau-Montaut, Jean-Pierre; Kiraly, Bela; Girardeau-Montaut, Claire
2000-11-01
We present the most recent data concerning the performances of the table-top laser driven electron and x-ray source developed in our laboratory. X-ray pulses are produced by a three-step process which consists of the photoelectron emission from a thin metallic photocathode illuminated by 16 ps duration laser pulse at 213 nm. The e-gun is a standard pierce diode electrode type, in which electrons are accelerated by a cw electric fields of 12 MV/m. The photoinjector produced a train of 90 - 100 keV electron pulses of approximately 1 nC and 40 A peak current at a repetition rate of 10 Hz. The electrons, transported outside the diode, are focused onto a target of thulium by magnetic fields produced by two electromagnetic coils to produce x-rays. Applications to low dose imagery of inert and living materials are also presented.
Dual comb generation from a mode-locked fiber laser with orthogonally polarized interlaced pulses.
Akosman, Ahmet E; Sander, Michelle Y
2017-08-07
Ultra-high precision dual-comb spectroscopy traditionally requires two mode-locked, fully stabilized lasers with complex feedback electronics. We present a novel mode-locked operation regime in a thulium-holmium co-doped fiber laser, a frequency-halved state with orthogonally polarized interlaced pulses, for dual comb generation from a single source. In a linear fiber laser cavity, an ultrafast pulse train composed of co-generated, equal intensity and orthogonally polarized consecutive pulses at half of the fundamental repetition rate is demonstrated based on vector solitons. Upon optical interference of the orthogonally polarized pulse trains, two stable microwave RF beat combs are formed, effectively down-converting the optical properties into the microwave regime. These co-generated, dual polarization interlaced pulse trains, from one all-fiber laser configuration with common mode suppression, thus provide an attractive compact source for dual-comb spectroscopy, optical metrology and polarization entanglement measurements.
Dosimetry of the portable blood irradiator
International Nuclear Information System (INIS)
Roberson, P.L.; Hungate, F.P.; Reece, W.D.; Tanner, J.E.
1985-08-01
A portable blood irradiator was developed at the Pacific Northwest Laboratory to evaluate the effects of chronic irradiation of the blood in suppressing graft rejection. The irradiator, designed to be worn on the arm or leg and be surgically connected in an arterio-venous shunt, uses beta radiation from activated thulium imbedded in a vitreous carbon matrix to reduce the number of lymphocytes circulating in the blood. The dose and energy spectra relative to the distance from and position around a prototype irradiator were measured by thermoluminescent dosimeters, ion chambers and photon spectroscopy. With computer simulations using those measurements, the shielding was redesigned to minimize the radiation dose to the patient and to the attending personnel and to minimize the weight of the irradiator. The new shielding design was incorporated into a new prototype, and the dose and spectral measurements were repeated, which confirmed the design improvements. 10 refs., 11 figs
Development of MATLAB Scripts for the Calculation of Thermal Manikin Regional Resistance Values
2016-01-01
TECHNICAL NOTE NO. TN16-1 DATE January 2016 ADA DEVELOPMENT OF MATLAB ® SCRIPTS FOR THE...USARIEM TECHNICAL NOTE TN16-1 DEVELOPMENT OF MATLAB ® SCRIPTS FOR THE CALCULATION OF THERMAL MANIKIN REGIONAL RESISTANCE VALUES...EXECUTIVE SUMMARY A software tool has been developed via MATLAB ® scripts to reduce the amount of repetitive and time-consuming calculations that are
2010-07-01
... designed to mix and ignite fuel and air to provide a flame to heat and oxidize waste organic vapors in a...) Research and development facility (§ 63.101) Routed to a process or route to a process (§ 63.161) Run (§ 63... vessel (§ 63.161) Temperature monitoring device (§ 63.111) Test method (§ 63.2) Treatment process (§ 63...
Energy Technology Data Exchange (ETDEWEB)
Lewis, Michael George [Idaho National Lab. (INL), Idaho Falls, ID (United States)
2016-02-01
This report describes conditions and information, as required by the state of Idaho, Department of Environmental Quality Reuse Permit I-161-02, for the Advanced Test Reactor Complex Cold Waste Ponds located at Idaho National Laboratory from November 1, 2014–October 31, 2015. The effective date of Reuse Permit I-161-02 is November 20, 2014 with an expiration date of November 19, 2019.
BOVINE TUBERCULOSIS IN EAST AFRICA ABSTRACT RÉSUMÉ
African Journals Online (AJOL)
ACSS
J.M. MUGAMBI, S.G. OMWENGA, H.O. WESONGA, P. MBATHA1, S. GATHOGO1, A.C. CHOTA2,. H.B. MAGWISHA2 ... In one area of Mwingi County, eastern Kenya, all the 161 cattle tested negative; while in the other ... Dans une zone de Mwingi a l'Est du Kenya, tous les 161 bovins ont été testes négative; tandis que dans.
International Nuclear Information System (INIS)
Lewis, Michael George
2016-01-01
This report describes conditions and information, as required by the state of Idaho, Department of Environmental Quality Reuse Permit I-161-02, for the Advanced Test Reactor Complex Cold Waste Ponds located at Idaho National Laboratory from November 1, 2014-October 31, 2015. The effective date of Reuse Permit I-161-02 is November 20, 2014 with an expiration date of November 19, 2019.
Lee, O. O.; Lai, P. Y.; Wu, H.-x.; Zhou, X.-j.; Miao, L.; Wang, H.; Qian, P.-Y.
2011-01-01
-1611(T) tolerated only 6% (w/v) NaCl, and optimal growth occurred at 2.0% (w/v) NaCl, pH 7.0-8.0 and 28-36 degrees C. The predominant cellular fatty acids were C-12:0 3-OH, C-16:0, C-12:0 and summed feature 3 (C-16.1 omega 6c and/or C-16:1 omega 7c
77 FR 43821 - Records Governing Off-the-Record Communications
2012-07-26
...-515-000 7-9-12 Michael Mojica \\2\\. 3. CP08-6-000 7-11-12 David J. Devine. 4. CP11-161-000 7-13-12...\\ Email record. \\6\\ Hons. Robert P. Casey, Jr. and Tom Marino. Dated: July 20, 2012. Nathaniel J. Davis... \\5\\. 3. P-2458-000 6-27-12 Hon. Michael H. Michaud. 4. CP11-161-000 6-27-12 Hon. Tom Marino. 5. P...
