WorldWideScience

Sample records for thiobacillus acidophilus thiobacillus

  1. THE DEPRESSION OF PYRITE FLOTATION BY THIOBACILLUS FERROOXIDANS

    Institute of Scientific and Technical Information of China (English)

    2000-01-01

    The experimental studies on the microbial flotation of a pure pyrite sample using Thiobacillus ferrooxidans was conducted in the laboratory. The results indicate that Thiobacillus ferrooaidans has strong depression effect on the flotation of pyrite. Thiobacillus f errooxidans can adsorb on the surface of pyrite in a very short time (a few min. ), changing the surface from hydrophobic into hydrophilic and making the pyrite particles to lose their floatability. Therefore, Thiobacillus ferrooxidans is an effective microbial depressant of pyrite. It has also been pointed out that the depression of pyrite by Thiobacillus ferrooxidans is caused by the adsorption of the microbial colloids, but not by the oxidation effect.

  2. Reduction of chromium (VI by the indirect action of Thiobacillus thioparus

    Directory of Open Access Journals (Sweden)

    E. Donati

    2003-03-01

    Full Text Available The microbial reduction of chromium(VI to chromium(III has been one of the most widely studied forms of metal bioremediation. Recently, we have found that Thiobacillus ferrooxidans and Thiobacillus thiooxidans, growing on elemental sulphur, can indirectly promote chromium(VI reduction by producing reducing agents such as sulphite and thiosulphate, which abiotically reduce chromium(VI. Those species of Thiobacillus are acidophilic bacteria which grow optimally at pH values lower than 4. However, most of those reducing agents are stabilised at higher pH values. Thus, the present paper reports on the ability to reduce chromium(VI using another specie of Thiobacilli, Thiobacillus thioparus, which is able to grow at pH close to 7.0. T. thioparus cultures were carried out in a fermentation vessel containing medium and sulphur as the sole energy source and maintained at 30ºC and 400 rpm. The pH was adjusted to 6.0, 7.0 or 8.0 and maintained with the automatic addition of KOH. Our results show high chromium (VI reduction values (close to 100% at the end of bacterial growth at the three pH values. The results of these experiments are very promising for development of a microbiological process to be used in the detoxification of chromium(VI-polluted effluents.

  3. Factors Influencing Degradation of Mercaptans by Thiobacillus ...

    African Journals Online (AJOL)

    Degradation of methylmercaptans by Thiobacillus thioparus TK-m was influenced by pH of the reaction medium. Ratios of headspace concentrations in empty vials and those of acidified buffer solutions were less than 1.0. 95% of the H2S was in headspace with the remaining 5% in solution upon acidification. The values for ...

  4. The role of sulfur-oxidizing bacteria Thiobacillus thiooxidans in pyrite weathering

    International Nuclear Information System (INIS)

    Sasaki, K.; Tsunekawa, M.; Ohtsuka, T.; Konno, H.

    1998-01-01

    The paper investigates the role of the sulfur-oxidizing bacteria Thiobacillus thiooxidans in pyrite weathering in order to clarify the effects of the bacteria on the dissolution behavior of pyrite and the formation of secondary minerals using Raman spectroscopy and powder X-ray diffraction (XRD) in addition to solution analysis. It was found that T. thiooxidans, when present with the iron-oxidizing bacteria Thiobacillus ferrooxidans, enhanced the dissolution of Fe and S species for pyrite, whereas T. thiooxidans alone did not oxidize pyrite. Enhancement of the consumption of elemental sulfur and regeneration of Fe(II) ions were also observed with T. thiooxidans together with T. ferrooxidans, while this did not occur with T. ferrooxidans alone

  5. Constitutive synthesis of a transport function encoded by the Thiobacillus ferrooxidans merC gene cloned in Escherichia coli

    International Nuclear Information System (INIS)

    Kusano, Tomonobu; Ji, Guangyong; Silver, S.; Inoue, Chihiro

    1990-01-01

    Mercuric reductase activity determined by the Thiobacillus ferrooxidans merA gene (cloned and expressed constitutively in Escherichia coli) was measured by volatilization of 203 Hg 2+ . (The absence of a merR regulatory gene in the cloned Thiobacillus mer determinant provides a basis for the constitutive synthesis of this system.) In the absence of the Thiobacillus merC transport gene, the mercury volatilization activity was cryptic and was not seen with whole cells but only with sonication-disrupted cells. The Thiobacillus merC transport function was compared with transport via the merT-merP system of plasmid pDU1358. Both systems, cloned and expressed in E. coli, governed enhanced uptake of 203 Hg 2+ in a temperature- and concentration-dependent fashion. Uptake via MerT-MerP was greater and conferred greater hypersensitivity to Hg 2+ than did uptake with MerC. Mercury uptake was inhibited by N-ethylmaleimide but not by EDTA. Ag + salts inhibited mercury uptake by the MerT-MerP system but did not inhibit uptake via MerC. Radioactive mercury accumulated by the MerT-MerP and by the MerC systems was exchangeable with nonradioactive Hg 2+

  6. Study of a bacterial leaching program for uranium ores by Thiobacillus ferroxidans

    International Nuclear Information System (INIS)

    Garcia Junior, O.

    1989-01-01

    The development of a bacterial leaching program for uranium ores is studied. Three basic points are presented: isolation and purification of Thiobacillus ferroxidans, as well Thiobacillus thio oxidans; physiological studies of growth and respiratory metabolism of T. ferroxidans; uranium leaching from two types of ore by T. ferroxidans action, on laboratory, semi pilot and pilot scales. The bacterial leaching studies were carried out in shake flasks, percolation columns (laboratory and semi pilot) and in heap leaching (pilot). The potential of the ores studied in relation to bacterial action, was first showed in shake flask experiments. The production of H 2 S O 4 and Fe 3+ was a result of the bacterial activity on both ore samples containing pyrite (Fe S 2 ). These two bacterial products resulted in a high uranium and molybdenum extraction and a lower sulfuric acid consumption compared to the sterilized treatments. Similar results were obtained in percolation column at the same scale (lab). (author)

  7. The Effect of Inoculants of Thiobacillus and Aspergillus on Corn Growth

    Directory of Open Access Journals (Sweden)

    M. Mohammdi Aria

    2011-01-01

    Full Text Available Abstract Phosphorus (P is one of the essential macronutrients for growth and development of plant. Phosphorus is added to soil in the form of phosphatic fertilizers, part of which is utilized by plants and the remainder converted into insoluble fixed forms. Increasingly high cost of chemical fertilizers has been the major stimulus to search for an alternative, naturally-occurring, phosphate source. The researchers offered phosphorus rocks as a valuable alternative source for P. fertilizer. Unfortunately, rock phosphate is not plant available in soils with a pH greater than 6. One method to increase soluble form inorganic P is application of phosphate solublizing microorganisms and sulfur oxidizing bacteria (Thiobacillus with rock phosphate. A greenhouse experiment was carried out with two bio fertilizers (bio fertilizers santes in incubation condition in a soil with low available P on corn growth. The bio fertilizers were: rock phosphate with 20% sulfur, 15% vermicompost, Thiobacillus bacteria and Aspergillus fungi (BFS20V15 at three rates: 440 kg/ha (BF1 , 880 kg/ha (BF2, 1320kg/ha (BF3, rock phosphate with 20% sulfur, 15% vermicompost, Thiobacillus bacteria (BFS20V15 at three rates: 440 kg/ha (B1 , 880 kg/ha (B2, 1320kg/ha (B3, triple super phosphate (TSP, and control without phosphorus. In the greenhouse experiment, shoot dry matter, p uptake in plant and available p in soil were determined. The results showed that maximum yield obtained from BF3 with the shoot dry weight 7.2 g per plant and with no significant difference in relation to the triple super phosphate (7.5g at 5% level. Also highest rate p-uptake resulted from BF3. There was significant difference between treatment BF3 and TSP on p-uptake. Results indicated that it could be possible to substitute rock phosphate inoculated with sulfur-oxidizing bacteria and phosphorous-solublizing fungus for super phosphate. Keywords: Uptake-p, pH Rock phosphate, Solfur, Vermicompost

  8. PERFORMANCE OF A BIOTRICKLING FILTER EMPLOYING THIOBACILLUS THIOPARUS IMMOBILIZED ON POLYURETHANE FOAM FOR HYDROGEN SULFIDE REMOVAL

    Directory of Open Access Journals (Sweden)

    N. Abdehagh

    2011-09-01

    Full Text Available The removal of hydrogen sulfide (H2S from contaminated airstream was studied in a biotrickling filter (BTF packed with open-pore polyurethane foam as a carrier of Thiobacillus thioparus (DSMZ5368 with counter current gas/liquid flows. The effect of operating parameters on BTF performance was studied. Experiments were performed at different Empty Bed Residence Times (EBRT from 9 to 45 seconds, and different initial H2S concentration from 25 to 85 ppm. The results showed reasonable performance of the BTF, in H2S removal from the synthetic gas stream. However, the performance was somewhat lower than other studies in BTF in which either Thiobacillus thioparus with other packings or polyurethane foam with other microbial cultures were used. The effect of liquid recirculation rate (LRR in the range of 175-525 ml/min (0.46-1.34 m/h on BTF performance was also studied. Results showed that increasing LRR from 175 to 350 mL/min resulted in significant enhancement of H2S removal efficiency, but further increase in LRR up to 525 mL/min had an insignificant effect. H2S elimination at different heights of the bed was studied and it was found that decrease in EBRT results in more homogeneous removal of the pollutant in BTF. Determination of microbial species in the BTF after 100 days performance showed that during BTF operation the only H2S degrading specie was Thiobacillus thioparus.

  9. Co-Inoculation Effects of Thiobacillus thiooxidans Bacteria and Mycorrhiza (Glomus spp. on Maize Nutrition at Different Levels of Sulfur

    Directory of Open Access Journals (Sweden)

    A. Gholami

    2016-02-01

    Full Text Available Introduction: Sulfur is the key element for higher crops and plays an important role in the formation of proteins, vitamins, and enzymes. It is a constituent of amino acids such as cysteine and methionine, which act for the synthesis of other compounds containing reduced sulfur, such as chlorophyll and utilization of phosphorus and otheressential nutrients.Deficiency of this nutrient in soil is usually compensated by using chemical fertilizers. However, these fertilizers have harmful effects on the environment and decrease the quality of the agriculture products. Therefore, biological fertilizers are more useful for using in agricultural ecosystems.Sulfurshould be addedto the soil, usually in a reduced form such as elemental sulfur. Use of S oxidizers enhances the rate of natural oxidation of S and speeds up the production of sulfates and makes them available to plants consequently resulting in an increased plant yield. The role of chemolithotrophic bacteria of the genus Thiobacillus through oxidation process in the soil is usually emphasized. Sulfur oxidation is the most important step of sulfur cycle, which improves soil fertility. The result is formation of sulfate, which can be used by the plants, while the acidity produced by oxidation helps to solubilize nutrients in alkaline soils. These bacteria can solubilise the soil minerals through the production of H2SO4 that reacts with these non-soluble minerals and oxidised them to be available nutrients to the cultivated plants. Arbuscular MycorrhizalFungi isan important component ofthe microbiota, mutualistic symbioticsoilfungithatcolonizesthe rootsofmost cropplants.The AM symbiosis involves an about 80% of land plant species and 92% of plant families. They have theability to enhance host uptake of relativelyimmobile nutrientsparticularly phosphorus (P andzinc (Zn,Manganese (Mn andiron(Fe.Arbuscular mycorrhizal fungi increased plant uptake of phosphorus, nitrogen and water absorption

  10. Specific dot-immunobinding assay for detection and enumeration of Thiobacillus ferrooxidans

    International Nuclear Information System (INIS)

    Arredondo, R.; Jerez, C.A.

    1989-01-01

    A specific and very sensitive dot-immunobinding assay for the detection and enumeration of the bioleaching microorganism Thiobacillus ferrooxidans was developed. Nitrocellulose spotted with samples was incubated with polyclonal antisera against whole T. ferrooxidans cells and then in 125 I-labeled protein A or 125 I-labeled goat antirabbit immunoglobulin G; incubation was followed by autoradiography. Since a minimum of 10 3 cells per dot could be detected, the method offers the possibility of simultaneous processing of numerous samples in a short time to monitor the levels of T. ferrooxidans in bioleaching operations

  11. Evaluation of Thiobacillus Bacteria and Mycorrhizal Symbiosis on Yield and Yield Components of Garlic (Allium sativum at Different Levels of Sulfur

    Directory of Open Access Journals (Sweden)

    parvin Hejazi rad

    2017-09-01

    Full Text Available Introduction Most researchers believe that good management and proper use of biofertilizers are the ways for preparation of better nutritional conditions for the medicinal plant. Garlic is one of the most important medicinal crops. Allicin is the main active ingredient in this plant. Biofertilizers contain beneficial soil microorganisms or the metabolic products. Mycorrhizal symbiosis improves the soil physical, chemical and biological properties. Mycorrhizae increase crop resistance to pathogens, nutrient and water uptake, also reduce the negative effects of environmental stress and improve the quality of their host plants. Adding sulfur to the soil to improve the nutritional status of the plant by the release of nutrients will be effective when that the oxidation of sulfur in the soil is significant. For sulfur uptake by the plant, it is necessary that this element convert to sulfate by soil microorganisms. If elemental sulfur distribute in the soil and mix with the organic material, conversion of sulfur-oxidizing microorganisms be faster in wet conditions. Materials and methods The experiment was conducted as randomized complete block design with three replications in 2012. Treatments were included control plot, mycorrhizal inoculation (M, Thiobacillus (T, M + T, 75 kg sulfur per hectare (75S, 75S + M, 75S + T, 75S + M + T, 150 kg sulfur per hectare (150S, 150S + M, 150S + T, 150S + M + T. Each plot consisted of four rows with a spacing of 40 cm and row length of 10 m. In treatments with 75 and 150 kg sulfur per hectare, 48 and 96 g of sulfur were used, respectively. Thiobacillus at the recommended dose was added to the soil a week before planting. Percent of fungal colonization obtained with Gridline Intersect Method. HPLC method was used to extract allicin content. Data were analyzed with the MSTAT-C software; the means were compared with LSD test at the 5% level of probability. Results and discussion The results showed that tuber dry

  12. Ferrous Iron Oxidation by Thiobacillus ferrooxidans: Inhibition with Benzoic Acid, Sorbic Acid, and Sodium Lauryl Sulfate

    OpenAIRE

    Onysko, Steven J.; Kleinmann, Robert L. P.; Erickson, Patricia M.

    1984-01-01

    Benzoic acid, sorbic acid, and sodium lauryl sulfate at low concentrations (5 to 10 mg/liter) each effectively inhibited bacterial oxidation of ferrous iron in batch cultures of Thiobacillus ferrooxidans. The rate of chemical oxidation of ferrous iron in low-pH, sterile batch reactors was not substantially affected at the tested concentrations (5 to 50 mg/liter) of any of the compounds.

  13. Ferrous Iron Oxidation by Thiobacillus ferrooxidans: Inhibition with Benzoic Acid, Sorbic Acid, and Sodium Lauryl Sulfate

    Science.gov (United States)

    Onysko, Steven J.; Kleinmann, Robert L. P.; Erickson, Patricia M.

    1984-01-01

    Benzoic acid, sorbic acid, and sodium lauryl sulfate at low concentrations (5 to 10 mg/liter) each effectively inhibited bacterial oxidation of ferrous iron in batch cultures of Thiobacillus ferrooxidans. The rate of chemical oxidation of ferrous iron in low-pH, sterile batch reactors was not substantially affected at the tested concentrations (5 to 50 mg/liter) of any of the compounds. PMID:16346592

  14. Genetic manipulation of the obligate chemolithoautotrophic bacterium Thiobacillus denitrificans

    Energy Technology Data Exchange (ETDEWEB)

    Beller, H.R.; Legler, T.C.; Kane, S.R.

    2011-07-15

    Chemolithoautotrophic bacteria can be of industrial and environmental importance, but they present a challenge for systems biology studies, as their central metabolism deviates from that of model organisms and there is a much less extensive experimental basis for their gene annotation than for typical organoheterotrophs. For microbes with sequenced genomes but unconventional metabolism, the ability to create knockout mutations can be a powerful tool for functional genomics and thereby render an organism more amenable to systems biology approaches. In this chapter, we describe a genetic system for Thiobacillus denitrificans, with which insertion mutations can be introduced by homologous recombination and complemented in trans. Insertion mutations are generated by in vitro transposition, the mutated genes are amplified by the PCR, and the amplicons are introduced into T. denitrificans by electroporation. Use of a complementation vector, pTL2, based on the IncP plasmid pRR10 is also addressed.

  15. Work within the coordinated programme on bacterial leaching of uranium ores. Immunological identification of Thiobacillus ferrooxidans and Thiobacillus thiooxidans

    International Nuclear Information System (INIS)

    Rhee, K.S.

    1978-04-01

    Little is known of the antigenic structure of Thiobacillus. In the composition of the antigens of gram negative bacteria the polysaccharide moiety endows some specificity permitting immunological identification. The report considers work on attempts to isolate the type specific component from T. thiooxidans and T ferrooxidans. The fractionation procedures presented suggest that the presence of one or a few such type specific major protein antigen fractions from both of the T. ferrooxidans and the T. thiooxidans seems to be originated from the cytoplasm of the bacteria, since it is believed that the glycoprotein fractions which was derived from the cell wall are the common antigenic fraction between the T. ferrooxidans and the T. thiooxidans, respectively. In this regard, it is of great interest that the T. ferrooxidans or the T. thiooxidans appears not to have the type-specific antigens on their LPS or polysaccharide moiety in contrast to the other gram-negative bacteria. Thus, it is strongly believed that the envelopes of these bacteria contain both glycoproteins bearing common antigenicity, since the T. ferrooxidans and the T. thiooxidans have a structually different type-specific antigen moiety according to the results polyacrylamide gel electrophoresis

  16. Effect of Vermicompost, Sulfur and Thiobacillus on Some Soil Physico-chemical Properties, Yield and Yield Components of Maize (Zea mays L. in Jovain District

    Directory of Open Access Journals (Sweden)

    Mahmmud Ahmadi

    2018-02-01

    Full Text Available Introduction The excessive use of chemical fertilizers causes environmental pollution that is led to imbalance of essential elements in agricultural production system. Organic matter application as compost in the soil can improve chemical quality and biochemical properties that increase essential elements for plant nutrition. Application of organic manure can significantly increase the soil aggregate as well. Reported that application of 7 ton ha-1 of vermicompost increased number of leaves, stem dry weight, and corn plant height as compared to control and water holding capacity increases. Sulphur in plant is near to phosphorus (0.2%. Sulphur deficiency cause severe reduction in plant growth and due to participation in protein building and its deficiency cause yellowish in younger leaves. Sulphur can be applied as elemental sulphur, with ammonium and super phosphate to the soil. Iran is situated in arid and semi arid region of the world and need to reduce the pH with sulphur application due to high pH above 8 in some parts. The aim of this research was to study the effect of above factors in yield and yield components of maize and reducing environmental pollution. Materials and Methods This research carried out at 2012 in Jovein Distract suberb of Sabzevar city. Before conducting the research soil sample were collected from 0-30 cm depth and physical and chemical properties of the soil were estimated. Treatments including sulphur, thiobacillus and vermicompost were applied to soil and well mixed with soil before sowing. Each plot consists of five rows with six m length by 80 cm from each other. Seeds were sown at the depth of five cm and 20 cm from each other. This research carried out as a factorial experiment on the basis of randomized complete block design. In this research three factors including elemental sulphur, vermicompost and thiobacillus were used with three replications. Elemental sulphur in three levels (control, 500 kg ha-1 and

  17. Growth of Thiobacillus ferrooxidans on elemental sulfur

    International Nuclear Information System (INIS)

    Espejo, R.T.; Romero, P.

    1987-01-01

    Growth kinetics of Thiobacillus ferrooxidans in batch cultures, containing prills of elementary sulfur as the sole energy source, were studied by measuring the incorporation of radioactive phosphorus in free and adsorbed bacteria. The data obtained indicate an initial exponential growth of the attached bacteria until saturation of the susceptible surface was reached, followed by a linear release of free bacteria due to successive replication of a constant number of adsorbed bacteria. These adsorbed bacteria could continue replication provided the colonized prills were transferred to fresh medium each time the stationary phase was reached. The bacteria released from the prills were unable to multiply, and in the medium employed they lost viability with a half-live of 3.5 days. The spreading of the progeny on the surface was followed by staining the bacteria on the prills with crystal violet; this spreading was not uniform but seemed to proceed through distortions present in the surface. The specific growth rate of T. ferrooxidans ATCC 19859 was about 0.5 day -1 , both before and after saturation of the sulfur surface. The growth of adsorbed and free bacteria in medium containing both ferrous iron and elementary sulfur indicated that T. ferrooxidans can simultaneously utilize both energy sources

  18. Evaluation of the Effect of Sulfur Application and Thiobacillus on Some Soil Chemical Characteristics and Yield of Canola in Wheat-Canola Rotation System

    Directory of Open Access Journals (Sweden)

    H. Besharati

    2016-09-01

    Full Text Available Introduction: After soybean and palm oil, canola is third important oil seed in the world which belongs to the genus Brassicaceae, that its seeds contain about 40% oil. The per capita consumption of oil in Iran is about 14 kg, so approximately 900 thousand tons of oil will be required for each year. However, only less than 10% of this oil is produced in the country. In recent years, special attention has been paid to canola cultivation in order to increase oil production, so during recent years an apparent increase in canola cultivated lands is significant. In most of these canola cultivated lands, the soil is calcareous therefore; some available nutrients such as phosphorus, iron and zinc are less than the amounts required by plants. Increasing qualitative and quantitative yield of canola in calcareous soils is a priority to canola cultivation improvement. Sulfur plays an important role in oil content of oily seed crops. On the other hands sulfur oxidation in calcareous soils can improve some nutrients availability. The present study was designed to investigate the effect of sulfur on yield, oil content and nutrients uptake and also its impact on soil chemical properties with 8 treatments, in 3 replications. Materials and Methods: This study was conducted in Ekbatan research station in Hamedan province for 2 years as completely randomized block design with 8 treatments and 3 repetitions. The treatments were: T1: Control (Without sulfur and Thiobacillus, T2: Application of 150 kg sulfur per ha, T3: T2+ Thiobacillus inoculums (2% of applied sulfur, T4: Application of 300 kg sulfur per ha, T5: T4+ Thiobacillus inoculums (2% of applied sulfur, T6: Application of 600 kg sulfur per ha, T7: T6+ Thiobacillus inoculums (2% of applied sulfur T8: Fertilizing based on soil test without sulfur and Thiobacillus. Thiobacillus inoculant containing about 107 cells of Thiobacillus bacteria which belonged to neutrophile Thiobacilli were prepared at soil biology

  19. Short communication: Adverse effect of surface-active reagents on the bioleaching of pyrite and chalcopyrite by Thiobacillus ferrooxidans.

    Science.gov (United States)

    Huerta, G; Escobar, B; Rubio, J; Badilla-Ohlbaum, R

    1995-09-01

    Oxidation of Fe(II) iron and bioleaching of pyrite and chalcopyrite by Thiobacillus ferrooxidans was adversely affected by isopropylxanthate, a flotation agent, and by LIX 984, a solvent-extraction agent, each at ≤ 1 g/l. The reagents/l were adsorbed on the bacterial surface, decreasing the bacteria's development and preventing biooxidation. Both reagents inhibited the bioleaching of pyrite and LIX 984 also inhibited the bioleaching of chalcopyrite.

  20. A novel mineral flotation process using Thiobacillus ferrooxidans.

    Science.gov (United States)

    Nagaoka, T; Ohmura, N; Saiki, H

    1999-08-01

    Oxidative leaching of metals by Thiobacillus ferrooxidans has proven useful in mineral processing. Here, we report on a new use for T. ferrooxidans, in which bacterial adhesion is used to remove pyrite from mixtures of sulfide minerals during flotation. Under control conditions, the floatabilities of five sulfide minerals tested (pyrite, chalcocite, molybdenite, millerite, and galena) ranged from 90 to 99%. Upon addition of T. ferrooxidans, the floatability of pyrite was significantly suppressed to less than 20%. In contrast, addition of the bacterium had little effect on the floatabilities of the other minerals, even when they were present in relatively large quantities: their floatabilities remained in the range of 81 to 98%. T. ferrooxidans thus appears to selectively suppress pyrite floatability. As a consequence, 77 to 95% of pyrite was removed from mineral mixtures while 72 to 100% of nonpyrite sulfide minerals was recovered. The suppression of pyrite floatability was caused by bacterial adhesion to pyrite surfaces. When normalized to the mineral surface area, the number of cells adhering to pyrite was significantly larger than the number adhering to other minerals. These results suggest that flotation with T. ferrooxidans may provide a novel approach to mineral processing in which the biological functions involved in cell adhesion play a key role in the separation of minerals.

  1. Influence oFe3+ Ions on Nitrate Removal by Autotrophic Denitrification Using Thiobacillus denitrificans

    Directory of Open Access Journals (Sweden)

    Z. Blažková

    2017-07-01

    Full Text Available he sulphur-based autotrophic denitrification process utilizing Thiobacillus denitrificans was studied experimentally as an alternative method of removing nitrates from industrial wastewater. The objective of the work was to examine the effect of ferric iron addition to the reaction mixture and determine optimal dosage for specific conditions. All experiments were carried out in anoxic batch bioreactor, and elemental sulphur was used as an electron donor. Compared to the control operation without ferric iron addition, significant increases in nitrates removal were demonstrated for the concentration of ferric iron equal to 0.1 mg L–1. However, under these conditions, increased nitrite content was detected in the reaction mixture which exceeds the limits for drinking water.

  2. Mathematical model of the oxidation of ferrous iron by a biofilm of Thiobacillus ferrooxidans.

    Science.gov (United States)

    Mesa, M M; Macías, M; Cantero, D

    2002-01-01

    Microbial oxidation of ferrous iron may be a viable alternative method of producing ferric sulfate, which is a reagent used for removal of H(2)S from biogas. The paper introduces a kinetic study of the biological oxidation of ferrous iron by Thiobacillus ferrooxidans immobilized on biomass support particles (BSP) composed of polyurethane foam. On the basis of the data obtained, a mathematical model for the bioreactor was subsequently developed. In the model described here, the microorganisms adhere by reversible physical adsorption to the ferric precipitates that are formed on the BSP. The model can also be considered as an expression for the erosion of microorganisms immobilized due to the agitation of the medium by aeration.

  3. Kinetic properties of ATP sulfurylase and APS kinase from Thiobacillus denitrificans.

    Science.gov (United States)

    Gay, Sean C; Fribourgh, Jennifer L; Donohoue, Paul D; Segel, Irwin H; Fisher, Andrew J

    2009-09-01

    The Thiobacillus denitrificans genome contains two sequences corresponding to ATP sulfurylase (Tbd_0210 and Tbd_0874). Both genes were cloned and expressed protein characterized. The larger protein (Tbd_0210; 544 residues) possesses an N-terminal ATP sulfurylase domain and a C-terminal APS kinase domain and was therefore annotated as a bifunctional enzyme. But, the protein was not bifunctional because it lacked ATP sulfurylase activity. However, the enzyme did possess APS kinase activity and displayed substrate inhibition by APS. Truncated protein missing the N-terminal domain had APS kinase activity suggesting the function of the inactive sulfurylase domain is to promote the oligomerization of the APS kinase domains. The smaller gene product (Tbd_0874; 402 residues) possessed strong ATP sulfurylase activity with kinetic properties that appear to be kinetically optimized for the direction of APS utilization and ATP+sulfate production, which is consistent with an enzyme that functions physiologically to produce inorganic sulfate.

  4. Structure/function relationship of the rusticyanin among thiobacillus ferroxidans: from the fermenter to the crystal; Relations structure/fonction de la rusticyanine chez thiobacillus ferrooxidans: du fermenteur au cristal

    Energy Technology Data Exchange (ETDEWEB)

    Nunzi, F.

    1996-09-23

    The commercial extraction of copper and uranium from ores by microbial leaching turns to account the iron oxidation capacity of Thiobacillus ferroxidans. The iron oxidation involves an electron transport chain localized in the peri-plasmic space of the cell. The aim of our work is to study the structure-function relationships of rusticyanin, the most important component of this respiratory chain. Rusticyanin is a blue copper protein and has been characterized from a new strain of Thilbacillus ferrooxidans. A preliminary electrochemical study has been made with a new modified-gold electrode and we have examined, in particular, the pH dependence of the high redox potential of rusticyanin. Its amino acid sequence has been determined and a comparison with two other rusticyanin sequences, isolated from different strains, shows a high degree of homology. A structural alignment with six other blue copper proteins allows to propose four residues as copper ligands, His 84, Cys 138, His 143 and Met 148. The supposed factors responsible for the high redox potential of rusticyanin are discussed. (author)

  5. Evaluating Maize Yield and the Quality of Response to Vermicompost, in Thiobacillus and Foliar Application of Fe and Zn

    Directory of Open Access Journals (Sweden)

    Elnaz Davaran Hagh

    2017-08-01

    Full Text Available Introduction Half of the world's population suffers from micronutrients malnutrition. Use of bio-fertilizers in sustainable agricultural systems is important in production and enables plants to absorb more water from soil and improves plant nutrient uptake and photosynthesis. Benefits of vermicompost application in agriculture is due to its content of organic matter, plant nutrients and plant growth promotion. Vermicompost increases the absorption and transition of nutrients from soil to roots and improves plant growth (Simsek-Ersahin, 2011. Zn and Fe application is highly important; foliar application causes faster and higher absorption rate and cures deficiencies symptoms (Ghaffari et al., 2010. Thiobacillus is a chemolithotroph bacterium, receiving energy from sulfur oxidation. This bacterium acidifies microcites in the rhizosphere, increasing the availability of nutrients to plant roots (Kaya et al., 2009. Regarding the benefits of integrated nutrient management, this experiment was conducted with the aim of testing the effects of Fe and Zn foliar spraying, Thiobacillu sthiooxidans inoculation and vermicompost application on growth, yield and bio fortification of popcorn maize. Materials and methods This experiment was conducted in 2012 at the research field of Islamic Azad University, Tabriz branch, Iran. The experiment was conducted in factorial in the form of a randomized complete block design with three replications and four factors: vermicompost application in soil (0 and 2 t.ha-1, applied in strip form below the seeds before cultivation, inoculation with Thiobacillus thiooxidans, with a population of 108cfu.g-1. Sulfur was inoculated with T. thiooxidans prior to application. Fe chelate foliar application (without spraying and two times spraying of 0.002 concentration of 13% Fe chelate and Zn chelate foliar application (without spraying and two times spraying of 0.002 concentration of 15% Zn chelate. Maize seeds (Zea mays L. var

  6. Effect of Thiobacillus thioparus 1904 and sulphur addition on odour emission during aerobic composting.

    Science.gov (United States)

    Gu, Wenjie; Sun, Wen; Lu, Yusheng; Li, Xia; Xu, Peizhi; Xie, Kaizhi; Sun, Lili; Wu, Hangtao

    2018-02-01

    The effects of sulphur and Thiobacillus thioparus 1904 on odour emissions during composting were studied. Results indicated that the sulphur addition reduced the pH and decreased cumulative emission of ammonia and the nitrogen loss by 47.80% and 44.23%, respectively, but the amount of volatile sulphur compounds (VSCs) and the sulphur loss increased. The addition of T. thioparus 1904 effectively reduced the cumulative emissions of H 2 S, methyl sulphide, methanethiol, dimethyl disulphide and the sulphur loss by 33.24%, 81.24%, 32.70%, 54.22% and 54.24%, respectively. T. thioparus 1904 also limited the nitrogen loss. The combined application of sulphur and T. thioparus 1904 resulted in the greatest amount of nitrogen retention. The accumulation of ammonia emissions was reduced by 63.33%, and the nitrogen loss was reduced by 71.93%. The combined treatment did not increase the emission of VSCs. The application of sulphur and T. thioparus 1904 may help to control the odour of compost. Copyright © 2017. Published by Elsevier Ltd.

  7. A kinetic study of the depyritization of oil shale HCl-kerogen concentrate by Thiobacillus ferrooxidans at different temperatures

    Directory of Open Access Journals (Sweden)

    OLGA CVETKOVIC

    2003-05-01

    Full Text Available The results of kinetic studies of bacterial depyritization of HCl-kerogen concentrate of Aleksinac (Serbia oil shale by the chemolithoautotrophic thionic bacteria Thiobacillus ferrooxidans under discontinuous laboratory conditions at various temperatures (0, 20, 28 and 37°C at a pH of ca. 1.5 are presented in this paper. Low pH prevents the occurrence of the precipitation of iron(III-ion hydrolysis products on the substrate particles and thereby reduces the process efficiency. Bacterial depyritization is developed as per kinetics of the first order. The activation energy which points to a successive mechanism of pyrite biooxidation, was computed from the Arrhenius plot. The biochemical kinetics indicators point to a high affinity of the bacteria toward pyrite but small values of Vmax, which are probably the result of decelerated metabolic processes due to the low pH value of the environment resp. the large difference of the pH between the external medium and the cell interior.

  8. Aplicação de técnicas eletroquímicas no estudo da dissolução oxidativa da covelita (CuS por Thiobacillus ferrooxidans Electrochemical techniques applied to study the oxidative dissolution of the covellite: CuS by Thiobacillus ferrooxidans

    Directory of Open Access Journals (Sweden)

    Christiane Medina Teixeira

    2002-02-01

    Full Text Available Among the copper sulphides, chalcopyrite (CuFeS2, covellite (CuS and chalcocite (Cu2S are the most important source of minerals for copper mining industry. The acknowledge of behaviour of these sulphides related with bacterial leaching process are essential for optimization procedures. Despite of its importance, covellite has not deserved much interest of researchers regarding this matter. In this work it was studied the oxidation of covellite by the chemolithotrophic bacterium Thiobacillus ferrooxidans by using electrochemical techniques, such as open circuit potentials with the time and cyclic voltammetry. The experiments were carried out in acid medium (pH 1.8, containing or not Fe2+ as additional energy source, and in different periods of incubation; chemical controls were run in parallel. The results showed that a sulphur layer is formed spontaneously due the acid attack, covering the sulphide in the initial phase of incubation, blocking the sulphide oxidation. However, the bacterium was capable to oxidize this sulphur layer. In the presence of Fe2+ as supplemental energy source, the corrosion process was facilitated, because ocurred an indirect oxidation of covellite by Fe3+, which was produced by T. ferrooxidans oxidation of the Fe2+ added in the medium.

  9. Hydrogen sulfide oxidation in novel Horizontal-Flow Biofilm Reactors dominated by an Acidithiobacillus and a Thiobacillus species.

    Science.gov (United States)

    Gerrity, S; Kennelly, C; Clifford, E; Collins, G

    2016-09-01

    Hydrogen Sulfide (H2S) is an odourous, highly toxic gas commonly encountered in various commercial and municipal sectors. Three novel, laboratory-scale, Horizontal-Flow Biofilm Reactors (HFBRs) were tested for the removal of H2S gas from air streams over a 178-day trial at 10°C. Removal rates of up to 15.1 g [H2S] m(-3) h(-1) were achieved, demonstrating the HFBRs as a feasible technology for the treatment of H2S-contaminated airstreams at low temperatures. Bio-oxidation of H2S in the reactors led to the production of H(+) and sulfate (SO(2-)4) ions, resulting in the acidification of the liquid phase. Reduced removal efficiency was observed at loading rates of 15.1 g [H2S] m(-3) h(-1). NaHCO3 addition to the liquid nutrient feed (synthetic wastewater (SWW)) resulted in improved H2S removal. Bacterial diversity, which was investigated by sequencing and fingerprinting 16S rRNA genes, was low, likely due to the harsh conditions prevailing in the systems. The HFBRs were dominated by two species from the genus Acidithiobacillus and Thiobacillus. Nonetheless, there were significant differences in microbial community structure between distinct HFBR zones due to the influence of alkalinity, pH and SO4 concentrations. Despite the low temperature, this study indicates HFBRs have an excellent potential to biologically treat H2S-contaminated airstreams.

  10. Charge and softness of the outer part of the cell wall of Thiobacillus ferrooxidans in the low ionic strength medium

    Directory of Open Access Journals (Sweden)

    Škvarla Jiří

    2002-03-01

    Full Text Available The surface charge and surface potential are parameters influencing the microbial adhesion phenomenon through the electrostatic interaction between bacteria and substrates. The Smoluchowski equation, originally developed for estimating the above parameters from the experimentally accessible electrophoretic mobility of rigid colloid particles, is however inapplicable to the elastic bacterial cells. The problem is that the outer cell wall of bacteria is a layer with a complex polyelectrolyte structure. In this article, the OhshimaLs model of the gsofth particle is applied to describe the surface electrostatics of Thiobacillus ferrooxidans cells by measuring their electrophoretic mobility in distilled water as a function of a (low ionic strength and pH. In this model, the rigid core is considered to be covered with a charged ion-penetrable layer of polyelectrolytes. Two model parameters have been determined by the curve fitting at pH from 3.2 to 5.8, namely the number density of the dissociated groups N and the softness parameter 1/ƒÉ of the polyelectrolyte layer of the bacterium. A disagreement of the best fit parameters (evaluated by the correlation coefficient with the analogous parameters determined for other colloids (including bacterial cells in aqueous solutions of a high ionic strength is discussed.

  11. Genome-enabled studies of anaerobic, nitrate-dependent iron oxidation in the chemolithoautotrophic bacterium Thiobacillus denitrificans

    Directory of Open Access Journals (Sweden)

    Harry R Beller

    2013-08-01

    Full Text Available Thiobacillus denitrificans is a chemolithoautotrophic bacterium capable of anaerobic, nitrate-dependent U(IV and Fe(II oxidation, both of which can strongly influence the long-term efficacy of in situ reductive immobilization of uranium in contaminated aquifers. We previously identified two c-type cytochromes involved in nitrate-dependent U(IV oxidation in T. denitrificans and hypothesized that c-type cytochromes would also catalyze Fe(II oxidation, as they have been found to play this role in anaerobic phototrophic Fe(II-oxidizing bacteria. Here we report on efforts to identify genes associated with nitrate-dependent Fe(II oxidation, namely (a whole-genome transcriptional studies [using FeCO3, Fe2+, and U(IV oxides as electron donors under denitrifying conditions], (b Fe(II oxidation assays performed with knockout mutants targeting primarily highly expressed or upregulated c-type cytochromes, and (c random transposon-mutagenesis studies with screening for Fe(II oxidation. Assays of mutants for 26 target genes, most of which were c-type cytochromes, indicated that none of the mutants tested were significantly defective in nitrate-dependent Fe(II oxidation. The non-defective mutants included the c1-cytochrome subunit of the cytochrome bc1 complex (complex III, which has relevance to a previously proposed role for this complex in nitrate-dependent Fe(II oxidation and to current concepts of reverse electron transfer. A transposon mutant with a disrupted gene associated with NADH:ubiquinone oxidoreductase (complex I was ~35% defective relative to the wild-type strain; this strain was similarly defective in nitrate reduction with thiosulfate as the electron donor. Overall, our results indicate that nitrate-dependent Fe(II oxidation in T. denitrificans is not catalyzed by the same c-type cytochromes involved in U(IV oxidation, nor have other c-type cytochromes yet been implicated in the process.

  12. Role of Thiobacillus thioparus in the biodegradation of carbon disulfide in a biofilter packed with a recycled organic pelletized material.

    Science.gov (United States)

    Prenafeta-Boldú, Francesc X; Rojo, Naiara; Gallastegui, Gorka; Guivernau, Miriam; Viñas, Marc; Elías, Ana

    2014-07-01

    This study reports the biodegradation of carbon disulfide (CS2) in air biofilters packed with a pelletized mixture of composted manure and sawdust. Experiments were carried out in two lab-scale (1.2 L) biofiltration units. Biofilter B was seeded with activated sludge enriched previously on CS2-degrading biomass under batch conditions, while biofilter A was left as a negative inoculation control. This inoculum was characterized by an acidic pH and sulfate accumulation, and contained Achromobacter xylosoxidans as the main putative CS2 biodegrading bacterium. Biofilter operation start-up was unsuccessfully attempted under xerophilic conditions and significant CS2 elimination was only achieved in biofilter A upon the implementation of an intermittent irrigation regime. Sustained removal efficiencies of 90-100 % at an inlet load of up to 12 g CS2 m(-3) h(-1) were reached. The CS2 removal in this biofilter was linked to the presence of the chemolithoautotrophic bacterium Thiobacillus thioparus, known among the relatively small number of species with a reported capacity of growing on CS2 as the sole energy source. DGGE molecular profiles confirmed that this microbe had become dominant in biofilter A while it was not detected in samples from biofilter B. Conventional biofilters packed with inexpensive organic materials are suited for the treatment of low-strength CS2 polluted gases (IL biofiltration of recalcitrant compounds has been highlighted.

  13. Distribution, ecology and inhibition of Thiobacillus ferrooxidans in relation to acid drainage from Witwatersrand gold mine dumps

    International Nuclear Information System (INIS)

    Whillier, P.A.