EST Table: FS737373 [KAIKOcDNA[Archive
Lifescience Database Archive (English)
Full Text Available FS737373 E_FL_bmmt_08K06_R_0 10/09/28 37 %/161 aa ref|XP_002067709.1| GK12566 [Dros...ophila willistoni] gb|EDW78695.1| GK12566 [Drosophila willistoni] 10/09/03 37 %/161 aa FBpp0241709|DwilGK12566-PA 10/08/28 n.h 10/09/10 n.h 10/09/10 n.h 10/09/10 n.h FS737272 bmmt ...
408-fs SESAM mode locked Cr:ZnSe laser
Bu, Xiangbao; Shi, Yuhang; Xu, Jia; Li, Huijuan; Wang, Pu
2018-01-01
We report self-starting femtosecond operation of a 127-MHz SESAM mode locked Cr:ZnSe laser around 2420 nm. A thulium doped double clad fiber laser at 1908 nm was used as the pumping source. In the normal dispersion regime, stable pulse pairs with constant phase differences in the multipulse regime were observed. The maximum output power was 342 mW with respect to incident pump power of 4.8 W and the corresponding slope efficiency was 10.4%. By inserting a piece of sapphire plate, dispersion compensation was achieved and the intra-cavity dispersion was moved to the anomalous regime. A maximum output power of 403 mW was obtained and the corresponding slope efficiency was 12.2%. Pulse width was measured to be 408 fs by a collinear autocorrelator using two-photon absorption in an InGaAs photodiode. The laser spectrum in multipulse operation showed a clear periodic modulation.
Sojka, Bartlomiej; Liskova, Aurelia; Kuricova, Miroslava; Banski, Mateusz; Misiewicz, Jan; Dusinska, Maria; Horvathova, Mira; Ilavska, Silvia; Szabova, Michaela; Rollerova, Eva; Podhorodecki, Artur; Tulinska, Jana
2017-02-01
Sodium fluoride-based β-NaLnF4 nanoparticles (NPs) doped with lanthanide ions are promising materials for application as luminescent markers in bio-imaging. In this work, the effect of NPs doped with yttrium (Y), gadolinium (Gd), europium (Eu), thulium (Tm), ytterbium (Yb) and terbium (Tb) ions on phagocytic activity of monocytes and granulocytes and the respiratory burst was examined. The surface functionalization of toxic with respect to conducted test; however, some cause toxic effects (they have statistically significant deviations compared to reference) in some selected doses tested. Both core types of NPs (Y-core and Gd-core) impaired the phagocytic activity of monocytes the strongest, having minimal or none whatsoever influence on granulocytes and respiratory burst of phagocytic cells. The lowest toxicity was observed in Gd-core, Yb, Tm dopants and near-infrared nanoparticles. Clear dose-dependent effect of NPs on phagocytic activity of leukocytes and respiratory burst of cells was observed for limited number of samples.
Monolithic PM Raman fiber laser at 1679 nm for Raman amplification at 1810 nm
DEFF Research Database (Denmark)
Svane, Ask Sebastian; Rottwitt, Karsten
2013-01-01
Stimulated Raman scattering (SRS) has been subject to much attention within the field of fiber lasers and amplifiers as it provides an extended wavelength coverage in comparison to rare-earth based devices. Motivated by the projected capacity crunch [1], different approaches are being explored...... demonstrate a monolithic RM Raman fiber laser (RFL), which acts as a pump for a Raman amplifier (RA) at 1810 nm. The lasing wavelength of a RFL, thus also for a RA, can in principle be designed arbitrarily within the entire wavelength range from the Erbium band up to the Thulium/Holmium band...... of OFS PM Raman fiber, with an estimated propagation loss of 0.42/0.46/1.3 dB/km at 1564/1679/1810 nm. The Raman gain coefficient was measured to be gR=2.66/2.35 W-1km-1 at 1679/1810 nm. The laser curve of the RFL is depicted in Fig. 1b, with a slope efficiency of 67 %. The high slope efficiency...
High-speed detection at two micrometres with monolithic silicon photodiodes
Ackert, Jason J.; Thomson, David J.; Shen, Li; Peacock, Anna C.; Jessop, Paul E.; Reed, Graham T.; Mashanovich, Goran Z.; Knights, Andrew P.
2015-06-01
With continued steep growth in the volume of data transmitted over optical networks there is a widely recognized need for more sophisticated photonics technologies to forestall a ‘capacity crunch’. A promising solution is to open new spectral regions at wavelengths near 2 μm and to exploit the long-wavelength transmission and amplification capabilities of hollow-core photonic-bandgap fibres and the recently available thulium-doped fibre amplifiers. To date, photodetector devices for this window have largely relied on III-V materials or, where the benefits of integration with silicon photonics are sought, GeSn alloys, which have been demonstrated thus far with only limited utility. Here, we describe a silicon photodiode operating at 20 Gbit s-1 in this wavelength region. The detector is compatible with standard silicon processing and is integrated directly with silicon-on-insulator waveguides, which suggests future utility in silicon-based mid-infrared integrated optics for applications in communications.
International Nuclear Information System (INIS)
Chattopadhyay, Rik; Haldar, Arindam; Paul, Mukul C.; Das, Shyamal; Bhadra, Shyamal K.
2015-01-01
We report a process for enhancing fluorescence emission from conventional rare earth ions in optical fiber by metal nanocluster (MNC) in nonresonant indirect pumping. The process is completely different from formal metal enhanced fluorescence phenomenon as the MNCs are too small in size to support localized surface plasmon and the excitation wavelength is far from plasmon resonance frequency. We used an established theory of two coupled oscillators to explain the simultaneous enhancement of Ytterbium (Yb 3+ ) and Thulium (Tm 3+ ) emission by silver (Ag) NCs under nonresonant pumping in optical fiber. The fiber is pumped with a 980 nm fiber pigtailed laser diode with input power of 20–100 mW to excite the Yb 3+ . Four times enhancement of Yb 3+ emission of 900–1100 nm and Tm 3+ upconversion emission around 474 nm, 650 nm, and 790 nm is observed in the fiber with Ag NCs
Jin, Jeongwan; Slater, Joshua A.; Saglamyurek, Erhan; Sinclair, Neil; George, Mathew; Ricken, Raimund; Oblak, Daniel; Sohler, Wolfgang; Tittel, Wolfgang
2013-08-01
Quantum memories allowing reversible transfer of quantum states between light and matter are central to quantum repeaters, quantum networks and linear optics quantum computing. Significant progress regarding the faithful transfer of quantum information has been reported in recent years. However, none of these demonstrations confirm that the re-emitted photons remain suitable for two-photon interference measurements, such as C-NOT gates and Bell-state measurements, which constitute another key ingredient for all aforementioned applications. Here, using pairs of laser pulses at the single-photon level, we demonstrate two-photon interference and Bell-state measurements after either none, one or both pulses have been reversibly mapped to separate thulium-doped lithium niobate waveguides. As the interference is always near the theoretical maximum, we conclude that our solid-state quantum memories, in addition to faithfully mapping quantum information, also preserve the entire photonic wavefunction. Hence, our memories are generally suitable for future applications of quantum information processing that require two-photon interference.
Jin, Jeongwan; Slater, Joshua A; Saglamyurek, Erhan; Sinclair, Neil; George, Mathew; Ricken, Raimund; Oblak, Daniel; Sohler, Wolfgang; Tittel, Wolfgang
2013-01-01
Quantum memories allowing reversible transfer of quantum states between light and matter are central to quantum repeaters, quantum networks and linear optics quantum computing. Significant progress regarding the faithful transfer of quantum information has been reported in recent years. However, none of these demonstrations confirm that the re-emitted photons remain suitable for two-photon interference measurements, such as C-NOT gates and Bell-state measurements, which constitute another key ingredient for all aforementioned applications. Here, using pairs of laser pulses at the single-photon level, we demonstrate two-photon interference and Bell-state measurements after either none, one or both pulses have been reversibly mapped to separate thulium-doped lithium niobate waveguides. As the interference is always near the theoretical maximum, we conclude that our solid-state quantum memories, in addition to faithfully mapping quantum information, also preserve the entire photonic wavefunction. Hence, our memories are generally suitable for future applications of quantum information processing that require two-photon interference.
Energy Technology Data Exchange (ETDEWEB)
Chattopadhyay, Rik; Haldar, Arindam; Paul, Mukul C.; Das, Shyamal; Bhadra, Shyamal K., E-mail: skbhadra@cgcri.res.in [Fiber Optics and Photonics Division, CSIR-Central Glass and Ceramic Research Institute, 196, Raja S. C. Mullick Road, Kolkata 700032 (India)
2015-12-07
We report a process for enhancing fluorescence emission from conventional rare earth ions in optical fiber by metal nanocluster (MNC) in nonresonant indirect pumping. The process is completely different from formal metal enhanced fluorescence phenomenon as the MNCs are too small in size to support localized surface plasmon and the excitation wavelength is far from plasmon resonance frequency. We used an established theory of two coupled oscillators to explain the simultaneous enhancement of Ytterbium (Yb{sup 3+}) and Thulium (Tm{sup 3+}) emission by silver (Ag) NCs under nonresonant pumping in optical fiber. The fiber is pumped with a 980 nm fiber pigtailed laser diode with input power of 20–100 mW to excite the Yb{sup 3+}. Four times enhancement of Yb{sup 3+} emission of 900–1100 nm and Tm{sup 3+} upconversion emission around 474 nm, 650 nm, and 790 nm is observed in the fiber with Ag NCs.
Solvent extraction studies on separation of yttrium from xenotime
International Nuclear Information System (INIS)
Singh, D.K.; Anitha, M.; Kain, V.
2017-01-01
Rare earths consists a group of 15 element from La to Lu in the periodic table and it also includes Sc and Y since they tend to occur in the same ore deposits as the lanthanides and exhibit similar chemical properties. The unique physical-chemical properties of the REEs render them important in applications as varies as high strength magnets, lighting phosphors, policing compounds and ceramics. In particular, yttrium finds numerous applications in many areas including superconductors, lasers, phosphors, nuclear reactors, astronavigation, ceramics etc. Yttrium is chemically similar to heavy rare earths (HRE: terbium, dysprosium, erbium, holmium, ytterbium, thulium and lutecium). Yttrium behaves like HRE due to similarity in ionic radius and finds place between Ho and Er. The cross current profile in terms of the plot of concentration of yttrium in raffinate as a function of contact number indicated the complete recovery of rare earths from nitrate solution of xenotime wet cake
Broadband photocarrier dynamics and nonlinear absorption of PLD-grown WTe2 semimetal films
Gao, Wenbin; Huang, Lei; Xu, Jinlong; Chen, Yequan; Zhu, Chunhui; Nie, Zhonghui; Li, Yao; Wang, Xuefeng; Xie, Zhenda; Zhu, Shining; Xu, Jun; Wan, Xiangang; Zhang, Chao; Xu, Yongbing; Shi, Yi; Wang, Fengqiu
2018-04-01
WTe2 is a unique material in the family of transition metal dichalcogenides and it has been proposed as a candidate for type-II Weyl semimetals. However, thus far, studies on the optical properties of this emerging material have been significantly hindered by the lack of large-area, high-quality WTe2 materials. Here, we grow a centimeter-scale, highly crystalline WTe2 ultrathin film (˜35 nm) by a pulsed laser deposition technique. Broadband pump-probe spectroscopy (1.2-2.5 μm) reveals a peculiar ultrafast optical response where an initial photo-bleaching signal (lasting ˜3 ps) is followed by a long-lived photoinduced absorption signature. Nonlinear absorption characterization using femtosecond pulses confirms the saturable absorption response of the WTe2 ultrathin films, and we further demonstrated a mode-locked Thulium fiber laser using a WTe2 absorber. Our work provides important insights into linear and nonlinear optical responses of WTe2 thin films.
Current-induced switching in a magnetic insulator
Avci, Can Onur; Quindeau, Andy; Pai, Chi-Feng; Mann, Maxwell; Caretta, Lucas; Tang, Astera S.; Onbasli, Mehmet C.; Ross, Caroline A.; Beach, Geoffrey S. D.
2017-03-01
The spin Hall effect in heavy metals converts charge current into pure spin current, which can be injected into an adjacent ferromagnet to exert a torque. This spin-orbit torque (SOT) has been widely used to manipulate the magnetization in metallic ferromagnets. In the case of magnetic insulators (MIs), although charge currents cannot flow, spin currents can propagate, but current-induced control of the magnetization in a MI has so far remained elusive. Here we demonstrate spin-current-induced switching of a perpendicularly magnetized thulium iron garnet film driven by charge current in a Pt overlayer. We estimate a relatively large spin-mixing conductance and damping-like SOT through spin Hall magnetoresistance and harmonic Hall measurements, respectively, indicating considerable spin transparency at the Pt/MI interface. We show that spin currents injected across this interface lead to deterministic magnetization reversal at low current densities, paving the road towards ultralow-dissipation spintronic devices based on MIs.
Advances in Lasers for the Treatment of Stones-a Systematic Review.