    1987-03-01

    The distribution and ecology of Thiobacillus ferrooxidans in gold mine dumps and possible means for its inhibition were investigated. A literature survey of the micro-ecology of mine waste dumps in various parts of the world was undertaken. A linear alkylbenzene sulphonate (LAS), NANSA 80/S, and a cetyl pyridinium chloride, Ceepryn, were tested as possible inhibitors for mine dump application. The LAS was rejected because it is poorly soluble in water and required higher concentrations than SLS for the inhibition of T.ferrooxidans. Ceepryn was an efficient inhibitor, but its efficiency was dramatically impeded in the presence of mine dump sand making it unsuitable for application on dumps. The SLS and LAS were tested against a mixed population of T.ferrooxidans from gold mine dumps and these bacteria were shown to be marginally more resistant to the inhibitors than the pure T.ferrooxidans culture. Sampling from mine dumps on the Witwatersrand suggested that the major T.ferrooxidans populations occurred in the moist sand of the drainage areas at the base of dumps, with few viable iron-oxidising bacteria located on the surfaces or in the centre of dumps. Sites of low moisture in dumps contained few or no viable bacteria. In the laboratory the bacterial viability decreased rapidly with loss of moisture from the sand. Moisture was shown to be important to bacterial activity and should be considered with respect to acid drainage control. Experimental sand columns showed that iron was leached with water from mine dump sand in the absence and presence of bacteria. In this study substrates, moisture, oxygen and carbon dioxide availability, ph, temperature, microorganisms and metal pollutants of uranium waste dumps are also covered

  14. Oxidation of inorganic compounds of sulphur by various sulphur bacteria

    Energy Technology Data Exchange (ETDEWEB)

    Parker, C D; Prisk, J

    1953-01-01

    Cultures of thiobacillus thiooxidans, Th. thioparus, Th. novellus, Thiobacillus b strains t and kand Th. concretivorus, Thiobacillus x and the m strains, organisms isolated from concrete were examined to elucidate the mode of oxidation and to establish the identity of the organisms recently isolated from corroded concrete. Thiosulphate was oxidized by all these bacteria. Th. thiooxidans, Th. concretivorus and Thiobacillus x first converted it to tetrathionate and sulphate and then oxidized the tetrathionate to sulphate and free sulphuric acid. Thiobaciullus x differed from the other two in that, owing to a lesser acid tolerance, some tetrathionate was found in the final products of oxidation. Th. Thioparus converted thiosulphate to sulphate and sulphur, followed by partial oxidation of the sulphur to sulphuric acid. Th. novellus produced sulphate and sulphuric acid. Thiobacillus b, the t and k strains and the m strains formed sulphate and tetrathionate with temporary increase in pH value; only Thiobacillus x oxidized tetrationate, yielding sulphate and sulphuric acid. Elementary sulphur was oxidized by Th. thiooxidans, th. Concretivorus, thiobacillus x and Th. thioparus; the rates of oxidation decreased in that order, and the only product was sulphuric acid. Hydrogen sulphide was oxidized only at low concentrations and only by th. Concretivorus and Thiobacillus x; sulphuric acid was the end-product, and elementary sulphur may have been an intermediate. Thiobacillus x differed from Th. thiooxidans in pH range for growth and from Th. thioparus in its method of oxidation of thiosulphate, tetrathionate and H/sub 2/S. The m strains were similar to thiobacillus b and the t and k strains of trautwein.

  15. Biodegradation of Mustard

    Science.gov (United States)

    1994-07-01

    different areas of Kuwait. The isolates were identified as Asoeraillus terreus, h. IlabirM, Mucor alobosus, usarium sp . and Penicillium citrinum (94...Thiobacillus delicatus nov. sp . J. Ferment . Technol. 54:181-191 (1976). (39) Harrison, AP. The acidophilic thiobacilli and other acidophilic bacteria...methyl sulfide is oxidized to sulfate by Hnhomicrobium S sp ., Hynhomicrobu EG (21-23), Thiobacillus thioDarus TK-m and Thiobacillus MS1 (24,25), but only

  16. Bioextraction of copper and zinc from fly ash from coal combustion

    Energy Technology Data Exchange (ETDEWEB)

    Wilczok, T; Cwalina, B; Chrostowska, D

    1986-02-01

    Results are evaluated of investigations carried out by the Institute of Chemistry and Physics of the Silesia Medical Academy in Sosnowiec into feasibility of bacterial leaching for utilization of fly ash from combustion of black coal. Fly ash separated by electrostatic precipitators in the Dolna Odra power plant fired with black coal was used. Copper content in the fly ash on the average was 0.012%, that of zinc was 0.025%. When Thiobacillus ferroxidans, Thiobacillus thiooxidans and bacteria separated from fly ash were used leaching efficiency after 21 days ranged from 69 to 87% in the case of copper and from 48 to 72% in the case of zinc. Origin of bacteria separated from fly ash was unclear. Autochthonous bacteria in the fly ash being leached increased efficiency of bacterial leaching. Effects of autochthonous bacteria were similar to those of the bacterial culture of Thiobacillus ferroxidans and Thiobacillus thiooxidans. Investigation results were shown in a table and 2 diagrams. 19 references.

  17. FY 1994 report on the cooperative research on the biological use mine wastewater treatment technology; 1994 nendo bio riyo ni yoru kohaisui shori gijutsu ni kansuru kenkyu kyoryoku hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1995-03-01

    In this project, a pilot plant for mine wastewater treatment facilities using Thiobacillus ferrooxidans was installed at the Wushan mine in China to study the operation using the bacteria habitable in this mine. The project aims at establishing the mine wastewater treatment technology using the method of Thiobacillus ferrooxidans in China. The field survey and study in Japan were carried out. In the field survey, the technical guidance was given for incubation method, neutralization experiment method and analysis method of Thiobacillus ferrooxidans. In the study in Japan, one kind of bacteria to be used was selected in the 'selection test for the optimum kind of bacteria,' and a study was made which was titled 'Study of mine wastewater treatment using the method of Thiobacillus ferrooxidans which is suitable for the mine site.' In 'Study of the optimum removal of heavy metal in mine wastewater,' a table test of sulfide precipitation method was conducted on copper removal/recovery to make formation conditions of copper sulfide clear. The conditions obtained were reflected in 'Study of mine wastewater treatment by the method of Thiobacillus ferrooxidans which is suitable for the mine site,' and various conditions for bacteria oxidation process were studied. The paper surveyed characteristics of heavy metal and temperature of Chinese strains. Further, the basic data were acquired which contribute to the production of inorganic flocculants. (NEDO)

  18. Microbial oxidation and reduction of inorganic sulphur compounds in relation to the development and control of microorganisms active in leaching operations. Part of a coordinated programme on bacterial leaching of uranium ores

    International Nuclear Information System (INIS)

    Tuovinen, O.H.

    1977-01-01

    The project considers the use of Thiobacillus ferroxidans type bacteria for the leaching of metals from ores. The various ways by which Thiobacillus ferroxidans utilizes inorganic sulfur compounds for oxidation, energy, growth and synthesis of cellular material were studied. The report briefly describes the scope and background of the project, and a list of publications describing experimental methods and research materials used is given. Unpublished work commenced during the Research Contract includes three major projects: (1) Transition of Thiobacillus ferroxidans from heterotrophic growth on fucose to autotropic growth on ferrous-iron; (2) development of a method to determine the ATP-content of bacteria attached to ore particles; (3) microbiological and chemical interactions of inorganic sulfur compounds. These three projects are summarized briefly

  19. Biochemical solubilization of toxic salts from residual geothermal brines and waste waters

    Science.gov (United States)

    Premuzic, Eugene T.; Lin, Mow S.

    1994-11-22

    A method of solubilizing metal salts such as metal sulfides in a geothermal sludge using mutant Thiobacilli selected for their ability to metabolize metal salts at high temperature is disclosed, The method includes the introduction of mutated Thiobacillus ferrooxidans and Thiobacillus thiooxidans to a geothermal sludge or brine. The microorganisms catalyze the solubilization of metal salts, For instance, in the case of metal sulfides, the microorganisms catalyze the solubilization to form soluble metal sulfates.

  20. [Application of immunologic methods to the analysis of bio-leaching bacteria].

    Science.gov (United States)

    Coto, O; Fernández, A I; León, T; Rodríguez, D

    1994-09-01

    Pure cultures of Thiobacillus ferrooxidans and mixed cultures of Thiobacillus ferrooxidans and Leptospirillum ferrooxidans isolated from the Matahambre mine (Cuba) were used to fit immunodiffusion and immunoelectron microscopy to the study of iron oxidizing bacteria. The possibilities, advantages and limits of those techniques have been studied from both the identification and the serological characterization points of view. Finally, the efficiency of these methods was tested by applying them to the identification of microorganisms from acidic waters from the mine.

  1. Bacterial leaching of uranium ores - a review

    International Nuclear Information System (INIS)

    Lowson, R.T.

    1975-11-01

    The bacterial leaching of uranium ores involves the bacterially catalysed oxidation of associated pyrite to sulphuric acid and Fe 3+ by autotrophic bacteria and the leaching of the uranium by the resulting acidic, oxidising solution. Industrial application has been limited to Thiobacillus thiooxidans and Thiobacillus ferrooxidans at pH 2 to 3, and examples of these are described. The bacterial catalysis can be improved with nutrients or prevented with poisons. The kinetics of leaching are controlled by the bed depth, particle size, percolation rate, mineralogy and temperature. Current work is aimed at quantitatively defining the parameters controlling the kinetics and extending the method to alkaline conditions with other autotrophic bacteria. (author)

  2. Using microbiological leaching method to remove heavy metals from sludge

    Directory of Open Access Journals (Sweden)

    Zhuyu Gu

    2017-01-01

    Full Text Available Microbial leaching is one of the most effective methods to remove heavy metals from sludge. In the conducted researches, the sludge samples were processed with Thiobacillus ferrooxidans and Thiobacillus thiooxidans obtained via cultivation, extraction and purification processes. Heavy metals such as Pb, Cd, Cu and Ni were leached from sludge by Thiobacillus ferrooxidans and Thiobacillus thiooxidans within different substrate concentration and pH value conditions. It is defined that from the point of view of economy and efficiency the optimal concentration of FeSO4.7H2O and sulfur for bio-leaching process was 0.2 g. The leaching rates of heavy metals such as Pb, Cd, Cu and Ni of the same concentration were 74.72%, 81.54%, 70.46% and 77.35% respectively. However, no significant differences depending on the pH value among the leaching rates were defined, even for the pH value of 1.5. Along with the removal of heavy metals from sludge, the organic matter, N, P, K were also leached to some extent. The losing rate of phosphorus was the highest and reached 38.44%. However, the content of organic matter, N, P, K in the processed sludge were higher in comparison with level I of the National Soil Quality Standards of China. Ecological risk of heavy metals in sludge before and after leaching was assessed by Index of Geo-accumulation (Igeo and comprehensive potential risk (RI. The results of research defined that the content of heavy metals in sludge meets the level of low ecological risk after leaching and their contents is lower in comparison with the National Agricultural Sludge Standard of China. Sludge leached by biological methods is possible to use for treatment for increasing soil fertility.

  3. Elective culture of bacteria used in bioleaching on pyrrhotite

    Institute of Scientific and Technical Information of China (English)

    邱冠周; 覃文庆; 蓝卓越; 黎维中

    2003-01-01

    Elective culture of bacteria on pyrrhotite was researched, and the selected bacteria were tested on bi-oleaching of marmatite and zinc sulfide ore. The results show that the microorganism cultured on pyrrhotite with va-rious S/Fe ratios is a mixed culture of thiobacillus ferrooxidans and thiobacillus thiooxidans, of which the integral ac-tivity and the oxidation capability of Fe2+ and S are enhanced. With the high Fe and low S content of pyrrhotite, the oxida-tion capacity of ferrous ion is improved; on the contrary, the oxidation capacity of sulfur is advanced. The bioleaching ca-pacity of bacteria cultured on marmatite is better than that of the bacteria cultivated by conventional methods.

  4. Sodium lauryl sulfate - a biocide for controlling acidity development in bulk commercially formed solid elemental sulfur

    Energy Technology Data Exchange (ETDEWEB)

    Hyne, J. B. [Calgary Univ., AB (Canada). Dept. of Biological Sciences

    1996-04-01

    Acidification of bulk elemental sulfur caused by Thiobacillus species which consume elemental sulfur by converting it into oxidized sulfur forms, was studied. Contributory factors, such as length of time in transit or in storage, warm temperatures, the presence of air and moisture, particle size and form of sulfur, and the presence of sources of carbon, nitrogen and phosphorus nutrients, were reviewed. Laboratory experiments with adding sodium lauryl sulfate (SLS), a known biocide, to sulfur inoculated with Thiobacillus, proved to be an efficient method for controlling acidity development. At the concentration required for effectiveness SLS did not interfere with purity specifications, had negligible effect on moisture, and appeared to be compatible with current dust suppression application practices. 2 tabs., 3 figs.

  5. Exploration on trickle leaching of uranium ore by refreshed liquor of bacterial oxidation

    International Nuclear Information System (INIS)

    Chen Shian; Huang Xiangfu; Fan Baotuan

    1995-01-01

    The paper describes the adaptation of the domesticated thiobacillus ferroxidans to the trickle leaching conditions of uranium ore. When the bacterial leaching liquor through multiple cycles of oxidation and regeneration was used to return to the trickle leaching, the following results were obtained: the extraction rate was more than 95%, the acid consumption was saved by 30%, and the consumed 2.0% pyrolusite (MnO 2 40%) was eliminated. The following problems are discussed: the basic principle, process and some factors influencing the process of the trickle leaching of uranium ore using regenerated liquor of bacterial oxidation, counter-current trickle leaching mode, oxidation and regeneration techniques of bacterial leaching liquor and other technological problems on the process of uranium extraction by thiobacillus ferroxidans

  6. Microbial leaching of low grade copper ores

    International Nuclear Information System (INIS)

    Rauf, A.; Ashfaq, M.

    1991-01-01

    Biotechnology is regarded as one of the most promising and revolutionary solution to various problems which are generally faced in the extraction of metals from their ores such as high energy, capital costs and environmental pollution. The paper deals with the study of low grade copper ores for their beneficiation and extraction of copper. The ores used were chalcopyrite and oxidized copper ores. Microorganisms play a vital role in the solubilization of valuable contents from ores such as copper and other metals. Studies have been conducted on the indigenous copper ores by using thiobacillus ferro oxidans and thiobacillus thio oxidans. For comparison purpose some experiments have also been conducted by chemical leaching. The results of bacterial leaching are encouraging. (author)

  7. Influence of divalent metal ions on degradation of dimethylsulphide ...

    African Journals Online (AJOL)

    SERVER

    2007-06-04

    Jun 4, 2007 ... Dimethylsulphide degradation by intact cells of Thiobacillus thioparus TK-m was stimulated by the addition of divalent .... plastic vials in ice-cooled water. .... tization of authotrophic sulphur bacteria oxidizing dimethyldisulphide.

  8. Biosuper as a phosphate fertilizer in a calcareous soil with low ...

    African Journals Online (AJOL)

    SERVER

    2007-06-04

    Jun 4, 2007 ... Key words: Zea mays, phosphorus uptake, phosphorus fertilization, corn, Thiobacillus, rock phosphate. ... improve plant nutrients availability in calcareous soils and .... lus elicits the reaction of sulphur with water and oxygen, ...

  9. Microbial- and Thiosulfate-Mediated Dissolution of Mercury Sulfide Minerals and Transformation to Gaseous Mercury

    Directory of Open Access Journals (Sweden)

    Adiari eVázquez-Rodríguez

    2015-06-01

    Full Text Available Mercury (Hg is a toxic heavy metal that poses significant human and environmental health risks. Soils and sediments, where Hg can exist as the Hg sulfide mineral metacinnabar (β-HgS, represent major Hg reservoirs in aquatic environments. Metacinnabar has historically been considered a sink for Hg in all but severely acidic environments, and thus disregarded as a potential source of Hg back to aqueous or gaseous pools. Here, we conducted a combination of field and laboratory incubations to identify the potential for metacinnabar as a source of dissolved Hg within near neutral pH environments and the underpinning (abiotic mechanisms at play. We show that the abundant and widespread sulfur-oxidizing bacterium Thiobacillus extensively colonized metacinnabar chips incubated within aerobic, near neutral pH creek sediments. Laboratory incubations of axenic Thiobacillus cultures lead to the release of metacinnabar-hosted Hg(II and subsequent volatilization to Hg(0. This dissolution and volatilization was greatly enhanced in the presence of the sulfur intermediate, thiosulfate, which served a dual role by enhancing HgS dissolution and providing an additional metabolic substrate for Thiobacillus. These findings reveal a new coupled abiotic-biotic pathway for the transformation of metacinnabar-bound Hg(II to Hg(0, while expanding the sulfide substrates available for neutrophilic chemosynthetic bacteria to Hg-laden sulfides. They also point to mineral-hosted Hg as an underappreciated source of gaseous elemental Hg to the environment.

  10. Formation and colloidal behaviour of elemental sulphur produced from the biological oxidation of hydrogensulphide

    NARCIS (Netherlands)

    Janssen, A.J.H.

    1996-01-01


    The formation and aggregation of elemental sulphur from the microbiological oxidation of hydrogensulphide (H 2 S) by a mixed population of aerobic Thiobacillus -like bacteria has been investigated. Sulphide is

  11. Hydrogen Sulfide Removal from Air by Acidithiobacillus thiooxidans in a Trickle Bed Reactor

    Czech Academy of Sciences Publication Activity Database

    Ramirez, M.; Gómez, J. M.; Cantero, D.; Páca, J.; Halecký, M.; Kozliak, E. I.; Sobotka, Miroslav

    2009-01-01

    Roč. 54, č. 5 (2009), s. 409-414 ISSN 0015-5632 Institutional research plan: CEZ:AV0Z50200510 Keywords : 2-STAGE BIOTRICKLING FILTER * THIOBACILLUS-THIOPARUS * DIMETHYL SULFIDE Subject RIV: EE - Microbiology, Virology Impact factor: 0.978, year: 2009

  12. ADVANCES IN BIOTREATMENT OF ACID MINE DRAINAGE AND BIORECOVERY OF METALS: 1. METAL PRECIPITATION FOR RECOVERY AND RECYCLE

    Science.gov (United States)

    Acid-mine drainage (AMD) is a severe pollution problem attributed to past mining activities. AMD is an acidic, metal-bearing wastewater generated by the oxidation of metal sulfides to sulfates by Thiobacillus bacteria in both active and abandoned mining operations. The wastewater...

  13. Syntrophic growth of sulfate-reducing bacteria and colorless sulfur bacteria during oxygen limitation

    NARCIS (Netherlands)

    vandenEnde, FP; Meier, J; vanGemerden, H

    Stable co-cultures of the sulfate-reducing bacterium Desulfovibrio desulfuricans PA2805 and the colorless sulfur bacterium Thiobacillus thioparus T5 were obtained in continuous cultures supplied with limiting amounts of lactate and oxygen while sulfate was present in excess. Neither species could

  14. Enhanced fatty acid production in engineered chemolithoautotrophic bacteria using reduced sulfur compounds as energy sources

    DEFF Research Database (Denmark)

    Beller, Harry R.; Zhou, Peng; Jewell, Talia N.M.

    2016-01-01

    Chemolithoautotrophic bacteria that oxidize reduced sulfur compounds, such as H2S, while fixing CO2 are an untapped source of renewable bioproducts from sulfide-laden waste, such as municipal wastewater. In this study, we report engineering of the chemolithoautotrophic bacterium Thiobacillus...

  15. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    ... TEM which substantiated UV–Vis and XRD results. Photoluminescence spectroscopy detected the bacteria attachment to the QDs by showing significant blue shift in bacteria conjugated ZnS QDs. Fluorescence microscopy confirmed the fluorescent labelling of QDs to Thiobacillus novellus bacteria cells making them ideal ...

  16. Meet the biologists: Sour gas treatment uses biology rather than chemistry to clean things up

    Energy Technology Data Exchange (ETDEWEB)

    Budd, G.

    2003-03-01

    Basic elements of the new bio-desulfurization technology are described. The new process uses the commonly occurring bacterium, Thiobacillus, rather than chemical means to remove hydrogen sulfide from natural gas. Development of the process began some ten years ago in the Netherlands as a means to clean sewage water and purify water for beer. The application of removing hydrogen sulfide from natural gas evolved upon discovery that the process was able to convert hydrogen sulfide to sulfur. Key to the bio-desulfurization process is the Thiobacillus bacterium, which unlike other plant forms, relies on chemosynthesis (instead of photosynthesis) of hydrogen sulfide, oxygen and carbon dioxide for its energy requirements. The technology has applications in refineries as well as in gas processing plants. It is well suited for use in Canada where operations tend to be on the small scale (less than 50 tonnes per day). The portable unit can be moved to another location when production at a given well drops off.

  17. Microbial diversity and community structure in an antimony-rich tailings dump.

    Science.gov (United States)

    Xiao, Enzong; Krumins, Valdis; Dong, Yiran; Xiao, Tangfu; Ning, Zengping; Xiao, Qingxiang; Sun, Weimin

    2016-09-01

    To assess the impact of antimony (Sb) on microbial community structure, 12 samples were taken from an Sb tailings pile in Guizhou Province, Southwest China. All 12 samples exhibited elevated Sb concentrations, but the mobile and bioaccessible fractions were small in comparison to total Sb concentrations. Besides the geochemical analyses, microbial communities inhabiting the tailing samples were characterized to investigate the interplay between the microorganisms and environmental factors in mine tailings. In all samples, Proteobacteria and Actinobacteria were the most dominant phyla. At the genus level, Thiobacillus, Limnobacter, Nocardioides, Lysobacter, Phormidium, and Kaistobacter demonstrated relatively high abundances. The two most abundant genera, Thiobacillus and Limnobacter, are characterized as sulfur-oxidizing bacteria and thiosulfate-oxidizing bacteria, respectively, while the genus Lysobacter contains arsenic (As)-resistant bacteria. Canonical correspondence analysis (CCA) indicates that TOC and the sulfate to sulfide ratio strongly shaped the microbial communities, suggesting the influence of the environmental factors in the indigenous microbial communities.

  18. LIXIVIACION BACTERIANA EN REACTORES: RECUPERACION DE COBRE A PARTIR DE CONCENTRADOS SULFURADOS.

    OpenAIRE

    CASAS DE PRADA, JESUS MANUEL

    1991-01-01

    Se estudió la cinética de lixiviación química (estéril) y bacteriana (con Thiobacillus ferrooxidans) de dos concentrados sulfurados de cobre, utilizando como agente oxidante el sulfato férrico en ambos casos. Los concentrados fueron suministrados por las 167p.

  19. Analysis of functional properties of Lactobacillus acidophilus

    NARCIS (Netherlands)

    Zhao, R.X.; Sun, J.L.; Mo, H.Z.; Yang Zhu, Yang

    2007-01-01

    Metabolites from Lactobacillus acidophilus were analysed. The results showed that Lactobacillus acidophilus Ind-1 and Lactobacillus acidophilus Lakcid produced respectively 12.73 g and 13.33 g lactic acid l¿1 after incubating in skim milk at 37 °C for 36 h; and 2.229 unit and 1.808 unit

  20. Probiotic effect of Lactobacillus acidophilus against vibriosis in ...

    African Journals Online (AJOL)

    The treatment with L. acidophilus 04 resulted in 20% final mortality as compared to 86.7% in the control group. Results of the study validated L. acidophilus 04 has potential probiotic principles to control pathogenic V. alginolyticus in shrimp aquaculture. Key words: Lactobacillus acidophilus, probiotic, shrimp, vibriosis.

  1. Biotechnology bibliographies

    Energy Technology Data Exchange (ETDEWEB)

    Beaudette, L.A.; McCready, R.G.L.

    1987-01-01

    Four bibliographies are included in this document, covering articles and scientific papers from around the world written mostly in English. Citations are presented alphabetically by author under the topics of: acid mine drainage (coal and metals) and bioadsorption of metals; solution mining; metabolism and physiology of thiobacillus and other microorganisms; and bacterial leaching of metals.

  2. Biotechnology bibliographies

    Energy Technology Data Exchange (ETDEWEB)

    Beaudette, L.A.; McCready, R.G.L.

    1986-01-01

    This bibliography consists of articles and scientific papers on biotechnology in areas in which BIOMINET is currently involved. The reports are categorized in four areas: 1) acid mine drainage (coals and metals) and bioadsorption of metals; 2) solution mining; 3) metabolism and physiology of Thiobacillus and other microorganisms; and 4) bacterial leaching of metals.

  3. Bacteriological lixiviation of low-grade uranium ores at low temperatures, by phiobacillus ferrooxidaus

    International Nuclear Information System (INIS)

    Lobato Filho, A.N.S.

    1976-12-01

    Laboratory experiments are described that, using selective and mutagenic agents, allowed the isolation of a strain of thiobacillus ferrooxidams capable of developing at 8 0 C, and keeping its oxidesing characteristics tests showed that the isoled sample is capable of solubilizing 95% of the uranium content in samples with U 3 O 8 content below 1000ppm [pt

  4. Research and Development of Methods for Estimating Physicochemical Properties of Organic Compounds of Environmental Concern. Part 1.

    Science.gov (United States)

    1981-06-01

    involved. Many of the chemicals are insecticides, herbicides, fungicides , or compounds of re- lated structure. Aromatic and polynuclear aromatic hydrocarbons...Water Partition Coefficients," Proc. 7th British Insecticide and Fungicide Conf., Vol. 1, The Boots Company Ltd., Nottingham, G.B. (1973). 6. Browman...Peniciii um, Pseudomonae, Thiobacillus, Torulop’is, Trichoderma , Micro onospora, Streptomyces Marine Aquatic Achremobacter, Flavobacteriwn, [53] System

  5. Treatments of acid waters; Tratamientos pasivos de aguas acidas

    Energy Technology Data Exchange (ETDEWEB)

    Delgado Fernandez, J. L.

    2000-07-01

    The exploitation of coal mining locations causes acid effluents due to the oxidation of the sulfurous minerals content of the rocks, denominated acid waters. There are Pyritic materials, pyres and sulphates associated to acid waters that in presence of water, oxygen and certain bacteria (mainly Thiobacillus ferro oxidants), are oxidized, by means of a chemistry reaction, yielding different products. (Author)

  6. Acidophilus Milk Shelf-life Prolongation by the Use of Cold Sensitive Mutants of Lactobacillus acidophilus MDC 9626

    Directory of Open Access Journals (Sweden)

    Alireza Goodarzi

    2017-09-01

    Full Text Available  Background and Objective: The shelf-life of Acidophilus milk fermented by probiotic culture Lactobacillus acidophilus is limited due to acidification caused by continued organic acid formation at low temperatures. Increasing of titrable acidity in turn causes reducing of the total viable count of probiotic bacteria. To overcome acidification we suggested to use coldsensitive mutants of Lactobacillus acidophilus, with limited metabolism at low temperatures. In order to facilitate the selection of cold sensitive mutants, it was decided to use Rifampicin and Streotomycin mutations affecting thermostability of the key molecules of cell metabolism the RNA polymerase and ribosome, respectively.Material and Methods: Ultra violet mutagenesis was used to enhance the yield and diversity of rifampicin and streptomycin resistant mutants of Lactobacillus acidophilus. To perform negative selection of cold sensitive mutants, antibiotic resistant colonies replica plated and incubated at 23ºC. The growth rate, milk fermenting rate, titratable acidity were measured.Results and Conclusion: Among tested resistant to either rifampicin or streptomycin clones with frequency mean of 1.0 %, ten mutants were isolated which have lost the ability to grow at minimal temperature. Fermented with cold-sensitive mutants of Lactobacillus acidophilus milks, during storage in the refrigerator, almost twice as long retained high amount of probiotic bacteria and low titratable acidity as compared to the parent strain. Thus, direct relationship between temperature sensitivity of the starter and shelf life of acidophilic milk was confirmed. Rifampicin and Streptomycin resistant mutations are powerful tools for selection of cold-sensitive dairy starters for preparing dairy fermented products with long shelf-life.Conflict of interest: The authors declare no conflict of interest.

  7. Phospholipid anaysis of extant microbiota for monitoring in situ bioremediation effectiveness

    International Nuclear Information System (INIS)

    Pinkart, H.C.; Ringelberg, D.B.; Stair, J.O.; Sutton, S.D..; Pfiffner, S.M.; White, D.C.

    1995-01-01

    Two sites undergoing bioremediation were studied using the signature lipid biomarker (SLB) technique. This technique isolates microbial lipid moieties specifically related to viable biomass and to both prokaryotic and eukaryotic biosynthetic pathways. The first site was a South Pacific atoll heavily contaminated with petroleum hydrocarbons. The second site was a mine waste reclamation area. The SLB technique was applied to quantitate directly the viable biomass, community structure, and nutritional/physiological status of the microbiota in the soils and subsurface sediments of these sites. All depths sampled at the Kwajalein Atoll site showed an increase in biomass that correlated with the co-addition of air, water, and nutrients. Monoenoic fatty acids increased in abundance with the nutrient amendment, which suggested an increase in gram-negative bacterial population. Ratios of specific phospholipid fatty acids indicative of nutritional stress decreased with the nutrient amendment. Samples taken from the mine reclamation site showed increases in total microbial biomass and in Thiobacillus biomass in the plots treated with lime and bactericide, especially when a cover soil was added. The plot treated with bactericide and buffered lime without the cover soil showed some decrease in Thiobacillus numbers, but was still slightly higher than that observed in the control plots

  8. Mixotrophy and chemiosmotic aspects of acidophilism in facultative thiobacilli

    International Nuclear Information System (INIS)

    Matin, A.

    1984-01-01

    Mixotrophic chemolithotrophs possess the unique potential of combining the use of autotrophic and heterotrophic growth substrates. This report discusses studies on dual substrate utilization by such organisms and recants the author's studies on mixotropy in Thiobacillus novellus using traditional batch cultures. It is concluded that although T. novellus can express its mixotrophic potential in both types of environments, this expression is complete and beneficial only under nutrient-limited conditions. 29 refs., 4 figs., 1 tab

  9. Enteric coating of granules containing the probiotic Lactobacillus acidophilus

    Directory of Open Access Journals (Sweden)

    Pyar Hassan

    2014-06-01

    Full Text Available In the present study, a capsule formulation composed of enteric coated granules of Lactobacillus acidophilus ATCC 4962 was developed using Eudragit L30D-55 as enteric polymer. Optimization of the capsule formulation was achieved with a maximum viable cell count after 2 h of incubation in acid medium and disintegration time of 1 h in buffer pH 6.8. The amount of Eudragit L30D-55 in the capsules correlated with gastric juice resistance. The best protective qualities against artificial gastric juice were observed when capsules were prepared from granules composed of L. acidophilus, corn starch, lactose monohydrate, polyvinylpyrrolidone and coated with 12.5 % (m/V of Eudragit L30D-55. Capsule formulation of L. acidophilus in edible broth medium suspension serves as a cheap alternative to the expensive freeze-drying procedure for preparing L. acidophilus. In addition, the enteric coating using Eudragit L30D-55 could protect probiotics from the acidic gastric environment and enhance the bioactivity of probiotics along with replacement of pathogenic microbes in human intestine

  10. Immobilisation of manganese, cobalt and nickel by deep-sea-sediment microbial communities

    Digital Repository Service at National Institute of Oceanography (India)

    Sujith, P.P.; Das, A.; Mourya, B.S.; LokaBharathi, P.A.

    and their various organic derivatives in nature are contained in the living biomass. For example, Razzell and Trussell (1963) [9] addressed the interaction of Thiobacillus spp with sulfide baring ores and their role in dissolution of oxides and release... of valuable metals. Likewise, Fortin et al (1994), Basnakova and Macaskie (1996) [10-11] presented the contribution of bacteria in the formation of sulfide and phosphide minerals by chemical complexing with available constituent sulfide and phosphide groups...

  11. Review biodepyritisation of coal

    Energy Technology Data Exchange (ETDEWEB)

    Acharya, C.; Sukla, L.B.; Misra, V.N. [Regional Research Lab., Orissa (India)

    2004-01-01

    This review provides a detailed summary of the recent and past research activities in the area of biodesulfurisation of coal. It provides information about microorganisms important for biodesulfurisation of coal, with the emphasis on Thiobacillus ferrooxidans. The review presents an insight into various methods of desulfurisation of coal combining physical and biological methods. Also, there are discussions on coal structure, distribution, mechanism and kinetics of pyrite oxidation and jarosite precipitation. Finally, areas requiring further research are identified.

  12. Effects of yogurt starter cultures on the survival of Lactobacillus acidophilus.

    Science.gov (United States)

    Ng, Elizabeth W; Yeung, Marie; Tong, Phillip S

    2011-01-31

    Recognized to confer health benefits to consumers, probiotics such as Lactobacillus acidophilus are commonly incorporated into fermented dairy products worldwide; among which yogurt is a popular delivery vehicle. To materialize most of the putative health benefits associated with probiotics, an adequate amount of viable cells must be delivered at the time of consumption. However, the loss in their viabilities during refrigerated storage has been demonstrated previously. This study focused on the effects of yogurt starter cultures on the survival of five strains of L. acidophilus, with emphases on low pH and acid production. Differential survival behavior between L. acidophilus strains was further analyzed. To this end, viable cell counts of L. acidophilus were determined weekly during 4°C storage in various types of yogurts made with Streptococcus thermophilus alone, L. delbrueckii ssp. bulgaricus alone, both species of the starter cultures, or glucono-delta-lactone (GDL). All yogurt types, except for pasteurized yogurts, were co-fermented with L. acidophilus. Yogurt filtrate was analyzed for the presence of any inhibitory substance and for the amount of hydrogen peroxide. Multiplication of L. acidophilus was not affected by the starter cultures as all strains reached high level on day 0 of the storage period. Throughout the 28-day storage period, cell counts of L. acidophilus PIM703 and SBT2062 remained steady (~6 × 10(7)CFU/g) in yogurts made with both starter cultures, whereas those of ATCC 700396 and NCFM were reduced by a maximum of 3 and 4.6 logs, respectively. When starter cultures were replaced by GDL, all strains survived well, suggesting that a low pH was not a critical factor dictating their survival. In addition, the filtrate collected from yogurts made with starter cultures appeared to have higher inhibitory activities against L. acidophilus than that made with GDL. The presence of viable starter cultures was necessary to adversely affect the

  13. Enrichment and immobilization of sulfide removal microbiota applied for environmental biological remediation of aquaculture area

    International Nuclear Information System (INIS)

    Zhao, Yang-Guo; Zheng, Yu; Tian, Weijun; Bai, Jie; Feng, Gong; Guo, Liang; Gao, Mengchun

    2016-01-01

    To remove sulfide in the deteriorating aquaculture sediment and water, sulfide-oxidizing microbiota was enriched from Jiaozhou Bay, China, by using sulfide-rich medium. Composition and structure of microbial communities in the enrichments were investigated by 16S rDNA molecular biotechniques. Results showed that microbial community structure continuously shifted and the abundance of sulfate reducing bacteria, i.e., Desulfobacterium, Desulfococcus and Desulfobacca apparently declined. Several halophile genera, Vibrio, Marinobacter, Pseudomonas, Prochlorococcus, Pediococcus and Thiobacillus predominated finally in the microbiota. The enriched microbiota was capable of removing a maximum of 1000 mg/L sulfide within 12 h with 10% inoculum at pH 7.0, 20–30 °C. After immobilized, the microbiota presented excellent resistance to impact and could completely remove 600 mg/L sulfide in 12 h. Moreover, the immobilized microbiota recovered well even recycled for five times. In conclusion, the immobilized sulfide-removing microbiota showed a quite promising application for biological restoring of sulfide-rich aquaculture environment. - Highlights: • A sulfide-oxidizing microbiota successfully enriched from aquaculture sediment. • Microbiota dominated by Vibrio, Marinobacter, Pseudomonas and Thiobacillus spp. • Sulfide-oxidizing microbiota removed sulfide at an average rate of 100 mg/(L·h). • Immobilized microbiota removed over 85% of sulfide even recycled for five times.

  14. Viability of Lactobacillus acidophilus and Lactobacillus casei in fermented milk products during refrigerated storage.

    Science.gov (United States)

    Nighswonger, B D; Brashears, M M; Gilliland, S E

    1996-02-01

    The viability was investigated of five strains of Lactobacillus acidophilus and one strain of Lactobacillus casei that were added as adjuncts to yogurt and cultured buttermilk during 28 d of refrigerated storage at 5 to 7 degrees C. A modification of LBS (Lactobacillus selection) agar was used for the enumeration of L. acidophilus and L. casei. The medium allowed the colony formation of the adjunct bacteria while preventing colony formation of the traditional yogurt or buttermilk starter cultures. At each sampling period, colonies from the selective agar medium were isolated for confirmation of identity to confirm that only L. acidophilus and L. casei were enumerated, that their characteristics did not change during storage, or both. The strains of L. acidophilus varied in both cultured products. In buttermilk, L. acidophilus MUH-41, O-16, and L-1 exhibited no significant loss in viability, but strains 43121 and La-5 did. No significant loss in viability of L. acidophilus MUH-41 and L-1 occurred in yogurt prepared using culture CM2; however, strains 43121, O-16, and La-5 lost viability. In the yogurt prepared using culture YC-4, L. acidophilus 43121 exhibited no significant loss in viability, but MUH-41, O-16, L-1, and La-5 did. There was no loss in viability of L. casei GG during storage of any of the cultured products.

  15. Underground bioleaching: extracting from low-grade ore

    International Nuclear Information System (INIS)

    McCready, R.G.L.

    1986-01-01

    In 1984, Denison Mines began a research and demonstration project on the engineering aspects of bacterial leaching of low-grade uranium ore at Elliot Lake. The leaching solution was acidic mine water enriched in bacterial nutrients and innoculated with Thiobacillus ferrooxidans. Leaching of one stope was found to be impeded by fungi of the genus penicillium. Although fungal growth on leaching stopes must be prevented, research is proceeding on the potential use of the fungi to concentrate uranium from bioleaching solutions

  16. Vaginal suppositories containing Lactobacillus acidophilus: development and characterization.

    Science.gov (United States)

    Rodrigues, Francisca; Maia, Maria João; das Neves, José; Sarmento, Bruno; Amaral, Maria Helena; Oliveira, Maria Beatriz P P

    2015-01-01

    The aim of this study was to develop and characterize suppositories for vaginal delivery of Lactobacillus acidophilus. Formulations were performed in order to select suitable excipients based on suppository formation feasibility and cytotoxicity. Solid body and hollow-type suppositories were prepared by melting and molding using poly(ethylene glycol) (PEG) 400 and 4000 or Witepsol (WIT) H12 as excipients. L. acidophilus was incorporated in the molten mass before molding solid body suppositories or added as suspension into the cavity of hollow-type suppositories and sealed molten excipients. Cytotoxicity of the selected excipients was evaluated by 3-(4,5-dimethylthiazol-2-yl)-5-(3-carboxymethoxyphenyl)-2-(4-sulfophenyl)-2H-tetrazolium and lactate dehydrogenase assays against VK2/E6E7, HEC-1-A and HeLa cells. Suppositories were characterized regarding organoleptic characteristics, mass uniformity, disintegration, breaking strength and L. acidophilus in vitro release. PEG 400, PEG 4000 and WIT H12 showed the absence of toxicity when tested using three different vaginal cell lines. Obtained vaginal suppositories presented uniform and mild texture, a content of about 1 × 10(8) colony-forming units, completely disintegrated in simulated vaginal environment in less than 60 min and provided sustained in vitro release of L. acidophilus. Release studies further demonstrated that incorporation of freeze-dried bacteria did not result in significant loss of viable bacteria, thus supporting that vaginal suppositories may possess good properties to promote the replacement of the vaginal flora in situations of urinary tract infection. Hollow-type suppositories showed to be promising delivery vehicles for vaginal delivery of probiotics.

  17. Isolation of Thiobacillus spp. and its application in the removal of ...

    African Journals Online (AJOL)

    uwerhiavwe

    physiological-biochemical characteristics. Single and mixed cultures of the strains were used to carry ... The characteristics of the sludge sample. Characteristic. Te content. Method. Solid content (%). 5 ..... archaeal diversity of a mixed thermophilic bioleaching culture by. TGGE and FISH. Syst. Appl. Microbiol. 32: 501–513.

  18. A probiotic strain of L. acidophilus reduces DMH-induced large intestinal tumors in male Sprague-Dawley rats.

    Science.gov (United States)

    McIntosh, G H; Royle, P J; Playne, M J

    1999-01-01

    Probiotic bacteria strains were examined for their influence on 1,2-dimethylhydrazine (DMH)-induced intestinal tumors in 100 male Sprague-Dawley rats. Lactobacillus acidophilus (Delvo Pro LA-1), Lactobacillus rhamnosus (GG), Bifidobacterium animalis (CSCC1941), and Streptococcus thermophilus (DD145) strains were examined for their influence when added as freeze-dried bacteria to an experimental diet based on a high-fat semipurified (AIN-93) rodent diet. Four bacterial treatments were compared: L. acidophilus, L. acidophilus + B. animalis, L. rhamnosus, and S. thermophilus, the bacteria being added daily at 1% freeze-dried weight (10(10) colony-forming units/g) to the diet. Trends were observed in the incidence of rats with large intestinal tumors for three treatments: 25% lower than control for L. acidophilus, 20% lower for L. acidophilus + B. animalis and L. rhamnosus treatments, and 10% lower for S. thermophilus. Large intestinal tumor burden was significantly lower for treated rats with L. acidophilus than for the control group (10 and 3 tumors/treatment group, respectively, p = 0.05). Large intestinal tumor mass index was also lower for the L. acidophilus treatment than for control (1.70 and 0.10, respectively, p L. acidophilus, no adenocarcinomas were present in the colons. Pulsed-field gel electrophoresis of bacterial chromosomal DNA fragments was used to differentiate introduced (exogenous) bacterial strains from indigenous bacteria of the same genera present in the feces. Survival during gut passage and displacement of indigenous lactobacilli occurred with introduced L. acidophilus and L. rhamnosus GG during the probiotic treatment period. However, introduced strains of B. animalis and S. thermophilus were not able to be isolated from feces. It is concluded that this strain of L. acidophilus supplied as freeze-dried bacteria in the diet was protective, as seen by a small but significant inhibition of tumors within the rat colon.