Kronenberg, Peter; Somani, Bhaskar
2018-05-17
Laser lithotripsy is increasingly used worldwide and is a continuously evolving field with new and extensive research being published every year. Variable pulse length Ho:YAG lithotripters allow new lithotripsy parameters to be manipulated, and there is an effort to integrate new technologies into lithotripters. Pulsed thulium lasers seem to be a viable alternative to holmium lasers. The performance of similar laser fibers varies from manufacturer to manufacturer. Special laser fibers and "cleaving only" fiber tip preparation can be beneficial for the lithotripsy procedure. Different laser settings and the surgical technique employed can have significant impact on the success of laser lithotripsy. When safely done, complications of laser lithotripsy are rare and concern the endoscopic nature of procedure, not the technology itself, making laser lithotripsy one of the safest tools in urology. Laser lithotripsy has had several new developments and more insight has been gained in recent years with many more advances expected in the future.
Publications | Page 161 | CRDI - Centre de recherches pour le ...
International Development Research Centre (IDRC) Digital Library (Canada)
African Youth on the Information Highway : Participation and Leadership in ... le marché : Réflexions à la croisée de la science, de la religion et du développement ... Modern and Traditional Irrigation Technologies in the Eastern Mediterranean.
40 CFR 161.167 - Discussion of formation of impurities.
2010-07-01
... present in his product at any time before use at a level equal to or greater than 0.1 percent (1000 ppm... at any time before use at a level equal to or greater than 0.1 percent (1000 ppm) by weight of the...) PESTICIDE PROGRAMS DATA REQUIREMENTS FOR REGISTRATION OF ANTIMICROBIAL PESTICIDES Product Chemistry Data...
161 ETHICAL PROBLEMS OF RAPE AS A SOCIAL CANKERWORM ...
African Journals Online (AJOL)
violence that involves intercourse without consent or against someone being willing ... Rape is a global problem with women and children being mostly vulnerable .... allows their wards to spend too much time watching television where sex is ...
A Formal Theory of Perception. Technical Report No. 161.
Rottmayer, William Arthur
An attempt to build a mathematical model of a device that could learn geometry is discussed. The report discusses the background and motivation of the study, the coding problem, the derivation of Suppes "Stimulus-Response Theory of Finite Automata" used in the work in learning theory, and a summary of the technical work. (DB)
All projects related to | Page 161 | IDRC - International Development ...
International Development Research Centre (IDRC) Digital Library (Canada)
Ecohealth Chair on Human and Animal Health in Protected Ecosystems of Central and Eastern Africa. Project ... Topic: AGRICULTURAL PRODUCTION, ZOONOSES, GENDER ANALYSIS, Disease control, ANTIBIOTICS, ANIMAL DISEASES.
33 CFR 161.35 - Vessel Traffic Service Houston/Galveston.
2010-07-01
...; Gulf ICW and Galveston-Freeport Cut-Off from Mile 346 to Mile 352; Texas City Channel; Texas City...′ N 94°47.0′ W Red Fish Bar 4000 29°29.8′ N 94°51.9′ W Bayport Channel 4000 29°36.7′ N 94°57.2′ W... Galveston Bay Entrance Channel LB 11 and 12 29° 20.6′ N; 94° 44.6′ W E Bolivar Land Cut Mile 349...
9 CFR 161.3 - Standards for accredited veterinarian duties.
2010-01-01
... legally able to practice veterinary medicine. An accredited veterinarian shall perform the functions of an... examine such an animal showing abnormalities, in order to determine whether or not there is clinical... accredited work, an accredited veterinarian shall take such measures of sanitation as are necessary to...
50.4% slope efficiency thulium-doped large-mode-area fiber laser fabricated by powder technology.
Darwich, Dia; Dauliat, Romain; Jamier, Raphaël; Benoit, Aurélien; Auguste, Jean-Louis; Grimm, Stephan; Kobelke, Jens; Schwuchow, Anka; Schuster, Kay; Roy, Philippe
2016-01-15
We report on a triple clad large-mode-area Tm-doped fiber laser with 18 μm core diameter manufactured for the first time by an alternative manufacturing process named REPUSIL. This reactive powder sinter material enables similar properties compared to conventional CVD-made fiber lasers, while offering the potential of producing larger and more uniform material. The fiber characterization in a laser configuration provides a slope efficiency of 47.7% at 20°C, and 50.4% at 0°C with 8 W output power, with a laser peak emission at 1970 nm. Finally, a beam quality near the diffraction-limit (M(x,y)2<1.1) is proved.
Chia, Phee-Phee; Fan, Sook-Ha; Say, Yee-How
2015-11-05
This study aimed to investigate the association of peroxisome proliferator-activated receptor (PPAR) genes PPARα L162V, PPARγ2 C161T and PPARδ T294C single nucleotide polymorphisms (SNPs) with obesity and metabolic syndrome (Met-S) in a multi-ethnic population in Kampar, Malaysia. Socio-demographic data, anthropometric and biochemical measurements (plasma lipid profile, adiponectin and interleukin-6 [IL-6] levels) were taken from 307 participants (124 males; 180 obese; 249 Met-S; 97 Malays, 85 ethnic Chinese, 55 ethnic Indians). The overall minor allele frequencies were .08, .22 and .30 for PPAR α L162V, γ C161T, δ T294C, respectively. All SNPs were not associated with obesity, Met-S and obesity with/without Met-S by χ(2) analysis, ethnicity-stratified and logistic regression analyses. Nevertheless, participants with V162 allele of PPARα had significantly higher IL-6, while those with T161 allele of PPARγ2 had significantly lower HOMA-IR. All PPAR SNPs were not associated with obesity and Met-S in the suburban population of Kampar, Malaysia, where only PPARα V162 and PPARγ2 T161 alleles were associated with plasma IL-6 and HOMA-IR, respectively.
Nguyen, Ngoc-Loi; Yu, Woon-Jong; Yang, Hye-Young; Kim, Jong-Geol; Jung, Man-Young; Park, Soo-Je; Roh, Seong-Woon; Rhee, Sung-Keun
2017-10-01
Aerobic methane oxidation is a key process in the global carbon cycle that acts as a major sink of methane. In this study, we describe a novel methanotroph designated EMGL16-1 that was isolated from a freshwater lake using the floating filter culture technique. Based on a phylogenetic analysis of 16S rRNA gene sequences, the isolate was found to be closely related to the genus Methylomonas in the family Methylococcaceae of the class Gammaproteobacteria with 94.2-97.4% 16S rRNA gene similarity to Methylomonas type strains. Comparison of chemotaxonomic and physiological properties further suggested that strain EMGL16-1 was taxonomically distinct from other species in the genus Methylomonas. The isolate was versatile in utilizing nitrogen sources such as molecular nitrogen, nitrate, nitrite, urea, and ammonium. The genes coding for subunit of the particulate form methane monooxygenase (pmoA), soluble methane monooxygenase (mmoX), and methanol dehydrogenase (mxaF) were detected in strain EMGL16-1. Phylogenetic analysis of mmoX indicated that mmoX of strain EMGL16-1 is distinct from those of other strains in the genus Methylomonas. This isolate probably represents a novel species in the genus. Our study provides new insights into the diversity of species in the genus Methylomonas and their environmental adaptations.
Treatment-Based Classification versus Usual Care for Management of Low Back Pain
2014-08-01
Acknowledgment: The authors thank Dr. David Brown, sports medi- cine physician, who administered the CSIs in this trial. Grant Support: By Cardon Rehabilitation...DATES COVERED 4. TITLE AND SUBTITLE 5a. CONTRACT NUMBER 5b. GRANT NUMBER 5c. PROGRAM ELEMENT NUMBER 6. AUTHOR(S) 5d. PROJECT NUMBER 5e...Primary Funding Source: Cardon Rehabilitation Products through the American Academy of Orthopaedic Manual Physical Therapists. Ann Intern Med. 2014;161:161
Lai, PokYui; Miao, Li; Lee, Onon; Liu, Lingli; Zhou, Xiaojian; Xü , Ying; Al-Suwailem, Abdulaziz M.; Qian, Peiyuan
2012-01-01
-sporulating and only slightly halophilic. Optimum growth occurred at 20-25 °C and at pH values ranging from 7.0 to 8.0. The major cellular fatty acids of the strain were unsaturated C18: 1ω6c and/or C18:1ω7c, C18:1ω7c 11-methyl and C16:1ω7c and/or C16:1ω6c. The major
Burkitt, Esther
2016-01-01
Effects of asking children to communicate through their drawings have been investigated using animate rather than inanimate drawing topics. The present study investigated the impact of a communication context on children’s drawings of topics with contrasting animism. Three hundred and twenty two children, 156 boys and 166 girls aged 6-11 years were allocated to two conditions. The communication condition (n=161) involved instructions to communicate emotion and the reference condition (n=161) ...
Czech Academy of Sciences Publication Activity Database
Kalinowska, Z.; Pisarczyk, T.; Badziak, J.; Borodziuk, S.; Chodukowski, T.; Kasperczuk, A.; Gus´kov, S.Y.; Demchenko, N. N.; Ullschmied, Jiří; Renner, Oldřich; Krouský, Eduard; Pfeifer, Miroslav; Skála, Jiří; Šmíd, Michal; Pisarczyk, P.
T161, May (2014), 014023-014023 ISSN 0031-8949 Grant - others:FP7(XE) 284464 Program:FP7 Institutional support: RVO:61389021 ; RVO:68378271 Keywords : ablation pressure * fast electron * interferometry * resonance absorption * scale length of electron density * shock ignition conception Subject RIV: BL - Plasma and Gas Discharge Physics; BL - Plasma and Gas Discharge Physics (FZU-D) Impact factor: 1.126, year: 2014 http://iopscience.iop.org/1402-4896/2014/T161/014023
International Nuclear Information System (INIS)
Noguchi-Sasaki, Mariko; Sasaki, Yusuke; Shimonaka, Yasushi; Mori, Kazushige; Fujimoto-Ouchi, Kaori
2016-01-01
Hepcidin, a key regulator of iron metabolism, is produced mainly by interleukin-6 (IL-6) during inflammation. A mechanism linking cancer-related anemia and IL-6 through hepcidin production is suggested. To clarify the hypothesis that overproduction of IL-6 elevates hepcidin levels and contributes to the development of cancer-related anemia, we evaluated anti-IL-6 receptor antibody treatment of cancer-related anemia in an IL-6–producing human lung cancer xenograft model. Nude mice were subcutaneously inoculated with cells of the IL-6–producing human lung cancer cell line LC-06-JCK and assessed as a model of cancer-related anemia. Mice bearing LC-06-JCK were administered rat anti-mouse IL-6 receptor antibody MR16-1 and their serum hepcidin levels and hematological parameters were determined. LC-06-JCK–bearing mice developed anemia according to the production of human IL-6 from xenografts, with decreased values of hemoglobin, hematocrit, and mean corpuscular volume (MCV) compared to non–tumor-bearing (NTB) mice. LC-06-JCK–bearing mice showed decreased body weight and serum albumin with increased serum amyloid A. MR16-1 treatment showed significant inhibition of decreased body weight and serum albumin levels, and suppressed serum amyloid A level. There was no difference in tumor volume between MR16-1-treated mice and immunoglobulin G (IgG)-treated control mice. Decreased hemoglobin, hematocrit, and MCV in LC-06-JCK–bearing mice was significantly relieved by MR16-1 treatment. LC-06-JCK–bearing mice showed high red blood cell counts and erythropoietin levels as compared to NTB mice, whereas MR16-1 treatment did not affect their levels. Serum hepcidin and ferritin levels were statistically elevated in mice bearing LC-06-JCK. LC-06-JCK–bearing mice showed lower values of MCV, mean corpuscular hemoglobin (MCH), and serum iron as compared to NTB mice. Administration of MR16-1 to mice bearing LC-06-JCK significantly suppressed levels of both serum hepcidin and
Journal abstracts from current research in the field of child and adolescent mental health.