  19. Microbially-Enhanced Redox Solution Reoxidation for Sour Natural Gas Sweetening

    Energy Technology Data Exchange (ETDEWEB)

    Kenneth Brezinsky

    2008-01-15

    The specific objective of this project are to advance the technology and improve the economics of the commercial iron-based chelate processes such as LO-CAT II and SulFerox process utilizing biologically enhanced reoxidation of the redox solutions used in these processes. The project is based on the use of chelated ferric iron as the catalyst for the production of elemental sulfur, and then oxidizing bacteria, such as Thiobacillus Ferrooxidans (ATCC 23270) as an oxidizer. The regeneration of Fe{sup 3+} - chelate is accomplished by the use of these same microbes under mild conditions at 25-30 C and at atmospheric pressure to minimize the chelate degradation process. The pH of the redox solution was observed to be a key process parameter. Other parameters such as temperature, total iron concentration, gas to liquid ratio and bacterial cell densities also influence the overall process. The second part of this project includes experimental data and a kinetic model of microbial H{sub 2}S removal from sour natural gas using thiobacillus species. In the experimental part, a series of experiments were conducted with a commercial chelated iron catalyst at pH ranges from 8.7 to 9.2 using a total iron concentration range from 925 ppm to 1050 ppm in the solution. Regeneration of the solution was carried out by passing air through the solution. Iron oxidizing bacteria were used at cell densities of 2.3 x 10{sup 7}cells/ml for optimum effective performance. In the modeling part, oxidation of Fe{sup 2+} ions by the iron oxidizing bacteria - Thiobacillus Ferrooxidans was studied for application to a continuous stirred tank reactor (CSTR). The factors that can directly affect the oxidation rate such as dilution rate, temperature, and pH were analyzed. The growth of the microorganism was assumed to follow Monod type of growth kinetics. Dilution rate had influence on the rate of oxidation of ferrous iron. Higher dilution rates caused washout of the biomass. The oxidation rate was

  20. Response of Lactobacillus acidophilus ATCC 4356 to low-shear modeled microgravity

    Science.gov (United States)

    Castro-Wallace, Sarah; Stahl, Sarah; Voorhies, Alexander; Lorenzi, Hernan; Douglas, Grace L.

    2017-10-01

    The introduction of probiotic microbes into the spaceflight food system has the potential for use as a safe, non-invasive, daily countermeasure to crew microbiome and immune dysregulation. However, the microgravity effects on the stress tolerances and gene expression of probiotic bacteria must be investigated to confirm that benefits of selected strains will still be conveyed under microgravity conditions. The goal of this study was to evaluate the characteristics of the probiotic bacteria Lactobacillus acidophilus ATCC 4356 in a microgravity analog environment. L. acidophilus was cultured anaerobically under modeled microgravity conditions and assessed for differences in growth, survival through stress challenge, and gene expression compared to control cultures. No significant differences were observed between the modeled microgravity and control grown L. acidophilus, suggesting that this strain will behave similarly in spaceflight.

  1. Shifts in microbial community composition and function in the acidification of a lead/zinc mine tailings.

    Science.gov (United States)

    Chen, Lin-Xing; Li, Jin-Tian; Chen, Ya-Ting; Huang, Li-Nan; Hua, Zheng-Shuang; Hu, Min; Shu, Wen-Sheng

    2013-09-01

    In an attempt to link the microbial community composition and function in mine tailings to the generation of acid mine drainage, we simultaneously explored the geochemistry and microbiology of six tailings collected from a lead/zinc mine, i.e. primary tailings (T1), slightly acidic tailings (T2), extremely acidic tailings (T3, T4 and T5) and orange-coloured oxidized tailings (T6). Geochemical results showed that the six tailings (from T1 to T6) likely represented sequential stages of the acidification process of the mine tailings. 16S rRNA pyrosequencing revealed a contrasting microbial composition between the six tailings: Proteobacteria-related sequences dominated T1-T3 with relative abundance ranging from 56 to 93%, whereas Ferroplasma-related sequences dominated T4-T6 with relative abundance ranging from 28 to 58%. Furthermore, metagenomic analysis of the microbial communities of T2 and T6 indicated that the genes encoding key enzymes for microbial carbon fixation, nitrogen fixation and sulfur oxidation in T2 were largely from Thiobacillus and Acidithiobacillus, Methylococcus capsulatus, and Thiobacillus denitrificans respectively; while those in T6 were mostly identified in Acidithiobacillus and Leptospirillum, Acidithiobacillus and Leptospirillum, and Acidithiobacillus respectively. The microbial communities in T2 and T6 harboured more genes suggesting diverse metabolic capacities for sulfur oxidation/heavy metal detoxification and tolerating low pH respectively. © 2013 John Wiley & Sons Ltd and Society for Applied Microbiology.

  2. The protective effect of recombinant FomA-expressing Lactobacillus acidophilus against periodontal infection.

    Science.gov (United States)

    Ma, Li; Ding, Qinfeng; Feng, Xiping; Li, Fei

    2013-10-01

    A number of studies have shown that the outer membrane protein FomA found in Fusobacterium nucleatum demonstrates great potential as an immune target for combating periodontitis. Lactobacillus acidophilus is a useful antigen delivery vehicle for mucosal immunisation, and previous studies by our group have shown that L. acidophilus acts as a protective factor in periodontal health. In this study, making use of the immunogenicity of FomA and the probiotic properties of L. acidophilus, we constructed a recombinant form of L. acidophilus expressing the FomA protein and detected the FomA-specific IgG in the serum and sIgA in the saliva of mice through oral administration with the recombinant strains. When serum containing FomA-specific antibodies was incubated with the F. nucleatum in vitro, the number of Porphyromonas gingivalis cells that coaggregated with the F. nucleatum cells was significantly reduced. Furthermore, a mouse gum abscess model was successfully generated, and the range of gingival abscesses in the immune mice was relatively limited compared with the control group. The level of IL-1β in the serum and local gum tissues of the immune mice was consistently lower than in the control group. Our findings indicated that oral administration of the recombinant L. acidophilus reduced the risk of periodontal infection with P. gingivalis and F. nucleatum.

  3. Pengaruh Variasi Konsentrasi Inulin pada Proses Fermentasi oleh L. acidophilus, L. bulgaricus dan S. thermophillus - (The Inulin Variation Concentration Effect in Fermentation Using L. acidophilus, L. bulgaricus and S. thermophilus

    Directory of Open Access Journals (Sweden)

    Raden Haryo Bimo Setiarto

    2017-06-01

    Full Text Available Prebiotics are food components that can not enzymatically digested, thus it fermented by probiotic bacteria. Inulin is a prebiotic source that widely used in processed food products such as fermented milk. This study aimed to know the variation concentrations effect of prebiotic inulin on the growth of lactic acid bacteria starter yogurt (Lactobacillus acidophillus, Lactobacillus bulgaricus, Streptococcus thermophillus. The growth of those lactic acid bacteries was determined based on OD (Optical Density, Total Plate Count (TPC, total lactic acid content and pH. Inulin concentration of 0.5% (w/v increased the growth of those three bacteries. Reductioned of pH value during inulin fermentation indicated the growth of bacteria that produced lactic acid. L.bulgaricus and S.thermophilus growth rate were more sensitive than L.acidophilus in addition of prebiotic inulin concentration. The growth of those bacteries in MRSB medium supplemented inulin decreased pH around 7.00 into below 5.00 due to organic acids formation.Keywords: Fermentation, Inulin, L.acidophilus, L.bulgaricus, S.thermophilusABSTRAKPrebiotik adalah komponen bahan pangan yang tidak dapat dicerna oleh saluran pencernaan secara enzimatis sehingga akan difermentasi oleh bakteri probiotik di usus besar. Inulin merupakan salah satu sumber prebiotik yang banyak dimanfaatkan dalam produk pangan olahan seperti susu fermentasi. Pemberian inulin pada kadar tertentu perlu diketahui untuk mengetahui jumlah optimal yang diperlukan untuk menjaga kesehatan. Penelitian ini bertujuan untuk mengetahui pengaruh variasi konsentrasi prebiotik inulin terhadap pertumbuhan bakteri asam laktat starter yogurt (Lactobacillus acidophillus, Lactobacillus bulgaricus dan Streptococcus thermophillus. Pengamatan pertumbuhan L. acidophilus, L. bulgaricus dan S. thermophillus dilakukan dengan beberapa cara antara lain perhitungan total sel dengan menggunakan prinsip turbidimetrik OD (Optical Density,  jumlah total

  4. Ceramide formation is involved in Lactobacillus acidophilus-induced IFN-beta response in dendritic cells

    DEFF Research Database (Denmark)

    Fuglsang, Eva; Henningsen, Louise; Frøkiær, Hanne

    of sphingomyelin to ceramide by acid sphingomyelinase (ASMase) at the outer leaflet of the PM is a key event in endocytosis of gram-positive Lactobacillus acidophilus (L. acidophilus) and the subsequent induction of IFN-beta in DCs and, as the gram-negative Escherichia coli (E. coli) does not induce appreciable...

  5. Microbial ecology of Rum Jungle, III. Leaching behaviour of sulphidic waste material under controlled conditions

    International Nuclear Information System (INIS)

    Babij, T.; Goodman, A.; Khalid, A.M.; Ralph, B.J.

    1981-12-01

    The discharge, into river systems, of acid and heavy metals generated by leaching of sulphidic waste materials at the abandoned opencut uranium mine at Rum Jungle, Northern Territory, is causing continuing pollution of the surrounding environment. The maximum effects of acid and microorganisms on samples from the overburden dump material, under defined and controlled environmental conditions, were assessed using reactor systems. These samples came from the overburden dump resulting from the mining of White's orebody. Similarly, the stability of tailings material under conditions of flooding and increasing acidity was determined. At ph 2.5, metals in White's dump material were solubilised by acid attack only, whereas at pH 3.5, bacterial activity (principally that of Thiobacillus ferrooxidans) generated acidity and contributed significantly to metal release. Under microaerophilic conditions Thiobacillus ferrooxidans continued to effect metal release from the ore, but did not produce further acidity. If White's overburden is returned to the acidic, flooded opencuts, complete solubilisation of the material will occur. The exclusion of oxygen from the dump will not necessarily stop bacterially catalysed leaching processes. Under highly aerated and agitated flooded conditions the tailings material was not active, except for copper release of about 2 g kg -1 ore at pH 4.0. The only deleterious element released by increasing acidity was copper, which was 100 per cent solubilised at pH 2.5. Uranium was always lss than 3 μg kg -1 ore, and lead was detected only at pH 2.5. Indigenous leaching bacteria did not develop

  6. Bugs and coal: processing fuels with biotechnology

    Energy Technology Data Exchange (ETDEWEB)

    Shepard, M

    1987-06-01

    Bioprocessing of coal is developing along several fronts, each of potential significance to utilities. Researchers have found a fungus, polyporous versicolor, which can liquefy certain kinds of coal and scientists have genetically engineered bacteria that remove sulfur and ash-forming metal impurities from coal. Research programs are being undertaken to find organisms that will convert lignite into gaseous methane to produce gaseous fuel more economically than the current coal gasification methods. Researchers looking for ways to remove sulfur from coal before it is burned are evaluating the use of a bacterium called thiobacillus ferroxidans to enhance the physical removal of pyrite. 2 refs.

  7. Application of microorganism to in-situ leaching mining

    International Nuclear Information System (INIS)

    Yu, Runlan; Sato, Kazuhiko; Nagara, Shuichi; Yamana, Satoshi

    1998-01-01

    In-situ leaching (ISL) technique has come into the spotlight recently because of its low production costs and low environmental impact. In China, development and application of economical ISL techniques are also being studied. To design a pilot scale ISL 'bioreactor' in China, applicability of microorganisms to ISL mining was evaluated at Ningyo Toge Works as a part of Scientist Exchange Program of the Science and Technology Agency. An overview of the indirect bio-ISL method with iron oxidizing bacteria, Thiobacillus ferroxidans (TF), and results from experiment to determine factors for the ISL 'bioreactor' are discussed. (author)

  8. Modelling a uranium ore bioleaching process

    International Nuclear Information System (INIS)

    Chien, D.C.H.; Douglas, P.L.; Herman, D.H.; Marchbank, A.

    1990-01-01

    A dynamic simulation model for the bioleaching of uranium ore in a stope leaching process has been developed. The model incorporates design and operating conditions, reaction kinetics enhanced by Thiobacillus ferroxidans present in the leaching solution and transport properties. Model predictions agree well with experimental data with an average deviation of about ± 3%. The model is sensitive to small errors in the estimates of fragment size and ore grade. Because accurate estimates are difficult to obtain a parameter estimation approach was developed to update the value of fragment size and ore grade using on-line plant information

  9. Safety and protective effect of Lactobacillus acidophilus and ...

    African Journals Online (AJOL)

    The protective effect of Lactobacillus acidophilus and Lactobacillus casei, isolated from fresh cow milk, was studied in vivo. Toxicological data of rat serum revealed that the Lactobacillus isolates had liver improvement functions. Serum alanine aminotransferase (ALT) activities of the rats dosed with Lactobacillus isolates ...

  10. Impact of oral Lactobacillus acidophilus gavage on rooster seminal and cloacal Lactobacilli concentrations.

    Science.gov (United States)

    Kiess, A S; Hirai, J H; Triplett, M D; Parker, H M; McDaniel, C D

    2016-08-01

    The use of antibiotics in poultry is being heavily scrutinized, therefore alternatives such as probiotics are being investigated. Lactobacilli spp. are a commonly used bacteria in formulating probiotics, and the addition of Lactobacilli to broiler diets has demonstrated increased growth rates, stimulated immune systems, and reduced pathogen loads in the gastro-intestinal tract ( GI: ) tract. However, previous research has shown that when rooster semen is directly exposed to Lactobacillus acidophilus (L. acidophilus) sperm quality is reduced. Therefore, the objective of the current study was to determine if oral administration of L. acidophilus increases the concentration of Lactobacilli in semen as well as the cloaca. A total of 30 roosters were used: 15 roosters were gavaged with 1X PBS (Control) and 15 roosters were gavaged with 10(7) cfu/mL of L. acidophilus (Treated). All roosters were gavaged for 14 consecutive days. Semen was collected on a 3 d interval, and cloacal swabs were collected on a 2 d interval, beginning on the first day prior to oral administration. Semen and cloacal swabs were serial diluted, and 100 μL of each dilution was then plated on Man, Rogosa, Sharpe ( MRS: ) agar plates. All plates were incubated for 48 h at 37°C under anaerobic conditions and counted. All Lactobacilli counts were first log transformed, then log transformed (day 0) pre-counts were subtracted from the log transformed day counts providing log differences for the analysis. Seminal Lactobacilli counts were not altered by treatments. However, the main effect of treatment (P = 0.026) for cloacal counts indicated that roosters gavaged with Lactobacilli yielded higher counts than the controls. Additionally, cloaca samples also demonstrated a treatment by day interaction trend (P = 0.082), where Lactobacilli was higher in the L. acidophilus gavaged roosters than the controls only on days 3, 5, 13, and 15. In conclusion, the addition of L. acidophilus to the male breeder diet

  11. Temperature and storing time influence on selected physical properties of milk and acidophilus milk

    Directory of Open Access Journals (Sweden)

    Monika Božiková

    2013-01-01

    Full Text Available This article deals with thermophysical parameters as: temperature, thermal conductivity, diffusivity and rheologic parameters as: dynamic, kinematic viscosity and fluidity of milk and acidophilus milk. For thermophysical parameters measurements was used Hot Wire method and for rheologic parameters measurements was used single – spindle viscometer. In the first series of measurements we measured relations between thermophysical and rheologic parameters in temperature range (5–25 °C for milk and acidophilus milk. Relations of all physical parameters of milk to the temperature showed influence of relative fat content. Effect of storage on milk and acidophilus milk is shown in the text. All measured relations for milk and acidophilus milk during temperature stabilisation had linear increasing progress with high coefficients of determination in the range (0.991–0.998. It was shown that increasing relative fat content has decreasing influence on milk thermal conductivity. Relations of rheologic parameters as dynamic and kinematic viscosity to the temperature had decreasing exponential progress, while relation of fluidity to the temperature had increasing exponential shape with high coefficients of determination in the range (0.985–0.994.. Mathematical description of the dependencies is summarised by regression equations and all coefficients are in presented tables.

  12. Lactobacillus acidophilus-Rutin Interplay Investigated by Proteomics.

    Directory of Open Access Journals (Sweden)

    Maria Fiorella Mazzeo

    Full Text Available Dietary polyphenols are bioactive molecules that beneficially affect human health, due to their anti-oxidant, anti-inflammatory, cardio-protective and chemopreventive properties. They are absorbed in a very low percentage in the small intestine and reach intact the colon, where they are metabolized by the gut microbiota. Although it is well documented a key role of microbial metabolism in the absorption of polyphenols and modulation of their biological activity, molecular mechanisms at the basis of the bacteria-polyphenols interplay are still poorly understood. In this context, differential proteomics was applied to reveal adaptive response mechanisms that enabled a potential probiotic Lactobacillus acidophilus strain to survive in the presence of the dietary polyphenol rutin. The response to rutin mainly modulated the expression level of proteins involved in general stress response mechanisms and, in particular, induced the activation of protein quality control systems, and affected carbohydrate and amino acid metabolism, protein synthesis and cell wall integrity. Moreover, rutin triggered the expression of proteins involved in oxidation-reduction processes.This study provides a first general view of the impact of dietary polyphenols on metabolic and biological processes of L. acidophilus.

  13. The Study of Alginate and Whey Protein Hydrolyzed Suplementation Utilization for Cell Release and Microencapsulated Lactobacillus Acidophilus Viability in Probiotic Ice Cream

    Directory of Open Access Journals (Sweden)

    Purwadi Purwadi

    2013-10-01

    Full Text Available The objectives of this research were to increase viability and activity of L. acidophilus encapsulated with alginate and whey protein hydrolyzed for cell release and microencapsulated Lactobacillus acidophilus viability in probiotic ice cream. The methods used were factorial experiment using Completely Randomized Design. Data was analysed with Variance Analysis. The results showed that the interaction between alginate and whey protein hydrolyzed supplemented could be increased the function of CaCl2 and also encapsulated L. acidophilus viability. The used alginate of 1% and whey protein hydrolyzed supplemented of 0,5% produced encapsulated L. acidophilus viability higher than before, but however, the utilization of alginate of 1% and whey protein hydrolyzed supplemented of 0% could release a few cell. Therefore, the utilization of alginate 1% and whey protein hydrolyzed supplemented 0,5% in ice cream produced L. acidophilus highest than other.   Keywords :   Lactobacillus acidophilus, microencapsulation, alginate, whey protein hydrolyzed, cell release, ice cream

  14. Biodecontamination of concrete

    International Nuclear Information System (INIS)

    Hamilton, M.A.; Rogers, R.D.; Benson, J.

    1996-01-01

    A novel technology for biologically decontaminating concrete is being jointly developed by scientists at the Idaho National Engineering Laboratory (INEL) and British Nuclear Fuels plc (BNFL). The technology exploits a naturally occurring phenomenon referred to as microbially influenced degradation (MID) in which bacteria produce acids that dissolve the cement matrix of concrete. Most radionuclide contamination of concrete is fixed in the outer few mm of the concrete surface. By capturing and controlling this natural process, a biological method of removing the surface of concrete to depths up to several mm is being developed. Three types of bacteria are known to be important in MID of concrete: nitrifying bacteria that produce nitric acid, sulfur oxidizing bacteria that produce sulfuric acid, and certain heterotrophic bacteria that produce organic acids. An investigation of natural environments demonstrated with scanning electron microscopy the presence of bacteria on concrete surfaces of a variety of structures, such as bridges and dams, where corrosion is evident. Enumeration of sulfur oxidizing and nitrifying bacteria revealed their presence and activity on structures to varying degrees in different environments. Under ideal conditions, Thiobacillus thiooxidans, a sulfur oxidizing bacteria, attached to and colonized the surface of concrete specimens. Over 1mm depth of material from a 10 cm x 10 cm square surface was removed in 68 days in the Thiobacillus treated specimen compared to a sterile control. Laboratory and field demonstrations are currently being conducted using experimental chambers designed to be mounted directly to concrete surfaces where radionuclide contamination exists. Data is being obtained in order to determine actual rates of surface removal and limitations to the system. This information will be used to develop a full scale decontamination technology

  15. Lactobacillus acidophilus-derived biosurfactant effect on gtfB and gtfC expression level in Streptococcus mutans biofilm cells

    Directory of Open Access Journals (Sweden)

    Arezoo Tahmourespour

    2011-03-01

    Full Text Available Streptococcus mutans (S. mutans, harboring biofilm formation, considered as a main aetiological factor of dental caries. Gtf genes play an important role in S. mutans biofilm formation. The purpose of this study was to investigate the effect of Lactobacillus acidophilus-derived biosurfactant on S. mutans biofilm formation and gtfB/C expression level (S. mutans standard strain ATCC35668 and isolated S. mutans strain (22 from dental plaque. The Lactobacillus acidophilus (L. acidophilus DSM 20079 was selected as a probiotic strain to produce biosurfactant. The FTIR analysis of its biosurfactant showed that it appears to have a protein-like component. Due to the release of such biosurfactants, L. acidophilus was able to interfere in the adhesion and biofilm formation of the S. mutans to glass slide. It also could make streptococcal chains shorter. Using realtime RT-PCR quantitation method made it clear that gtfB and gtfC gene expression were decreased in the presence of L. acidophilus-derived biosurfactant fraction. Several properties of S. mutans cells (the surface properties, biofilm formation, adhesion ability and gene expression were changed after L. acidophilus-derived biosurfactant treatment. It is also concluded that biosurfacant treatment can provide an optional way to control biofilm development. On the basis of our findings, we can suggest that the prepared biosurfactant may interfere with adhesion processes of S. mutans to teeth surfaces, provided additional evaluation produce satisfactory results.

  16. A new record of Chironomus (Chironomus) acidophilus Keyl (Diptera, Chironomidae) from the Uzon volcanic caldera (Kronotsky Reserve, Kamchatka Peninsula, Russia), its karyotype, ecology and biology.

    Science.gov (United States)

    Orel, Oksana V; Lobkova, Ludmila E; Zhirov, Sergey V; Petrova, Ninel A

    2015-07-03

    Morphology, cytology, ecology and biology of Holarctic Chironomus (Chironomus) acidophilus Keyl, 1960 (Diptera, Chironomidae) was examined from material collected in the geothermal Vosmerka Lake (pH=2.0-2.5). An illustrated redescription of C. acidophilus is given on the basis of adult males reared from field-collected pupae, and of simultaneously collected larvae. Additional larvae belonging to the pseudothummi-complex were identified as C. acidophilus on the basis of their karyotype. The karyotype of C. acidophilus (2n=8) and detailed mapping of the 4 chromosome arms A, E, D and F are provided. The population of C. acidophilus from Kamchatka was found to be karyologically monomorphic. Information on distribution and ecology of C. acidophilus from Vosmerka Lake (total mineralization 1583.5 mg/l) is also given. Chironomus acidophilus is the only species of aquatic insects recorded in this lake. Lack of competition and a richness of food resources contribute to the high abundance (35161 ind./m2) and biomass (11.342 g/m2) of the larvae of C. acidophilus in Vosmerka Lake.

  17. Bacterial Endocarditis Caused by Lactobacillus acidophilus Leading to Rupture of Sinus of Valsalva Aneurysm.

    Science.gov (United States)

    Encarnacion, Carlos Omar; Loranger, Austin Mitchell; Bharatkumar, A G; Almassi, G Hossein

    2016-04-01

    Lactobacillus acidophilus rarely causes bacterial endocarditis, because it usually resides in the mucosa of the vagina, gastrointestinal tract, and oropharynx. Moreover, sinus of Valsalva aneurysms are rare cardiac anomalies, either acquired or congenital. We present the case of a middle-aged man whose bacterial endocarditis, caused by Lactobacillus acidophilus, led to an aneurysmal rupture of the sinus of Valsalva into the right ventricular outflow tract. The patient underwent successful surgical repair, despite numerous complications and sequelae.

  18. Waste pyritic coal as a raw material for energetic industry

    Energy Technology Data Exchange (ETDEWEB)

    Gasiorek, J. [Institute of Inorganic Chemistry, Poznan (Poland). Dept. of Research and Technology

    1997-11-01

    Results are presented of large laboratory studies on coal desulphurisation with foam flotation method improved by application of bioadsorption of Thiobacillus ferrooxidans bacteria to the modification of superficial properties of pyrite particulates from hydrophobic to hydrophillic ones. Results of coal desulfurization with and without bioadsorption have been compared. Bioadsorption improved pyritic sulfur removal by 30% (for coal from `Sierza mine`, coal size 0.3 to 0.102 mm, S pyritic content 1.69%) after 6-week adaptation of bacteria and 30 min of bioadsorption. Bacteria concentration in 5% water suspension of coal reached 22 {mu}g of biomass cm{sup -3}. 12 refs., 4 figs., 1 tab.

  19. Application of bacterial leaching technology to deep solution-mining conditions for uranium extraction. Final report, September 1, 1978-September 30, 1981

    International Nuclear Information System (INIS)

    Brierley, J.A.; Brierley, C.L.; Torma, A.E.

    1982-03-01

    Microorganisms were evaluated for use in recovery of uranium under conditions of in-situ solution mining. The cultures tested were Thiobacillus ferrooxidans, the faculative-thermophilic TH3 strain, and two Sulfolobus species. Growth of the organisms occurred in the presence of 0.34 to 5.0 mM uranyl ion with higher concentrations being inhibitory. Uranium ore from the Anaconda Minerals Co. Jackpile mine was not readily leachable by microorganisms. To support bacterial activity the ore was supplemented with pyrite or ferrous iron. The ore possessed some toxic properties. T. ferrooxidans was able to assist in leaching of uranium from the ore at a hydrostatic pressure of 10.3 MPa

  20. Research within the coordinated progamme on bacterial leaching of uranium ores

    International Nuclear Information System (INIS)

    Marjanovic, D.

    1978-01-01

    Effect of magnetic field on the growth rate of Thiobacillus ferrooxidans bacteria was studied at intensities of 30, 100, 2400, and 4000 Oe. Low intensity magnetic field was found to stimulate the bacteria growth rate and the rate of ferrosulphate oxidation with optimum values at 30 to 300 Oe (maximum at 300 Oe). Magnetic field of high intensity (2400, 3200, 4000 Oe) inhibits the growth of bacteria and processes of bacterial oxidation. The possibility was also studied of using biocides for inhibiting bacterial processes in uranium-bearing waste dumps. The use of biocides resulted in a decrease of uranium-bearing waste dump autochthonous microflora density

  1. A functional glycogen biosynthesis pathway in Lactobacillus acidophilus: expression and analysis of the glg operon

    OpenAIRE

    Goh, Yong Jun; Klaenhammer, Todd R

    2013-01-01

    Glycogen metabolism contributes to energy storage and various physiological functions in some prokaryotes, including colonization persistence. A role for glycogen metabolism is proposed on the survival and fitness of Lactobacillus acidophilus, a probiotic microbe, in the human gastrointestinal environment. L.?acidophilus?NCFM possesses a glycogen metabolism (glg) operon consisting of glgBCDAP - amy - pgm genes. Expression of the glg operon and glycogen accumulation were carbon source- and gro...

  2. Carrageenan :the difference between PNG and KCL gel precipitation method as Lactobacillus acidophilus encapsulation material

    Science.gov (United States)

    Setijawati, D.; Nursyam, H.; Salis, H.

    2018-04-01

    The study on the effects of using of materials and methods in the preparation of the microcapsules Lactobacillus acidophilus towards the viability has been done. The research method used is experimental laboratory design. Variable research was kind of material (A) as the first factor with sub factor (A1 = Eucheuma cottonii) (A2 = Eucheuma spinosum) (A3 = mixture of Eucheuma cottonii and Eucheuma spinosum 1:1 ratio), while the second factor is a method of extraction to produce caragenan (B) with sub factor (B1 = Philipine Natural Grade modification) (B2 = KCl gel Press Precipitation). Analysis of different influences uses Analysis Of Varians followed by Fisher’s test. Analysis of data uses Mini tab 16. The results shows that the kind of extraction factors and methods gave significantly different effects on the viability of Lactobacillus acidophilus. The highest mean of Viablity obtained in the treatment of materials with a mixture of Eucheuma cottonii and Eucheuma spinosum and used KCl Gel Press method is equal to 7.14 log (CFU / mL). It is ssuggested using of kappa-iota carrageenanmixture asencapsulation material with KCl Gel Press method on Lactobacillus acidophilus microencapsulation process because it treatment gavethe highest average of Lactobacillus acidophilus viability.

  3. Health importance of of faecal strain of Lactobacillus acidophilus ...

    African Journals Online (AJOL)

    The health promoting potential of Lactobacillus acidophilus isolated from faeces of human neonate, pig and albino rat was assessed. A set of rats were orogastrically dosed with the Lactobacillus isolates alone (safety test), while the other set was dosed with Lactobacillus isolates and infected with E. coli NCIB 86 (Challenge ...

  4. Enhancement of ceramide formation increases endocytosis of Lactobacillus acidophilus and leads to increased IFN-β and IL-12 production in dendritic cells

    DEFF Research Database (Denmark)

    Fuglsang, Eva; Boye, Louise; Frøkiær, Hanne

    2017-01-01

    , and induced macropinocytosis in the bmDCs. Addition of SMase increased the phagocytosis of L. acidophilus and L. acidophilus-induced IL-12/IFN-β but showed no effect on the uptake of E. coli nor on E.coli induced IL-12/IFN-β production. Also, SMase did not affect Pam3CSK4-induced macropinocytosis of FITC......-dextran. Inhibition of both acid SMase and ceramidase by CPZ increased constitutive macropinocytosis of dextran and slightly increased L.acidophilus induced Il12/Ifn-β expression and E.coli induced Ifnβ expression. Our results confirm a role for ceramide in the L.acidophilus induced IL-12/IFN-β production but also...

  5. Preservation of intestinal integrity during radiotherapy using live Lactobacillus acidophilus cultures

    International Nuclear Information System (INIS)

    Salminen, E.; Elomaa, I.; Minkkenen, J.; Vapaatalo, H.; Salminen, S.

    1988-01-01

    Twenty-four female patients suffering from gynaecological malignancies and scheduled for internal and external irradiation of the pelvic area (pelvic dose 5000 cGy) were selected for a study on prevention of intestinal side-effects by live Lactobacillus acidophilus cultures. The patients were randomised into two groups. Both groups received dietary counselling recommending a low-fat and low-residue diet during radiotherapy. The control group received dietary counselling only. The test group received 150 ml of a fermented milk test product supplying them with at least 2 x 10 9 live Lactobacillus acidophilus bacteria daily and 6.5% lactulose as substrate for the bacteria. The results indicated that the test product appeared to prevent radiotherapy-associated diarrhoea. However, flatulence was increased probably due to lactulose ingestion in the test group. (author)

  6. Development of a chromosome-plasmid balanced lethal system for Lactobacillus acidophilus with thyA gene as selective marker.

    Science.gov (United States)

    Fu, X; Xu, J G

    2000-01-01

    A chromosome-plasmid balanced lethal gene delivery system for Lactobacillus acidophilus based on the thyA gene was developed. The selected L. acidophilus DOM La strain carries a mutated thyA gene and has an obligate requirement for thymidine. This strain can be used as a host for the constructed shuttle vector pFXL03, lacking antibiotic-resistant markers but having the wild-type thyA gene from L. casei which complements the thyA chromosomal mutation. The vector also contains the replicon region from plasmid pUC19 and that of the Lactococcus plasmid pWV01, which allows the transfer between Escherichia coli, L. casei and L. acidophilus. Eight unique restriction sites (i.e., PstI, HindIII, SphI, SalI, AccI, XbaI, KpnI and SacI) are available for cloning. After 40-time transfers in modified MRS medium, no plasmid loss was observed. The vector pFXL03 is potentially useful as a food-grade vaccine delivery system for L. acidophilus.

  7. PENURUNAN KADAR AFLATOKSIN B1 PADA SARI KEDELAI OLEH SEL HIDUP DAN SEL MATI Lactobacillus acidophilus SNP-2 [Reduction of Aflatoxin B1 in Soymilk by Viable and Heat-killed Lactobacillus acidophilus SNP-2

    Directory of Open Access Journals (Sweden)

    Tyas Utami1*

    2012-06-01

    Full Text Available Aflatoxins are carcinogenic mycotoxins that commonly contaminate foods and feed. There are many different forms of aflatoxin and its metabolites. Of these, aflatoxin B1 (AFB1 is the most prevalent and toxic. Lactobacillus acidophilus SNP-2 has previously been shown to remove AFB1 from liquid solution of phosphate saline buffer. However, the ability of lactic acid bacteria to reduce AFB1 content in soymilk has not been studied yet. The objective of this study was to investigate the ability of viable and heat-killed cells of L. acidophilus SNP-2 to reduce AFB1 in soymilk and fermented soymilk. Soymilk contaminated with Aspergillus flavus was inoculated with culture of L. acidophilus SNP-2, and incubated at 37C for 12 hours. Fermented soymilk, then, was heat sterilized and stored at cool room (4°C. Heat-killed cells were introduced to soy milk and then kept at cool room for 3 days. During soymilk fermentation, there was reduction of AFB1 content in soymilk related to the growth of lactic acid bacteria and the reduction of pH. The initial concentration of AFB1 in the soymilk was 4.9 ppb. Lactobacillus acidophilus SNP-2 reduced 67.58% of AFB1 in the soymilk after 12 hoursof fermentation. In cool environment, the binding of AFB1 to heat-killed cell after soymilk fermentation was relatively more stable than that of soymilk without fermentation.

  8. Isolation and characterization of cbbL and cbbS genes encoding form I ribulose-1,5-bisphosphate carboxylase/oxygenase large and small subunits in Nitrosomonas sp. strain ENI-11.

    Science.gov (United States)

    Hirota, Ryuichi; Kato, Junichi; Morita, Hiromu; Kuroda, Akio; Ikeda, Tsukasa; Takiguchi, Noboru; Ohtake, Hisao

    2002-03-01

    The cbbL and cbbS genes encoding form I ribulose-1,5-bisphosphate carboxylase/oxygenase (RubisCO) large and small subunits in the ammonia-oxidizing bacterium Nitrosomonas sp. strain ENI-11 were cloned and sequenced. The deduced gene products, CbbL and CbbS, had 93 and 87% identity with Thiobacillus intermedius CbbL and Nitrobacter winogradskyi CbbS, respectively. Expression of cbbL and cbbS in Escherichia coli led to the detection of RubisCO activity in the presence of 0.1 mM isopropyl-beta-D-thiogalactopyranoside (IPTG). To our knowledge, this is the first paper to report the genes involved in the carbon fixation reaction in chemolithotrophic ammonia-oxidizing bacteria.

  9. Utilization of low grade and waste uranium ores by means of biological processes. Part of a coordinated programme on bacterial leaching of uranium ores

    International Nuclear Information System (INIS)

    Czegledi, B.

    1978-01-01

    Investigation of the possible affect of bacteria in leaching uranium using alkaline carbonate medium has been investigated. Eleven strains of bacteria were isolated from the alkaline percolation solutions. Most belonged to the genus Thiobacillus. Each strain was characterized by growth under aerobic conditions in Levinthal - bouillon medium and under vaseline (semi-anaerobic in Hetehens medium. Growth of the bacteria was optimum at pH range 7 to 8 but a significant population was found to exist in alkaline leaching solutions of about pH 9 to 9.5 in heap leaching experiments. It was concluded that microbiological processes can play a role in alkaline heap leaching although the quantitative measure is yet uncertain

  10. Bioleaching of a manganese and silver Ore

    International Nuclear Information System (INIS)

    Porro, S.; Tedesco, P.H.; La Plata

    1990-01-01

    The bioleaching with a strain of Thiobacillus thiooxidans of the ore of Farallon Negro (Catamarca, Argentina) was studied in order to estimate its application to the solution and recovery of the manganese, and to improve the silver extraction. The State company which works the mine has not yet found an economical process to extract the manganese and has only reached a 30% efficiency in the recovery of silver by cianuration. The effects of pulp density variations and the addition of different quantities of FeS were analysed looking for the best working conditions. 74 μm (mesh Tyler 200) of ore particles were used because that is the size used in this plant for the cianuration process. (Author)

  11. Investigations on microbial leaching of zircon by means of spark source mass spectrometry

    International Nuclear Information System (INIS)

    Becker, S.; Dietze, H.J.; Bullmann, M.; Iske, U.

    1985-01-01

    Spark source mass spectrometry is a useful method for chemical element analysis of geological and biological samples. This sensitive technique (detection limit down to the ppb-range) is used to analyze leaching processes by means of several microorganisms. The problem of microbial leaching of chemical resistent materials was tested under laboratory condition with regard to possible analytical and technical applications. Leaching of metalls with chemolithotrophic and heterotrophic, organic acids producing microorganisms has been investigated with zircon from Baltic Shield containing 0.7% rare earth elements and 1.67% hafnium. When zircon is leached with strains of Thiobacillus ferroxidans the rare earth elements, Hf, Th, and U mostly (about 80%) can be recovered. (author)

  12. Mass spectrographic analysis of selected chemical elements by microbial leaching of zircon

    International Nuclear Information System (INIS)

    Becker, S.; Dietze, H.J.; Bullmann, M.; Iske, U.

    1986-01-01

    Spark source mass spectrometry is a useful method for chemical element analysis of geological and biological samples. This sensitive technique (detection limit down to the ppb-range) is used to analyze leaching processes by means of several microorganisms. The problem of microbial leaching of chemical resistent materials was tested under laboratory conditions with regard to possible analytical and technical applications. Leaching of metals with chemolithotrophic and heterotrophic, organic acids producing microorganisms has been investigated with zircon from the Baltic Shield containing 0.7% rare earth elements and 1.67% hafnium. When zircon is leached with strains of thiobacillus ferrooxidans about 80% of the rare earth elements, Hf, Th and U can be recovered. (orig.) [de

  13. Dicty_cDB: Contig-U05414-1 [Dicty_cDB

    Lifescience Database Archive (English)

    Full Text Available NA clone ZM... 76 1e-18 CP001071_756( CP001071 |pid:none) Akkermansia muciniphila ATCC BAA... 89 1e-18 AE017...CP000472 |pid:none) Shewanella piezotolerans WP3, com... 92 2e-17 AM286415_3721( AM286415 |pid:none) Yersini...lin,... 50 2e-06 AM494945_19( AM494945 |pid:none) Leishmania braziliensis chromosom... 55 5e-06 AP00725...0_22( DQ226510 |pid:none) Thellungiella halophila clone ThB... 94 2e-23 CP000116_2432( CP000116 |pid:none) Thiobacillus denitrificans...-17 CP000934_3554( CP000934 |pid:none) Cellvibrio japonicus Ueda107, c... 83 3e-17 AB274914_1( AB274914 |pid:none) Pleurochrysi

  14. Survival of Lactobacillus acidophilus and Bacillus coagulans in probiotic and low-fat synbiotic ice-creams

    Directory of Open Access Journals (Sweden)

    M Hashemi

    2013-11-01

    Full Text Available In this study, survival of Lactobacillus acidophilus and Bacillus coagulans after freezing and during 90 days of storage at -18○C in probiotic and low-fat synbiotic ice-cream was evaluated. Addition to a control group (which was ordinary ice-cream, two probiotic ice-creams were formulated using L. acidophilus and B. coagulans and two synbiotic ice-creams were prepared using the aforementioned microorganisms but replacing 5% of milk-fat with inulin. The total solids of the ice-cream mixes did not differ significantly, however there was a significant difference (p

  15. Inhibitory effects of antiseptic mouthrinses on Streptococcus mutans, Streptococcus sanguinis and Lactobacillus acidophilus.

    Science.gov (United States)

    Evans, A; Leishman, S J; Walsh, L J; Seow, W K

    2015-06-01

    Oral antiseptics are valuable in controlling oral infections caused by cariogenic bacteria. The aim of this study was to investigate the effects of mouthrinses and pure antiseptic compounds on Streptococcus mutans and non-mutans bacteria (Streptococcus sanguinis and Lactobacillus acidophilus). The agar diffusion assay was employed to determine bacterial growth inhibition. Commercial mouthrinses containing chlorhexidine gluconate (0.2%), cetylpyridinium chloride (0.05%) and sodium fluoride (0.05%) produced statistically similar growth inhibition of S. mutans, S. sanguinis and L. acidophilus (with zones of inhibition ranging from 7.56 ± 0.52 mm to 7.39 ± 0.53 mm, 17.44 ± 0.94 mm to 18.31 ± 0.62 mm and 8.61 ± 1.43 to 8.67 ± 1.43 mm respectively, p > 0.05). The chlorhexidine mouthwash produced the greatest mean growth inhibition of S. sanguinis and S. mutans compared to all other mouthrinses tested (p mutans could be detected were chlorhexidine gluconate at 0.005% (wt/vol), cetylpyridinium chloride 0.01% (wt/ vol), povidone iodine 10% (wt/vol) and sodium hypochlorite 0.5% (vol/vol). Chlorhexidine (0.01%), cetylpyridinium chloride (0.01%), povidone iodine (10%) and sodium hypochlorite (0.5%) are effective at inhibiting the growth of S. mutans, S. sanguinis and L. acidophilus. © 2015 Australian Dental Association.