Idemudia, Erhabor S
2011-06-01
Gonzales NA, Coxe S, Roosa MW, White RMB, Knight GP, Zeiders KH and Saenz D (2011) Economic hardship, neighborhood context, and parenting: Prospective effects on Mexican-American adolescent's mental health. American Journal of Community Psychology 47(1-2): 98-113 O'Kane D (2011) A phenomenological study of child and adolescent mental health consultation in primary care. Journal of Psychiatric and Mental Health Nursing 18(2): 185-188 Sentse M, Ormel J, Veenstra R, Verhulst FC and Oldehinkel AJ (2011) Child temperament moderates the impact of parental separation on adolescent mental health: The trails study. Journal of Family Psychology 25(1): 97-106 Leo RJ, Srinivasan SP and Parekh S (2011) The role of the mental health practitioner in the assessment and treatment of child and adolescent chronic pain. Child and Adolescent Mental Health 16(1): 2-8 James AC, Winmill L, Anderson C and Alfoadari K (2011) A preliminary study of an extension of a community dialectic behaviour therapy (DBT) programme to adolescents in the looked after care system. Child and Adolescent Mental Health 16(1): 9-13 Flouri E, Hickey J, Mavroveli S and Hurry J (2011) Adversity, emotional arousal, and problem behaviour in adolescence: The role of non-verbal cognitive ability as a resilience promoting factor. Child and Adolescent Mental Health 16(1): 22-29 Paradis AD, Giaconia RM, Reinherz HZ, Beardslee WR, Ward KE and Fitzmaurice GM (2011) Adolescent family factors promoting healthy adult functioning: A longitudinal community study. Child and Adolescent Mental Health 16(1): 30-37 Webster-Stratton C, Rinaldi J and Reid JM (2011) Long-term outcomes of Incredible Years parenting program: Predictors of adolescent adjustment. Child and Adolescent Mental Health 16(1): 38-46 Baruch G, Vrouva I and Wells C (2011) Outcome findings from a parent training programme for young people with conduct problems. Child and Adolescent Mental Health 16(1): 47-54 Davis Kenaley BL and Williams NJ (2011) A preliminary
Neutron capture measurements and resonance parameters of dysprosium
Energy Technology Data Exchange (ETDEWEB)
Shin, S.G.; Kye, Y.U.; Namkung, W.; Cho, M.H. [Pohang University of Science and Technology, Division of Advanced Nuclear Engineering, Pohang, Gyeongbuk (Korea, Republic of); Kang, Y.R.; Lee, M.W. [Dongnam Inst. of Radiological and Medical Sciences, Research Center, Busan (Korea, Republic of); Kim, G.N. [Kyungpook National University, Department of Physics, Daegu (Korea, Republic of); Ro, T.I. [Dong-A University, Department of Physics, Busan (Korea, Republic of); Danon, Y.; Williams, D. [Rensselaer Polytechnic Institute, Department of Mechanical, Aerospace, and Nuclear Engineering, Troy, NY (United States); Leinweber, G.; Block, R.C.; Barry, D.P.; Rapp, M.J. [Naval Nuclear Laboratory, Knolls Atomic Power Laboratory, Schenectady, NY (United States)
2017-10-15
Neutron capture yields of dysprosium isotopes ({sup 161}Dy, {sup 162}Dy, {sup 163}Dy, and {sup 164}Dy) were measured using the time-of-flight method with a 16 segment sodium iodide multiplicity detector. The measurements were made at the 25m flight station at the Gaerttner LINAC Center at Rensselaer Polytechnic Institute. Resonance parameters were obtained using the multilevel R-matrix Bayesian code SAMMY. The neutron capture data for four enriched dysprosium isotopes and one natural dysprosium sample were sequentially fitted. New resonances not listed in ENDF/B-VII.1 were observed. There were 29 and 17 new resonances from {sup 161}Dy and {sup 163}Dy isotopes, respectively. Six resonances from {sup 161}Dy isotope, two resonances from {sup 163}Dy, and four resonances from {sup 164}Dy were not observed. The capture resonance integrals of each isotope were calculated with the resulting resonance parameters and those of ENDF/B-VII.1 in the energy region from 0.5 eV to 20 MeV and were compared to the capture resonance integrals with the resonance parameters from ENDF/B-VII.1. A resonance integral value of the natural dysprosium calculated with present resonance parameters was 1405 ± 3.5 barn. The value is ∝ 0.3% higher than that obtained with the ENDF/B-VII.1 parameters. The distributions of the present and ENDF/B-VII.1 neutron widths were compared to a Porter-Thomas distribution. Neutron strength functions for {sup 161}Dy and {sup 163}Dy were calculated with the present resonance parameters and both values were in between the values of ''Atlas of Neutron Resonances'' and ENDF/B-VII.1. The present radiation width distributions of {sup 161}Dy and {sup 163}Dy were fitted with the χ{sup 2} distribution by varying the degrees of freedom. (orig.)
Chen, Chih-Ping; Su, Yi-Ning; Chen, Yi-Yung; Su, Jun-Wei; Chern, Schu-Rern; Chen, Yu-Ting; Chen, Wen-Lin; Chen, Li-Feng; Wang, Wayseen
2011-12-01
To present prenatal diagnosis and molecular cytogenetic characterization of Wolf-Hirschhorn syndrome (WHS) associated with microduplications at 8p and 10p in a fetus with an apparently pure 4p deletion. A 35-year-old gravida 2, para 1 woman underwent amniocentesis at 18 weeks of gestation because of advanced maternal age. Her husband was 38 years of age. There was no family history of congenital malformations. Amniocentesis revealed a karyotype of 46,XY,del(4p16.1). The parental karyotypes were normal. Array comparative genomic hybridization (aCGH) analysis revealed a 6.5-Mb deletion at 4p16.3-p16.1, a 1.2-Mb microduplication at 8p22-p21.3, and a 1.1-Mb microduplication at 10p15.3, or arr cgh 4p16.3p16.1 (0-6,531,998 bp)×1, 8p22p21.3 (18,705,388-19,940,445 bp)×3, 10p15.3 (0-1,105,065 bp)×3. Polymorphic DNA marker analysis confirmed a paternal origin of 4p deletion. Prenatal ultrasound revealed facial dysmorphism and hypospadias. The aCGH analysis of the parents revealed no genomic imbalance. Fluorescence in situ hybridization study showed an unbalanced reciprocal translocation between chromosomes 4 and 10 at bands 4p16.1 and 10p15.3. The cytogenetic result, thus, was 46,XY,der(4)t(4;10)(p16.1;p15.3),dup(8)(p21.3p22). The parents elected to terminate the pregnancy, and a 470-g malformed fetus was delivered. The present case provides evidence that an apparently pure 4p deletion can be associated with subtle chromosome imbalances in other chromosomes. Copyright © 2011. Published by Elsevier B.V.
Directory of Open Access Journals (Sweden)
Clarke Rachael
2011-03-01
Full Text Available Abstract Background Microglial function is modulated by several factors reflecting the numerous receptors expressed on the cell surface, however endogenous factors which contribute to the age-related increase in microglial activation remain largely unknown. One possible factor which may contribute is interferon-γ (IFNγ. IFNγ has been shown to increase in the aged brain and potently activates microglia, although its endogenous cell source in the brain remains unidentified. Methods Male Wistar rats were used to assess the effect of age and amyloid-β (Aβ on NK cell infiltration into the brain. The effect of the anti-inflammatory compound, atorvastatin was also assessed under these conditions. We measured cytokine and chemokine (IFNγ, IL-2, monocyte chemoattractant protein-1 (MCP-1 and IFNγ-induced protein 10 kDa (IP-10, expression in the brain by appropriate methods. We also looked at NK cell markers, CD161, NKp30 and NKp46 using flow cytometry and western blot. Results Natural killer (NK cells are a major source of IFNγ in the periphery and here we report the presence of CD161+ NKp30+ cells and expression of CD161 and NKp46 in the brain of aged and Aβ-treated rats. Furthermore, we demonstrate that isolated CD161+ cells respond to interleukin-2 (IL-2 by releasing IFNγ. Atorvastatin, the HMG-CoA reductase inhibitor, attenuates the increase in CD161 and NKp46 observed in hippocampus of aged and Aβ-treated rats. This was paralleled by a decrease in IFNγ, markers of microglial activation and the chemokines, MCP-1 and IP-10 which are chemotactic for NK cells. Conclusions We propose that NK cells contribute to the age-related and Aβ-induced neuroinflammatory changes and demonstrate that these changes can be modulated by atorvastatin treatment.