  16. Exo- and surface proteomes of the probiotic bacterium Lactobacillus acidophilus NCFM

    DEFF Research Database (Denmark)

    Celebioglu, Hasan Ufuk; Svensson, Birte

    2017-01-01

    Lactobacillus acidophilus NCFM is a well-known probiotic bacterium extensively studied for its beneficial health effects. Exoproteome (proteins exported into culture medium) and surface proteome (proteins attached to S-layer) of this probiotic were identified by using 2DE followed by MALDI TOF MS...

  17. Astragalus root and elderberry fruit extracts enhance the IFN-β stimulatory effects of Lactobacillus acidophilus in murine-derived dendritic cells.

    Directory of Open Access Journals (Sweden)

    Hanne Frøkiær

    Full Text Available Many foods and food components boost the immune system, but little data are available regarding the mechanisms by which they do. Bacterial strains have disparate effects in stimulating the immune system. In dendritic cells, the gram-negative bacteria Escherichia coli upregulates proinflammatory cytokines, whereas gram-positive Lactobacillus acidophilus induces a robust interferon (IFN-β response. The immune-modulating effects of astragalus root and elderberry fruit extracts were examined in bone marrow-derived murine dendritic cells that were stimulated with L. acidophilus or E. coli. IFN-β and other cytokines were measured by ELISA and RT-PCR. Endocytosis of fluorescence-labeled dextran and L. acidophilus in the presence of elderberry fruit or astragalus root extract was evaluated in dendritic cells. Our results show that both extracts enhanced L. acidophilus-induced IFN-β production and slightly decreased the proinflammatory response to E. coli. The enhanced IFN-β production was associated with upregulation of toll-like receptor 3 and to a varying degree, the cytokines IL-12, IL-6, IL-1β and TNF-α. Both extracts increased endocytosis in immature dendritic cells, and only slightly influenced the viability of the cells. In conclusion, astragalus root and elderberry fruit extracts increase the IFN-β inducing activity of L. acidophilus in dendritic cells, suggesting that they may exert antiviral and immune-enhancing activity.

  18. SUPLEMENTASI Lactobacillus acidophilus SNP-2 PADA TAPE DAN PENGARUHNYA PADA RELAWAN [Supplementation of Lactocbacillus acidophilus SNP-2 Into Tape and its Effect to the Volunteer

    Directory of Open Access Journals (Sweden)

    Endang S Rahayu1

    2004-08-01

    Full Text Available Functional food is defined as any potentially healthful food or food ingredient that may provide a health benefit beyond the traditional nutrients it contains. Many researches have been conducted on the health benefit of probiotic (life bacterial cells, one of the ingredient of functional foods. One of the potential bacteria used for probiotic agent and also involved in traditional fermented foods are lactic acid bacteria (LAB. Previous research showed that Lactobacillus acidophilus SNP-2 isolated from faecal material of healthy infant is resistant to acid and bile salt, and has an antagonistic effect against several enteric bacterial pathogens. The objective of this research was to study the effect of L. acidophilus SNP-2 as probiotic agent to the health benefits. These bacteria were supplemented into tape ketan (fermented sticky rice, the indigenous Indonesian fermented food. Tape ketan was chosen as the carrier of probiotic biomass based on the high population of LAB in this product, i.e., 1.3 x 108 CFU/g. Addition of L. acidophilus SNP-2 biomass prior to fermentation of tape ketan resulted in a higher total of LAB cells, i.e. 2.1 x 109 CFU/g compared to the amount of 1.5 x 108 CFU/g when the addition was done after fermentation. Consumption of tape ketan containing probiotic agent by the volunteers increased the population of lactobacilli (from 1.7x107 CFU/g to 9.9x107 CFU/g and decreased the population of enterobacteriacea (from 5.4x109 CFU/g to 4.4x108 in their faecal material. This phenomenon revealed that probiotic agent was able to colonize and inhibit the growth of enterobacteriaceae in the gastrointestinal tract. The result implied that tape ketan can be used as a carrier for probiotic agent and it can be categorized as functional food

  19. Bifidobacterium bifidum Actively Changes the Gene Expression Profile Induced by Lactobacillus acidophilus in Murine Dendritic Cells

    DEFF Research Database (Denmark)

    Weiss, Gudrun Margarethe; Rasmussen, Simon; Fink, Lisbeth Nielsen

    2010-01-01

    Dendritic cells (DC) play a pivotal regulatory role in activation of both the innate as well as the adaptive immune system by responding to environmental microorganisms. We have previously shown that Lactobacillus acidophilus induces a strong production of the pro-inflammatory and Th1 polarizing...... cytokine IL-12 in DC, whereas bifidobacteria do not induce IL-12 but inhibit the IL-12 production induced by lactobacilli. In the present study, genome-wide microarrays were used to investigate the gene expression pattern of murine DC stimulated with Lactobacillus acidophilus NCFM and Bifidobacterium...

  20. Lactobacillus acidophilus ameliorates H. pylori-induced gastric inflammation by inactivating the Smad7 and NFκB pathways

    Directory of Open Access Journals (Sweden)

    Yang Yao-Jong

    2012-03-01

    Full Text Available Abstract Background H. pylori infection may trigger Smad7 and NFκB expression in the stomach, whereas probiotics promote gastrointestinal health and improve intestinal inflammation caused by pathogens. This study examines if probiotics can improve H. pylori-induced gastric inflammation by inactivating the Smad7 and NFκB pathways. Results Challenge with H. pylori increased IL-8 and TNF-α expressions but not TGF-β1 in MKN45 cells. The RNA levels of Smad7 in AGS cells increased after H. pylori infection in a dose-dependent manner. A higher dose (MOI 100 of L. acidophilus pre-treatment attenuated the H. pylori-induced IL-8 expressions, but not TGF-β1. Such anti-inflammatory effect was mediated via increased cytoplasmic IκBα and depletion of nuclear NFκB. L. acidophilus also inhibited H. pylori-induced Smad7 transcription by inactivating the Jak1 and Stat1 pathways, which might activate the TGF-β1/Smad pathway. L. acidophilus pre-treatment ameliorated IFN-γ-induced Smad7 translation level and subsequently reduced nuclear NF-κB production, as detected by western blotting. Conclusions H. pylori infection induces Smad7, NFκB, IL-8, and TNF-α production in vitro. Higher doses of L. acidophilus pre-treatment reduce H. pylori-induced inflammation through the inactivation of the Smad7 and NFκB pathways.

  1. Influence of Gamma Rays on the Ability of Lactobacillus acidophilus and Lactobacillus casei for Lowering Cholesterol and Aflatoxin

    International Nuclear Information System (INIS)

    Hussien, H.A.

    2009-01-01

    Specific lactic acid bacterial strains reduce cholesterol and remove aflatoxin B1 (AFB1) from phosphate buffer by physical binding or by assimilation. L. acidophilus and L. casei could grow in the presence of 0 to 0.8 % of bile salt. Below 0.4 % concentration bile salte has no effect on the viability, cholesterol lowering or toxin binding percentages for both strains. Bile salts concentration 0.8 % reduce the viable counts approximately 5 log cycle for L. acidophilus and 4.5 log cycles for L. casei. At the same concentration the cholesterol percentage decreased from 83.6 % to 80 % and from 83.3% to 80% for Lactobacillus acidophilus and Lactobacillus casei, respectively. Bile salts concentration of 0.2% decreased AFB1 binding percentage from 56.9 and 57.2 to 45.4 and 53.8 % for L. acidophilus and L.casei ,respectively then both lowering and binding percentages remained constant when bile increased more than to 0.2%.Dead cells have great effect in removing AFB1 while living cells of both strains lowered cholesterol concentration more than dead cells. The irradiated examined strains decreased cholesterol lowering percentage while low doses of Gamma ray (50 Gy) stimulated the organisms to bind AFB1 while relatively high doses decrease the binding percentage

  2. Production of ferric sulphate from pyrite by thiobacillus ferrooxidans. Application to uranium ore leaching

    International Nuclear Information System (INIS)

    Rouas, C.

    1988-12-01

    A process for uranium extraction by oxidizing solutions of ferric sulphate produced by T. ferrooxidans from pyrite is developed. A new counting method specific of T. ferrooxidans is designed. An uranium resistant wild strain, with oxidizing properties as high as the strain ATCC 19859, is isolated. Optimal conditions for ferric sulphate production from pyrite are defined (pH 1.8, density of the medium 1.2%, pyrite granulometry [fr

  3. Drug resistance plasmids in Lactobacillus acidophilus and Lactobacillus reuteri.

    OpenAIRE

    Vescovo, M; Morelli, L; Bottazzi, V

    1982-01-01

    Sixteen strains of Lactobacillus reuteri and 20 strains of Lactobacillus acidophilus were tested for resistance to 22 antibiotics by using commercially available sensitivity disks. Evidence suggesting linkage of these resistances to plasmids was obtained by "curing" experiments with acridine dyes and high growth temperatures. Examination of plasmid patterns of agarose gel electrophoresis provided further evidence of loss in plasmid DNA under curing conditions in some of the strains examined.

  4. Plant extract enhances the viability of Lactobacillus delbrueckii subsp. bulgaricus and Lactobacillus acidophilus in probiotic nonfat yogurt

    Science.gov (United States)

    Michael, Minto; Phebus, Randall K; Schmidt, Karen A

    2015-01-01

    A commercial plant extract (prepared from olive, garlic, onion and citrus extracts with sodium acetate (SA) as a carrier) was evaluated to extend the viability of yogurt starter and probiotic bacteria as a means to enhance the shelf life of live and active culture, probiotic nonfat yogurt. Yogurts prepared from three different formulas (0.5* plant extract, 0.25* SA, or no supplement) and cultures (yogurt starter plus Bifidobacterium animalis,Lactobacillus acidophilus, or both probiotics) were assessed weekly during 29 days of storage at 5°C. Supplemented yogurt mixes had greater buffering capacities than non-supplemented yogurt mixes. At the end of storage, Lactobacillus bulgaricus and L. acidophilus counts in supplemented yogurts were greater compared with non-supplemented yogurts. Supplementation did not affect Streptococcus thermophilus and B. animalis counts. Hence the greater buffering capacity of yogurt containing plant extract could enhance the longevity of the probiotics, L. bulgaricus and L. acidophilus, during storage. PMID:25650127

  5. Plant extract enhances the viability of Lactobacillus delbrueckii subsp. bulgaricus and Lactobacillus acidophilus in probiotic nonfat yogurt.

    Science.gov (United States)

    Michael, Minto; Phebus, Randall K; Schmidt, Karen A

    2015-01-01

    A commercial plant extract (prepared from olive, garlic, onion and citrus extracts with sodium acetate (SA) as a carrier) was evaluated to extend the viability of yogurt starter and probiotic bacteria as a means to enhance the shelf life of live and active culture, probiotic nonfat yogurt. Yogurts prepared from three different formulas (0.5* plant extract, 0.25* SA, or no supplement) and cultures (yogurt starter plus Bifidobacterium animalis,Lactobacillus acidophilus, or both probiotics) were assessed weekly during 29 days of storage at 5°C. Supplemented yogurt mixes had greater buffering capacities than non-supplemented yogurt mixes. At the end of storage, Lactobacillus bulgaricus and L. acidophilus counts in supplemented yogurts were greater compared with non-supplemented yogurts. Supplementation did not affect Streptococcus thermophilus and B. animalis counts. Hence the greater buffering capacity of yogurt containing plant extract could enhance the longevity of the probiotics, L. bulgaricus and L. acidophilus, during storage.

  6. Microencapsulation of Bifidobacterium animalis subsp. lactis and Lactobacillus acidophilus in cocoa butter using spray chilling technology

    Science.gov (United States)

    Pedroso, D.L.; Dogenski, M.; Thomazini, M.; Heinemann, R.J.B.; Favaro-Trindade, C.S.

    2013-01-01

    In the present study, the cells of Bifidobacterium animalis subsp. lactis (BI-01) and Lactobacillus acidophilus (LAC-04) were encapsulated in cocoa butter using spray-chilling technology. Survival assays were conducted to evaluate the resistance of the probiotics to the spray-chilling process, their resistance to the simulated gastric and intestinal fluids (SGF and SIF), and their stability during 90 days of storage. The viability of the cells was not affected by microencapsulation. The free and encapsulated cells of B. animalis subsp. lactis were resistant to both SGF and SIF. The micro-encapsulated cells of L. acidophilus were more resistant to SGF and SIF than the free cells; the viability of the encapsulated cells was enhanced by 67%, while the free cells reached the detection limit of the method (103 CFU/g). The encapsulated probiotics were unstable when they were stored at 20 °C. The population of encapsulated L. acidophilus decreased drastically when they were stored at 7 °C; only 20% of cells were viable after 90 days of storage. The percentage of viable cells of the encapsulated B. animalis subsp.lactis, however, was 72% after the same period of storage. Promising results were obtained when the microparticles were stored at −18 °C; the freeze granted 90 days of shelf life to the encapsulated cells. These results suggest that the spray-chilling process using cocoa butter as carrier protects L. acidophilus from gastrointestinal fluids. However, the viability of the cells during storage must be improved. PMID:24516445

  7. Microencapsulation of Bifidobacterium animalis subsp. lactis and Lactobacillus acidophilus in cocoa butter using spray chilling technology

    Directory of Open Access Journals (Sweden)

    D.L. Pedroso

    2013-09-01

    Full Text Available In the present study, the cells of Bifidobacterium animalis subsp. lactis (BI-01 and Lactobacillus acidophilus (LAC-04 were encapsulated in cocoa butter using spray-chilling technology. Survival assays were conducted to evaluate the resistance of the probiotics to the spray-chilling process, their resistance to the simulated gastric and intestinal fluids (SGF and SIF, and their stability during 90 days of storage. The viability of the cells was not affected by microencapsulation. The free and encapsulated cells of B. animalis subsp. lactis were resistant to both SGF and SIF. The micro-encapsulated cells of L. acidophilus were more resistant to SGF and SIF than the free cells; the viability of the encapsulated cells was enhanced by 67%, while the free cells reached the detection limit of the method (10³ CFU/g. The encapsulated probiotics were unstable when they were stored at 20 °C. The population of encapsulated L. acidophilus decreased drastically when they were stored at 7 °C; only 20% of cells were viable after 90 days of storage. The percentage of viable cells of the encapsulated B. animalis subsp.lactis, however, was 72% after the same period of storage. Promising results were obtained when the microparticles were stored at -18 °C; the freeze granted 90 days of shelf life to the encapsulated cells. These results suggest that the spray-chilling process using cocoa butter as carrier protects L. acidophilus from gastrointestinal fluids. However, the viability of the cells during storage must be improved.

  8. Fractionation of sulfur isotopes in the chemical and biochemical oxidation of sulfide to sulfate

    International Nuclear Information System (INIS)

    Maass, I.; Wetzel, K.; Weise, G.; Heyer, J.

    1983-01-01

    The behaviour of sulfur isotopes in the chemical and biochemical oxidation of marcasite (FeS 2 ) to sulfate has been investigated in rest and shaker cultures at 30 0 C. The microbiological oxidation was carried out using a mixed culture of Thiobacillus. The results show a considerably faster formation of sulfate in the biochemical oxidation in comparison with the chemical oxidation. Isotope analyses of the formed sulfates indicate no or only very small isotope fractionations depending on experimental conditions. The highest enrichment of 32 S in the sulfate is 1.7 per mille. In accordance with the results of other authors it is concluded that in both chemical and biochemical weathering of sedimentary sulfides resulting in the formation of sulfates isotope effects are not of importance. (author)

  9. The effects of Lactobacillus Acidophilus fermentation products as an alternative to antibiotics

    Science.gov (United States)

    This experiment compared the effects of Lactobacillus acidophilus fermentation products (LAFP) to carbadox and copper sulfate on growth performance and complete blood counts (CBC). Eight hundred pigs were weaned at 24 d of age and utilized in a randomized block design (4 farrowing groups, blocked by...

  10. Microencapsulation of Lactobacillus Acidophilus by Xanthan-Chitosan and Its Stability in Yoghurt

    Directory of Open Access Journals (Sweden)

    Guowei Shu

    2017-12-01

    Full Text Available Microencapsulations of Lactobacillus acidophilus in xanthan-chitosan (XC and xanthan-chitosan-xanthan (XCX polyelectrolyte complex (PEC gels were prepared in this study. The process of encapsulation was optimized with the aid of response surface methodology (RSM. The optimum condition was chitosan of 0.68%, xanthan of 0.76%, xanthan-L. acidophilus mixture (XLM/chitosan of 1:2.56 corresponding to a high viable count (1.31 ± 0.14 × 1010 CFU·g−1, and encapsulation yield 86 ± 0.99%, respectively. Additionally, the application of a new encapsulation system (XC and XCX in yoghurt achieved great success in bacterial survival during the storage of 21 d at 4 °C and 25 °C, respectively. Specially, pH and acidity in yogurt were significantly influenced by the new encapsulation system in comparison to free suspension during 21 d storage. Our study provided a potential encapsulation system for probiotic application in dairy product which paving a new way for functional food development.

  11. Bacteriocins produced by L. fermentum and L .acidophilus can inhibit cephalosporin resistant E .coli.

    Directory of Open Access Journals (Sweden)

    Saba Riaz

    2010-10-01

    Full Text Available Reemerging infections occur due to resistant bacteria. Such infections create restrictions for clinicians and microbiologists in drug selection. Such problems demand new strategies for solution. Use of bacteriocins for this purpose may be fruitful. In the present research work, the inhibitory effects of bactericins on cephalosporin resistant Escherichia coli are used as model system for the control of antibiotic resistant pathogenic bacteria. Cephalosporin resistant Escherichia coli strain was isolated from pus by using conventional methodology. For bacteriocin production, Lactobacilli strains were selected by using selective media. Out of seventy two strains isolated from yogurt, fecal materials of human, chick, parrot and cat, only two strains (strain 45 and strain 52 were found to produce bacteriocins having antimicrobial potential against cephalosporin resistant Escherichia coli. Biochemical characterization showed that strain 45 belonged to group of Lactobacillus fermentum and strain 52 to Lactobacillus acidophilus. Both strains showed maximum growth at 25°C and 35°C respectively. Suitable pH was 5.5 and 6.0 for Lactobacillus fermentum and Lactobacillus acidophilus respectively. Bacteriocins produced by both strains were found stable at 50, 75 and 100°C for 60min. Function of bacteriocin was also not disturbed due to change in pH. These findings suggest that bacteriocin produced by Lactobacillus fermentum and Lactobacillus acidophilus can be used for the infection control of cephalosporin resistant Escherichia coli.

  12. Transcriptional and functional analysis of galactooligosaccharide uptake by lacS in Lactobacillus acidophilus

    DEFF Research Database (Denmark)

    Andersen, Joakim Mark; Barrangou, Rodolphe; Abou Hachem, Maher

    2011-01-01

    remain to be elucidated for many prebiotic substrates. Although β-galactooligosaccharides (GOS) are documented prebiotic compounds, little is known about their utilization by lactobacilli. This study aimed to identify genetic loci in Lactobacillus acidophilus NCFM responsible for the transport...

  13. The substitution of a traditional starter culture in mutton fermented sausages by Lactobacillus acidophilus and Bifidobacterium animalis.

    Science.gov (United States)

    Holko, I; Hrabě, J; Šalaková, A; Rada, V

    2013-07-01

    Common starter cultures used in fermented mutton sausages were substituted by probiotic strains of Lactobacillus acidophilus CCDM 476 and Bifidobacterium animalis 241a. Technological properties of the traditional and the probiotic sausages were compared. The potential probiotic effect was evaluated by enumeration of bifidobacteria and lactobacilli in stool samples of 15 volunteers before and after a 14-day consumption period. The numbers of lactobacilli (10(7) cfu/g) and bifidobacteria (10(3) cfu/g) in the final product did not affect the technological properties. The use of L. acidophilus as a starter culture was found more beneficial than the use of B. animalis. Even after 60 days of storage, high counts of L. acidophilus (10(6) cfu/g) were detected; on the other hand, the counts of B. animalis were under the detection limit. Regarding sensory properties, the probiotic products showed better texture, and, curiously, a reduction of the typical smell of mutton. The numbers of lactobacilli in stool samples increased significantly after the consumption of the probiotic sausages. Copyright © 2013 Elsevier Ltd. All rights reserved.

  14. Minas-type fresh cheese developed from buffalo milk with addition of L. acidophilus Desenvolvimento de queijo minas frescal de leite de búfala com adição de L. acidophilus

    Directory of Open Access Journals (Sweden)

    Bruna Marcatti

    2009-08-01

    Full Text Available Effective incorporation of a probiotic into foods requires the culture to remain viable all along processing and storage, without adverse alterations to sensory characteristics. The objective of this work was developing Minas-type fresh cheese with probiotic properties from buffalo milk. Four batches of Minas-type fresh cheese were prepared using buffalo milk: batch T1 in which neither culture nor lactic acid added; batch T3 in which only lactic acid added; batches T2 and T4 , both added of Lactobacillus acidophilus LAC 4, but T4 was also acidified. Resulting cheeses were evaluated for probiotic culture stability, texture profile, sensory acceptance, and changes in pH. The T4 probiotic cheese presented hardness, gumminess, and chewiness significantly lower than the other treatments. However, values for springiness and cohesiveness did not differ between all cheeses, and no sensory differences (p > 0.05 were found between treatments for texture, taste, and overall acceptance. The addition of probiotic to the acidified cheese (T4 yielded best aroma. The populations of L. acidophilus were greater than 10(6 CFU g-1 after 28 days of storage all products. Minas-type fresh cheese from buffalo milk is a suitable food for the delivery of L. acidophilus, since the culture remained viable during the shelf life of the products and did not negative affect analysed parameters.Para incorporação efetiva de probióticos em alimentos é imprescindível que a cultura mantenha-se viável durante todo o processamento e a estocagem e que não ocorram alterações adversas nas características sensoriais do produto. O objetivo deste trabalho foi desenvolver queijo Minas frescal com propriedades probióticas a partir do leite de búfala. Foram avaliados quatro tratamentos (T1 a T4, sendo T1 e T3 controles, sem e com acidificação, respectivamente em T2 e T4 foram adicionados da cultura probiótica Lactobacillus acidophilus (LAC 4, porém T4 foi também acidificado

  15. Complete genome sequence of the moderately thermophilic mineral-sulfide-oxidizing firmicute Sulfobacillus acidophilus type strain (NALT)

    Energy Technology Data Exchange (ETDEWEB)

    Anderson, Iain [U.S. Department of Energy, Joint Genome Institute; Chertkov, Olga [Los Alamos National Laboratory (LANL); Chen, Amy [U.S. Department of Energy, Joint Genome Institute; Saunders, Elizabeth H [Los Alamos National Laboratory (LANL); Lapidus, Alla L. [U.S. Department of Energy, Joint Genome Institute; Nolan, Matt [U.S. Department of Energy, Joint Genome Institute; Lucas, Susan [U.S. Department of Energy, Joint Genome Institute; Hammon, Nancy [U.S. Department of Energy, Joint Genome Institute; Deshpande, Shweta [U.S. Department of Energy, Joint Genome Institute; Cheng, Jan-Fang [U.S. Department of Energy, Joint Genome Institute; Han, Cliff [Los Alamos National Laboratory (LANL); Tapia, Roxanne [Los Alamos National Laboratory (LANL); Goodwin, Lynne A. [Los Alamos National Laboratory (LANL); Pitluck, Sam [U.S. Department of Energy, Joint Genome Institute; Liolios, Konstantinos [U.S. Department of Energy, Joint Genome Institute; Pagani, Ioanna [U.S. Department of Energy, Joint Genome Institute; Ivanova, N [U.S. Department of Energy, Joint Genome Institute; Mikhailova, Natalia [U.S. Department of Energy, Joint Genome Institute; Pati, Amrita [U.S. Department of Energy, Joint Genome Institute; Palaniappan, Krishna [U.S. Department of Energy, Joint Genome Institute; Land, Miriam L [ORNL; Pan, Chongle [ORNL; Rohde, Manfred [HZI - Helmholtz Centre for Infection Research, Braunschweig, Germany; Pukall, Rudiger [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Goker, Markus [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Detter, J. Chris [U.S. Department of Energy, Joint Genome Institute; Woyke, Tanja [U.S. Department of Energy, Joint Genome Institute; Bristow, James [U.S. Department of Energy, Joint Genome Institute; Eisen, Jonathan [U.S. Department of Energy, Joint Genome Institute; Markowitz, Victor [U.S. Department of Energy, Joint Genome Institute; Hugenholtz, Philip [U.S. Department of Energy, Joint Genome Institute; Kyrpides, Nikos C [U.S. Department of Energy, Joint Genome Institute; Klenk, Hans-Peter [DSMZ - German Collection of Microorganisms and Cell Cultures GmbH, Braunschweig, Germany; Mavromatis, K [U.S. Department of Energy, Joint Genome Institute

    2012-01-01

    Sulfobacillus acidophilus Norris et al. 1996 is a member of the genus Sulfobacillus which comprises five species of the order Clostridiales. Sulfobacillus species are of interest for comparison to other sulfur and iron oxidizers and also have biomining applications. This is the first completed genome sequence of a type strain of the genus Sulfobacillus, and the second published genome of a member of the species S. acidophilus. The genome, which consists of one chromosome and one plasmid with a total size of 3,557,831 bp, harbors 3,626 protein-coding and 69 RNA genes, and is a part of the Genomic Encyclopedia of Bacteria and Archaea project.

  16. Effect of aqueous and alcoholic Stevia (Stevia rebaudiana) extracts against Streptococcus mutans and Lactobacillus acidophilus in comparison to chlorhexidine: An in vitro study

    Science.gov (United States)

    Ajagannanavar, Sunil Lingaraj; Shamarao, Supreetha; Battur, Hemant; Tikare, Shreyas; Al-Kheraif, Abdulaziz Abdullah; Al Sayed, Mohammed Sayed Al Esawy

    2014-01-01

    Introduction: Stevia (S. rebaudiana) a herb which has medicinal value and was used in ancient times as a remedy for a great diversity of ailments and sweetener. Leaves of Stevia contain a high concentration of Stevioside and Rebaudioside which are supposed to be sweetening agents. Aim: To compare the efficacy of aqueous and alcoholic S. rebaudiana extract against Streptococcus mutans and Lactobacillus acidophilus in comparison to chlorhexidine. Materials and Methods: In the first part of the study, various concentrations of aqueous and ethanolic Stevia extract were prepared in the laboratory of Pharmacy College. It was then subjected to microbiological assay to determine its zone of inhibition using Agar disk diffusion test and minimum inhibitory concentration (MIC) using serial broth dilution method against Streptococcus mutans and Lactobacillus acidophilus. Chlorhexidine was used as a positive control. One way Analysis of Variance (ANOVA) test was used for multiple group comparisons followed by Tukey post hoc for group wise comparisons. Results: Minimum inhibitory concentration (MIC) of aqueous and ethnolic Stevia extract against Streptococcus mutans and Lactobacillus acidophilus were 25% and 12.5% respectively. Mean zone of inhibition of the aqueous and alcoholic Stevia extracts against Streptococcus mutans at 48 hours were 22.8 mm and 26.7 mm respectively. Mean zone of inhibition of the aqueous and alcoholic Stevia extracts against Lactobacillus acidophilus at 48 hours were 14.4 mm and 15.1 mm respectively. Mean zone of inhibition of the chlorhexidine against Streptococcus mutans and Lactobacillus acidophilus at 48 hours was 20.5 and 13.2 respectively. Conclusion: The inhibitory effect shown by alcoholic Stevia extract against Streptococcus mutans and Lactobacillus acidophilus was superior when compared with that of aqueous form and was inferior when compared with Chlorhexidine. PMID:25558451

  17. Characteristic of Lamb Sausages Fermented by Indonesian Meat-Derived Probiotic, Lactobacillus plantarum IIA-2C12 and Lactobacillus acidophilus IIA-2B4

    Directory of Open Access Journals (Sweden)

    Noraimah Binti Sulaiman

    2016-08-01

    Full Text Available Probiotic is a group of microorganism, mainly from lactic acid bacteria (LAB, widely used to increase functionality of various foodstuffs, including lamb which was limited by its goaty odor and short life issue. This study aimed to evaluate the characteristic of lamb sausages fermented by either Lactobacillus plantarum IIA-2C12 or L. acidophilus IIA-2B4 isolated from local cattle in Indonesia, and stored for 21 days at low temperature (4oC. Fermented lamb sausages were made with the addition of L. plantarum IIA-2C12 and L. acidophilus IIA-2B4 with three replications. The result showed that pH value, protein, and cholesterol contents of the sausages with addition of L. acidophilus IIA-2B4 were higher (P<0.05 than that of L. plantarum IIA-2C12. Meanwhile, the sausage fermented with L. plantarum IIA-2C12 had higher titratable acid (TA value, texture, and the content of fat, carbohydrate, tyrosine, lysine, myristoleic (C14:1, pentadecanoic (C15:0, heneicosanoic (C21:0 and cis-11-eicosatrienoic (C20:1 as compared to that of  L. acidophilus 2C12-2B4. Final population of LAB in the sausage fermented by L. plantarum IIA-2C12 was also higher than that of L. acidophilus IIA-2B4, yet both can be categorized as a probiotic. The differences between characteristics of the physicochemical traits and microbiological quality of the sausage fermentation associated with the addition of L. plantarum IIA-2C12 or L. acidophilus IIA-2B4. The 21 days of storage at cold temperatures with probiotics addition could extend shelf life and maintain quality of fermented sausage.

  18. Mutualism between autotrophic and heterophic bacteria in leaching of low grade ores

    International Nuclear Information System (INIS)

    Khalid, Z.M.; Naeveke, R.

    1991-01-01

    During solubilization processes of low grade sulphidic ores, the auto trophic bacteria oxidize reduced sulphur compounds and ferrous iron to sulphates and ferric iron respectively. The ore leaching bio topes are not only colonized by auto trophic bacteria (Thiobacillus spp., Leptospirillum ferro oxidans and sulfolobus sp.) but the heterotrophic microorganisms, including bacteria and fungi of various species are also found in these habitats. The autotrophs, in addition to energy metabolism, also produce organic compounds which in excess amount inhibit their growth. Through the utilization of such compounds and also through the production of carbon dioxide and ammonia, these heterotorphs can help bio leaching processes. Effect of one of the heterotrophs; methylobacterium sp., a nitrogen scavenger, found in as association with the thio bacilli in one of the leaching bio tope in Germany was studied in leaching of a carbonate bearing complex (containing copper, iron, zinc and lead) sulphidic ore, in shake flask studies. T. ferro oxidans (Strain F-40) reported to be non nitrogen fixer and strain F-41, a nitrogen fixing thiobacillus were studied for leachability behaviour alone and in combination with T. thio oxidans (lacking nitrogen fixing ability) using media with and without added ammonium nitrogen. In addition the effect of methylobacterium sp. (alt-25) was also tested with the afore mentioned combinations. Nitrogen fixation by T. ferro oxidans did not suffice the nitrogen requirement and the leaching system in laboratory needed addition of nitrogen. The heterotrophic nitrogen scavenger also did not have a positive influence in nitrogen limited system. In case where ammonium nitrogen was also provided in the media, this heterotroph had a negative in own growth and leaving lesser amount available for thio bacilli. This high amount of acid is a limiting factor in bio leaching of high carbonate uranium ores. Uranium ore ecosystems have also been found to contain

  19. Anaerobic microbiological method of cleaning water contaminated by metallurgical slags

    Directory of Open Access Journals (Sweden)

    Олена Леонідівна Дан

    2015-11-01

    Full Text Available The problem of environmental protection and rational use of water resources is one of the most important problems of environmental policy in Ukraine. This problem in Mariupol is particularly acute as metallurgical and coke industries cause significant damage to adjacent water bodies (the Kalchyk, the Kalmius and coastal zone of the Sea of Azov. One of the most harmful components of wastewater of these enterprises are sulfide-containing compounds. These compounds in water can cause great harm to both human health and the environment. For example, in 1999 the main city enterprises (AZOVSTAL IRON & STEEL WORKS and ILYICH IRON AND STEEL WORKS discharged 885,0 million m³ of wastewater (including 403,9 million m³ of polluted waste water into water bodies. The slag dumps and landfills in close proximity to the sea form a source of dangerous pollution, because contaminated water infiltration washed out here in the groundwater and surface water, get into the Sea of Azov later on. There are 97 mg/l of sulfides in the protective dam of AZOVSTAL IRON & STEEL WORKS, what exceeds the standards (MPC = 10 mg/l. It makes it possible for us to put forward biochemical purification processes. Anaerobic microbiological method proposed in the article has several advantages (compact hardware design, a minimum amount of activated sludge and lack of energy consumption for aeration over the existing wastewater treatment (chemical, mechanical, biological. The experimental procedure consisted in introducing the medium to be purified purified into microbial communities of high concentration (Thiobacillus «X», Thiobacillus concretivorus, which assimilated organic substances of the medium as a primary energy source. The kinetics of sulfide compounds removal by means of anaerobic microbiological method was considered. The effectiveness of wastewater treatment with changing purification process conditions has been also assessed (concentration of sulfides, reactor type, p

  20. Fermentation optimization of goat milk with Lactobacillus acidophilus and Bifidobacterium bifidum by Box-Behnken design.

    Science.gov (United States)

    Shu, Guowei; Bao, Chunju; Chen, He; Wang, Changfeng; Yang, Hui

    2016-01-01

    Goat milk is only limited to the processing of goat milk powder and liquid milk, the products are mainly about milk powder and a few of them are made as milk tablet. Therefore, the study of probiotic goat milk will have great significance in the full use of goats and the development of the goat milk industry in China. The effect of fermentation temperature (35°C, 37°C, 39°C), strain ratio (1:1:1, 2:1:1, 3:1:1) and inoculum size (4%, 5%, 6%) on viable counts of L. acidophilus and B. bifidum, total bacteria and sensory value during fermentation process of L. acidophilus and B. bifidum goat yogurt (AB-goat yogurt) was investigated. The optimum fermentation conditions for AB-goat yogurt were: fermentation temperature 38°C, the strain ratio 2:1:1, inoculum size 6%. Under the optimum conditions, the viable counts of B. bifidum, L. acidophilus, total bacteria and sensory value reached (4.30 ±0.11)×107  cfu/mL, (1.39 ±0.09)×108  cfu/mL, (1.82±0.06)×109  cfu/mL and 7.90 ±0.14, respectively. The fermentation temperature, the strain ratio and inoculum size had a significant effect on the fermentation of AB-goat yogurt and these results are beneficial for developing AB-goat yogurt.

  1. In vitro assessment of photocatalytic titanium oxide surface modified stainless steel orthodontic brackets for antiadherent and antibacterial properties against Lactobacillus acidophilus.

    Science.gov (United States)

    Shah, Alok Girish; Shetty, Pradeep Chandra; Ramachandra, C S; Bhat, N Sham; Laxmikanth, S M

    2011-11-01

    To assess the antiadherent and antibacterial properties of surface modified stainless steel orthodontic brackets with photocatalytic titanium oxide (TiO(2)) against Lactobacillus acidophilus. This study was done on 120 specimens of stainless steel preadjusted edgewise appliance (PEA) orthodontic brackets. The specimens were divided into four test groups. Each group consisted of 30 specimens. Groups containing uncoated brackets acted as a control group for their respective experimental group containing coated brackets. Surface modification of brackets was carried out by the radiofrequency (RF) magnetron sputtering method with photocatalytic TiO(2). Brackets then were subjected to microbiological tests for assessment of the antiadherent and antibacterial properties of photocatalytic TiO(2) coating against L acidophilus. Orthodontic brackets coated with photocatalytic TiO(2) showed an antiadherent effect against L acidophilus compared with uncoated brackets. The bacterial mass that was bound to the TiO(2)-coated brackets was less when compared with the uncoated brackets. Furthermore, TiO(2)-coated brackets had a bactericidal effect on L acidophilus, which causes dental caries. Surface modification of orthodontic brackets with photocatalytic TiO(2) can be used to prevent the accumulation of dental plaque and the development of dental caries during orthodontic treatment.

  2. Effect of oil pollution on pattern and functions of soil microbiosensors

    International Nuclear Information System (INIS)

    Talibli, A.K.; Mamedova, I.S.; Mamedyarov, M.A.

    2002-01-01

    Full text : The soil polluted by oil and petroleum creates severe social and ecological problem. The solution of indicated problem is requires the development and intrusion of modern progressive technology. Most perspective in this sense can be clearing the oil-polluted soils with usage of activity of microorganisms. The modern level of learning of microorganisms oxidizing oil hydrocarbon testifies to a capability of creation of the non-polluting, economically effective biotechnological schemes. It was established by our researches that in oil polluted soils of Absheron peninsula alongside with hydrocarbon oxidizing bacteria it is finding everywhere lithotrophic bacteria of cycle of sulfur - representatives of sulfate-reducing and bacteria of genus Thiobacillus. It was established that the soil polluted by heavy tarry oil renders negative influencing on development of microorganisms

  3. Acidophiles of saline water at thermal vents of Vulcano, Italy.

    Science.gov (United States)

    Simmons, Susan; Norris, R

    2002-06-01

    DNA was extracted from samples taken from close to acidic hydrothermal vents on shore of the Aeolian Island of Vulcano (Italy). RNA gene sequences were amplified by PCR, cloned, and sequenced. A sequence with an origin in samples at 35 degrees and 45 degrees C corresponded to that of a novel Acidithiobacillus species that was isolated from water close to the vents. Novel, iron-oxidizing mesophilic acidophiles were isolated through enrichment cultures with ferrous iron but were not represented in the clone banks of environmental rDNA. These acidophiles were related to Thiobacillus prosperus, which was isolated previously from Vulcano. The archaeal sequences that comprised a clone bank representing a high-temperature sample (75 degrees C) corresponded to those of Acidianus brierleyi and of thermophiles previously isolated from Vulcano, Thermoplasma volcanium and Acidianus infernus.

  4. Activity of passion fruit (Passiflora edulis and guava (Psidium guajava pulps on Lactobacillus acidophilus in refrigerated mousses Atividade das polpas de maracujá (Passiflora edulis e goiaba (Psidium guajava sobre Lactobacillus acidophilus em musses refrigeradas

    Directory of Open Access Journals (Sweden)

    Flávia C. A. Buriti

    2007-06-01

    Full Text Available Five pilot-scale mousse-making trials were produced and supplemented with Lactobacillus acidophilus La-5 probiotic culture: M1 with passion fruit concentrated juice (PJ; M2 with PJ and prebiotic fibre inulin; M3 with frozen passion fruit pulp (PP; M4 with frozen guava pulp (GP; M5 with GP and lactic acid. The products were stored refrigerated (4ºC and M2 and M5 were also stored frozen (-18ºC. Viability of L. acidophilus decreased up to 4.7 log cfu.g-1 in the 21st day for refrigerated mousses containing passion fruit (M1, M2 and M3, whereas the probiotic population remained above 6 log cfu.g-1 in the mousses containing guava (M4 and M5. Inhibition due to acidity was discharged. The addition of fruits to probiotic products should be carefully planned because inhibition of probiotic strains might occur.Cinco musses foram produzidas em escala piloto e suplementadas com a cultura probiótica de Lactobacillus acidophilus La-5: M1 - com suco concentrado de maracujá (SM; M2 - com SM e fibra prebiótica inulina; M3 - com polpa congelada de maracujá (PM; M4 - com polpa congelada de goiaba (PG; M5 - com PG e ácido lático. Os produtos foram armazenados refrigerados (4ºC e M2 e M5 também congelados (-18ºC. A viabilidade de Lactobacillus acidophilus diminuiu em até 4,7 log ufc.g-1 ao 21º dia nas musses contendo maracujá (M1, M3 e M2, enquanto a população do probiótico permaneceu acima de 6 log ufc.g-1 naquelas contendo goiaba (M4 e M5. A inibição devido à acidez foi descartada. A adição de frutas aos produtos probióticos deve ser cuidadosamente planejada, uma vez que pode haver inibição das cepas probióticas.

  5. Some low homogenization pressures improve certain probiotic characteristics of yogurt culture bacteria and Lactobacillus acidophilus LA-K.

    Science.gov (United States)

    Muramalla, T; Aryana, K J

    2011-08-01

    Lactobacillus delbrueckii ssp. bulgaricus, Streptococcus salivarius ssp. thermophilus, and Lactobacillus acidophilus are dairy cultures widely used in the manufacture of cultured dairy products. Commonly used homogenization pressures in the dairy industry are 13.80 MPa or less. It is not known whether low homogenization pressures can stimulate bacteria to improve their probiotic characteristics. Objectives were to determine the effect of homogenization at 0, 3.45, 6.90, 10.34, and 13.80 MPa on acid tolerance, bile tolerance, protease activity, and growth of L. delbrueckii ssp. bulgaricus LB-12, S. salivarius ssp. thermophilus ST-M5, and L. acidophilus LA-K. The cultures were individually inoculated in cool autoclaved skim milk (4°C) and homogenized for 5 continuous passes. Growth and bile tolerance of samples were determined hourly for 10h of incubation. Acid tolerance was determined every 20 min for 120 min of incubation. Protease activity was determined at 0, 12, and 24h of incubation. All homogenization pressures studied improved acid tolerance of L. delbrueckii ssp. bulgaricus LB-12 but had no beneficial effect on protease activity and had negative effects on growth and bile tolerance. A pressure of 6.90 MPa improved acid tolerance, bile tolerance, and protease activity of S. salivarius ssp. thermophilus ST-M5, but none of the homogenization pressures studied had an effect on its growth. Homogenization pressures of 13.80 and 6.90 MPa improved acid tolerance and bile tolerance, respectively, of L. acidophilus LA-K but had no effect on protease activity and its growth. Some low homogenization pressures positively influenced some characteristics of yogurt culture bacteria and L. acidophilus LA-K. Culture pretreatment with some low homogenization pressures can be recommended for improvement of certain probiotic characteristics. Copyright © 2011 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  6. Data regarding the growth of Lactobacillus acidophilus NCFM on different carbohydrates and recombinant production of elongation factor G and pyruvate kinase

    Directory of Open Access Journals (Sweden)

    Hasan Ufuk Celebioglu

    2017-10-01

    Full Text Available The present study describes the growth of the very well-known probiotic bacterium Lactobacillus acidophilus NCFM on different carbohydrates. Furthermore, recombinant production of putative moonlighting proteins elongation factor G and pyruvate kinase from this bacterium is described. For further and detailed interpretation of the data presented here, please see the research article “Mucin- and carbohydrate-stimulated adhesion and subproteome changes of the probiotic bacterium Lactobacillus acidophilus NCFM” (Celebioglu et al., 2017 [1].

  7. Two-dimensional gel-based alkaline proteome of the probiotic bacterium Lactobacillus acidophilus NCFM

    DEFF Research Database (Denmark)

    Majumder, Avishek; Cai, Liyang; Ejby, Morten

    2012-01-01

    Lactobacillus acidophilus NCFM (NCFM) is a well‐documented probiotic bacterium isolated from human gut. Detailed 2D gel‐based NCFM proteomics addressed the so‐called alkaline range, i.e., pH 6–11. Proteins were identified in 150 of the 202 spots picked from the Coomassie Brilliant Blue stained 2D...

  8. Characterization of a lactose-responsive promoter of ATP-binding cassette (ABC) transporter gene from Lactobacillus acidophilus 05-172.

    Science.gov (United States)

    Zeng, Zhu; Zuo, Fanglei; Yu, Rui; Zhang, Bo; Ma, Huiqin; Chen, Shangwu

    2017-09-01

    A novel lactose-responsive promoter of the ATP-binding cassette (ABC) transporter gene Lba1680 of Lactobacillus acidophilus strain 05-172 isolated from a traditionally fermented dairy product koumiss was characterized. In L. acidophilus 05-172, expression of Lba1680 was induced by lactose, with lactose-induced transcription of Lba1680 being 6.1-fold higher than that induced by glucose. This is in contrast to L. acidophilus NCFM, a strain isolated from human feces, in which expression of Lba1680 and Lba1679 is induced by glucose. Both gene expression and enzyme activity assays in L. paracasei transformed with a vector containing the inducible Lba1680 promoter (PLba1680) of strain 05-172 and a heme-dependent catalase gene as reporter confirmed that PLba1680 is specifically induced by lactose. Its regulatory expression could not be repressed by glucose, and was independent of cAMP receptor protein. This lactose-responsive promoter might be used in the expression of functional genes in L. paracasei incorporated into a lactose-rich environment, such as dairy products. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  9. Viability of probiotic (Bifidobacterium, Lactobacillus acidophilus and Lactobacillus casei) and nonprobiotic microflora in Argentinian Fresco cheese.

    Science.gov (United States)

    Vinderola, C G; Prosello, W; Ghiberto, T D; Reinheimer, J A

    2000-09-01

    We evaluated the suitability of Argentinian Fresco cheese as a food carrier of probiotic cultures. We used cultures of Bifidobacterium bifidum (two strains), Bifidobacterium longum (two strains), Bifidobacterium sp. (one strain), Lactobacillus acidophilus (two strains), and Lactobacillus casei (two strains) in different combinations, as probiotic adjuncts. Probiotic, lactic starter (Lactococcus lactis and Streptococcus thermophilus), and contaminant (coliforms, yeasts, and molds) organisms were counted at 0, 30, and 60 d of refrigerated storage. Furthermore, the acid resistance of probiotic and starter bacteria was determined from hydrochloric solutions (pH 2 and 3) of Fresco cheese. The results showed that nine different combinations of bifidobacteria and L. acidophilus had a satisfactory viability (count decreases in 60 d casei cultures assayed also showed a satisfactory survival (counts decreased casei). On the other hand, the three combinations of bifidobacteria, L. acidophilus, and L. casei tested adapted well to the Fresco cheese environment. When a cheese homogenate at pH 3 was used to partially simulate the acidic conditions in the stomach, the probiotic cultures had an excellent ability to remain viable up to 3 h. At pH 2, the cell viability was more affected; B. bifidum was the most resistant organism. This study showed that the Argentinian Fresco cheese could be used as an adequate carrier of probiotic bacteria.

  10. Viability of Lactobacillus acidophilus in synbiotic guava mousses and its survival under in vitro simulated gastrointestinal conditions.

    Science.gov (United States)

    Buriti, Flávia C A; Castro, Inar A; Saad, Susana M I

    2010-02-28

    The effects of refrigeration, freezing and substitution of milk fat by inulin and whey protein concentrate (WPC) on Lactobacillus acidophilus La-5 viability and resistance to gastric and enteric simulated conditions in synbiotic guava mousses effects were investigated. Refrigerated mousses supplemented with WPC presented the best probiotic viability, ranging from 7.77 to 6.24 log cfu/g during 28 days of storage. The highest probiotic populations, above 7.45 log cfu/g, were observed for all frozen mousses during 112 days of storage. Decreased L. acidophilus survival during the in vitro gastrointestinal simulation was observed both for refrigerated and frozen mousses. Nonetheless, for the refrigerated mousses, the addition of inulin enhanced the probiotic survival during the in vitro assays in the first week of storage. L. acidophilus survival in simulated gastrointestinal fluids was also improved through freezing. The frozen storage may be used to provide increased shelf-life for synbiotic guava mousses. Even though the protective effect of inulin and WPC on the probiotic microorganism tested was shown to be more specific for the refrigerated products, the partial replacement of milk fat by these ingredients may also help, as it improves the nutritional value of mousses in both storage conditions. (c) 2009 Elsevier B.V. All rights reserved.

  11. Transcriptional analysis of prebiotic uptake and catabolism by Lactobacillus acidophilus NCFM.

    Directory of Open Access Journals (Sweden)

    Joakim Mark Andersen

    Full Text Available The human gastrointestinal tract can be positively modulated by dietary supplementation of probiotic bacteria in combination with prebiotic carbohydrates. Here differential transcriptomics and functional genomics were used to identify genes in Lactobacillus acidophilus NCFM involved in the uptake and catabolism of 11 potential prebiotic compounds consisting of α- and β-linked galactosides and glucosides. These oligosaccharides induced genes encoding phosphoenolpyruvate-dependent sugar phosphotransferase systems (PTS, galactoside pentose hexuronide (GPH permease, and ATP-binding cassette (ABC transporters. PTS systems were upregulated primarily by di- and tri-saccharides such as cellobiose, isomaltose, isomaltulose, panose and gentiobiose, while ABC transporters were upregulated by raffinose, Polydextrose, and stachyose. A single GPH transporter was induced by lactitol and galactooligosaccharides (GOS. The various transporters were associated with a number of glycoside hydrolases from families 1, 2, 4, 13, 32, 36, 42, and 65, involved in the catabolism of various α- and β-linked glucosides and galactosides. Further subfamily specialization was also observed for different PTS-associated GH1 6-phospho-β-glucosidases implicated in the catabolism of gentiobiose and cellobiose. These findings highlight the broad oligosaccharide metabolic repertoire of L. acidophilus NCFM and establish a platform for selection and screening of both probiotic bacteria and prebiotic compounds that may positively influence the gastrointestinal microbiota.

  12. Effect of Low Shear Modeled Microgravity (LSMMG) on the Probiotic Lactobacillus Acidophilus ATCC 4356

    Science.gov (United States)

    Stahl, S.; Voorhies, A.; Lorenzi, H.; Castro-Wallace, S.; Douglas, G.

    2016-01-01

    The introduction of generally recognized as safe (GRAS) probiotic microbes into the spaceflight food system has the potential for use as a safe, non-invasive, daily countermeasure to crew microbiome and immune dysregulation. However, the microgravity effects on the stress tolerances and genetic expression of probiotic bacteria must be determined to confirm translation of strain benefits and to identify potential for optimization of growth, survival, and strain selection for spaceflight. The work presented here demonstrates the translation of characteristics of a GRAS probiotic bacteria to a microgravity analog environment. Lactobacillus acidophilus ATCC 4356 was grown in the low shear modeled microgravity (LSMMG) orientation and the control orientation in the rotating wall vessel (RWV) to determine the effect of LSMMG on the growth, survival through stress challenge, and gene expression of the strain. No differences were observed between the LSMMG and control grown L. acidophilus, suggesting that the strain will behave similarly in spaceflight and may be expected to confer Earth-based benefits.

  13. An Extracellular Cell-Attached Pullulanase Confers Branched α-Glucan Utilization in Human Gut Lactobacillus acidophilus.

    Science.gov (United States)

    Møller, Marie S; Goh, Yong Jun; Rasmussen, Kasper Bøwig; Cypryk, Wojciech; Celebioglu, Hasan Ufuk; Klaenhammer, Todd R; Svensson, Birte; Abou Hachem, Maher

    2017-06-15

    Of the few predicted extracellular glycan-active enzymes, glycoside hydrolase family 13 subfamily 14 (GH13_14) pullulanases are the most common in human gut lactobacilli. These enzymes share a unique modular organization, not observed in other bacteria, featuring a catalytic module, two starch binding modules, a domain of unknown function, and a C-terminal surface layer association protein (SLAP) domain. Here, we explore the specificity of a representative of this group of pullulanases, Lactobacillus acidophilus Pul13_14 ( La Pul13_14), and its role in branched α-glucan metabolism in the well-characterized Lactobacillus acidophilus NCFM, which is widely used as a probiotic. Growth experiments with L. acidophilus NCFM on starch-derived branched substrates revealed a preference for α-glucans with short branches of about two to three glucosyl moieties over amylopectin with longer branches. Cell-attached debranching activity was measurable in the presence of α-glucans but was repressed by glucose. The debranching activity is conferred exclusively by La Pul13_14 and is abolished in a mutant strain lacking a functional La Pul13_14 gene. Hydrolysis kinetics of recombinant La Pul13_14 confirmed the preference for short-branched α-glucan oligomers consistent with the growth data. Curiously, this enzyme displayed the highest catalytic efficiency and the lowest K m reported for a pullulanase. Inhibition kinetics revealed mixed inhibition by β-cyclodextrin, suggesting the presence of additional glucan binding sites besides the active site of the enzyme, which may contribute to the unprecedented substrate affinity. The enzyme also displays high thermostability and higher activity in the acidic pH range, reflecting adaptation to the physiologically challenging conditions in the human gut. IMPORTANCE Starch is one of the most abundant glycans in the human diet. Branched α-1,6-glucans in dietary starch and glycogen are nondegradable by human enzymes and constitute a

  14. Effects of Lactobacillus acidophilus NCFM on insulin sensitivity and the systemic inflammatory response in human subjects

    DEFF Research Database (Denmark)

    Andreasen, Anne Sofie; Larsen, Nadja; Pedersen-Skovsgaard, Theis

    2010-01-01

    According to animal studies, intake of probiotic bacteria may improve glucose homeostasis. We hypothesised that probiotic bacteria improve insulin sensitivity by attenuating systemic inflammation. Therefore, the effects of oral supplementation with the probiotic bacterium Lactobacillus acidophilus...

  15. Viability of commercial probiotic cultures (L. acidophilus, Bifidobacterium sp., L. casei, L. paracasei and L. rhamnosus) in cheddar cheese.

    Science.gov (United States)

    Phillips, Michael; Kailasapathy, Kasipathy; Tran, Lai

    2006-04-25

    Six batches of cheddar cheese were manufactured containing different combinations of commercially available probiotic cultures from three suppliers. Duplicate cheeses contained the organisms of each supplier, a Bifidobacterium spp. (each supplier), a Lactobacillus acidophilus (2 suppliers), and either Lactobacillus casei, Lactobacillus paracasei, or Lactobacillus rhamnosus. Using selective media, the different strains were assessed for viability during cheddar cheese maturation over 32 weeks. The Bifidobacterium sp. remained at high numbers with the three strains being present in cheese at 4 x 10(7), 1.4 x 10(8), and 5 x 10(8) CFU/g after 32 weeks. Similarly the L. casei (2 x 10(7) CFU/g), L. paracasei (1.6 x 10(7) CFU/g), and L. rhamnosus (9 x 10(8) CFU/g) strains survived well; however, the L. acidophilus strains performed poorly with both decreasing in a similar manner to be present at 3.6 x 10(3) CFU/g and 4.9 x 10(3) CFU/g after 32 weeks. This study indicates that cheddar cheese is a good vehicle for a variety of commercial probiotics but survival of L. acidophilus strains will need to be improved.

  16. Definition of a concrete bio-decontamination process in nuclear substructures; Biodegradation de matrices cimentaires en vue de leur decontamination

    Energy Technology Data Exchange (ETDEWEB)

    Jestin, A

    2005-05-15

    The decontamination of sub-structural materials represents a stake of high-importance because of the high volume generated. It is agreed then to propose efficient and effective processes. The process of bio-decontamination of the hydraulic binders leans on the mechanisms of biodegradation of concretes, phenomenon characterized in the 40's by an indirect attack of the material by acids stem from the microbial metabolism: sulphuric acid (produced by Thiobacillus), nitric acid (produced by Nitrosomonas and Nitrobacter) and organic acids (produced by fungi). The principle of the bio-decontamination process is to apply those micro-organisms on the surface of the contaminated material, in order to damage its surface and to retrieve the radionuclides. One of the multiple approaches of the process is the use of a bio-gel that makes possible the micro-organisms application. (author)

  17. Biodegradation of concrete intended for their decontamination; Biodegradation de matrices cimentaires en vue de leur decontamination

    Energy Technology Data Exchange (ETDEWEB)

    Jestin, A

    2005-05-15

    The decontamination of sub-structural materials represents a stake of high importance because of the high volume generated. It is agreed then to propose efficient and effective processes. The process of bio-decontamination of the hydraulic binders leans on the mechanisms of biodegradation of concretes, phenomenon characterized in the 40's by an indirect attack of the material by acids stem from the microbial metabolism: sulphuric acid (produced by Thiobacillus), nitric acid (produced by Nitrosomonas and Nitrobacter) and organic acids (produced by fungi). The principle of the bio-decontamination process is to apply those microorganisms on the surface of the contaminated material, in order to damage its surface and to retrieve the radionuclides. One of the multiple approaches of the process is the use of a bio-gel that makes possible the micro-organisms application. (author)

  18. Heap leaching for uranium

    International Nuclear Information System (INIS)

    1988-01-01

    Denison Mines Ltd. is using two bacterial leaching processes to combat the high cost of extracting uranium from low grade ore in thin reefs. Both processes use thiobacillus ferro-oxidans, a bacterium that employs the oxidation of ferrous iron and sulphur as its source of energy for growth. The first method is flood leaching, in which ore is subjected to successive flood, drain and rest cycles. The second, trickle leaching, uses sprinklers to douse the broken muck continuously with leaching solution. In areas where grades are too low to justify the expense of hauling the ore to the surface, the company is using this biological process underground to recover uranium. In 1987 Denison recovered 840 000 lb of uranium through bacterial heap leaching. It plans to have biological in-place leaching contribute 25% of the total uranium production by 1990. (fig.)

  19. Definition of a concrete bio-decontamination process in nuclear substructures

    International Nuclear Information System (INIS)

    Jestin, A.

    2005-05-01

    The decontamination of sub-structural materials represents a stake of high-importance because of the high volume generated. It is agreed then to propose efficient and effective processes. The process of bio-decontamination of the hydraulic binders leans on the mechanisms of biodegradation of concretes, phenomenon characterized in the 40's by an indirect attack of the material by acids stem from the microbial metabolism: sulphuric acid (produced by Thiobacillus), nitric acid (produced by Nitrosomonas and Nitrobacter) and organic acids (produced by fungi). The principle of the bio-decontamination process is to apply those micro-organisms on the surface of the contaminated material, in order to damage its surface and to retrieve the radionuclides. One of the multiple approaches of the process is the use of a bio-gel that makes possible the micro-organisms application. (author)

  20. Biodegradation of concrete intended for their decontamination

    International Nuclear Information System (INIS)

    Jestin, A.

    2005-05-01

    The decontamination of sub-structural materials represents a stake of high importance because of the high volume generated. It is agreed then to propose efficient and effective processes. The process of bio-decontamination of the hydraulic binders leans on the mechanisms of biodegradation of concretes, phenomenon characterized in the 40's by an indirect attack of the material by acids stem from the microbial metabolism: sulphuric acid (produced by Thiobacillus), nitric acid (produced by Nitrosomonas and Nitrobacter) and organic acids (produced by fungi). The principle of the bio-decontamination process is to apply those microorganisms on the surface of the contaminated material, in order to damage its surface and to retrieve the radionuclides. One of the multiple approaches of the process is the use of a bio-gel that makes possible the micro-organisms application. (author)

  1. Microbial detoxification of waste rubber material by wood-rotting fungi.

    Science.gov (United States)

    Bredberg, Katarina; Andersson, B Erik; Landfors, Eva; Holst, Olle

    2002-07-01

    The extensive use of rubber products, mainly tires, and the difficulties to recycle those products, has resulted in world wide environmental problems. Microbial devulcanisation is a promising way to increase the recycling of rubber materials. One obstacle is that several microorganisms tested for devulcanisation are sensitive to rubber additives. A way to overcome this might be to detoxify the rubber material with fungi prior to the devulcanisation. In this study, 15 species of white-rot and brown-rot fungi have been screened with regard to their capacity to degrade an aromatic model compound in the presence of ground waste tire rubber. The most effective fungus, Resinicium bicolor, was used for detoxification of rubber material. Increase in growth of the desulfurising bacterium Thiobacillus ferrooxidans in presence of the rubber treated with Resinicium bicolor compared to untreated rubber demonstrated that detoxification with fungi is possible.

  2. Eruca sativa Might Influence the Growth, Survival under Simulated Gastrointestinal Conditions and Some Biological Features of Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus Strains

    OpenAIRE

    Fratianni, Florinda; Pepe, Selenia; Cardinale, Federica; Granese, Tiziana; Cozzolino, Autilia; Coppola, Raffaele; Nazzaro, Filomena

    2014-01-01

    The growth and viability of three Lactobacillus strains, Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus, after their passage through simulated gastric and pancreatic juices were studied as a function of their presence in the growth medium of rocket salad (Eruca sativa). The presence of E. sativa affected some of the biological properties of the strains. For example, L. acidophilus and L. plantarum worked more efficiently in the presence of E. sativa, increasing...

  3. Astragalus root and elderberry fruit extracts enhance the IFN-ß stimulatory effects of Lactobacillus acidophilus in murine-derived dendritic cells

    DEFF Research Database (Denmark)

    Frøkiær, Hanne; Henningsen, Louise; Metzdorff, Stine Broeng

    2012-01-01

    Many foods and food components boost the immune system, but little data are available regarding the mechanisms by which they do. Bacterial strains have disparate effects in stimulating the immune system. In dendritic cells, the gram-negative bacteria Escherichia coli upregulates proinflammatory......-ß and other cytokines were measured by ELISA and RT-PCR. Endocytosis of fluorescence-labeled dextran and L. acidophilus in the presence of elderberry fruit or astragalus root extract was evaluated in dendritic cells. Our results show that both extracts enhanced L. acidophilus-induced IFN-ß production...

  4. Selection of the Strain Lactobacillus acidophilus ATCC 43121 and Its Application to Brewers' Spent Grain Conversion into Lactic Acid

    Science.gov (United States)

    Liguori, Rossana; Soccol, Carlos Ricardo; Vandenberghe, Luciana Porto de Souza; Woiciechowski, Adenise Lorenci; Ionata, Elena; Marcolongo, Loredana; Faraco, Vincenza

    2015-01-01

    Six Lactobacillus strains were analyzed to select a bacterium for conversion of brewers' spent grain (BSG) into lactic acid. Among the investigated strains, L. acidophilus ATCC 43121 showed the highest yield of lactic acid production (16.1 g/L after 48 hours) when grown in a synthetic medium. It was then analyzed for its ability to grow on the hydrolysates obtained from BSG after acid-alkaline (AAT) or aqueous ammonia soaking (AAS) pretreatment. The lactic acid production by L. acidophilus ATCC 43121 through fermentation of the hydrolysate from AAS treated BSG was 96% higher than that from the AAT treated one, although similar yields of lactic acid per consumed glucose were achieved due to a higher (46%) glucose consumption by L. acidophilus ATCC 43121 in the AAS BSG hydrolysate. It is worth noting that adding yeast extract to the BSG hydrolysates increased both the yield of lactic acid per substrate consumed and the volumetric productivity. The best results were obtained by fermentation of AAS BSG hydrolysate supplemented by yeast extract, in which the strain produced 22.16 g/L of lactic acid (yield of 0.61 g/g), 27% higher than the value (17.49 g/L) obtained in the absence of a nitrogen source. PMID:26640784

  5. Kualitas Mikrobiologis dan Kimiawi Kefir Susu Kambing dengan Penambahan Lactobacillus acidophilus FNCC 0051 dan Tepung Kulit Pisang Kepok (Musa Paradisiaca

    Directory of Open Access Journals (Sweden)

    Dwitiya Martharini

    2017-03-01

    Full Text Available This experiment was carried out to investigate the effect of  plantain peel flour and Lactobacillus acidophilus FNCC 0051 on the microbiological and chemical quality of goat milk kefir. Kefir was made from goat’s milk with 3 % of kefir grain (w/v and  Lactobacillus acidophilus FNCC 0051 (0, 1 and 3 % (v/v and  plantain peel flour (0, 1 and 2 % (w/v. All treatments were  incubated at room temperature (± 28.5 °C for 10 hours, until the pH dropped to 4.2-4.6.The quality of Kefir was evaluated by  microbiological analysis (total of lactic acid bacteria, probiotics  viability, total yeast and chemical analysis (pH, lactose content,  alcohol content, fat content and dietary fiber. The data of total lactic acid bacteria, probiotics viability, total yeast, pH, lactose  content, alcohol content, fat content were evaluated by analysis of variance and followed by Duncan’s New Multiple Range Test  (DMRT. Data of dietary fiber was evaluated by descriptive analysis. The research result showed that the addition of  Lactobacillus acidophilus FNCC 0051 had a significant effect (p ≤  0.05 on decreasing pH, alcohol content and increasing total lactic  acid bacteria and probiotic viability. Plantain peel flour had  significantl effect (p ≤ 0.05 on increasing alcohol content and  total lactic acid bacteria. Kefir had 9.51 log cfu mL-1 of lactic acid  bacteria total; 8.65 log cfu mL-1 of probiotic viability; 6.13 log cfu  mL-1 of total yeast; 4.85 of pH; 3.14 % of lactose content; 0.096 % of alcohol content; 5.33 % of fat content; and 10.49 % of dietary fiber. This research concluded that kefir quality for all  treatments kefir were complied with Codex Standard 234-2003  while the best treatment was the kefir with the addition of 3 %  Lactobacillus acidophilus FNCC 0051 and 1 % flour banana peel.   ABSTRAK Penelitian ini bertujuan untuk mengetahui pengaruh penambahan tepung kulit pisang dan Lactobacillus acidophilus FNCC 0051  terhadap

  6. A mild pulsed electric field condition that improves acid tolerance, growth, and protease activity of Lactobacillus acidophilus LA-K and Lactobacillus delbrueckii subspecies bulgaricus LB-12.

    Science.gov (United States)

    Najim, N; Aryana, Kayanush J

    2013-06-01

    Pulsed electric field (PEF) processing involves the application of pulses of voltage for less than 1 s to fluid products placed between 2 electrodes. The effect of mild PEF on beneficial characteristics of probiotic bacteria Lactobacillus acidophilus and Lactobacillus delbrueckii ssp. bulgaricus is not clearly understood. The objective of this study was to determine the influence of mild PEF conditions on acid tolerance, growth, and protease activity of Lb. acidophilus LA-K and Lactobacillus delbrueckii ssp. bulgaricus LB-12. A pilot plant PEF system (OSU-4M; The Ohio State University, Columbus) was used. The PEF treatments were positive square unipolar pulse width of 3 µs, pulse period of 0.5s, electric field strength of 1 kV/cm, delay time of 20 µs, flow rate of 60 mL/min, and 40.5°C PEF treatment temperature. Both Lb. acidophilus LA-K and Lb. bulgaricus LB-12 subjected to mild PEF conditions were acid tolerant until the end of the 120 min of incubation, unlike the Lb. bulgaricus control, which was not acid tolerant after 30 min. The mild PEF-treated Lb. acidophilus LA-K and Lb. bulgaricus LB-12 reached the logarithmic phase of growth an hour earlier than the control. Mild PEF conditions studied significantly improved acid tolerance, exponential growth, and protease activity of both Lb. acidophilus LA-K and Lb. bulgaricus LB-12 compared with the control. The mild PEF conditions studied can be recommended for pretreating cultures to enhance these desirable attributes. Copyright © 2013 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  7. The hsp 16 Gene of the Probiotic Lactobacillus acidophilus Is Differently Regulated by Salt, High Temperature and Acidic Stresses, as Revealed by Reverse Transcription Quantitative PCR (qRT-PCR Analysis

    Directory of Open Access Journals (Sweden)

    Daniela Fiocco

    2011-08-01

    Full Text Available Small heat shock proteins (sHsps are ubiquitous conserved chaperone-like proteins involved in cellular proteins protection under stressful conditions. In this study, a reverse transcription quantitative PCR (RT-qPCR procedure was developed and used to quantify the transcript level of a small heat shock gene (shs in the probiotic bacterium Lactobacillus acidophilus NCFM, under stress conditions such as heat (45 °C and 53 °C, bile (0.3% w/v, hyperosmosis (1 M and 2.5 M NaCl, and low pH value (pH 4. The shs gene of L. acidophilus NCFM was induced by salt, high temperature and acidic stress, while repression was observed upon bile stress. Analysis of the 5' noncoding region of the hsp16 gene reveals the presence of an inverted repeat (IR sequence (TTAGCACTC-N9-GAGTGCTAA homologue to the controlling IR of chaperone expression (CIRCE elements found in the upstream regulatory region of Gram-positive heat shock operons, suggesting that the hsp16 gene of L. acidophilus might be transcriptionally controlled by HrcA. In addition, the alignment of several small heat shock proteins identified so far in lactic acid bacteria, reveals that the Hsp16 of L. acidophilus exhibits a strong evolutionary relationship with members of the Lactobacillus acidophilus group.

  8. Physicochemical and hygienic effects of Lactobacillus acidophilus in Iranian white cheese

    Directory of Open Access Journals (Sweden)

    Razzaqh Mahmoudi

    2012-09-01

    Full Text Available Increasing incidence of food-borne disease along with its social and economic consequences have led to conducting extensive research in order to produce safer food and develop new antimicrobial agents; among them, extensive use of probiotics and bacteriocins as biological additives is of significant importance. The aim of the present study was to evaluate the interactions (growth behavior and survival of Listeria monocytogenes and Lactobacillus acidophilus in various stages of production, ripening and storage of Iranian white cheese. Changes in pH values at different stages of cheese ripening, along with changes in organoleptic properties of cheese were also assessed. Compared to other treatments, in the treatment of cheese with probiotic agent without starter, the most significant decrease in Listeria monocytogenes count at the end of ripening stage was observed (3.16 Log per gram cheese compared with the control group (p < 0.05. Survival of probiotic bacteria in control samples of cheese were significantly higher when compared to cheese sample contaminated with Listeria (p < 0.05. White probiotic cheese with starter had the highest of sensory acceptability (p < 0.05. Listeria Monocytogenes count decreased during ripening period of probiotic white cheese but the bacteria survived in probiotic white cheese. Lactobacillus acidophilus count decreased during ripening period of white cheese but it did not lower to less than 106 CFU per g at the end of ripening and storage periods.

  9. Proteome reference map of Lactobacillus acidophilus NCFM and quantitative proteomics towards understanding the prebiotic action of lactitol

    DEFF Research Database (Denmark)

    Majumder, Avishek; Sultan, Abida; Jersie-Christensen, Rosa Rakownikow

    2011-01-01

    subunit, galactokinase, galactose‐1‐phosphate uridylyltransferase and UDP‐glucose‐4‐epimerase, which all are potentially involved in lactitol metabolism. This first comprehensive proteome analysis of L. acidophilus NCFM provides insights into protein abundance changes elicited by the prebiotic lactitol....

  10. Discrimination of the Lactobacillus acidophilus group using sequencing, species-specific PCR and SNaPshot mini-sequencing technology based on the recA gene.

    Science.gov (United States)

    Huang, Chien-Hsun; Chang, Mu-Tzu; Huang, Mu-Chiou; Wang, Li-Tin; Huang, Lina; Lee, Fwu-Ling

    2012-10-01

    To clearly identify specific species and subspecies of the Lactobacillus acidophilus group using phenotypic and genotypic (16S rDNA sequence analysis) techniques alone is difficult. The aim of this study was to use the recA gene for species discrimination in the L. acidophilus group, as well as to develop a species-specific primer and single nucleotide polymorphism primer based on the recA gene sequence for species and subspecies identification. The average sequence similarity for the recA gene among type strains was 80.0%, and most members of the L. acidophilus group could be clearly distinguished. The species-specific primer was designed according to the recA gene sequencing, which was employed for polymerase chain reaction with the template DNA of Lactobacillus strains. A single 231-bp species-specific band was found only in L. delbrueckii. A SNaPshot mini-sequencing assay using recA as a target gene was also developed. The specificity of the mini-sequencing assay was evaluated using 31 strains of L. delbrueckii species and was able to unambiguously discriminate strains belonging to the subspecies L. delbrueckii subsp. bulgaricus. The phylogenetic relationships of most strains in the L. acidophilus group can be resolved using recA gene sequencing, and a novel method to identify the species and subspecies of the L. delbrueckii and L. delbrueckii subsp. bulgaricus was developed by species-specific polymerase chain reaction combined with SNaPshot mini-sequencing. Copyright © 2012 Society of Chemical Industry.

  11. Immunochemical localization of ribulose-1,5-bisphosphate carboxylase in the symbiont-containing gills of Solemya velum (Bivalvia: Mollusca).

    Science.gov (United States)

    Cavanaugh, C M; Abbott, M S; Veenhuis, M

    1988-10-01

    The distribution of the Calvin cycle enzyme ribulose-1,5-bisphosphate carboxylase (RbuP(2)Case; EC 4.1.1.39) was examined by using two immunological methods in tissues of Solemya velum, an Atlantic coast bivalve containing putative chemoautotrophic symbionts. Antibodies elicited by the purified large subunit of RbuP(2)Case from tobacco (Nicotiana tabacum) cross-reacted on immunoblots with a protein of similar molecular mass occurring in extracts of the symbiont-containing gill tissue of S. velum. No cross-reactivity was detected in symbiont-free tissue extracts. The antiserum also cross-reacted in immunoblots with proteins of Thiobacillus neapolitanus, a free-living sulfuroxidizing chemoautotroph whose RbuP(2)Case has been well characterized. In protein A-gold immunoelectron microscopy studies, this antiserum consistently labeled the symbionts but not surrounding host gill tissue, indicating that the symbionts are responsible for the RbuP(2)Case activity.

  12. Murein Hydrolase Activity in the Surface Layer of Lactobacillus acidophilus ATCC 4356▿

    OpenAIRE

    Prado Acosta, Mariano; Palomino, María Mercedes; Allievi, Mariana C.; Rivas, Carmen Sanchez; Ruzal, Sandra M.

    2008-01-01

    We describe a new enzymatic functionality for the surface layer (S-layer) of Lactobacillus acidophilus ATCC 4356, namely, an endopeptidase activity against the cell wall of Salmonella enterica serovar Newport, assayed via zymograms and identified by Western blotting. Based on amino acid sequence comparisons, the hydrolase activity was predicted to be located at the C terminus. Subsequent cloning and expression of the C-terminal domain in Bacillus subtilis resulted in the functional verificati...

  13. Elimination of Pathogen Escherichia coli O157:H7 in Ground Beef by a Newly Isolated Strain of Lactobacillus acidophilus during Storage at 5°C

    Directory of Open Access Journals (Sweden)

    Alireza Goodarzi

    2016-06-01

    Full Text Available Background and Objective: Constant use of limited number of lactic acid bacteria species in biopreservation can cause genetic degradation and or rising resistance against food pathogens or antimicrobial substances they produce. For this objective, a newly isolated strain of Lactobacillus acidophilus possessing high antimicrobial activity was evaluated as a candidate for use in biopreservation.Materials and Methods: Antibacterial activity was evaluated by agar disk diffusion method. Hydrogen peroxide amount was measured by Merckoquant Peroxide test strips. Microbiological analysis of the ground beef infected by Escherichia coli O157:H7 and treated by Lactobacillus acidophilus GH 201was done by plating of serial dilution in physiological saline on Tryptose agar.Results and Conclusion: The cells (109 CFU ml-1 of Lactobacillus acidophilus produced significant amount of antibacterial substances mainly hydrogen peroxide (28 and 30 μg ml-1 in sodium phosphate buffer (0.2 M, pH 6.5 and LAPTg at 5°C during submerged cultivation with no growth, respectively. Submerged co-cultivation of Escherichia coli O157:H7 with lactobacilli in LAPTg broth at 5°C reduced the total number of the pathogen more than 2 log for 5 days. In case of solid state cultivation on agar-based medium, the maximum inhibitory zones on Escherichia coli O157:H7 lawn around the disks soaked by different amounts of washed Lactobacillus acidophilus cells appear for one-day cold exposition. The size of inhibition zone depends on the concentration of lactic acid bacteria cells. The cell suspension intended for treatment must contain 108-9CFU ml-1 of lactic acid bacteria. Lactobacillus acidophilus reduced the initial amount (2×105 CFU ml-1 of Escherichia coli O157:H7 in ground beef up to 2 log for 5 days of solid-state co-cultivation. The application of Lactobacillus acidophilus bacteria expanded the shelf-life of ground beef due to inhibition of

  14. The quorum sensing luxS gene is induced in Lactobacillus acidophilus NCFM in response to Listeria monocytogenes

    DEFF Research Database (Denmark)

    Moslehi Jenabian, Saloomeh; Vogensen, Finn Kvist; Jespersen, Lene

    2011-01-01

    The luxS gene involved in quorum sensing has been shown to control different behaviour of probiotic lactobacilli. In this study we investigated if luxS in Lactobacillus acidophilus NCFM was up-regulated in response to Listeria monocytogenes EGD-e. The two bacterial strains were grown in mono......-killed cells of L. monocytogenes have no effect on luxS transcription. The luxS gene involved in quorum sensing has been shown to control different behaviour of probiotic lactobacilli. In this study we investigated if luxS in Lactobacillus acidophilus NCFM was up-regulated in response to Listeria monocytogenes...

  15. In vitro activity of ethanolic and water extract of guava leaves at various concentrations against Lactobacillus acidophilus

    Directory of Open Access Journals (Sweden)

    Deepika Jain

    2014-01-01

    Full Text Available Introduction: Chemical substances used for prevention of dental caries are known to have many side-effects. Thus, natural products should be explored for their anticaries action. Objectives: To prepare 5% and 20% concentrations of ethanolic and water extracts of guava leaves and to assess their activity against Lactobacillus acidophilus. Materials and Methods: In vitro experimental study was conducted in Department of Biosciences. Ethanolic and water extracts of guava leaves were prepared using Soxhlet extractor. Two concentrations 5% and 20% weight/volume of both extracts were prepared. Test organism L. acidophilus Microbial Type Culture Collection 447 was obtained in lyophillized form. After revival in nutrient broth, bacteria were grown on Lactobacilli de Man, Rogosa, Sharpe agar for further experiment. Antimicrobial testing of extracts was done using Agar well-diffusion method. Ten plates each were prepared for both extracts. Chlorhexidine (0.2% served as a positive control and distilled water as a negative control. Results: Mean zone of inhibition produced by 5% and 20% ethanolic extract was 11.2 mm and 14.1 mm respectively and by 5% and 20% water extract was 1.6 mm and 5.1 mm respectively. Statistical analysis of results using one-way ANOVA and post-hoc Tukey′s test revealed that activity of 5% ethanolic extract and 5%, 20% water extract was significantly less than that of 0.2% chlorhexidine. There was no statistical difference in efficacy of 20% ethanolic extract of guava and 0.2% chlorhexidine (P = 0.270. Conclusion: Ethanolic and water extracts of guava leaves possess antibacterial activity against L. acidophilus with 20% ethanolic extract being as efficacious as 0.2% chlorhexidine.

  16. Modulation of the Lactobacillus acidophilus La-5 lipidome by different growth conditions

    DEFF Research Database (Denmark)

    Hansen, Marie-Louise R W; Clausen, Anders; Ejsing, Christer S

    2015-01-01

    Probiotics are bacteria used in the food industry due to their potential health benefits. In this study, the plasma membrane of the probiotic Lactobacillus acidophilus La-5 was investigated using state-of-the-art high-resolution shotgun lipidomics. Comparisons of the lipidome of the plasma membrane...... (CL) and lowest proportion of monolysocardiolipin (MLCL). No significant changes were found for other lipid classes. The bacteria grown with di- and tri-unsaturated fatty acids were expected to have more unsaturated plasma membranes than bacteria grown with mono-unsaturated fatty acids. This was also...

  17. Translocação de Lactobacillus acidophilus em ratos alimentados com dieta rica em colesterol e ácido cólico suplementada com probiótico Lactobacillus acidophilus translocation in rats fed cholesterol rich diet

    Directory of Open Access Journals (Sweden)

    Dayse F. M. Coelho de Souza

    2004-12-01

    Full Text Available Lactobacillus acidophilus é um microrganismo bastante estudado e componente comum de probióticos. No entanto, ainda há pouca informação sobre a translocação deste microrganismo para órgãos do corpo. O presente trabalho visou investigar a taxa de translocação de Lactobacillus acidophilus em ratos que receberam uma dieta rica em colesterol, suplementada com um concentrado de células de L. acidophilus NCFM, visto que, o consumo deste, tem sido indicado como adjunto dietético para indivíduos hipercolesterolêmicos. Foram utilizados 130 ratos machos Wistar, com peso médio inicial de 250±32g, distribuídos em 4 grupos experimentais, sendo: Padrão, com 40 animais e Controle, LDR (Leite Desnatado Reconstituído e P (Probiótico com 30 animais cada. O grupo Padrão recebeu a dieta AIN-93G durante todo o período experimental (42dias. Os demais grupos receberam a mesma dieta acrescida de 1% de colesterol e 0,1% de ácido cólico. Durante 14 dias (do 1º ao 14º dia, o grupo LDR recebeu 0,1mL/dia/animal de leite desnatado reconstituído a 10% de sólidos não gordurosos e o grupo P, recebeu 0,1mL/dia/animal de probiótico contendo 10(10 UFC/mL de Lactobacillus acidophilus NCFM. A taxa de translocação foi monitorada no 14º, 28º e 42º dias de experimentação (tempo 0, 14 e 28 dias após o término do consumo do probiótico, respectivamente no baço, coração, fígado e rins. Nos órgãos dos animais dos grupos Padrão, Controle e LDR não foi observado crescimento de microrganismos nos tempos avaliados. Verificou-se translocação para o baço, coração, fígado e rins dos animais do grupo que recebeu probiótico (grupo P. O número de células de Lactobacillus encontrado nos órgãos foram, em UFC/órgão: baço (8,6 x 10²; fígado (4,8 x 10²; coração (4,7 x 10² e rins (1,3 x 10². Constatou-se diferença significativa (p0,05, mas ambos diferiram estatisticamente dos rins (pLactobacillus acidophilus NCFM is a strain present in

  18. Pembuatan Dan Aktivitas Antibakteri Yogurt Hasil Fermentasi Tiga Bakteri (Lactobacillus bulgaricus, Streptococcus thermophilus, Lactobacilus acidophilus

    Directory of Open Access Journals (Sweden)

    Dian S. Kamara

    2016-07-01

    Full Text Available Exploitation of synthetic antibiotics compounds not only have positive effect for human, but also have side effect that can be unfavorable, therefore many researches are being conducted to find natural antibiotics compounds that are safer. Lactic acid bacteria has the abilitytoproduce antibacterial compound when used in fermentation process.For example, Lactobacillus acidophilus produces acidophilin and acidolin. The main purpose of the present study is to investigate antibacterial activity of yogurt fermented with mixed bacterial culture of L. bulgaricus, S. thermophilus and L. acidophilus against Escherichia coli (representing Gram negative bacteria and Bacillus subtilis (representing Gram  positive bacteria. The antibacterial activity of the yogurt at three different time points (5, 7 and 9 hours were examined. We also investigate the fermentation parameters of the yogurt production. The results of the present study indicate that the crude yogurt extract has antibacterial activity, where the highest activity was observed  at 7 hour of incubation, resulting 0.35 and 0.30 cm of clear zone against E. coli and B. subtilis, respectively. It is most likely that the compound is non protein compound.

  19. Lactobacillus acidophilus induces virus immune defence genes in murine dendritic cells by a Toll-like receptor-2-dependent mechanism

    DEFF Research Database (Denmark)

    Weiss, Gudrun Margarethe; Rasmussen, Simon; Hjerrild Zeuthen, L.