LENUS (Irish Health Repository)
Lyons, Anthony
2011-03-31
Abstract Background Microglial function is modulated by several factors reflecting the numerous receptors expressed on the cell surface, however endogenous factors which contribute to the age-related increase in microglial activation remain largely unknown. One possible factor which may contribute is interferon-γ (IFNγ). IFNγ has been shown to increase in the aged brain and potently activates microglia, although its endogenous cell source in the brain remains unidentified. Methods Male Wistar rats were used to assess the effect of age and amyloid-β (Aβ) on NK cell infiltration into the brain. The effect of the anti-inflammatory compound, atorvastatin was also assessed under these conditions. We measured cytokine and chemokine (IFNγ, IL-2, monocyte chemoattractant protein-1 (MCP-1) and IFNγ-induced protein 10 kDa (IP-10)), expression in the brain by appropriate methods. We also looked at NK cell markers, CD161, NKp30 and NKp46 using flow cytometry and western blot. Results Natural killer (NK) cells are a major source of IFNγ in the periphery and here we report the presence of CD161+ NKp30+ cells and expression of CD161 and NKp46 in the brain of aged and Aβ-treated rats. Furthermore, we demonstrate that isolated CD161+ cells respond to interleukin-2 (IL-2) by releasing IFNγ. Atorvastatin, the HMG-CoA reductase inhibitor, attenuates the increase in CD161 and NKp46 observed in hippocampus of aged and Aβ-treated rats. This was paralleled by a decrease in IFNγ, markers of microglial activation and the chemokines, MCP-1 and IP-10 which are chemotactic for NK cells. Conclusions We propose that NK cells contribute to the age-related and Aβ-induced neuroinflammatory changes and demonstrate that these changes can be modulated by atorvastatin treatment.
International Nuclear Information System (INIS)
Sardanelli, Francesco; Di Leo, Giovanni; Aliprandi, Alberto; Flor, Nicola; Papini, Giacomo D.E.; Roccatagliata, Luca; Cotticelli, Biagio; Nano, Giovanni; Cornalba, Gianpaolo
2009-01-01
Objectives: This study was aimed at testing the value of image subtraction for evaluating carotid vessel wall enhancement in contrast-enhanced MR angiography (MRA). Materials and methods: IRB approval was obtained. The scans of 81 consecutive patients who underwent carotid MRA with 0.1 mmol/kg of gadobenate dimeglumine were reviewed. Axial carotid 3D T1-weighted fast low-angle shot sequence before and 3 min after contrast injection were acquired and subtracted (enhanced minus unenhanced). Vessel wall enhancement was assigned a four-point score using native or subtracted images from 0 (no enhancement) to 3 (strong enhancement). Stenosis degree was graded according to NASCET. Results: With native images, vessel wall enhancement was detected in 20/81 patients (25%) and in 20/161 carotids (12%), and scored 2.0 ± 0.6 (mean ± standard deviation); with subtracted images, in 21/81 (26%) and 22/161 (14%), and scored 2.5 ± 0.6, respectively (P < 0.001, Sign test). The overall stenosis degree distribution was: mild, 41/161 (25%); moderate, 77/161 (48%); severe, 43/161 (27%). Carotids with moderate stenosis showed vessel wall enhancement with a frequency (17/77, 22%) significantly higher than that observed in carotids with mild stenosis (1/41, 2%) (P = 0.005, Fisher exact test) and higher, even though with borderline significance (P = 0.078, Fisher exact test), than that observed in carotids with severe stenosis (4/43, 9%). Conclusion: Roughly a quarter of patients undergoing carotid MRA showed vessel wall enhancement. Image subtraction improved vessel wall enhancement conspicuity. Vessel wall enhancement seems to be an event relatively independent from the degree of stenosis. Further studies are warranted to define the relation between vessel wall enhancement and histopathology, inflammatory status, and instability.
Beaujard, M-P; Jouannic, J-M; Bessières, B; Borie, C; Martin-Luis, I; Fallet-Bianco, C; Portnoï, M-F
2005-06-01
To present the prenatal diagnosis of a de novo terminal inversion duplication of the short arm of chromosome 4 and a review of the literature. An amniocentesis for chromosome analysis was performed at 33 weeks' gestation because ultrasound examination showed a female fetus with multiple abnormalities consisting of severe intrauterine growth retardation, microcephaly, a cleft lip and renal hypoplasia. Cytogenetic analysis and FISH studies of the cultured amniocytes revealed a de novo terminal inversion duplication of the short arm of chromosome 4 characterized by a duplication of 4p14-p16.1 chromosome region concomitant with a terminal deletion 4p16.1-pter. The karyotype was thus: 46,XX, inv dup del (4)(:p14-->p16.1::p16.1-->qter). The parents opted to terminate the pregnancy. Fetopathological examination showed dysmorphic features and abnormalities consistent with a Wolf-Hirschhorn syndrome (WHS) diagnosis, clinical manifestations of partial 4p trisomy being mild. Although relatively rare, inverted duplications have been reported repeatedly in an increasing number of chromosomes. Only two previous cases with de novo inv dup del (4p) and one with tandem dup 4p have been reported, all of them associated with a 4pter deletion. We report the first case diagnosed prenatally. Breakpoints are variable, resulting in different abnormal phenotype. In our case, clinical manifestations resulted in a WHS phenotype.
International Nuclear Information System (INIS)
Nelson, C.A.