    2010-01-01

    Lactobacilli are probiotics that, among other health-promoting effects, have been ascribed immunostimulating and virus-preventive properties. Certain Lactobacillus spp. have been shown to possess strong interleukin-12 (IL-12) -inducing properties. As IL-12 production depends on the up......-regulation of type I interferons (IFNs), we hypothesized that the strong IL-12-inducing capacity of Lactobacillus acidophilus NCFM in murine bone-marrow-derived dendritic cells (DCs) is caused by an up-regulation of IFN-beta, which subsequently induces IL-12 and the double-stranded RNA binding Toll-like receptor-3...... detected in another L. acidophilus strain (X37), but was not a property of other probiotic strains tested, i.e. Bifidobacterium bifidum Z9 and Escherichia coli Nissle 1917. The IFN-beta expression was markedly reduced in TLR-2(-/-) DCs, dependent on endocytosis, and the major cause of the induction of Il...

  20. AcmB Is an S-Layer-Associated β-N-Acetylglucosaminidase and Functional Autolysin in Lactobacillus acidophilus NCFM.

    Science.gov (United States)

    Johnson, Brant R; Klaenhammer, Todd R

    2016-09-15

    Autolysins, also known as peptidoglycan hydrolases, are enzymes that hydrolyze specific bonds within bacterial cell wall peptidoglycan during cell division and daughter cell separation. Within the genome of Lactobacillus acidophilus NCFM, there are 11 genes encoding proteins with peptidoglycan hydrolase catalytic domains, 9 of which are predicted to be functional. Notably, 5 of the 9 putative autolysins in L. acidophilus NCFM are S-layer-associated proteins (SLAPs) noncovalently colocalized along with the surface (S)-layer at the cell surface. One of these SLAPs, AcmB, a β-N-acetylglucosaminidase encoded by the gene lba0176 (acmB), was selected for functional analysis. In silico analysis revealed that acmB orthologs are found exclusively in S-layer- forming species of Lactobacillus Chromosomal deletion of acmB resulted in aberrant cell division, autolysis, and autoaggregation. Complementation of acmB in the ΔacmB mutant restored the wild-type phenotype, confirming the role of this SLAP in cell division. The absence of AcmB within the exoproteome had a pleiotropic effect on the extracellular proteins covalently and noncovalently bound to the peptidoglycan, which likely led to the observed decrease in the binding capacity of the ΔacmB strain for mucin and extracellular matrices fibronectin, laminin, and collagen in vitro These data suggest a functional association between the S-layer and the multiple autolysins noncovalently colocalized at the cell surface of L. acidophilus NCFM and other S-layer-producing Lactobacillus species. Lactobacillus acidophilus is one of the most widely used probiotic microbes incorporated in many dairy foods and dietary supplements. This organism produces a surface (S)-layer, which is a self-assembling crystalline array found as the outermost layer of the cell wall. The S-layer, along with colocalized associated proteins, is an important mediator of probiotic activity through intestinal adhesion and modulation of the mucosal immune

  1. Crystal Structure of α-Galactosidase from Lactobacillus acidophilus NCFM: Insight into Tetramer Formation and Substrate Binding

    DEFF Research Database (Denmark)

    Fredslund, Folmer; Abou Hachem, Maher; Larsen, Rene Jonsgaard

    2011-01-01

    structure of α-Gal from L. acidophilus NCFM (LaMel36A) of glycoside hydrolase (GH) family 36 (GH36) is determined by single-wavelength anomalous dispersion. In addition, a 1.58-Å-resolution crystallographic complex with α-d-galactose at substrate binding subsite −1 was determined. LaMel36A has a large N...

  2. The potential use of probiotic strains Lactobacillus acidophilus NRRL B 4495, Bifidobacterium bifidum NRRL B41410 in “Lor Whey Cheese” and the effects on sensory properties.

    Science.gov (United States)

    Irkin, Reyhan; Yalcin, Onur

    2017-01-01

    In recent years, probiotic bacteria have increasingly been incorporated into various foods as dietary adjuncts. The viability of the probiotic bacteria Lactobacillus acidophilus NRRL B 4495 and Bifido- bacterium bifidum NRRL B41410 in salted (1% w/w) and unsalted lor whey cheese during storage (21 days) at a refrigerated temperature (4°C) was evaluated. As well as the survival of the probiotic bacteria, total mesophilic bacteria, total lactic acid bacteria, Pseudomonas spp., yeast-mould counts and sensory characteristics were examined in the lor samples. The Bf. bifidum remained in large numbers, at 7.30 and 7.11 log cfu/g, and Lb. acidophilus also survived well, with counts of 7.60 and 7.47 log cfu/g, for unsalted and salted cheeses respectively. Salted lor cheeses with added Lb. acidophilus have the highest sensory scores in the groups. “Lor” whey cheese showed good probiotic properties.

  3. The presence of two S-layer-protein-encoding genes is conserved among species related to Lactobacillus acidophilus

    NARCIS (Netherlands)

    Boot, H.J.; Kolen, C.P.A.M.; Pot, B.; Kersters, K.; Pouwels, P.H.

    1996-01-01

    Previously we have shown that the type strain of Lactobacillus acidophilus possesses two S-protein-encoding genes, one of which is silent, on a chromosomal segment of 6 kb. The S-protein-encoding gene in the expression site can be exchanged for the silent S-protein-encoding gene by inversion of this

  4. Differential proteome and cellular adhesion analyses of the probiotic bacterium Lactobacillus acidophilus NCFM grown on raffinose - an emerging prebiotic

    DEFF Research Database (Denmark)

    Celebioglu, Hasan Ufuk; Hansen, Morten Ejby; Majumder, Avishek

    2016-01-01

    Whole cell and surface proteomes were analyzed together with adhesive properties of the probiotic bacterium Lactobacillus acidophilus NCFM (NCFM) grown on the emerging prebiotic raffinose, exemplifying a synbiotic. Adhesion of NCFM to mucin and intestinal HT-29 cells increased three-fold after...

  5. Analysis of the human intestinal epithelial cell transcriptional response to Lactobacillus acidophilus, Lactobacillus salivarius, Bifidobacterium lactis and Escherichia coli

    DEFF Research Database (Denmark)

    Putaala, H; Barrangou, R; Leyer, G J

    2010-01-01

    a comparative analysis of the global in vitro transcriptional response of human intestinal epithelial cells to Lactobacillus acidophilus NCFM™, Lactobacillus salivarius Ls-33, Bifidobacterium animalis subsp. lactis 420, and enterohaemorrhagic Escherichia coli O157:H7 (EHEC). Interestingly, L. salivarius Ls-33...

  6. Inhibitory effect of self-generated extracellular dissolved organic carbon on carbon dioxide fixation in sulfur-oxidizing bacteria during a chemoautotrophic cultivation process and its elimination.

    Science.gov (United States)

    Wang, Ya-Nan; Tsang, Yiu Fai; Wang, Lei; Fu, Xiaohua; Hu, Jiajun; Li, Huan; Le, Yiquan

    2018-03-01

    The features of extracellular dissolved organic carbon (EDOC) generation in two typical aerobic sulfur-oxidizing bacteria (Thiobacillus thioparus DSM 505 and Halothiobacillus neapolitanus DSM 15147) and its impact on CO 2 fixation during chemoautotrophic cultivation process were investigated. The results showed that EDOC accumulated in both strains during CO 2 fixation process. Large molecular weight (MW) EDOC derived from cell lysis and decay was dominant during the entire process in DSM 505, whereas small MW EDOC accounted for a large proportion during initial and middle stages of DSM 15147 as its cytoskeleton synthesis rate did not keep up with CO 2 assimilation rate. The self-generated EDOC feedback repressed cbb gene transcription and thus decreased total bacterial cell number and CO 2 fixation yield in both strains, but DSM 505 was more sensitive to this inhibition effect. Moreover, the membrane bioreactor effectively decreased the EDOC/TOC ratio and improved carbon fixation yield of DSM 505. Copyright © 2017 Elsevier Ltd. All rights reserved.

  7. Microbial community analysis in rice paddy soils irrigated by acid mine drainage contaminated water.

    Science.gov (United States)

    Sun, Min; Xiao, Tangfu; Ning, Zengping; Xiao, Enzong; Sun, Weimin

    2015-03-01

    Five rice paddy soils located in southwest China were selected for geochemical and microbial community analysis. These rice fields were irrigated with river water which was contaminated by Fe-S-rich acid mine drainage. Microbial communities were characterized by high-throughput sequencing, which showed 39 different phyla/groups in these samples. Among these phyla/groups, Proteobacteria was the most abundant phylum in all samples. Chloroflexi, Acidobacteria, Nitrospirae, and Bacteroidetes exhibited higher relative abundances than other phyla. A number of rare and candidate phyla were also detected. Moreover, canonical correspondence analysis suggested that pH, sulfate, and nitrate were significant factors that shaped the microbial community structure. In addition, a wide diversity of Fe- and S-related bacteria, such as GOUTA19, Shewanella, Geobacter, Desulfobacca, Thiobacillus, Desulfobacterium, and Anaeromyxobacter, might be responsible for biogeochemical Fe and S cycles in the tested rice paddy soils. Among the dominant genera, GOUTA19 and Shewanella were seldom detected in rice paddy soils.

  8. Performance of denitrifying microbial fuel cell with biocathode over nitrite

    Directory of Open Access Journals (Sweden)

    Zhao eHuimin

    2016-03-01

    Full Text Available Microbial fuel cell (MFC with nitrite as an electron acceptor in cathode provided a new technology for nitrogen removal and electricity production simultaneously. The influences of influent nitrite concentration and external resistance on the performance of denitrifying MFC were investigated. The optimal effectiveness were obtained with the maximum total nitrogen (TN removal rate of 54.80±0.01 g m-3 d-1. It would be rather desirable for the TN removal than electricity generation at lower external resistance. Denaturing gradient gel electrophoresis suggested that Proteobacteria was the predominant phylum, accounting for 35.72%. Thiobacillus and Afipia might benefit to nitrite removal. The presence of nitrifying Devosia indicated that nitrite was oxidized to nitrate via a biochemical mechanism in the cathode. Ignavibacterium and Anaerolineaceae was found in the cathode as a heterotrophic bacterium with sodium acetate as substrate, which illustrated that sodium acetate in anode was likely permeated through proton exchange membrane to the cathode .

  9. Bacterial community compositions of coking wastewater treatment plants in steel industry revealed by Illumina high-throughput sequencing.

    Science.gov (United States)

    Ma, Qiao; Qu, Yuanyuan; Shen, Wenli; Zhang, Zhaojing; Wang, Jingwei; Liu, Ziyan; Li, Duanxing; Li, Huijie; Zhou, Jiti

    2015-03-01

    In this study, Illumina high-throughput sequencing was used to reveal the community structures of nine coking wastewater treatment plants (CWWTPs) in China for the first time. The sludge systems exhibited a similar community composition at each taxonomic level. Compared to previous studies, some of the core genera in municipal wastewater treatment plants such as Zoogloea, Prosthecobacter and Gp6 were detected as minor species. Thiobacillus (20.83%), Comamonas (6.58%), Thauera (4.02%), Azoarcus (7.78%) and Rhodoplanes (1.42%) were the dominant genera shared by at least six CWWTPs. The percentages of autotrophic ammonia-oxidizing bacteria and nitrite-oxidizing bacteria were unexpectedly low, which were verified by both real-time PCR and fluorescence in situ hybridization analyses. Hierarchical clustering and canonical correspondence analysis indicated that operation mode, flow rate and temperature might be the key factors in community formation. This study provides new insights into our understanding of microbial community compositions and structures of CWWTPs. Copyright © 2014 Elsevier Ltd. All rights reserved.

  10. Isolation of Sulfur Reducing and Oxidizing Bacteria Found in Contaminated Drywall

    Directory of Open Access Journals (Sweden)

    Frederick T. Guilford

    2010-02-01

    Full Text Available Drywall from China has been reported to release sulfur producing products which are corrosive to metals, result in noxious odors, and represent a significant health risk. It has been reported that these emissions produce medical symptoms such as respiratory or asthma type problems, sinusitis, gastrointestinal disorders, and vision problems in home owners and their household pets. We report here a method of identifying a causative agent for these emissions by sampling affected gypsum wallboard and subjecting those samples to Real Time Polymerase Chain Reaction [RT-PCR] studies. Specific DNA probes and primers have been designed and patented that detect a specific iron and sulfur reducing bacterium (i.e., Thiobacillus ferrooxidans. One hundred percent of affected drywall samples obtained from homes located in the southeastern United States tested positive for the presence of T. ferrooxidans. All negative controls consisting of unaffected wallboard and internal controls, Geotrichum sp., tested negative within our limits of detection.

  11. Recent knowledge about the role of bacterial adhesion in coal preparation

    Directory of Open Access Journals (Sweden)

    Turèániová ¼udmila

    1998-09-01

    Full Text Available V nadväznosti na flotáciu pyritu v uhlí sú zhrnuté súèasné poznatky o vplyve fyzikálno-chemických vlastností buneènej steny baktérie Thiobacillus ferrooxidans na jej adhéziu na povrch rôznych minerálov a uhlia. Aplikovaním modelu mikrobiálnej adhézie (Škvarla, J. Chem. Soc. Faraday Trans., 89, 1993, p. 2913-2921 a využitím známych parametrov vstupujúcich do tohoto modelu bolo zistené, že k (reverzibilnej adhézii T. ferrooxidans dochádza spravidla v sekundárnom minime. Pre posúdenie možnosti využitia tohoto modelu na objasnenie selektívneho prichytenia T. ferrooxidans na pyrit je však potrebné doplni chýbajúce údaje vstupujúce do tohoto modelu.

  12. "Desenvolvimento de produtos efervescentes adicionados dos probióticos Lactobacillus acidophilus e Saccharomyces boulardii"

    OpenAIRE

    Agnes Izumi Nagashima

    2010-01-01

    Probióticos são microrganismos vivos, que administrados em quantidades adequadas, conferem benefícios à saúde do hospedeiro, sendo sua influência benéfica sobre a microbiota intestinal humana, incluindo fatores como efeitos antagônicos, competição e efeitos imunológicos. Assim, este trabalho apresentou como objetivo desenvolver produtos efervescentes com os microrganismos probióticos Lactobacillus acidophilus e Saccharomyces boulardii (comprimido, pó e ingrediente), identificar a melhor formu...

  13. Pembuatan Dan Aktivitas Antibakteri Yogurt Hasil Fermentasi Tiga Bakteri (Lactobacillus bulgaricus, Streptococcus thermophilus, Lactobacilus acidophilus)

    OpenAIRE

    Dian S. Kamara; Saadah D. Rachman; Ridya Widya Pasisca; Sadiah Djajasoepana; O. Suprijana; Idar Idar; Safri Ishmayana

    2016-01-01

    Exploitation of synthetic antibiotics compounds not only have positive effect for human, but also have side effect that can be unfavorable, therefore many researches are being conducted to find natural antibiotics compounds that are safer. Lactic acid bacteria has the abilitytoproduce antibacterial compound when used in fermentation process.For example, Lactobacillus acidophilus produces acidophilin and acidolin. The main purpose of the present study is to investigate antibacterial activity o...

  14. Antigen-presenting cells exposed to Lactobacillus acidophilus NCFM, Bifidobacterium bifidum BI-98, and BI-504 reduce regulatory T cell activity

    DEFF Research Database (Denmark)

    Schmidt, Esben Gjerløff Wedebye; Claesson, Mogens Helweg; Jensen, Simon Skjøde

    2010-01-01

    BACKGROUND:: The effect in vitro of six different probiotic strains including Lactobacillus acidophilus NCFM, Lactobacillus salivarius Ls-33, Lactobacillus paracasei subsp. paracasei YS8866441, Lactobacillus plantarum Lp-115, Bifidobacterium bifidum BI-504 and BI-98 was studied on splenic...

  15. Effects of a milk product, fermented by Lactobacillus acidophilus and with fructo-oligosaccharides added, on blood lipids in male volunteers

    NARCIS (Netherlands)

    Schaafsma, G.; Meuling, W.J.A.; Dokkum, W. van; Bouley, C.

    1998-01-01

    Objective: To investigate in adult male volunteers the effect of a new fermented milk product, fermented by Lactobacillus acidophilus and with fructo-oligosaccharides added, on blood lipids. Design: Randomized placebo-controlled double-blind two-way cross over trial with two treatment periods of

  16. Lactobacillus plantarum L9 but not Lactobacillus acidophilus LA reduces tumour necrosis factor induced bacterial translocation in Caco-2 cells.

    Science.gov (United States)

    Wang, B; Chen, J; Wang, S; Zhao, X; Lu, G; Tang, X

    2017-05-30

    Translocation of bacteria across the intestinal barrier is important in the pathogenesis of systemic sepsis and multiple organ dysfunction syndromes. Inflammatory cytokines increase paracellular permeability that allows increased luminal bacteria to translocate across mucosal epithelium and further deteriorate the gut barrier. In order to reduce this risk, the prophylactic use of probiotics has been recently addressed. In this paper, we investigate the protective role toward tumour necrosis factor (TNF)-α induced non-pathogenic Escherichia coli translocation across Caco-2 monolayers of Lactobacillus strains. According to our experimental data, Lactobacillus plantarum L9 and Lactobacillus acidophilus LA have good capacities to adhere to Caco-2 cells. Addition of L. plantarum L9 and L. acidophilus LA to the enterocyte monolayer surface result in significant inhibition of E. coli adhesion and cell internalisation. However, L. plantarum L9 and L. acidophilus LA did not inhibit the growth of the non-pathogenic E. coli B5 after 24 h incubation. Exposure to TNF-α for 6 h caused a dramatic increase in E. coli B5 translocation across Caco-2 cells, which was uncoupled from increases in paracellular permeability. Pretreatment with L. plantarum L9 prevent TNF-α induced transcellular bacterial translocation and IL-8 production in Caco-2 cells. L. plantarum L9 also did not affect the integrity of the monolayers, as indicated by lactate dehydrogenase release, horseradish peroxidase permeability, and transepithelial electrical resistance. L. plantarum L9 showed the potential to protect enterocytes from an acute inflammatory response and therefore could be good potential prophylactic agents in counteracting bacterial translocation.

  17. Changes in the F0F1-ATPase activity of irradiated Lactobacillus acidophilus in the presence of ceftazidime at low pH

    International Nuclear Information System (INIS)

    Kalantaryan, V.P.; Trchounian, A.H.; Soghomonyan, D.R.

    2014-01-01

    The aim of this study was the investigation of the effects of low intensity electromagnetic irradiation (EMI) at the frequencies of 51.8 and 53 GHz and of antibiotic ceftazidime on the N,N'-dicyclohexylcarbodiimide (DCCD) inhibited ATPase activity of membrane vesicles of lactic acid bacteria Lactobacillus acidophilus grown at low pH (pH 4.0 or 6.5) and assayed at the same pH. It was shown that both frequencies EMI stimulated ATPase activity of L. acidophilus grown at pH 4.0, but EMI combined with ceftazidime and DCCD decreased ATPase activity at pH 4.0 and pH 6.5. It was suggested that the F 0 F 1 -ATPase might be a target for EMI even at low pH

  18. Data regarding the growth of Lactobacillus acidophilus NCFM on different carbohydrates and recombinant production of elongation factor G and pyruvate kinase

    DEFF Research Database (Denmark)

    Celebioglu, Hasan Ufuk; Olesen, Sita Vaag; Prehn, Kennie

    2017-01-01

    The present study describes the growth of the very well-known probiotic bacterium Lactobacillus acidophilus NCFM on different carbohydrates. Furthermore, recombinant production of putative moonlighting proteins elongation factor G and pyruvate kinase from this bacterium is described. For further...

  19. Plasma membrane Toll-like receptor activation increases bacterial uptake but abrogates endosomal Lactobacillus acidophilus induction of interferon-β

    DEFF Research Database (Denmark)

    Boye, Louise; Welsby, Iain; Lund, Lisbeth Drozd

    2016-01-01

    Lactobacillus acidophilus induces a potent interferon-β (IFN-β) response in dendritic cells (DCs) by a Toll-like receptor 2 (TLR2) -dependent mechanism, in turn leading to strong interleukin-12 (IL-12) production. In the present study, we investigated the involvement of different types of endocyt...

  20. A functional glycogen biosynthesis pathway in Lactobacillus acidophilus: expression and analysis of the glg operon

    Science.gov (United States)

    Goh, Yong Jun; Klaenhammer, Todd R

    2013-01-01

    Glycogen metabolism contributes to energy storage and various physiological functions in some prokaryotes, including colonization persistence. A role for glycogen metabolism is proposed on the survival and fitness of Lactobacillus acidophilus, a probiotic microbe, in the human gastrointestinal environment. L. acidophilus NCFM possesses a glycogen metabolism (glg) operon consisting of glgBCDAP-amy-pgm genes. Expression of the glg operon and glycogen accumulation were carbon source- and growth phase-dependent, and were repressed by glucose. The highest intracellular glycogen content was observed in early log-phase cells grown on trehalose, which was followed by a drastic decrease of glycogen content prior to entering stationary phase. In raffinose-grown cells, however, glycogen accumulation gradually declined following early log phase and was maintained at stable levels throughout stationary phase. Raffinose also induced an overall higher temporal glg expression throughout growth compared with trehalose. Isogenic ΔglgA (glycogen synthase) and ΔglgB (glycogen-branching enzyme) mutants are glycogen-deficient and exhibited growth defects on raffinose. The latter observation suggests a reciprocal relationship between glycogen synthesis and raffinose metabolism. Deletion of glgB or glgP (glycogen phosphorylase) resulted in defective growth and increased bile sensitivity. The data indicate that glycogen metabolism is involved in growth maintenance, bile tolerance and complex carbohydrate utilization in L. acidophilus. PMID:23879596

  1. Lactobacillus acidophilus Metabolizes Dietary Plant Glucosides and Externalizes Their Bioactive Phytochemicals

    DEFF Research Database (Denmark)

    Theilmann, Mia Christine; Goh, Yong Jun; Nielsen, Kristian Fog

    2017-01-01

    Therapeutically active glycosylated phytochemicals are ubiquitous in the human diet. The human gut microbiota (HGM) modulates the bioactivities of these compounds, which consequently affect host physiology and microbiota composition. Despite a significant impact on human health, the key players...... of the loci to distinct groups of PGs. Following intracellular deglucosylation, the aglycones of PGs are externalized, rendering them available for absorption by the host or for further modification by other microbiota taxa. The PG utilization loci are conserved in L. acidophilus and closely related...... active plant-derived compounds are widely present in berries, fruits, nuts, and beverages like tea and wine. The bioactivity and bioavailability of these compounds, which are typically glycosylated, are altered by microbial bioconversions in the human gut. Remarkably, little is known about...

  2. Antimicrobial efficacy of Acacia nilotica, Murraya koenigii (L.) Sprengel, Eucalyptus hybrid, Psidium guajava extracts and their combination on Streptococcus mutans and Lactobacillus acidophilus.

    Science.gov (United States)

    Chandra Shekar, B R; Nagarajappa, Ramesh; Jain, Richa; Singh, Rupal; Thakur, Rupesh; Shekar, Suma

    2016-01-01

    The aim of this in vitro study was to assess antimicrobial efficacy of Acacia nilotica, Murraya koenigii (L.) Sprengel, Eucalyptus hybrid, Psidium guajava extracts, and their combination on Streptococcus mutans and Lactobacillus acidophilus. The branches of four plants were collected, identified, and authenticated by a taxonomist. The plants were rinsed in water, healthy leaves were separated and shade dried over a period of 3-4 weeks. Soxhlet apparatus using ethanol was employed for extraction procedure. The combinations of plant extracts were prepared by mixing equal quantities of 10% solutions of each of these extracts. 0.2% chlorhexidine and dimethyl sulfoxide were used as positive and negative controls, respectively. The antimicrobial efficacy testing was done using agar well-diffusion method under anaerobic conditions. The mean diameter of inhibition zone was computed and compared between different categories using one-way analysis of variance and Tukey's post-hoc test. A qualitative assay was carried out to identify the various phytochemical constituents in the plants. The data was assessed by SPSS version 20. The statistical significance was fixed at 0.05. All the plants extracts and their combinations inhibited S. mutans and L. acidophilus. However, the quadruple combination of A. nilotica + M. koenigii (L.) Sprengel + Eucalyptus hybrid + P. guajava produced the maximum inhibition zone (23.5 ± 2.2 mm) against S. mutans. Although, 0.2% chlorhexidine produced the highest inhibition zone against L. acidophilus (18.8 ± 1.2 mm), A. nilotica extract produced maximum inhibition among the various plant extracts and their combinations (14.1 ± 1.8 mm). All the individual plant extracts and their combinations were effective against S. mutans and L. acidophilus. These could be tried as herbal alternates to chlorhexidine. However, these in vitro results have to be further evaluated for any toxicity of the polyherbal combinations in animal models and effectiveness

  3. Efficient one-pot enzymatic synthesis of alpha-(1 -> 4)-glucosidic disaccharides through a coupled reaction catalysed by Lactobacillus acidophilus NCFM maltose phosphorylase

    DEFF Research Database (Denmark)

    Nakai, Hiroyuki; Dilokpimol, Adiphol; Abou Hachem, Maher

    2010-01-01

    Lactobacillus acidophilus NCFM maltose phosphorylase (LaMalP) of glycoside hydrolase family 65 catalysed enzymatic synthesis of alpha-(1 -> 4)-glucostdic disacchandes from maltose and five monosacchandes in a coupled phosphorolysis/reverse phosphorolysis one-pot reaction Thus phosphorolysis...

  4. Influência da co-agregação entre Candida. albicans e Lactobacillus acidophilus na capacidade de adesão destes microrganismos às células epiteliais vaginais humanas (CEVH = Influence of the co-aggregation between Candida. albicans e Lactobacillus acidophilus on the adhesion capacity these microorganisms in the human ephitelial vaginal cells (HEVC

    Directory of Open Access Journals (Sweden)

    Simone Américo Etgeton

    2011-07-01

    Full Text Available Este trabalho teve por objetivo avaliar a influência da co-agregação in vitro entre Candida albicans e Lactobacillus acidophilus na capacidade de adesão destes microrganismos às células epiteliais vaginais humanas (CEVH. Foram utilizados um isolado vaginal de C. albicans e uma cepa ATCC de L. acidophilus. Uma suspensão de cada microrganismo isoladamente e do coagregado foram incubados com as CEVH obtidas de uma doadora saudável. Foram feitos esfregaços por cristal violeta e Papanicolaou, e o número de leveduras, lactobacilos ou coagregados aderidos às células foi contado (em 300 células superficiais-CS e 300 intermediárias-CI. A Microscopia eletrônica de varredura (MEV foi realizada em todas as situações dos ensaios.Leveduras e lactobacilos aderiram fortemente as CEVH, tanto em CS quanto em CI. A coagregação levou a um aumento na capacidade de adesão das leveduras (p 0,05. Havendo correlação com o que acontece in vivo, probióticos à base de L. acidophillus e mesmo uma flora lactobacilar vaginal não surtiriam efeito protetor contra a adesão de C. albicans as CEVH e do possível desenvolvimento de candidíase vulvovaginal.This work has aimed to evaluate the influence of the L. acidophilus and Candida albicans co-aggregation on the adhesion capacity this microorganisms in the human ephitelial vaginal cells (HEVC. One vaginal isolated of C. albicans and one ATCC strain of L. acidophilus was used. A suspension of the isolated and co-aggregated microorganisms was incubated with HVEC obtained from a healthy donor. After one hour, smears were made with crystal violet and Papanicolaou, and the number of yeasts adhered to HVEC was evaluated (300 superficial-SC and 300 intermediate cells-IC. Scanning electron microscopy (SEM was made in all situations of the assays. Yeasts and lactobacilli adhered strongly to the HEVC, both SC and IC. The co-aggregation there was an increase in the adhesion capacity of the yeasts (p 0

  5. Eruca sativa might influence the growth, survival under simulated gastrointestinal conditions and some biological features of Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus strains.

    Science.gov (United States)

    Fratianni, Florinda; Pepe, Selenia; Cardinale, Federica; Granese, Tiziana; Cozzolino, Autilia; Coppola, Raffaele; Nazzaro, Filomena

    2014-10-01

    The growth and viability of three Lactobacillus strains, Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus, after their passage through simulated gastric and pancreatic juices were studied as a function of their presence in the growth medium of rocket salad (Eruca sativa). The presence of E. sativa affected some of the biological properties of the strains. For example, L. acidophilus and L. plantarum worked more efficiently in the presence of E. sativa, increasing not only the antioxidant activity of the medium, but also their own antioxidant power and antimicrobial activity; L. rhamnosus was not affected in the same manner. Overall, the presence of vegetables might help to boost, in specific cases, some of the characteristics of lactobacilli, including antioxidant and antimicrobial power.

  6. Eruca sativa Might Influence the Growth, Survival under Simulated Gastrointestinal Conditions and Some Biological Features of Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus Strains

    Science.gov (United States)

    Fratianni, Florinda; Pepe, Selenia; Cardinale, Federica; Granese, Tiziana; Cozzolino, Autilia; Coppola, Raffaele; Nazzaro, Filomena

    2014-01-01

    The growth and viability of three Lactobacillus strains, Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus, after their passage through simulated gastric and pancreatic juices were studied as a function of their presence in the growth medium of rocket salad (Eruca sativa). The presence of E. sativa affected some of the biological properties of the strains. For example, L. acidophilus and L. plantarum worked more efficiently in the presence of E. sativa, increasing not only the antioxidant activity of the medium, but also their own antioxidant power and antimicrobial activity; L. rhamnosus was not affected in the same manner. Overall, the presence of vegetables might help to boost, in specific cases, some of the characteristics of lactobacilli, including antioxidant and antimicrobial power. PMID:25275269

  7. Eruca sativa Might Influence the Growth, Survival under Simulated Gastrointestinal Conditions and Some Biological Features of Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus Strains

    Directory of Open Access Journals (Sweden)

    Florinda Fratianni

    2014-10-01

    Full Text Available The growth and viability of three Lactobacillus strains, Lactobacillus acidophilus, Lactobacillus plantarum and Lactobacillus rhamnosus, after their passage through simulated gastric and pancreatic juices were studied as a function of their presence in the growth medium of rocket salad (Eruca sativa. The presence of E. sativa affected some of the biological properties of the strains. For example, L. acidophilus and L. plantarum worked more efficiently in the presence of E. sativa, increasing not only the antioxidant activity of the medium, but also their own antioxidant power and antimicrobial activity; L. rhamnosus was not affected in the same manner. Overall, the presence of vegetables might help to boost, in specific cases, some of the characteristics of lactobacilli, including antioxidant and antimicrobial power.

  8. Simple and double microencapsulation of Lactobacillus acidophilus with chitosan using spray drying

    Directory of Open Access Journals (Sweden)

    Isela A. Flores-Belmont

    2015-10-01

    Full Text Available The aim of this study was to evaluate the survival of Lactobacillus acidophilus that had been simple or double spray dried using chitosan to cause microencapsulation and which had been exposed to model gastrointestinal conditions. In addition, the study also determined the physicochemical properties of the powder containing the microencapsulated probiotic.Chitosan-inulin or chitosan-maltodextrin (1:15 or 1:25 solutions were inoculated with 1012 cfu mL-1 of L. acidophilus, for simple microencapsulation. The different solutions were dried using a spray dryer with an inlet air temperature of 130°C and a solution flux of 4.8 g min-1. A two-step process was used for the double microencapsulation. In the first step, the probiotic was added to a gelatin-maltodextrin (1:25 solution and then spray dried; for the second step, the microencapsulated probiotic was added to a chitosan-inulin or chitosan-maltodextrin (1:25 solution and then it was spray dried again.With the simple microencapsulated probiotic, a microbial reduction of 7 log cycles was obtained. With the double microencapsulated probiotic only 3 log reductions were achieved. The double microencapsulated probiotic thus demonstrated greater resistance to simulated gastrointestinal conditions. The powders produced were shown to have water activity values of 0.176 - 0.261 at 25 °C and moisture content of 0.8 – 1.0%, which are characteristic of spray dried products. The bulk density was significantly (p < 0.05 lower (300 kg m-3 for simple than for double (400 kg m-3 microencapsulated probiotic powders. Solubility and dispersibility of the powder microcapsules were better at lower pH values.Double microencapsulation using a process of spray drying is therefore recommended for probiotics, thus exploiting chitosan’s insolubility in water, which can be applied for the of development food products.

  9. DETERMINATION OF QUALITY PROPERTIES OF DIET ACIDOPHILUS BIFIDUS YOGHURT AND DIET YOGHURT

    Directory of Open Access Journals (Sweden)

    Oğuz GÜRSOY

    1999-03-01

    Full Text Available Diet yoghurt and diet Asidophilus bifidus yoghurt were produced from cow milk and fat ratio was decreased below 1 %. In production of diet Asidophilus bifidus yoghurt, freeze dried DVS culture which contains normal yoghurt bacteria (Streptococcus thermophilus ve Lactobacillus delbrueckii subsp. bulgaricus and therapeutic lactic acid bacteria (Lactobacillus acidophilus and Bifidobacteria was used. In production of diet yoghurt, normal yoghurt bacteria were used. Chemical, microbiological and sensory properties of these products were determined and compared. Generally, except the consistency sensed in mouth, chemical, microbiological and sensory properties were approximately same. Finally, these products were healthier than other yoghurt products, because of the amount of low fat and containing therapeutic bacteria.

  10. Microencapsulation and Fermentation of Lactobacillus acidophilus LA-5 and Bifidobacterium BB-12

    Directory of Open Access Journals (Sweden)

    Maryam Yari

    2015-09-01

    Full Text Available Because of poor survival of probiotic bacteria, microencapsulation evolved from the immobilized cell culture technology used in the biotechnological industry. Two probiotic strains, Bifidobacterium (BB-12 and Lactobacillus acidophilus (LA-5 were immobilized in calcium alginate by extrusion method. Encapsulation parameters and efficacy of this method were evaluated. Growth factors of these two bacteria were also measured by culturing in 10-L fermenter. Growth curves were obtained with respect to optical density and dry biomass weight. Encapsulation yield was over than 60% in each experiment. Scanning electron microscopy (SEM of Entrapment of cells in alginate matrix and cross-sections of dried bead were obtained and illustrated. Bifidobacterium have been shown better biotechnological properties.

  11. Comparative proteomics of oxidative stress response of Lactobacillus acidophilus NCFM reveals effects on DNA repair and cysteine de novo synthesis

    DEFF Research Database (Denmark)

    Calderini, Elia; Celebioglu, Hasan Ufuk; Villarroel, Julia

    2017-01-01

    acidophilus NCFM to H2O2, simulating an oxidative environment. Bacterial growth was monitored by BioScreen and batch cultures were harvested at exponential phase for protein profiling of stress responses by 2D gel-based comparative proteomics. Proteins identified in 19 of 21 spots changing in abundance due...

  12. Study on the effects of consumption of milk containing Lactobacillus acidophilus on serum lipid trends and weight gain of rats fed high lipid diet

    Directory of Open Access Journals (Sweden)

    H Mirzaei

    2008-02-01

    Full Text Available Despite the significant progresses made in the reduction of mortality due to cardiovascular diseases, they are still the primary cause of death in many countries and hyperlipidemia is an important causal agent of cardiovascular diseases. Probiotics are food supplements containing live microbes which balance the flora of the digestive system and produce positive effects in the host body. L.acidophilus is a beneficial bacterium used in the production of probiotic products .The aim of this study is to evaluate the effects of consumption of milk containing L.acidophilus on serum lipid trends of rats fed high lipid diet. This is an experimental study in which 30 male albino Wistar rats with a body weight of 200±15 gr. were randomly allocated to two groups of treatment and control each containing 15 rats which were adapted to a high lipid diet (11.74% and water containing 25% milk within a week. Rats in both groups received high lipid diet and water containing 25% milk for 60 days with the exception that rats in the treatment group received water containing L. acidophilus at a level of 109 CFU/rat/day throughout the experiment. Independent t-test revealed that at a level of α= 0.05, mean levels of total cholesterol and LDL-C of rats in the treatment group was significantly lower than the control group (p

  13. Protective effect of lactobacillus acidophilus and isomaltooligosaccharide on intestinal mucosal barriers in rat models of antibiotic-associated diarrhea

    International Nuclear Information System (INIS)

    Du Dan; Fang Lichao; Chen Bingbo; Wei Hong

    2008-01-01

    Objective: To investigate the protective effect of synbiotics combined lactobacillus acidophilus and iso-malto-oligosaccharide (IMO) on intestinal mucosal barriers in rat models of antibiotic-associated diarrhea(AAD). Methods: Rat models of AAD were prepared with lincomycin gavage for 5 days. The synbiotics was orally administered to the AAD rats daily at three different strengths for 7 days. The intestinal flora and intestinal mucus SIgA levels were determined on d6, d9 and d13. The histopathological changes of ileal mucosa were studied on d13. Results: In the prepared AAD model rats (on d6) there were lower intestinal mucus SIgA levels and intestinal flora disorders were demonstrated. The intestinal floras of the rats administering synbiotics were readjusted to the similar pattern of healthy rats with bacterial translocation corrected on d13 and the levels of SIgA were not significantly different from of the control (P>0.05). The histopathological picture was basically normal in the treated models on d13. Conclusion: The synbiotics combined lactobacillus acidophilus and isomaltooligosaccharide possessed good protective effect on the intestinal mucosal barrier in lincomycin induced rat models of AAD. (authors)

  14. Lactobacillus acidophilus induces a slow but more sustained chemokine and cytokine response in naïve foetal enterocytes compared to commensal Escherichia coli

    Directory of Open Access Journals (Sweden)

    Nellemann Christine

    2010-01-01

    Full Text Available Abstract Background The first exposure to microorganisms at mucosal surfaces is critical for immune maturation and gut health. Facultative anaerobic bacteria are the first to colonise the infant gut, and the impact of these bacteria on intestinal epithelial cells (IEC may be determinant for how the immune system subsequently tolerates gut bacteria. Results To mirror the influence of the very first bacterial stimuli on infant IEC, we isolated IEC from mouse foetuses at gestational day 19 and from germfree neonates. IEC were stimulated with gut-derived bacteria, Gram-negative Escherichia coli Nissle and Gram-positive Lactobacillus acidophilus NCFM, and expression of genes important for immune regulation was measured together with cytokine production. E. coli Nissle and L. acidophilus NCFM strongly induced chemokines and cytokines, but with different kinetics, and only E. coli Nissle induced down-regulation of Toll-like receptor 4 and up-regulation of Toll-like receptor 2. The sensitivity to stimulation was similar before and after birth in germ-free IEC, although Toll-like receptor 2 expression was higher before birth than immediately after. Conclusions In conclusion, IEC isolated before gut colonisation occurs at birth, are highly responsive to stimulation with gut commensals, with L. acidophilus NCFM inducing a slower, but more sustained response than E. coli Nissle. E. coli may induce intestinal tolerance through very rapid up-regulation of chemokine and cytokine genes and down-regulation of Toll-like receptor 4, while regulating also responsiveness to Gram-positive bacteria.

  15. Study on effect of Artemisia sieberi hydro-alcoholic extract on the survival of Lactobacillus acidophilus and Bifidobacterium lactis in probiotic yoghurt

    Directory of Open Access Journals (Sweden)

    Saeed Akbari

    2017-05-01

    Full Text Available Background and Aim: In the present study, the possibility of probiotic yoghurt production using Artemisia sieberi hydro- alcoholic extract and also the effects of different concentrations of this medicinal herb on the survival of two probiotic strains, Lactobacillus acidophilus and Bifidobacterium lactis, in probiotic yoghurt were investigated. Materials and Methods: In different treatments, the amounts of 0, 0.1, 0.2, 0.3 and 0.4 gr/lit of Artemisia sieberi extract together with conventional yoghurt starter, Bif. lactis and lact. acidophilus were added to 1 liter of boiled milk. The samples were incubated at 37˚centigrade, and then, the acidity and pH changes every two hours during the incubation period were examined up to approximately 80˚ of the survival of probiotic bacteria was tested during the storage of the samples in the refrigerator. On the tenth day, after yoghurt production, all the samples were examined for sensory evaluation using a panel test and the obtained data was analyzed by means of SPSS software (V:19. Results: There was no significant difference in the acidity and pH changes during the production process of probiotic yoghurt in different treatments. The probiotic yoghurt containing 0.4 gr/lit  of Artemisia hydro-alcoholic extract had the best quality in terms of organoleptic properties and shelf life of the product. During 21 days storage in the refrigerator none of the treatments showed the number of probiotic bacteria less than 106 bacteria in gram. Conclusion: It was found that appropriate concentrations of Artemisia sieberi extract can be used for the production of probiotic yoghurt, as a new functional food containing Lactobacillus acidophilus and Bifodobacterium lactis.

  16. Effect of oral administration of lactobacillus acidophilus on the immune responses and survival of BALB/c mice bearing human breast cancer

    Directory of Open Access Journals (Sweden)

    Soltan Dallal MM

    2010-02-01

    Full Text Available "n Normal 0 false false false EN-US X-NONE AR-SA MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin:0in; mso-para-margin-bottom:.0001pt; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-fareast-font-family:"Times New Roman"; mso-fareast-theme-font:minor-fareast; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:Arial; mso-bidi-theme-font:minor-bidi;} Background: In according to immunomodulatory effect of probiotics and effect of these bacteria on the effectiveness of immune responses, at the present work we proposed the evaluation of oral administration of L.acidophilus on the immune statues in BALB/c mice bearing breast cancer."n"nMethods: A total of 30 In-bred BALB/c mices aged from six to eight weeks weighting 25-30g were randomly enrolled in our study, in two groups each consist of 15 mices. The L.acidophilus ATCC4356 strain used in this study was inoculated in MRS broth and cultivated for a day at 37°C under anaerobic conditions, collected by centrifugation and resuspend in Phosphate Buffer Saline (PBS. After preparation of proper amount of these suspensions it was orally administered to the mice with a gastric feeding, Control mices received an equal volume of PBS in duration of study."n"nResults: Results showed the increase in production of IFnγ (p<0.005, and decrease in production of Th2 cytokines such as IL4 (p=0.347 in the L.acidophilus administered mice in comparison to control group of mice. In addition the proliferation of immune cells in probiotic group was significantly higher than controls, and most importantly probiotic administered mice showed

  17. Increases in Phenolic, Fatty Acid, and Phytosterol Contents and Anticancer Activities of Sweet Potato after Fermentation by Lactobacillus acidophilus.

    Science.gov (United States)

    Shen, Yixiao; Sun, Haiyan; Zeng, Haiying; Prinyawiwatukul, Witoon; Xu, Wenqing; Xu, Zhimin

    2018-03-21

    Phenolic, fatty acid, and phytosterol contents in sweet potato (SP) fermented by Lactobacillus acidophilus were evaluated and compared with those of raw and boiled SPs. The differences in the profiles and levels of phenolics between the raw and boiled SPs were not as significant as the differences between those and the fermented SP. The levels of caffeic acid and 3,5-dicaffeoylquinic acid in fermented SP were more than 4 times higher than those in raw and boiled SPs. Two phenolics, p-coumaric acid and ferulic acid, which were not detected in either raw or boiled SP, were found in fermented SP. The level of each fatty acid or phytosterol increased in fermented SP and decreased in boiled SP. Among the hydrophilic and lipophilic extracts obtained from raw and fermented SPs, the hydrophilic extract of fermented SP exhibited the highest capability of inhibiting cancer-cell PC-12 proliferation. However, each of the extracts had very low cytotoxicities to normal-monkey-kidney-cell growth. The results indicated that SP fermented by L. acidophilus significantly increased free antioxidant-rich phenolics and inhibited cancer-cell-proliferation activity without cytotoxicity to normal cells.

  18. Lactobacillus reuteri CRL 1098 and Lactobacillus acidophilus CRL 1014 differently reduce in vitro immunotoxic effect induced by Ochratoxin A.

    Science.gov (United States)

    Mechoud, Mónica A; Juarez, Guillermo E; de Valdez, Graciela Font; Rodriguez, Ana V

    2012-12-01

    Ochratoxin A (OTA) is a widespread mycotoxin contaminating several food products which causes detrimental health effects. The ability of Lactobacillus reuteri CRL 1098 and Lactobacillus acidophilus CRL 1014 to prevent OTA effects on TNF-α and IL-10 production and apoptosis induction in human peripheral blood mononuclear cells (PBMC) was investigated. Membrane rafts participation in these responses was also evaluated. L. reuteri reduced by 29% the OTA inhibition of TNF-α production whereas L. acidophilus increased 8 times the TNF-α production by OTA treated-PBMC. Also, both bacteria reversed apoptosis induced by OTA by 32%. However, neither of the bacteria reversed the OTA inhibition on IL-10 production. On the other hand, the lactobacilli were less effective to reverse OTA effects on disrupted-rafts PBMC. This study shows that two lactobacilli strains can reduce some negative OTA effects, being membrane rafts integrity necessary to obtain better results. Also, the results highlight the potential capacity of some lactobacilli strains usually included in natural dietary components in milk-derived products and cereals feed, to reduce OTA toxicity once ingested by humans or animals. Copyright © 2012 Elsevier Ltd. All rights reserved.

  19. Endogenous influences on anammox and sulfocompound-oxidizing autotrophic denitrification coupling system (A/SAD) and dynamic operating strategy.

    Science.gov (United States)

    Sun, Xinbo; Du, Lingfeng; Hou, Yuqian; Cheng, Shaoju; Zhang, Xuxiang; Liu, Bo

    2018-02-21

    The anaerobic ammonia oxidation (anammox) and sulfocompound-oxidizing autotrophic denitrification coupling system (A/SAD) was initiated in an expanded granular sludge bed (EGSB) reactor for nitrogen removal from high-strength wastewater. Owing to cooperation between anammox and partial sulfocompound-oxidation autotrophic denitrification coupling system (PSAD), the highest nitrogen removal efficiency (NRE) of 98.1% ± 0.4% achieved at the optimal influent conditions of conversion efficiency of ammonium (CEA) of 55% and S 2 O 3 2- -S/NO 3 - -N (S/N) of 1.4 mol mol -1 . The activity of the short-cut sulfocompound-oxidizing autotrophic denitrification (SSAD) was also regulated to cope with dynamic CEA in the influent by changing the S/N, which was demonstrated to be effective in alleviating nitrite accumulation when the CEA was between 57% and 61%. Both the anammox and SAD bacteria enriched in the reactor after long-term incubation. Candidatus Brocadia and Candidatus Jettenia might be potentially contributing the most to anammox, while the Thiobacillus was the dominant taxa related to SAD. Copyright © 2018. Published by Elsevier Ltd.

  20. Exploring the Molecular Basis for Selective Binding of Homoserine Dehydrogenase from Mycobacterium leprae TN toward Inhibitors: A Virtual Screening Study

    Directory of Open Access Journals (Sweden)

    Dongling Zhan

    2014-01-01

    Full Text Available Homoserine dehydrogenase (HSD from Mycobacterium leprae TN is an antifungal target for antifungal properties including efficacy against the human pathogen. The 3D structure of HSD has been firmly established by homology modeling methods. Using the template, homoserine dehydrogenase from Thiobacillus denitrificans (PDB Id 3MTJ, a sequence identity of 40% was found and molecular dynamics simulation was used to optimize a reliable structure. The substrate and co-factor-binding regions in HSD were identified. In order to determine the important residues of the substrate (l-aspartate semialdehyde (l-ASA binding, the ASA was docked to the protein; Thr163, Asp198, and Glu192 may be important because they form a hydrogen bond with HSD through AutoDock 4.2 software. neuraminidaseAfter use of a virtual screening technique of HSD, the four top-scoring docking hits all seemed to cation–π ion pair with the key recognition residue Lys107, and Lys207. These ligands therefore seemed to be new chemotypes for HSD. Our results may be helpful for further experimental investigations.

  1. Response of microbial communities to pesticide residues in soil restored with Azolla imbricata.

    Science.gov (United States)

    Lu, Xiao-Ming; Lu, Peng-Zhen

    2018-01-01

    Under conditions of Azolla imbricata restoration, the high-throughput sequencing technology was employed to determine change trends of microbial community structures in the soil that had undergone long-term application of pesticides. The relationship between the content of pesticide residues in the soil and the microbial community structure was analyzed. The results indicated that the microbial diversity was strongly negatively correlated with the contents of pesticide residues in the soil. At a suitable dosage of 5 kg fresh A. imbricata per square meter of soil area, the soil microbial diversity increased by 12.0%, and the contents of pesticide residues decreased by 26.8-72.1%. Sphingobacterium, Sphingopyxis, Thermincola, Sphingobium, Acaryochloris, Megasphaera, Ralstonia, Pseudobutyrivibrio, Desulfitobacterium, Nostoc, Oscillochloris, and Aciditerrimonas may play major roles in the degradation of pesticide residues. Thauera, Levilinea, Geothrix, Thiobacillus, Thioalkalispira, Desulfobulbus, Polycyclovorans, Fluviicola, Deferrisoma, Erysipelothrix, Desulfovibrio, Cytophaga, Vogesella, Zoogloea, Azovibrio, Halomonas, Paludibacter, Crocinitomix, Haliscomenobacter, Hirschia, Silanimonas, Alkalibacter, Woodsholea, Peredibacter, Leptolinea, Chitinivorax, Candidatus_Lumbricincola, Anaerovorax, Propionivibrio, Parasegetibacter, Byssovorax, Runella, Leptospira, and Nitrosomonas may be indicators to evaluate the contents of pesticide residues.

  2. Structure of nitrogen-converting communities induced by hydraulic retention time and COD/N ratio in constantly aerated granular sludge reactors treating digester supernatant.

    Science.gov (United States)

    Cydzik-Kwiatkowska, Agnieszka; Rusanowska, Paulina; Zielińska, Magdalena; Bernat, Katarzyna; Wojnowska-Baryła, Irena

    2014-02-01

    This study investigated how hydraulic retention time (HRT) and COD/N ratio affect nitrogen-converting consortia in constantly aerated granules treating high-ammonium digester supernatant. Three HRTs (10, 13, 19 h) were tested at COD/N ratios of 4.5 and 2.3. Denaturing gradient gel electrophoresis and relative real-time PCR were used to characterize the microbial communities. When changes in HRT and COD/N increased nitrogen loading, the ratio of the relative abundance of aerobic to anaerobic ammonium-oxidizers decreased. The COD/N ratio determined the species composition of the denitrifiers; however, Thiobacillus denitrificans, Pseudomonas denitrificans and Azoarcus sp. showed a high tolerance to the environmental conditions and occurred in the granules from all reactors. Denitrifier genera that support granule formation were identified, such as Pseudomonas, Shinella, and Flavobacterium. In aerated granules, nirK-possessing bacteria were more diverse than nirS-possessing bacteria. At a low COD/N ratio, N2O-reducer diversity increased because of the presence of bacteria known as aerobic denitrifiers. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Identification of the autotrophic denitrifying community in nitrate removal reactors by DNA-stable isotope probing.

    Science.gov (United States)

    Xing, Wei; Li, Jinlong; Cong, Yuan; Gao, Wei; Jia, Zhongjun; Li, Desheng

    2017-04-01

    Autotrophic denitrification has attracted increasing attention for wastewater with insufficient organic carbon sources. Nevertheless, in situ identification of autotrophic denitrifying communities in reactors remains challenging. Here, a process combining micro-electrolysis and autotrophic denitrification with high nitrate removal efficiency was presented. Two batch reactors were fed organic-free nitrate influent, with H 13 CO 3 - and H 12 CO 3 - as inorganic carbon sources. DNA-based stable-isotope probing (DNA-SIP) was used to obtain molecular evidence for autotrophic denitrifying communities. The results showed that the nirS gene was strongly labeled by H 13 CO 3 - , demonstrating that the inorganic carbon source was assimilated by autotrophic denitrifiers. High-throughput sequencing and clone library analysis identified Thiobacillus-like bacteria as the most dominant autotrophic denitrifiers. However, 88% of nirS genes cloned from the 13 C-labeled "heavy" DNA fraction showed low similarity with all culturable denitrifiers. These findings provided functional and taxonomical identification of autotrophic denitrifying communities, facilitating application of autotrophic denitrification process for wastewater treatment. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Microbial nitrate removal in biologically enhanced treated coal gasification wastewater of low COD to nitrate ratio by coupling biological denitrification with iron and carbon micro-electrolysis.

    Science.gov (United States)

    Zhang, Zhengwen; Han, Yuxing; Xu, Chunyan; Ma, Wencheng; Han, Hongjun; Zheng, Mengqi; Zhu, Hao; Ma, Weiwei

    2018-04-21

    Mixotrophic denitrification coupled biological denitrification with iron and carbon micro-electrolysis (IC-ME) is a promising emerging bioprocess for nitrate removal of biologically enhanced treated coal gasification wastewater (BECGW) with low COD to nitrate ratio. TN removal efficiency in R1 with IC-ME assisted was 16.64% higher than R2 with scrap zero valent iron addition, 23.05% higher than R3 with active carbon assisted, 30.51% higher than R4 with only active sludge addition, 80.85% higher than R5 utilizing single IC-ME as control. Fe 2+ generated from IC-ME decreased the production of N 2 O and enriched more Nitrate-reducing Fe(Ⅱ) oxidation bacteria (NRFOB) Acidovorax and Thiobacillus, which could convert nitrate to nitrogen gas. And the presence of Fe 3+ , as the Fe 2+ oxidation product, could stimulate the growth of Fe(III)-reducing strain (FRB) that indicated by redundancy analysis. Microbial network analysis demonstrated FRB Geothrix had a co-occurrence relationship with other bacteria, revealing its dominant involvement in nitrate removal of BECGW. Copyright © 2018 Elsevier Ltd. All rights reserved.

  5. Micro-electrolysis/retinervus luffae-based simultaneous autotrophic and heterotrophic denitrification for low C/N wastewater treatment.

    Science.gov (United States)

    Li, Jinlong; Li, Desheng; Cui, Yuwei; Xing, Wei; Deng, Shihai

    2017-07-01

    Nitrogen bioremediation in organic insufficient wastewater generally requires an extra carbon source. In this study, nitrate-contaminated wastewater was treated effectively through simultaneous autotrophic and heterotrophic denitrification based on micro-electrolysis carriers (MECs) and retinervus luffae fructus (RLF), respectively. The average nitrate and total nitrogen removal rates reached 96.3 and 94.0% in the MECs/RLF-based autotrophic and heterotrophic denitrification (MRAHD) system without ammonia and nitrite accumulation. The performance of MRAHD was better than that of MEC-based autotrophic denitrification for the wastewater treatment with low carbon nitrogen (COD/N) ratio. Real-time quantitative polymerase chain reaction (qPCR) revealed that the relative abundance of nirS-type denitrifiers attached to MECs (4.9%) and RLF (5.0%) was similar. Illumina sequencing suggested that the dominant genera were Thiobacillus (7.0%) and Denitratisoma (5.7%), which attached to MECs and RLF, respectively. Sulfuritalea was discovered as the dominant genus in the middle of the reactor. The synergistic interaction between autotrophic and heterotrophic denitrifiers played a vital role in the mixotrophic substrate environment.

  6. Studies of detailed biofilm characterization on fly ash concrete in comparison with normal and superplasticizer concrete in seawater environments.

    Science.gov (United States)

    Vishwakarmaa, Vinita; George, R P; Ramachandran, D; Anandkumar, B; Mudalib, U Kamachi

    2014-01-01

    In cooling water systems, many concrete structures in the form of tanks, pillars and reservoirs that come in contact with aggressive seawater are being deteriorated by chemical and biological factors. The nuclear industry has decided to partially replace the Portland cement with appropriate pozzolans such as fly ash, which could densify the matrix and make the concrete impermeable. Three types of concrete mixes, viz., normal concrete (NC), concrete with fly ash and superplasticizer (FA) and concrete with only superplasticizer (SP) were fabricated for short- and long-term exposure studies and for screening out the better concrete in seawater environments. Biofilm characterization studies and microscopic studies showed excellent performance of FA concrete compared to the other two. Laboratory exposure studies in pure cultures of Thiobacillus thiooxidans and Fusarium oxysporum were demonstrated for the inhibition of microbial growth on fly ash. Epifluorescence and scanning electron microscopic studies supported the better performance of the FA specimen. Thus, the present study clearly showed that FA concrete is less prone to biofilm formation and biodeterioration.

  7. Microbially influenced degradation of cement-solidified low-level radioactive waste forms

    International Nuclear Information System (INIS)

    Rogers, R.D.; Hamilton, M.A.; Veeh, R.H.; McConnell, J.W. Jr.

    1996-01-01

    Because of its apparent structural integrity, cement has been widely used in the United States as a binder to solidify Class B and C low-level radioactive waste (LLW). However, the resulting cement preparations are susceptible to failure due to the actions of stress and environment. This paper contains information on three groups of microoganisms that are associated with the degradation of cement materials: sulfur-oxidizing bacteria (Thiobacillus), nitrifying bacteria (Nitrosomonas and Nitrobacter), and heterotrophic bacteria, which produce organic acids. Preliminary work using laboratory- and vendor-manufactured, simulated waste forms exposed to thiobacilli has shown that microbiologically influenced degradation has the potential to severely compromise the structural integrity of ion-exchange resin and evaporator-bottoms waste that is solidified with cement. In addition, it was found that a significant percentage of calcium was leached from the treated waste forms. Also, the surface pH of the treated specimens was decreased to below 2. These conditions apparently contributed to the physical deterioration of simulated waste forms after 30 to 60 days of exposure

  8. Influence of the addition of Lactobacillus acidophilus La-05, Bifidobacterium animalis subsp. lactis Bb-12 and inulin on the technological, physicochemical, microbiological and sensory features of creamy goat cheese.

    Science.gov (United States)

    Barbosa, Ilsa C; Oliveira, Maria E G; Madruga, Marta S; Gullón, Beatriz; Pacheco, Maria T B; Gomes, Ana M P; Batista, Ana S M; Pintado, Maria M E; Souza, Evandro L; Queiroga, Rita C R E

    2016-10-12

    The effects of the addition of Lactobacillus acidophilus LA-05, Bifidobacterium animalis subsp. lactis BB-12 and inulin on the quality characteristics of creamy goat cheese during refrigerated storage were evaluated. The manufactured cheeses included the addition of starter culture (Lactococcus lactis subsp. lactis and Lactococcus lactis subsp. cremoris - R-704) (CC); starter culture, L. acidophilus LA-05 and inulin (CLA); starter culture, B. lactis BB-12 and inulin (CBB); or starter culture, L. acidophilus LA-05, B. lactis BB-12 and inulin (CLB). In the synbiotic cheeses (CLA, CBB and CLB), the counts of L. acidophilus LA-05 and B. lactis BB-12 were greater than 6log CFU g -1 , the amount of inulin was greater than 6 g per 100 g, and the firmness was reduced. The cheeses evaluated had high brightness values (L*), with a predominance of yellow (b*). CC had higher contents of proteins, lipids and minerals compared to the other cheeses. There was a decrease in the amount of short-chain fatty acids (SCFAs) and an increase of medium-chain (MCFAs) and long-chain fatty acids (LCFAs) in the synbiotic cheeses compared to CC. The amount of conjugated linoleic acid increased in CLA, CBB and CLB. The highest depth of proteolysis and the greatest changes in the release of free amino acids were found in CLB. The addition of inulin and probiotics, alone or in co-culture, did not affect the cheese acceptance. Inulin and probiotics can be used together for the production of creamy goat cheese without negatively affecting the general quality characteristics of the product, and to add value because of its synbiotic potential.

  9. Effects of Royal Jelly and Bee Pollen on the Growth of Selected Probiotic Bacteria (Bf. animalis Spp. Lactis, L. acidophilus and L. casei

    Directory of Open Access Journals (Sweden)

    Guldas Metin

    2016-12-01

    Full Text Available In this research article, the effects of bee pollen and royal jelly on the selected probiotic bacteria, as growth factors, were investigated. The probiotic cultures were activated in MRS broth at 37°C. Then, bee pollen and royal jelly (10 mg/100 μL, 25 mg/250 μL, 50 mg/500 μL, 75 mg/750 μL, and 100 mg/1000 μL were added on the probiotic cultures in MRS broth and sampled at 0, 24, and 48 hours of incubation. The medias used for enumeration of the probiotic cultures were RCA (Reinforced Clostridial Agar for Bf. animalis spp. lactis, MRS (deMann, Rogosa and Sharpe Agar with D-sorbitol for Lb. acidophilus and MRS-Vancomycine Agar for Lb. casei. The lactic acid production by Lb. acidophilus, Lb. casei, and Bf. animalis spp. lactis, and acetic acid production by Bf. animalis spp. lactis, were determined to compare the bacterial proliferation. The probiotic cultures were mainly affected by the bee pollen and royal jelly during the first 24 hours. The changes observed in the number of probiotic counts between 24 and 48 hours were not significant, statistically (P<0.05. Generally, the probiotic bacterial counts increased parallel to the concentration of bee pollen or royal jelly up to 75mg, and remained unchanged above this concentration. In terms of lactic acid production and bacterial growth, the most significant growth was observed on Lb. acidophilus when bee pollen or royal jelly was added.

  10. Mono-colonization with Lactobacillus acidophilus NCFM affects the intestinal metabolome as compared to germ-free mice

    DEFF Research Database (Denmark)

    Roager, Henrik Munch; Sulek, Karolina; Skov, Kasper

    Every single species of the gut microbiota produce low-molecular-weight compounds that are absorbed constantly from the intestinal lumen and carried to systemic circulation where they play a direct role in health and disease. However, very few studies address the host metabolome as a function...... of colonizing bacteria. In this study the effect of the Lactobacillus acidophilus NCFM strain was investigated by comparing the metabolome of mono-colonized and germ-free mice in several compartments. By liquid-chromatography coupled to mass spectrometry, we were able to show that the metabolome differed...

  11. Enzymology and Structure of the GH13_31 Glucan 1,6-α-Glucosidase That Confers Isomaltooligosaccharide Utilization in the Probiotic Lactobacillus acidophilus NCFM

    DEFF Research Database (Denmark)

    Møller, Marie Sofie; Fredslund, Folmer; Majumder, Avishek

    2012-01-01

    or maltotetraose, as determined by reverse transcription-PCR (RT-PCR) transcriptional analysis, suggesting coregulation of α-1,6- and α-1,4-glucooligosaccharide utilization loci in L. acidophilus NCFM. The L. acidophilus NCFM GH13_31 (LaGH13_31) was produced recombinantly and shown to be a glucan 1,6-α......-glucosidase active on IMO and dextran and product-inhibited by glucose. The catalytic efficiency of LaGH13_31 on dextran and the dextran/panose (trisaccharide) efficiency ratio were the highest reported for this class of enzymes, suggesting higher affinity at distal substrate binding sites. The crystal structure...... of LaGH13_31 was determined to a resolution of 2.05 Å and revealed additional substrate contacts at the +2 subsite in LaGH13_31 compared to the GH13_31 from Streptococcus mutans (SmGH13_31), providing a possible structural rationale to the relatively high affinity for dextran. A comprehensive...

  12. Evidence of biogenic corrosion of titanium after exposure to a continuous culture of thiobacillus ferrooxidans grown in thiosulfate medium

    International Nuclear Information System (INIS)

    Horn, J M; Martin, S I; Masterson, B

    2000-01-01

    Experiments were undertaken to evaluate extreme conditions under which candidate materials intended for use in a proposed nuclear waste repository might be susceptible to corrosion by endogenous microorganisms. Thiobucillus ferrooxidans, a sulfur-oxidizing bacterium, was grown in continuous culture using thiosulfate as an energy source; thiosulfate is oxidized to sulfate as a metabolic endproduct by this organism. Culture conditions were optimized to produce a high-density, metabolically active culture throughout a period of long term incubation in the presence of Alloy 22 (a high nickel-based alloy) and Titanium grade 7 (Tigr7) material coupons. After seven months incubation under these conditions, material coupons were withdrawn and analyzed by high resolution microscopy and energy dispersive x-ray analyses. Alloy 22 coupons showed no detectable signs of corrosion. Tigr7, however, demonstrated distinct roughening of the coupon surface, and [presumably solubilized and precipitated] titanium was detected on Alloy 22 coupons incubated in the same T. ferrooxiduns culture vessel. Control coupons of these materials incubated in sterile thiosulfate medium did not demonstrate any signs of corrosion, thus showing that observed corrosive effects were due to the T. ferrooxidans metabolic activities. T. ferrooxidans intermediates of thiosulfate oxidation or sulfate may have caused the corrosive effects observed on Tigr7

  13. Use of Lactobacillus acidophilus and Lactobacillus casei for a potential probiotic legume-based fermented product using pigeon pea (Cajanus cajan).

    Science.gov (United States)

    Parra, K; Ferrer, M; Piñero, M; Barboza, Y; Medina, L M

    2013-02-01

    The aim of the present study was to evaluate the use of pigeon pea (Cajanus cajan) as an appropriate substrate in the production of a legume-based fermented product with Lactobacillus acidophilus ATCC 314 or Lactobacillus casei ATCC 393 and then to ascertain the effects of the addition of ingredients such as powdered milk and banana or strawberry sauce. The products were analyzed for viable cell counts, pH, and sensory attributes during product manufacture and throughout the refrigerated storage period at 3, 7, 14, 21, and 28 days. Nine types of products were produced. At the end of the storage period, the viability of L. acidophilus was above 7 log CFU/g in the presence of milk and 20% sucrose fruit sauce. For products with L. casei, the lack of ingredients such as milk caused no significant loss in viability; however, a high concentration of sucrose in the fruit sauce was an important factor in maintaining a high L. casei population. L. casei had high viability and good sensory attributes. Both strains could be considered suitable for a pigeon pea-based fermented potential probiotic product and a low-cost protein source.

  14. Selective and differential enumerations of Lactobacillus delbrueckii subsp. bulgaricus, Streptococcus thermophilus, Lactobacillus acidophilus, Lactobacillus casei and Bifidobacterium spp. in yoghurt--a review.

    Science.gov (United States)

    Ashraf, Rabia; Shah, Nagendra P

    2011-10-03

    Yoghurt is increasingly being used as a carrier of probiotic bacteria for their potential health benefits. To meet with a recommended level of ≥10(6) viable cells/g of a product, assessment of viability of probiotic bacteria in market preparations is crucial. This requires a working method for selective enumeration of these probiotic bacteria and lactic acid bacteria in yoghurt such as Streptococcus thermophilus, Lactobacillus delbrueckii subsp. bulgaricus, Lb. acidophilus, Lb. casei and Bifidobacterium. This chapter presents an overview of media that could be used for differential and selective enumerations of yoghurt bacteria. De Man Rogosa Sharpe agar containing fructose (MRSF), MRS agar pH 5.2 (MRS 5.2), reinforced clostridial prussian blue agar at pH 5.0 (RCPB 5.0) or reinforced clostridial agar at pH 5.3 (RCA 5.3) are suitable for enumeration of Lb. delbrueckii subsp. bulgaricus when the incubation is carried out at 45°C for 72h. S. thermophilus (ST) agar and M17 are recommended for selective enumeration of S. thermophilus. Selective enumeration of Lb. acidophilus in mixed culture could be made in Rogosa agar added with 5-bromo-4-chloro-3-indolyl-β-d-glucopyranoside (X-Glu) or MRS containing maltose (MRSM) and incubation in a 20% CO2 atmosphere. Lb. casei could be selectively enumerated on specially formulated Lb. casei (LC) agar from products containing yoghurt starter bacteria (S. thermophilus and Lb. delbrueckii subsp. bulgaricus), Lb. acidophilus, Bifidobacterium spp. and Lb. casei. Bifidobacterium could be enumerated on MRS agar supplemented with nalidixic acid, paromomycin, neomycin sulphate and lithium chloride (MRS-NPNL) under anaerobic incubation at 37°C for 72h. Copyright © 2011. Published by Elsevier B.V.

  15. Probiotic cheese containing Lactobacillus rhamnosus HN001 and Lactobacillus acidophilus NCFM® modifies subpopulations of fecal lactobacilli and Clostridium difficile in the elderly.

    Science.gov (United States)

    Lahtinen, Sampo J; Forssten, Sofia; Aakko, Juhani; Granlund, Linda; Rautonen, Nina; Salminen, Seppo; Viitanen, Matti; Ouwehand, Arthur C

    2012-02-01

    Aging is associated with alterations in the intestinal microbiota and with immunosenescence. Probiotics have the potential to modify a selected part of the intestinal microbiota as well as improve immune functions and may, therefore, be particularly beneficial to elderly consumers. In this randomized, controlled cross-over clinical trial, we assessed the effects of a probiotic cheese containing Lactobacillus rhamnosus HN001 and Lactobacillus acidophilus NCFM on the intestinal microbiota and fecal immune markers of 31 elderly volunteers and compared these effects with the administration of the same cheese without probiotics. The probiotic cheese was found to increase the number of L. rhamnosus and L. acidophilus NCFM in the feces, suggesting the survival of the strains during the gastrointestinal transit. Importantly, probiotic cheese administration was associated with a trend towards lower counts of Clostridium difficile in the elderly, as compared with the run-in period with the plain cheese. The effect was statistically significant in the subpopulation of the elderly who harbored C. difficile at the start of the study. The probiotic cheese was not found to significantly alter the levels of the major microbial groups, suggesting that the microbial changes conferred by the probiotic cheese were limited to specific bacterial groups. Despite that the administration of the probiotic cheese to the study population has earlier been shown to significantly improve the innate immunity of the elders, we did not observe measurable changes in the fecal immune IgA concentrations. No increase in fecal calprotectin and β-defensin concentrations suggests that the probiotic treatment did not affect intestinal inflammatory markers. In conclusion, the administration of probiotic cheese containing L. rhamnosus HN001 and L. acidophilus NCFM, was associated with specific changes in the intestinal microbiota, mainly affecting specific subpopulations of intestinal lactobacilli and C

  16. Production of beta-glucosidase and hydrolysis of isoflavone phytoestrogens by Lactobacillus acidophilus, Bifidobacterium lactis, and Lactobacillus casei in soymilk.

    Science.gov (United States)

    Donkor, O N; Shah, N P

    2008-01-01

    The study determined beta-glucosidase activity of commercial probiotic organisms for hydrolysis of isoflavone to aglycones in fermenting soymilk. Soymilk made with soy protein isolate (SPI) was fermented with Lactobacillus acidophilus LAFTI L10, Bifidobacterium lactis LAFTI B94, and Lactobacillus casei LAFTI L26 at 37 degrees C for 48 h and the fermented soymilk was stored for 28 d at 4 degrees C. beta-Glucosidase activity of organisms was determined using rho-nitrophenyl beta-D-glucopyranoside as a substrate and the hydrolysis of isoflavone glycosides to aglycones by these organisms was carried out. The highest level of growth occurred at 12 h for L. casei L26, 24 h for B. lactis B94, and 36 h for L. acidophilus L10 during fermentation in soymilk. Survival after storage at 4 degrees C for 28 d was 20%, 15%, and 11% greater (P < 0.05) than initial cell counts, respectively. All the bacteria produced beta-glucosidase, which hydrolyzed isoflavone beta-glycosides to isoflavone aglycones. The decrease in the concentration of beta-glycosides and the increase in the concentration of aglycones were significant (P < 0.05) in the fermented soymilk. Increased isoflavone aglycone content in fermented soymilk is likely to improve the biological functionality of soymilk.

  17. Structural and functional analysis of the S-layer protein crystallisation domain of Lactobacillus acidophilus ATCC 4356 : evidence for protein : protein interaction of two subdomains

    NARCIS (Netherlands)

    Smit, E.; Jager, D.; Martinez, B.; Tielen, F.J.; Pouwels, P.H.

    2002-01-01

    The structure of the crystallisation domain, SAN, of the S A-protein of Lactobacillus acidophilus ATCC 4356 was analysed by insertion and deletion mutagenesis, and by proteolytic treatment. Mutant S A-protein synthesised in Escherichia coli with 7-13 amino acid insertions near the N terminus or

  18. Investigating the Effect of Growth Phase on the Surface-Layer Associated Proteome of Lactobacillus acidophilus Using Quantitative Proteomics

    Directory of Open Access Journals (Sweden)

    Courtney Klotz

    2017-11-01

    Full Text Available Bacterial surface-layers (S-layers are semi-porous crystalline arrays that self-assemble to form the outermost layer of some cell envelopes. S-layers have been shown to act as scaffolding structures for the display of auxiliary proteins externally. These S-layer associated proteins have recently gained attention in probiotics due to their direct physical contact with the intestinal mucosa and potential role in cell proliferation, adhesion, and immunomodulation. A number of studies have attempted to catalog the S-layer associated proteome of Lactobacillus acidophilus NCFM under a single condition. However, due to the versatility of the cell surface, we chose to employ a multiplexing-based approach with the intention of accurately contrasting multiple conditions. In this study, a previously described lithium chloride isolation protocol was used to release proteins bound to the L. acidophilus S-layer during logarithmic and early stationary growth phases. Protein quantification values were obtained via TMT (tandem mass tag labeling combined with a triple-stage mass spectrometry (MS3 method. Results showed significant growth stage-dependent alterations to the surface-associated proteome while simultaneously highlighting the sensitivity and reproducibility of the technology. Thus, this study establishes a framework for quantifying condition-dependent changes to cell surface proteins that can easily be applied to other S-layer forming bacteria.

  19. Microencapsulation of Lactobacillus acidophilus NCIMB 701748 in matrices containing soluble fibre by spray drying: Technological characterization, storage stability and survival after in vitro digestion☆

    Science.gov (United States)

    Yonekura, Lina; Sun, Han; Soukoulis, Christos; Fisk, Ian

    2014-01-01

    We evaluated sodium alginate, chitosan and hydroxypropyl methylcellulose (HPMC) as co-encapsulants for spray dried Lactobacillus acidophilus NCIMB 701748 by assessing their impact on cell viability and physicochemical properties of the dried powders, viability over 35 days of storage at 25 °C and survival after simulated digestion. Fibres were added to a control carrier medium containing whey protein concentrate, d-glucose and maltodextrin. Sodium alginate and HPMC did not affect cell viability but chitosan reduced viable counts in spray dried powders, as compared to the control. Although chitosan caused large losses of viability during spray-drying, these losses were counteracted by the excellent storage stability compared to control, sodium alginate and HPMC, and the overall effect became positive after the 35-day storage. Chitosan also improved survival rates in simulated GI conditions, however no single fibre could improve L. acidophilus NCIMB 701748 viability in all steps from production through storage and digestion. PMID:24748900

  20. Randomized controlled trial of live lactobacillus acidophilus plus bifidobacterium bifidum in prophylaxis of diarrhea during radiotherapy in cervical cancer patients

    International Nuclear Information System (INIS)

    Chitapanarux, Imjai; Chitapanarux, Taned; Traisathit, Patrinee; Kudumpee, Sudkaneung; Tharavichitkul, Ekkasit; Lorvidhaya, Vicharn

    2010-01-01

    Radiation-induced diarrhea is frequently observed during pelvic radiotherapy. This study was performed to determine the ability of a probiotic containing live lactobacillus acidophilus plus bifidobacterium bifidum to reduce the incidence of radiation-induced diarrhea in locally advanced cervical cancer patients. Patients who were undergoing pelvic radiotherapy concurrent with weekly cisplatin were randomly assigned to a study drug or placebo, in a double-blind study. Diarrhea was graded weekly according the Common Toxicity Criteria (CTC) system. Stool consistency and white and red blood cell count in stool were also assessed. The primary endpoint was to reduce the incidence of diarrhea, defined by a CTC grade 2 or more, and the need for anti-diarrheal medication. A total of 63 patients were enrolled. Grade 2 -3 diarrhea was observed in 45% of the placebo group (n = 31) and 9% of the study drug group (n = 32) (p = 0.002). Anti-diarrheal medication use was significantly reduced in the placebo group (p = 0.03). The patients in the study drug group had a significantly improved stool consistency (p < 0.001). Live lactobacillus acidophilus plus bifidobacterium bifidum reduced the incidence of radiation-induced diarrhea and the need for anti-diarrheal medication and had a significant benefits on stool consistency

  1. Antimicrobial efficacy of Acacia nilotica, Murraya koenigii (L. Sprengel, Eucalyptus hybrid, Psidium guajava extracts and their combination on Streptococcus mutans and Lactobacillus acidophilus

    Directory of Open Access Journals (Sweden)

    B R Chandra Shekar

    2016-01-01

    Conclusion: All the individual plant extracts and their combinations were effective against S. mutans and L. acidophilus. These could be tried as herbal alternates to chlorhexidine. However, these in vitro results have to be further evaluated for any toxicity of the polyherbal combinations in animal models and effectiveness has to be assessed using in vivo studies on humans.

  2. Viability of lactobacillus acidophilus in various vaginal tablet formulations

    Directory of Open Access Journals (Sweden)

    Fazeli M.R.

    2006-07-01

    Full Text Available The lactobacilli which are present in vaginal fluids play an important role in prevention of vaginosis and there are considerable interests in formulation of these friendly bacteria into suitable pharmaceutical dosage forms. Formulating these microorganisms for vaginal application is a critical issue as the products should retain viability of lactobacilli during formulation and also storage. The aim of this study was to examine the viability and release of Lactobacillus acidophilus from slow-release vaginal tablets prepared by using six different retarding polymers and from two effervescent tablets prepared by using citric or adipic acid. The Carbomer–based formulations showed high initial viablility compared to those based on HPMC-LV, HPMC-HV, Polycarbophil and SCMC polymers which showed one log decrease in viable cells. All retarding polymers in slow release formulations presented a strong bacterial release at about 2 h except Carbomer polymers which showed to be poor bacterial releasers. Although effervescent formulations produced a quick bacterial release in comparison with polymer based slow-release tablets, they were less stable in cold storage. Due to the strong chelating characteristic of citric acid, the viability was quickly lost for aqueous medium of citric acid in comparison with adipic acid based effervescent tablets.

  3. Evaluación de las condiciones de cultivo de Lactobacillus acidophilus y Lactobacillus casei a nivel de laboratorio, con inulina como fuente de carbono

    Directory of Open Access Journals (Sweden)

    James, M

    2017-02-01

    Full Text Available Lactobacillus acidophilus y Lactobacillus casei son bacterias ácido lácticas que funcionan como probioticos, generalmente son usadas para la formulación de alimentos funcionales y crecen en condiciones de cultivo similares. Ambas especies de Lactobacillus metabolizan azúcares específicos. La inulina es un fructooligosacárido cuya función prebiótica contribuye a la proliferación de la micro-flora intestinal y evita el crecimiento de microorganismos patógenos. En el presente trabajo se evaluó la concentración de inulina tanto de grado molecular como de grado reactivo, así como el pH del medio en sistemas fermentativos aerobios. Se obtuvo un medio óptimo para el crecimiento de Lactobacillus casei suplementado con 43,1g/L de inulina grado reactivo a un pH de 7,47; para Lactobacillus acidophilus se requiere de mayores estudios para determinar las condiciones óptimas tanto de concentración de inulina como de pH

  4. Report on Japan/Republic of Kazakhstan cooperative research project (March, 1996)

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    Joint technological development was conducted with the purpose of increasing operational efficiency of metal mines (refining of lead, copper, etc.) in Kazakhstan. This paper explains the fiscal 1995 results. Ores and tailings were sampled from three mines, with wastewater sampled from drainage ponds of one plant. The characteristics and conditions of coexistence of various minerals were studied mineralogically, determining the grades of valuable minerals, identifying and analyzing ore minerals. A hydrometallurgical processing was applied to a preliminary test for the purpose of enhancing research efficiency by separating and concentrating effective substances in the mineral samples as much as possible. Performed as leaching tests were a mechanical stirring method (for fine particles), column method (for coarse particles), bacterial method, chalcopyrite method (for tailing), etc.. In the stirring method, about 80% of copper was recovered. In the tailing concentration by the Fe{sup 3+} chalcopyrite method, the quantity and temperature of Fe{sup 3+} as an oxidizing agent affected the rate of concentration of copper. The bacteria leaching test using the sample from the drainage pond revealed existence of Thiobacillus ferrooxidus bacteria that was effective for leaching. (NEDO)

  5. Microbial interspecies electron transfer via electric currents through conductive minerals

    Science.gov (United States)

    Kato, Souichiro; Hashimoto, Kazuhito; Watanabe, Kazuya

    2012-01-01

    In anaerobic biota, reducing equivalents (electrons) are transferred between different species of microbes [interspecies electron transfer (IET)], establishing the basis of cooperative behaviors and community functions. IET mechanisms described so far are based on diffusion of redox chemical species and/or direct contact in cell aggregates. Here, we show another possibility that IET also occurs via electric currents through natural conductive minerals. Our investigation revealed that electrically conductive magnetite nanoparticles facilitated IET from Geobacter sulfurreducens to Thiobacillus denitrificans, accomplishing acetate oxidation coupled to nitrate reduction. This two-species cooperative catabolism also occurred, albeit one order of magnitude slower, in the presence of Fe ions that worked as diffusive redox species. Semiconductive and insulating iron-oxide nanoparticles did not accelerate the cooperative catabolism. Our results suggest that microbes use conductive mineral particles as conduits of electrons, resulting in efficient IET and cooperative catabolism. Furthermore, such natural mineral conduits are considered to provide ecological advantages for users, because their investments in IET can be reduced. Given that conductive minerals are ubiquitously and abundantly present in nature, electric interactions between microbes and conductive minerals may contribute greatly to the coupling of biogeochemical reactions. PMID:22665802

  6. A Comparative Study on the Effect of Flotation Reagents on Growth and Iron Oxidation Activities of Leptospirillum ferrooxidans and Acidithiobacillus ferrooxidans

    Directory of Open Access Journals (Sweden)

    Mohammad Jafari

    2016-12-01

    Full Text Available Recently, extraction of metals from different resources using a simple, efficient, and low-cost technique-known as bioleaching-has been widely considered, and has turned out to be an important global technology. Leptospirillum ferrooxidans and Acidithiobacillus (Thiobacillus ferrooxidans are ubiquitous bacteria in the biomining industry. To date, the effects of commercial flotation reagents on the biooxidation activities of these bacteria have not been thoroughly studied. This investigation, by using various systematic measurement methods, studied the effects of various collectors and frothers (collectors: potassium amylxanthate, potassium isobutyl-xanthate, sodium ethylxanthate, potassium isopropylxanthate, and dithiophosphate; and frothers: pine oil and methyl isobutyl carbinol on L. ferrooxidans and A. ferrooxidans activities. In general, results indicate that in the presence of these collectors and frothers, L. ferrooxidans is less sensitive than T. ferrooxidans. In addition, the inhibition effect of collectors on both bacteria is recommended in the following order: for the collectors, potassium isobutyl-xanthate > dithiophosphate > sodium ethylxanthate > potassium isobutyl-xanthate > potassium amylxanthate; and for the frothers, methyl isobutyl carbinol > pine oil. These results can be used for the optimization of biometallurgical processes or in the early stage of a process design for selection of flotation reagents.