1970-12-01
A study was performed of the correlation between fuel form stability and exposure environment of (temperature and atmosphere). 100% Tm 2 O 3 , 80% Tm 2 O 3 /20% Yb 2 O 3 and 100% Yb 2 O 3 wafers were subjected to air, dynamic vacuum and static vacuum at temperatures to 2000 0 C for times to 100 hours. Results showed the Tm 2 O 3 /Yb 2 O 3 cubic structure to be unaffected by elemental levels of iron, aluminum, magnesium and silicon and unaffected by the environmental conditions imposed on the wafers. A second task emphasized the optimization of the thermal, mechanical and chemical stability of Tm 2 O 3 fuel forms. Enhancement was sought through process variable optimization and the addition of metal oxides to Tm 2 O 3 . CaO, TiO 2 and Al 2 O 3 were added to form a grain boundary precipitate to control fines generation. The presence of 1% additive was inadequate to depress the melting point of Tm 2 O 3 or to change the cubic crystalline structure of Tm 2 O 3 /Yb 2 O 3 . Tm 2 O 3 /Yb 2 O 3 wafers containing CaO developed a grain boundary phase that improved the resistance to fines generation. The presence of Yb 2 O 3 did not appear to measurably influence behavior
ORF Alignment: NC_004567 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available ... Length = 161 ... Query: 2 ... QVLFHDQALDLVGEPLQDGDQLPKFKVFTTHDEKIKTKDLLGKPVLLSVMPDIDTRVCSI 61 ... ... ... QVLFHDQALDLVGEPLQDGDQLPKFKVFTTHDEKIKTKDLLGKPVLLSVMPDIDTRVCSI Sbjct: 1 ... QVLFHDQALDLVGEPLQDGDQLPKFKVFTTH
A family-based association study of the HTR1B gene in eating disorders
Directory of Open Access Journals (Sweden)
Sandra Hernández
Full Text Available Objective: To explore the association of three polymorphisms of the serotonin receptor 1Dβ gene (HTR1B in the etiology of eating disorders and their relationship with clinical characteristics. Methods: We analyzed the G861C, A-161T, and A1180G polymorphisms of the HTR1B gene through a family-based association test (FBAT in 245 nuclear families. The sample was stratified into anorexia nervosa (AN spectrum and bulimia nervosa (BN spectrum. In addition, we performed a quantitative FBAT analysis of anxiety severity, depression severity, and Yale-Brown-Cornell Eating Disorders Scale (YBC-EDS in the AN and BN-spectrum groups. Results: FBAT analysis of the A-161T polymorphism found preferential transmission of allele A-161 in the overall sample. This association was stronger when the sample was stratified by spectrums, showing transmission disequilibrium between the A-161 allele and BN spectrum (z = 2.871, p = 0.004. Quantitative trait analysis showed an association between severity of anxiety symptoms and the C861 allele in AN-spectrum participants (z = 2.871, p = 0.004. We found no associations on analysis of depression severity or preoccupation and ritual scores in AN or BN-spectrum participants. Conclusions: Our preliminary findings suggest a role of the HTR1B gene in susceptibility to development of BN subtypes. Furthermore, this gene might have an impact on the severity of anxiety in AN-spectrum patients.
Mucilaginibacter vulcanisilvae sp. nov., isolated from a volcanic forest.
Baek, Kyunghwa; Ok Jeon, Che
2015-07-01
A Gram-stain-negative, strictly aerobic, pale-pink-pigmented bacterium, designated strain G27(T), was isolated from a volcanic forest of Jeju Island, South Korea. Cells were catalase- and oxidase-positive, non-motile rods producing exopolysaccharide and flexirubin-type and pale pink pigments. Growth of strain G27(T) was observed at 4-30 °C (optimum, 25 °C) and pH 5.0-8.0 (optimum, pH 7.0). Phylogenetic analyses based on 16S rRNA gene sequences showed that strain G27(T) formed a phyletic lineage within the genus Mucilaginibacter of the family Sphingobacteriaceae. Strain G27(T) was related most closely to Mucilaginibacter gossypii Gh-67(T) at 96.5% 16S rRNA gene sequence similarity. Strain G27(T) contained menaquinone 7 (MK-7) as the sole isoprenoid quinone and summed feature 3 (comprising C16:1ω7c/C16:1ω6c), iso-C15:0, C16:0, C16:1ω5c and C16:1ω5c as the major cellular fatty acids. Phosphatidylethanolamine was identified as the major polar lipid. The G+C content of the genomic DNA was 46.5 mol%. On the basis of phenotypic, chemotaxonomic and molecular properties, strain G27(T) represents a novel species of the genus Mucilaginibacter, for which the name Mucilaginibacter vulcanisilvae sp. nov. is proposed. The type strain is G27(T) ( = KACC 18231(T) = JCM 30363(T)).
Integrated system for recommending fertilization rates in pineapple (Ananas comosus (L. Merr. crop
Directory of Open Access Journals (Sweden)
Sergio Salgado García
2017-10-01
Full Text Available In recent years much attention has focused on the impacts of agriculture on climate change, due to this stage specialists in plant nutrition and soil fertility have achieved the task of generating adequate fertilization doses for pineapple to reduce effects on environment. A methodology for Integrated System for Recommending Fertilizer Dose (ISRFD was used. As a result, seven Thiessen polygons of the average annual rainfall, where rainfall ranged from 1640 to 2841 mm was correlated. Therefore, three major soil groups were defined and classified as subunit level. Likewise, eight doses of fertilizers were generated as follows: N, P2O5 and K2O, with a fertilizer dose, a map is generated according to the cultivar: 230-138-300 for Creole pineapple in Acrisol Cutanic (Chromic, Ferric; 460-161-480 for Cayenne and MD2 in Acrisol Cutanic (Endoclayic, Ferric; 345-161-450 for Cayenne and MD2, 253-138-450 for Creole in Acrisol Cutanic (Endoclayic, Hyperdystric, Ferric; 391-161-450 for Cayenne and MD2 in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric and Acrisol Umbric Cutanic (Endoclayic, Hyperdystric, Ferric; 207-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic, Hyperdystric; 253-138-300 for Creole in Acrisol Umbric Cutanic (Endoclayic,Hyperdystric, Ferric; 253-138-360 for Creole in Acrisol Umbric Gleyic (Hyperdystric, Ferric; and 391-161-360 in Cambisol Endogleyic (Clayic, Eutric. These fertilizer doses were supplemented with micronutrients to obtain the expected results.
ORF Alignment: NT_033778 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available MFAYDILVVTVRLGEYNTKTKVDCDNHLCQE 60 ... Query: 161 FTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGA ...220 ... FTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGA Sbjct: 121 FTTTVWRETAANATSKVLRTMNIDRQPKETCSEIYGWNMTFEQICAGNTLSQLCSTDSGA 180 ...
ORF Alignment: NC_005823 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available KYSLVAGGKRLRPVLALAAFGGLQNETQNVLLLGASLECI 100 ... NSQTLSILSKQSAPELFEAMKYSLVAGGKRLRPVLALAAFGGLQNETQNVLLLGASLEC...I Sbjct: 1 ... NSQTLSILSKQSAPELFEAMKYSLVAGGKRLRPVLALAAFGGLQNETQNVLLLGASLECI 60 ... Query: 161 LHRNLLEILHAG
Résultats de recherche | Page 161 | CRDI - Centre de recherches ...
International Development Research Centre (IDRC) Digital Library (Canada)
Du 7 au 10 février 2005, les représentants de cinq pays d'Afrique francophone (le Cameroun, le Maroc, le Niger, le Sénégal et la République démocratique du Congo - RDC) se sont réunis pour s'interroger sur les voies et moyens de dynamiser l'approp. Projet ...