  7. FY 2000 report on the results of the research and development project for utilization of information of high-molecular-weight structures in a living body. Survey on the technological trends of utilizing the reactions with metals in a living body; 2000 nendo seitai kobunshi kozo joho riyo gijutsu kaihatsu chosa hokokusho. 'Seitai kinzoku hanno riyo gijutsu' ni kansuru gijutsu doko chosa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    Described herein are the FY 2000 results of the survey on the technological trends of utilizing the reactions with metals in a living body, noting the bio-processes effectively coping with the environmental problems. The effects of heavy metals on microorganisms have been investigated on the molecular biology level, but are not fully elucidated. Recently, the microorganisms capable of converting inorganic metal ions in water into the insoluble compounds have been known, leading to possibility of bioremediation to solve pollution by heavy metals, which have detrimental effects on human health. Heavy metals must be recovered, because they are not extinct by decomposition. The plant aided purification has been attracting attention to cope with heavy metals accumulated in soil. Application of bacteria-aided leaching, which is adopted as one ore smelting process, to the technologies for utilizing metals in a living body has been expected, because diversified activities of inanimate matters in extreme environments have been known. Recently, bio-machining of metals aided by Thiobacillus ferrooxidans, one species of independent nutrient bacteria capable of eating metals, has been developed to a potentially viable stage. (NEDO)

  8. Compared microbiology of granular sludge under autotrophic, mixotrophic and heterotrophic denitrification conditions.

    Science.gov (United States)

    Fernández, N; Sierra-Alvarez, R; Amils, R; Field, J A; Sanz, J L

    2009-01-01

    Water contamination by nitrate is a wideworld extended phenomena. Biological autotrophic denitrification has a real potential to face this problem and presents less drawbacks than the most extended heterotrophic denitrification. Three bench-scale UASB reactors were operated under autotrophic (R1, H2S as electron donor), mixotrophic (R2, H2S plus p-cresol as electron donors) and heterotrophic (R3, p-cresol as electron donor) conditions using nitrate as terminal electron acceptor. 16S rDNA genetic libraries were built up to compare their microbial biodiversity. Six different bacteria phyla and three archaeal classes were observed. Proteobacteria was the main phyla in all reactors standing out the presence of denitrifiers. Microorganisms similar to Thiobacillus denitrificans and Acidovorax sp. performed the autotrophic denitification. These OTUs were displaced by chemoheterotrophic denitrifiers, especially by Limnobacter-like and Ottowia-like OTUs. Other phyla were Bacteroidetes, Chloroflexi, Firmicutes and Actinobacteria that--as well as Archaea members--were implicated in the degradation of organic matter, as substrate added as coming from endogenous sludge decay under autotrophic conditions. Archaea diversity remained low in all the reactors being Methanosaeta concilii the most abundant one.

  9. Limnobacter thiooxidans gen. nov., sp. nov., a novel thiosulfate-oxidizing bacterium isolated from freshwater lake sediment.

    Science.gov (United States)

    Spring, S; Kämpfer, P; Schleifer, K H

    2001-07-01

    Two novel thiosulfate-oxidizing strains were isolated from sediment of the littoral zone of a freshwater lake (Lake Chiemsee, Bavaria, Germany). The new isolates, designated CS-K1 and CS-K2T, were gram-negative, slightly curved rods with pointed ends that were motile by means of single polar flagella. Both strains were obligately aerobic and grew on a variety of organic substrates, but not autotrophically. The utilization of thiosulfate led to an increase in the growth yield, indicating that these strains were able to grow chemolithoheterotrophically by oxidation of thiosulfate to sulfate. The optimum thiosulfate concentrations for growth were determined to be 10 mM for strain CS-K1 and 20 mM for strain CS-K2T. Phylogenetically, both strains were affiliated to the beta-Proteobacteria. Their characterization by a polyphasic approach resulted in the placement of both strains into a single species that is related only distantly to any known type species. Thus, the creation of a novel taxon is proposed, with the name Limnobacter thiooxidans gen. nov., sp. nov., to include the novel strains. In addition, the phylogenetic position of the chemolithoheterotrophic strain 'Thiobacillus' Q was determined.

  10. FY 2000 report on the results of the research and development project for utilization of information of high-molecular-weight structures in a living body. Survey on the technological trends of utilizing the reactions with metals in a living body; 2000 nendo seitai kobunshi kozo joho riyo gijutsu kaihatsu chosa hokokusho. 'Seitai kinzoku hanno riyo gijutsu' ni kansuru gijutsu doko chosa

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    2001-03-01

    Described herein are the FY 2000 results of the survey on the technological trends of utilizing the reactions with metals in a living body, noting the bio-processes effectively coping with the environmental problems. The effects of heavy metals on microorganisms have been investigated on the molecular biology level, but are not fully elucidated. Recently, the microorganisms capable of converting inorganic metal ions in water into the insoluble compounds have been known, leading to possibility of bioremediation to solve pollution by heavy metals, which have detrimental effects on human health. Heavy metals must be recovered, because they are not extinct by decomposition. The plant aided purification has been attracting attention to cope with heavy metals accumulated in soil. Application of bacteria-aided leaching, which is adopted as one ore smelting process, to the technologies for utilizing metals in a living body has been expected, because diversified activities of inanimate matters in extreme environments have been known. Recently, bio-machining of metals aided by Thiobacillus ferrooxidans, one species of independent nutrient bacteria capable of eating metals, has been developed to a potentially viable stage. (NEDO)

  11. UJI KUALITATIF DAN KUANTITATIF EKSTRAK Sargassum sp. DAN Gracilaria sp. SEBAGAI INHIBITOR BIO-KOROSI PADA BAJA KARBON

    Directory of Open Access Journals (Sweden)

    Isriyanti Affifah

    2016-07-01

    Full Text Available Korosi atau perkaratan logam merupakan proses oksidasi suatu logam dengan udara atau elektrolit. Udara atau elektrolit tersebut akan mengalami reduksi, sehingga proses korosi merupakan proses elektrokimia. Pada penelitian sebelumnya diketahui bahwa korosi yang disebabkan mikroorganisme pengoksidasi besi (Thiobacillus ferooxidans memiliki peranan yang cukup signifikan terhadap kerugian ekonomi bagi industri. Lapisan biofilm yang dihasilkan mikroorganisme pada permukaan logam dapat mengubah karakteristik elektrokimia permukaan logam tersebut dan dapat menginduksi terjadinya korosi. Untuk mengatasi masalah tersebut, pada penelitian ini dilakukan ekstraksi Sargassum sp. dan Gracilaria sp. yang diduga efektif menginhibisi pertumbuhan mikroba pengoksidasi besi (Thibacillus ferooxidans yang biasanya terdapat di bangunan bawah laut. Hasil ekstraksi Sargassum sp. dan Gracilaria sp. menggunakan pelarut metanol-kloroform (1:1 memberikan yield terhadap berat basah sebesar 44,5% dan 36,5%. Ekstrak tersebut diuji bioaktivitasnya terhadap pertumbuhan T. ferooxidans secara kualitatif (kasat mata dan kuantitatif (metode weight-loss. Melalui kurva pertumbuhan diketahui bahwa T. ferooxidans mampu tumbuh sampai hari ke-7 dan mengalami fasa stasioner pada hari ke-8. Analisis metode weight-loss dilakukan menggunakan coupon dengan luas permukaan 3,6 cm2. Hasil analisis menunjukkan bahwa ekstrak Gracilaria sp mampu menginhibisi 29,3% lebih efektif daripada biocide komersial.

  12. Effect of lactobacillus acidophilus combined with iso-malto-oligosaccharide on the intestinal mucosal secretion of SlgA in rat models with antibiotic-associated diarrhea (AAD)

    Energy Technology Data Exchange (ETDEWEB)

    Dan, Du; Lichao, Fang; Bingbo, Chen; Hong, Wei [Third Military Medical Univ., Chongqing (China). Laboratory Animal Center

    2005-02-15

    Objective: To investigate the corrective effect of synbiotic (Lactobacillus acidophilus combined with iso-malto-oligosaccharide) on the decreased intestinal mucosal secretion of SlgA in rat models with antibiotic-associated diarrhea (AAD). Methods: Rat models of AAD were prepared with lincomycin gavage for 6 days. One group of models were left with natural recovery and three other groups were given gavage with different strengths of synbiotic for 7 days. In each group, stool specimens were taken from 6-8 rats for flora examination, then the animals sacrificed and intestinal mucus contents of SIgA determined (with RIA) on d6, d9 and d13. Results: The intestinal flora in rat models of AAD was greatly altered with marked reduction in probiotics. Also, the intestinal mucus contents of SIgA were significantly decreased. Treatment with different strengths of synbiotic (Lactobacillus acidophilus combined with iso-malto-oligosaccharide) would significantly improve the condition with SIgA contents approaching normal. Conclusion: Synbiotic treatment could increase the intestinal mucosal secretion of SIgA with restoration of the mucosal immuno-barrier function in rat models with AAD. (authors)

  13. Effect of lactobacillus acidophilus combined with iso-malto-oligosaccharide on the intestinal mucosal secretion of SlgA in rat models with antibiotic-associated diarrhea (AAD)

    International Nuclear Information System (INIS)

    Du Dan; Fang Lichao; Chen Bingbo; Wei Hong

    2005-01-01

    Objective: To investigate the corrective effect of synbiotic (Lactobacillus acidophilus combined with iso-malto-oligosaccharide) on the decreased intestinal mucosal secretion of SlgA in rat models with antibiotic-associated diarrhea (AAD). Methods: Rat models of AAD were prepared with lincomycin gavage for 6 days. One group of models were left with natural recovery and three other groups were given gavage with different strengths of synbiotic for 7 days. In each group, stool specimens were taken from 6-8 rats for flora examination, then the animals sacrificed and intestinal mucus contents of SIgA determined (with RIA) on d6, d9 and d13. Results: The intestinal flora in rat models of AAD was greatly altered with marked reduction in probiotics. Also, the intestinal mucus contents of SIgA were significantly decreased. Treatment with different strengths of synbiotic (Lactobacillus acidophilus combined with iso-malto-oligosaccharide) would significantly improve the condition with SIgA contents approaching normal. Conclusion: Synbiotic treatment could increase the intestinal mucosal secretion of SIgA with restoration of the mucosal immuno-barrier function in rat models with AAD. (authors)

  14. Teknik Pengawetan Fillet Ikan Nila Merah dengan Senyawa Anti Bakteri asal Lactobacillus Acidophilus dan Bifido Bacteria Biffidum

    Directory of Open Access Journals (Sweden)

    Dede Saputra

    2014-12-01

    Full Text Available Red tilapia is a good commodity to be developed because it has a high nutritional value composition, with a protein content 17.8%, fat 2.8%, and others composition. The fillet of red tilapia fish is easy to spoil, because of S. aureus, Salmonella sp., and other microbes. Many methods are used to save and preserve the quality of fillet, such fillet preparation through good sanitation practices, cooling process, but the effort were not optimal. The objectives of this study were to 1 evaluate the potency of antibacterial produced by Lactobacillus acidophilus and Bifidobacteria biffidum to inhibit the growth of spoilage bacteria that contaminated the red tilapia fillet; 2 evaluate the effect of antibacterial compounds produced by Lactobacillus acidophilus and Bifidobacteria biffidum of inhibiting the setback fillet quality, 3 determine the shelf life of red tilapia fillet at room temperature. Antibacterial activity test is done by using the well diffusion method; the rate of deterioration of quality of fish tests done by observing the organoleptic parameters, pH measurement test, total volatile base method. Total number of bacteria were performed by Standard Plate Count (SPC test. The LAB’s are able to inhibit the growth of spoilage bacteria Pseudomonas aeruginosa about 8.67-9.00 mm and Listeria monocytogenes about 8.33-9.00 mm through the well diffusion method. pH values about 5.71-5.74, TVB values about 1,26-21.43 with SPC test about 1.39-4.83 CFU/mL. The antibacterial compounds could inhibit  the rate of deterioration of quality red tilapia fillets until 14 hours.

  15. Survival of Lactobacillus acidophilus NCFM® and Bifidobacterium lactis HN019 encapsulated in chocolate during in vitro simulated passage of the upper gastrointestinal tract

    DEFF Research Database (Denmark)

    Klindt-Toldam, Stine; Larsen, Susanne K.; Saaby, Lasse

    2016-01-01

    Probiotic microorganisms are exposed to different types of stress both before and after consumption which strongly influences probiotic survival. Here the viability of 2 different probiotic bacteria incorporated in different types of chocolate was investigated during storage and passage of the up......Probiotic microorganisms are exposed to different types of stress both before and after consumption which strongly influences probiotic survival. Here the viability of 2 different probiotic bacteria incorporated in different types of chocolate was investigated during storage and passage...... of the upper gastro-intestinal tract using both a static and a dynamic gastric in vitro model. Lactobacillus acidophilus NCFM® and Bifidobacterium lactis HN019 equalling a total concentration of 2 × 108, 2 × 109 and 2 × 1010 CFU/g chocolate were added to samples of milk chocolate, 57% and 72% dark chocolate...... dairy and juice based probiotic products, chocolate was an excellent carrier for probiotic delivery, because of very good survival of probiotics during simulated passage of the upper GI tract. The viability of B. lactis was slightly higher than Lb. acidophilus and survival rates were >6.5 log CFU...

  16. Effects of Lactobacillus rhamnosus and Lactobacillus acidophilus on bacterial vaginal pathogens.

    Science.gov (United States)

    Bertuccini, Lucia; Russo, Rosario; Iosi, Francesca; Superti, Fabiana

    2017-06-01

    The human vagina is colonized by a variety of microbes. Lactobacilli are the most common, mainly in healthy women; however, the microbiota composition can change rapidly, leading to infection or to a state in which potential pathogenic microorganisms co-exist with other commensals. In premenopausal women, urogenital infections, such as bacterial vaginosis and aerobic vaginitis, remain an important health problem. Treatment of these infections involves different kind of antibiotics; however, the recurrence rate remains high, and it must be also underlined that antibiotics are unable to spontaneously restore normal flora characterized by an abundant community of Lactobacilli. The main limitation is the inability to offer a long-term defensive barrier, thus facilitating relapses and recurrences. We report here the antimicrobial activities of two commercially existing Lactobacillus strains, Lactobacillus rhamnosus HN001 and Lactobacillus acidophilus GLA-14 strains and their combination (Respecta® probiotic blend) against four different pathogens responsible for both bacterial vaginosis ( Gardenerella vaginalis and Atopobium vaginae) and aerobic vaginitis ( Staphylococcus aureus and Escherichia coli) by co-culturing assay. The probiotic combination, even if resulting in a different microbicidal activity against the different strains tested, demonstrated the efficacy of combined Lactobacillus strain treatment.

  17. Effect of dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529) on caecum microbioma and productive performance in broiler chickens

    OpenAIRE

    De Cesare, Alessandra; Sirri, Federico; Manfreda, Gerardo; Moniaci, Paola; Giardini, Alberto; Zampiga, Marco; Meluzzi, Adele

    2017-01-01

    This study examines the effects of the dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529) (LA) on productive performances, incidence of foot pad dermatitis and caecum microbioma in broiler chickens. A total of 1,100 one-day old male Ross 308 chicks were divided into 2 groups of 16 replicates with 25 birds each and reared from 1-41 d. One group was fed a basal diet (CON) and the other group the same diet supplemented with LA. Caecum contents were collected from 4 selecte...

  18. Probiotic Yogurt Culture Bifidobacterium Animalis Subsp. Lactis BB-12 and Lactobacillus Acidophilus LA-5 Modulate the Cytokine Secretion by Peripheral Blood Mononuclear Cells from Patients with Ulcerative Colitis.

    Science.gov (United States)

    Sheikhi, A; Shakerian, M; Giti, H; Baghaeifar, M; Jafarzadeh, A; Ghaed, V; Heibor, M R; Baharifar, N; Dadafarin, Z; Bashirpour, G

    2016-06-01

    There are some evidences for the immunomodulation disorders in the response to intestinal microbiota in inflammatory bowel disease. Yogurt is a fermented milk product made with a starter culture consisting of different probiotics which could be colonized in intestine. However, the role of probiotics in the aetiopathogenesis of ulcerative colitis (UC) has not been clarified. To determine how the immune system responds to these bacteria this study was planned. Bifidobacterium lactis BB-12 (B. lactis) and Lactobacillus acidophilus LA-5 (L. acidophilus) were cultivated on MRS broth. PBMCs of 36 UC patients were separated by Ficoll-Hypaque centrifugation and co-cultured with different concentrations of UV killed bacteria in RPMI-1 640 plus 10% FCS for 48/72 h. IL-10, TGF-β, IFN-γ and TNF-α were measured in supernatant of PBMCs by ELISA. Both bacteria significantly augmented IL-10, TGF-β, IFN-γ and TNF-α compared to control (p<0.001). The secretion levels of IL-10 and TGF-β by B. lactis- compared to L. acidophilus-stimulated PBMCs were significantly higher (p<0.05, p<0.01 respectively). The secretion levels of TNF-α and IFN-γ by PBMCs after 72 h were significantly lower compared to 48 h stimulation by B. lactis (p<0.001, p<0.035 respectively). These data show that both probiotics may trigger the pro- and anti-inflammatory immune response of UC patients. It seems that IL-10/TGF-β uprising by B. lactis could be the reason of TNF-α/IFN-γ reduction. Therefore albeit B. lactis still stimulates the effector Th cells but because of more stimulatory effect on Tregs, it could be a good potential therapeutic candidate for further investigation. © Georg Thieme Verlag KG Stuttgart · New York.

  19. The S-layer Associated Serine Protease Homolog PrtX Impacts Cell Surface-Mediated Microbe-Host Interactions of Lactobacillus acidophilus NCFM

    Directory of Open Access Journals (Sweden)

    Brant R. Johnson

    2017-06-01

    Full Text Available Health-promoting aspects attributed to probiotic microorganisms, including adhesion to intestinal epithelia and modulation of the host mucosal immune system, are mediated by proteins found on the bacterial cell surface. Notably, certain probiotic and commensal bacteria contain a surface (S- layer as the outermost stratum of the cell wall. S-layers are non-covalently bound semi-porous, crystalline arrays of self-assembling, proteinaceous subunits called S-layer proteins (SLPs. Recent evidence has shown that multiple proteins are non-covalently co-localized within the S-layer, designated S-layer associated proteins (SLAPs. In Lactobacillus acidophilus NCFM, SLP and SLAPs have been implicated in both mucosal immunomodulation and adhesion to the host intestinal epithelium. In this study, a S-layer associated serine protease homolog, PrtX (prtX, lba1578, was deleted from the chromosome of L. acidophilus NCFM. Compared to the parent strain, the PrtX-deficient strain (ΔprtX demonstrated increased autoaggregation, an altered cellular morphology, and pleiotropic increases in adhesion to mucin and fibronectin, in vitro. Furthermore, ΔprtX demonstrated increased in vitro immune stimulation of IL-6, IL-12, and IL-10 compared to wild-type, when exposed to mouse dendritic cells. Finally, in vivo colonization of germ-free mice with ΔprtX led to an increase in epithelial barrier integrity. The absence of PrtX within the exoproteome of a ΔprtX strain caused morphological changes, resulting in a pleiotropic increase of the organisms’ immunomodulatory properties and interactions with some intestinal epithelial cell components.

  20. Mucosal Immunogenicity of Genetically Modified Lactobacillus acidophilus Expressing an HIV-1 Epitope within the Surface Layer Protein.

    Directory of Open Access Journals (Sweden)

    Akinobu Kajikawa

    Full Text Available Surface layer proteins of probiotic lactobacilli are theoretically efficient epitope-displaying scaffolds for oral vaccine delivery due to their high expression levels and surface localization. In this study, we constructed genetically modified Lactobacillus acidophilus strains expressing the membrane proximal external region (MPER from human immunodeficiency virus type 1 (HIV-1 within the context of the major S-layer protein, SlpA. Intragastric immunization of mice with the recombinants induced MPER-specific and S-layer protein-specific antibodies in serum and mucosal secretions. Moreover, analysis of systemic SlpA-specific cytokines revealed that the responses appeared to be Th1 and Th17 dominant. These findings demonstrated the potential use of the Lactobacillus S-layer protein for development of oral vaccines targeting specific peptides.

  1. An extracellular cell-attached pullulanase confers branched α-glucan utilization in human gut Lactobacillus acidophilus

    DEFF Research Database (Denmark)

    Møller, Marie Sofie; Goh, Yong Jun; Rasmussen, Kasper Bøwig

    2017-01-01

    binding modules, a domain of unknown function, and a C-terminal surface layer association protein (SLAP) domain. Here we explore the specificity of a representative of this group of pullulanases, LaPul13_14 and its role in branched α-glucans metabolism in the well characterized Lactobacillus acidophilus...... in the presence of α-glucans but was repressed by glucose. The debranching activity is conferred exclusively by LaPul13_14 and is abolished in a mutant strain lacking a functional LaPul13_14 gene. Hydrolysis kinetics of recombinant LaPul13_14 confirmed the preference for short branched α-glucan oligomers....... Branched α-1,6-glucans in dietary starch and glycogen are non-degradable by human enzymes and constitute a metabolic resource for the gut microbiota. The role of health-beneficial lactobacilli prevalent in the human small intestine in starch metabolism remains unexplored in contrast to colonic bacterial...

  2. FY 1995 report on the cooperative research on the development of environmentally friendly high efficiency mineral resource extraction/treatment technology; 1995 nendo kankyo chowagata kokoritsu kobutsu shigen chushutsu shori gijutsu no kaihatsu ni kansuru kenkyu kyoryoku hokokusho

    Energy Technology Data Exchange (ETDEWEB)

    NONE

    1996-03-01

    This promotion project on the cooperative research aims to efficiently extract and recover valuable metals (gold, silver, copper, rare metal, etc.) including in large quantity in tailings of ores in the Republic of Kazakhstan. In FY 1995, conducted were the field survey, support study in Japan, acceptance of researchers from Kazakhstan, conceptual design of pilot plant, etc. The ore/mineral for Cu is mainly an alteration ore of chalcopyrite. Au and Ag are low grade and unknown, and the main gangue mineral is pyrite. The low grade ore (waste/much) of the Nikolayevska mine has a tendency to leaching at normal temperature, but the ore of mostly chalcopyrite such as tailings from each place has difficulty in leaching. It gets leaching by increasing temperature. The more the temperature rises, the more conspicuous the reaction becomes. Further, chalcopyrite is leached with priority over pyrite. From the result, a technical potentiality was obtained of leaching of low grade chalcopyrite in tailings mostly of pyrite. The existence of Thiobacillus ferrooxidans was confirmed. As to the recovery method for Au and Ag, CIC is studied. The process of waste/much is solvent extraction, electrowinning study and leaching, and that of tailings is bacteria leaching and leaching study. (NEDO)

  3. From lithotroph- to organotroph-dominant: directional shift of microbial community in sulphidic tailings during phytostabilization

    Science.gov (United States)

    Li, Xiaofang; Bond, Philip L.; Van Nostrand, Joy D.; Zhou, Jizhong; Huang, Longbin

    2015-01-01

    Engineering microbial diversity to enhance soil functions may improve the success of direct revegetation in sulphidic mine tailings. Therefore, it is essential to explore how remediation and initial plant establishment can alter microbial communities, and, which edaphic factors control these changes under field conditions. A long-term revegetation trial was established at a Pb-Zn-Cu tailings impoundment in northwest Queensland. The control and amended and/or revegetated treatments were sampled from the 3-year-old trial. In total, 24 samples were examined using pyrosequencing of 16S rRNA genes and various chemical properties. The results showed that the microbial diversity was positively controlled by soil soluble Si and negatively controlled by soluble S, total Fe and total As, implying that pyrite weathering posed a substantial stress on microbial development in the tailings. All treatments were dominated by typical extremophiles and lithotrophs, typically Truepera, Thiobacillus, Rubrobacter; significant increases in microbial diversity, biomass and frequency of organotrophic genera (typically Nocardioides and Altererythrobacter) were detected in the revegetated and amended treatment. We concluded that appropriate phytostabilization options have the potential to drive the microbial diversity and community structure in the tailings toward those of natural soils, however, inherent environmental stressors may limit such changes. PMID:26268667

  4. Report on assessment of the mechanism of bacterially assisted oxidation of pyritic uranium tailings

    International Nuclear Information System (INIS)

    Halbert, B.B.; Scharer, J.M.; Knapp, R.A.

    1984-07-01

    The oxidation of pyritic minerals has been shown to be catalyzed by the presence of iron- and sulphur-oxidizing bacteria. Thiobacillus ferroxidans plays the most significant role in the formation and propagation of acidic conditions. Optimum growth conditions for the T. ferroxidans occurs at a temperature of 35 degrees C and pH of 2 to 3. Bacterially assisted oxidation of pyrite involves both direct and indirect contact mechanisms. The direct contact mechanism entails enzymatic oxidation of the insoluble sulphide moiety. The indirect mechanism involves bacterial oxidation of the dissolved ferrous component to the ferric state. The ferric iron, in turn, acts as the prime oxidant of pyrite and is reduced to ferrous iron. The re-oxidation of the dissolved ferrous component which is catalyzed by bacterial activity, completes the cyclic process. The rate of bacterial oxidation is affected by: the geochemistry and reactivity of the pyritic material; the amount of pyrite present in the waste material and the exposed surface area of the pyritic component; the availability of oxygen and carbon dioxide; the pH and temperature of the leach solution; and the presence (or absence) of organic inhibitors. Of the above factors, oxygen has been frequently identified as the rate limiting reactant in tailings

  5. Thermophilic prokaryotic communities inhabiting the biofilm and well water of a thermal karst system located in Budapest (Hungary).

    Science.gov (United States)

    Anda, Dóra; Makk, Judit; Krett, Gergely; Jurecska, Laura; Márialigeti, Károly; Mádl-Szőnyi, Judit; Borsodi, Andrea K

    2015-07-01

    In this study, scanning electron microscopy (SEM) and 16S rRNA gene-based phylogenetic approach were applied to reveal the morphological structure and genetic diversity of thermophilic prokaryotic communities of a thermal karst well located in Budapest (Hungary). Bacterial and archaeal diversity of the well water (73.7 °C) and the biofilm developed on the inner surface of an outflow pipeline of the well were studied by molecular cloning method. According to the SEM images calcium carbonate minerals serve as a surface for colonization of bacterial aggregates. The vast majority of the bacterial and archaeal clones showed the highest sequence similarities to chemolithoautotrophic species. The bacterial clone libraries were dominated by sulfur oxidizer Thiobacillus (Betaproteobacteria) in the water and Sulfurihydrogenibium (Aquificae) in the biofilm. A relatively high proportion of molecular clones represented genera Thermus and Bellilinea in the biofilm library. The most abundant phylotypes both in water and biofilm archaeal clone libraries were closely related to thermophilic ammonia oxidizer Nitrosocaldus and Nitrososphaera but phylotypes belonging to methanogens were also detected. The results show that in addition to the bacterial sulfur and hydrogen oxidation, mainly archaeal ammonia oxidation may play a decisive role in the studied thermal karst system.

  6. Characterization of the bacterial community in a biotrickling filter treating high loads of H(2)S by molecular biology tools.

    Science.gov (United States)

    Maestre, Juan P; Rovira, Roger; Gamisans, Xavier; Kinney, Kerry A; Kirisits, Mary Jo; Lafuente, Javier; Gabriel, David

    2009-01-01

    The diversity and spatial distribution of bacteria in a lab-scale biotrickling filter treating high loads of hydrogen sulfide (H(2)S) were investigated. Diversity and community structure were studied by terminal-restriction fragment length polymorphism (T-RFLP). A 16S rRNA gene clone library was established. Near Full-length 16S rRNA gene sequences were obtained, and clones were clustered into 24 operational taxonomic units (OTUs). Nearly 74% and 26% of the clones were affiliated with the phyla Proteobacteria and Bacteroidetes, respectively. Beta-, epsilon- and gamma-proteobacteria accounted for 15, 9 and 48%, respectively. Around 45% of the sequences retrieved were affiliated to bacteria of the sulfur cycle including Thiothrix spp., Thiobacillus spp. and Sulfurimonas denitrificans. Sequences related to Thiothrix lacustris accounted for a 38%. Rarefaction curve demonstrated that clone library constructed can be sufficient to describe the vast majority of the bacterial diversity of this reactor operating under strict conditions (2,000 ppm(v) of H(2)S). A spatial distribution of bacteria was found along the length of the reactor by means of the T-RFLP technique. Although aerobic species were predominant along the reactor, facultative anaerobes had a major relative abundance in the inlet part of the reactor, where the sulfide to oxygen ratio is higher.

  7. Bacterial community composition characterization of a lead-contaminated Microcoleus sp. consortium.

    Science.gov (United States)

    Giloteaux, Ludovic; Solé, Antoni; Esteve, Isabel; Duran, Robert

    2011-08-01

    A Microcoleus sp. consortium, obtained from the Ebro delta microbial mat, was maintained under different conditions including uncontaminated, lead-contaminated, and acidic conditions. Terminal restriction fragment length polymorphism and 16S rRNA gene library analyses were performed in order to determine the effect of lead and culture conditions on the Microcoleus sp. consortium. The bacterial composition inside the consortium revealed low diversity and the presence of specific terminal-restriction fragments under lead conditions. 16S rRNA gene library analyses showed that members of the consortium were affiliated to the Alpha, Beta, and Gammaproteobacteria and Cyanobacteria. Sequences closely related to Achromobacter spp., Alcaligenes faecalis, and Thiobacillus species were exclusively found under lead conditions while sequences related to Geitlerinema sp., a cyanobacterium belonging to the Oscillatoriales, were not found in presence of lead. This result showed a strong lead selection of the bacterial members present in the Microcoleus sp. consortium. Several of the 16S rRNA sequences were affiliated to nitrogen-fixing microorganisms including members of the Rhizobiaceae and the Sphingomonadaceae. Additionally, confocal laser scanning microscopy and scanning and transmission electron microscopy showed that under lead-contaminated condition Microcoleus sp. cells were grouped and the number of electrodense intracytoplasmic inclusions was increased.

  8. Utilisation of Food and Woodworking Production By-products by Composting

    Directory of Open Access Journals (Sweden)

    Uldis Viesturs

    2004-10-01

    Full Text Available The purpose of the study was to develop laboratory-scale technologies for composting milk/cheese whey, spent liquor, brewery yeast, fish processing by-products, etc., adding these by-products and special microorganism associations to the basic material - sawdust, bark, etc., also arranging different experimental composting sites. Two Trichoderma strains (Tr. lignorum, Tr. viride and a nitrification association for regulating the circulation of nitrogen-ammonification and nitrification processes were applied. Monitoring of the composting quality was realised by microbiological and chemical analyses, and biotests for compost quality (toxicity assessment. For purifying the polluted air from the composting facilities, the biofiltration technique was realised in a modified SSF system. Biodegradation of ammonia was investigated in a two-stage system with the inert packing material - dolomite broken bricks, and hemoautotrophic microorganisms: DN-1 (Pseudomonas sp., DN-2 (Nitrosomonas sp., DN-3 (Nitrobacter sp. and DN-13 (Sarcina sp.. For hydrogen sulphide biodegradation, Thiobacillus thioparus-3 was immobilised on glass bricks as the carrier material. Biodegradation efficiency of hydrogen sulphide was 87%. Biodegradation of ammonia in the first step in the two-stage system reached 77%, degradation of the gas remaining in the second step was 75%. Compost's quality was similar to black soil - brown-coloured, with good soil odour and without toxic compounds.

  9. An examination of sulfur polymer cement as a waste encapsulation agent

    International Nuclear Information System (INIS)

    McNew, E.B.

    1995-01-01

    Sulfur polymer cement (SPC) is a unique material having potential applications for hazardous and radioactive waste encapsulation. This material was originally developed by the US Bureau of Mines as an acid and chemical resistant construction cement and has since been applied in tie waste encapsulation field. The material is easily prepared from elemental sulfur and organic dienes. It is an easy to use low-viscosity thermoplastic, and has many favorable properties such as low porosity, high compressive strength, and resistance to chemical attack. The results of several invetigations on this material will be discussed, and include: (1) the chemical form and physical structure of the material, (2) the compressive strength of cylindrical test samples after gamma radiation testing, (3) the aqueous leaching behavior of lead, cerium, cesium, cobalt, and strontium from SPC-ash mixtures at room and elevated temperatures, (4) the casting compatibility of mixtures of SPC with different waste materials, (5) the ability of SPC to encapsulate elemental mercury contaminated soils, (6) laboratory and field studies of SPC biocorrosion by Thiobacillus bacteria, (7) small scale (10 kg) SPC-ash monolith casting studies, and (8) methods for the formulation of a grade of SPC more applicable to the encapsulation of aggregate waste materials

  10. Bacterial diversity in the active stage of a bioremediation system for mineral oil hydrocarbon-contaminated soils.

    Science.gov (United States)

    Popp, Nicole; Schlömann, Michael; Mau, Margit

    2006-11-01

    Soils contaminated with mineral oil hydrocarbons are often cleaned in off-site bioremediation systems. In order to find out which bacteria are active during the degradation phase in such systems, the diversity of the active microflora in a degrading soil remediation system was investigated by small-subunit (SSU) rRNA analysis. Two sequential RNA extracts from one soil sample were generated by a procedure incorporating bead beating. Both extracts were analysed separately by generating individual SSU rDNA clone libraries from cDNA of the two extracts. The sequencing results showed moderate diversity. The two clone libraries were dominated by Gammaproteobacteria, especially Pseudomonas spp. Alphaproteobacteria and Betaproteobacteria were two other large groups in the clone libraries. Actinobacteria, Firmicutes, Bacteroidetes and Epsilonproteobacteria were detected in lower numbers. The obtained sequences were predominantly related to genera for which cultivated representatives have been described, but were often clustered together in the phylogenetic tree, and the sequences that were most similar were originally obtained from soils and not from pure cultures. Most of the dominant genera in the clone libraries, e.g. Pseudomonas, Acinetobacter, Sphingomonas, Acidovorax and Thiobacillus, had already been detected in (mineral oil hydrocarbon) contaminated environmental samples. The occurrence of the genera Zymomonas and Rhodoferax was novel in mineral oil hydrocarbon-contaminated soil.

  11. Bioreactor microbial ecosystems for thiocyanate and cyanide degradation unravelled with genome-resolved metagenomics.

    Science.gov (United States)

    Kantor, Rose S; van Zyl, A Wynand; van Hille, Robert P; Thomas, Brian C; Harrison, Susan T L; Banfield, Jillian F

    2015-12-01

    Gold ore processing uses cyanide (CN(-) ), which often results in large volumes of thiocyanate- (SCN(-) ) contaminated wastewater requiring treatment. Microbial communities can degrade SCN(-) and CN(-) , but little is known about their membership and metabolic potential. Microbial-based remediation strategies will benefit from an ecological understanding of organisms involved in the breakdown of SCN(-) and CN(-) into sulfur, carbon and nitrogen compounds. We performed metagenomic analysis of samples from two laboratory-scale bioreactors used to study SCN(-) and CN(-) degradation. Community analysis revealed the dominance of Thiobacillus spp., whose genomes harbour a previously unreported operon for SCN(-) degradation. Genome-based metabolic predictions suggest that a large portion of each bioreactor community is autotrophic, relying not on molasses in reactor feed but using energy gained from oxidation of sulfur compounds produced during SCN(-) degradation. Heterotrophs, including a bacterium from a previously uncharacterized phylum, compose a smaller portion of the reactor community. Predation by phage and eukaryotes is predicted to affect community dynamics. Genes for ammonium oxidation and denitrification were detected, indicating the potential for nitrogen removal, as required for complete remediation of wastewater. These findings suggest optimization strategies for reactor design, such as improved aerobic/anaerobic partitioning and elimination of organic carbon from reactor feed. © 2015 Society for Applied Microbiology and John Wiley & Sons Ltd.

  12. Biotechnical leaching of lean ores using heterotrophic microorganisms

    International Nuclear Information System (INIS)

    Schwartz, W.; Naeveke, R.

    1980-01-01

    After reporting briefly on leaching with Thiobacillus, it is discussed whether in those cases where thiobacilli fail to work the limits of microbial leaching are reached or still other groups of microorganisms will be suitable. In this relation the great number of carbon-heterotrophic fungi and bacteria have to be considered which are partly oligotrophic and occur e.g. in weathering biotopes of rocks and minerals and which may even include heavy metals in the dissolving processes of weathering. The active agents are, as far as is known up to now, organic acids which are produced by microorganisms and given off to the medium where they may combine with metals to form water-soluble complex compounds. In order to detect and isolate suitable strains of fungi and bacteria it will be necessary to work out a screening program which proceeds from general to special selections. Experiments to identify the active agents and the conditions of their production will have to follow. It remains still an open question whether such studies will result in technical processes. Mass production processes which are possible with the carbon-autotrophic and acidophilic thiobacilli are less probable than special processes to get hold of rare and economically valuable metals whose extraction would be difficult by other means. (orig.) [de

  13. Death of Lactobacillus acidophilus caused by incorporated /sup 3/H-thymine during incubation without amino acids

    Energy Technology Data Exchange (ETDEWEB)

    Koukalova, B [Ceskoslovenska Akademie Ved, Brno. Biofysikalni Ustav

    1976-01-01

    If the cells of Lactobacillus acidophilus R-26 incorporated /sup 3/H-thymine (specific radioactivity 1.57 Ci/mmol or 3.15 Ci/mmol), their transfer to a medium without essential amino acids resulted in their death. This death may result from cell damage caused by the disintegration of tritium which cannot be effectively repaired under conditions of amino acid deprivation. Experimental conditions make it possible to explain this death either as a result of the inhibition of protein or RNA synthesis, or of the absence of amino acids. These possibilities were tested in experiments, in which the synthesis of proteins and RNA was inhibited by specific inhibitors in the presence of amino acids. Under these conditions no death of cells was detected, thus indicating that free amino acids are important in the repair of radiation damage.

  14. Peripheral Light-Harvesting LH2 Complex Can Be Assembled in Cells of Nonsulfur Purple Bacterium Rhodoblastus acidophilus without Carotenoids.

    Science.gov (United States)

    Bol'shakov, M A; Ashikhmin, A A; Makhneva, Z K; Moskalenko, A A

    2015-09-01

    The effect of carotenoids on the assembly of LH2 complex in cells of the purple nonsulfur bacterium Rhodoblastus acidophilus was investigated. For this purpose, the bacterial culture was cultivated with an inhibitor of carotenoid biosynthesis - 71 µM diphenylamine (DPA). The inhibitor decreased the level of biosynthesis of the colored carotenoids in membranes by ~58%. It was found that a large amount of phytoene was accumulated in them. This carotenoid precursor was bound nonspecifically to LH2 complex and did not stabilize its structure. Thermostability testing of the isolated LH2 complex together with analysis of carotenoid composition revealed that the population of this complex was heterogeneous with respect to carotenoid composition. One fraction of the LH2 complex with carotenoid content around 90% remains stable and was not destroyed under heating for 15 min at 50°C. The other fraction of LH2 complex containing on average less than one molecule of carotenoid per complex was destroyed under heating, forming a zone of free pigments (and polypeptides). The data suggest that a certain part of the LH2 complexes is assembled without carotenoids in cells of the nonsulfur bacterium Rbl. acidophilus grown with DPA. These data contradict the fact that the LH2 complex from nonsulfur bacteria cannot be assembled without carotenoids, but on the other hand, they are in good agreement with the results demonstrated in our earlier studies of the sulfur bacteria Allochromatium minutissimum and Ectothiorhodospira haloalkaliphila. Carotenoidless LH2 complex was obtained from these bacteria with the use of DPA (Moskalenko, A. A., and Makhneva, Z. K. (2012) J. Photochem. Photobiol., 108, 1-7; Ashikhmin, A., et al. (2014) Photosynth. Res., 119, 291-303).

  15. Viability of Lactobacillus acidophilus LA-5 and Bifidobacterium bifidum BB-12 in Rice Pudding

    Directory of Open Access Journals (Sweden)

    Tulay Ozcan

    2010-06-01

    Full Text Available The purpose of this study was to determine the survival of two probiotic micro-organisms (Lactobacillus acidophilus LA-5 and Bifidobacterium bifidum BB-12 in a rice pudding, the impact of these bacteria on hygienic quality, and to verify the perspectives of the product with regard to consumer sensorial acceptance. The products were monitored for the microbial population, pH, titratable acidity and consistency, during storage at 4±1 °C for up to 21 days. Sensory preference was also tested. Even though the viability of the probiotic bacteria was reduced over 21 days of storage, the viable cell concentrations were still sufficient to obtain the desired therapeutic impact. The counts of yeasts-moulds and Staphylococcus spp. decreased in samples with added probiotic bacteria. The sensorial properties of probiotic rice pudding demonstrated similar acceptability to the control up to 14 days and declined thereafter. Rice pudding was considered suitable food for the delivery of probiotic micro-organisms, with sufficient viability and acceptable sensory characteristics.

  16. Application of Lactobacillus acidophilus (LA 5) strain in fruit-based ice cream.

    Science.gov (United States)

    Senanayake, Suraji A; Fernando, Sirimali; Bamunuarachchi, Arthur; Arsekularatne, Mariam

    2013-11-01

    A study was performed to apply a probiotic strain into fermented ice cream mix with suitable fruit bases to develop a value-added product with a substantial level of viable organisms for a sufficient shelf life. Pure direct vat strain culture of Lactobacillus acidophilus (LA 5) in freeze-dried form was inoculated into a mixture of ice cream, frozen, and the number of viable organisms during frozen storage for a period of time was enumerated, using turbidity measurements with a spectrophotometer. An ice cream sample prepared without the probiotic culture was compared with the test sample for quality, by testing the basic quality parameters for ice cream. Results show a reduction in the over run of the probiotic ice cream compared to the nonprobiotic ice cream. Significantly high level (P ice cream. Significantly low pH level in the probiotic sample may be due to the lactic acid produced by the probiotic culture. No significant difference (P > 0.05) in the fat content in the two types of ice cream was observed. A significantly low level (P ice cream. Results show the presence of a sufficient number of viable organisms in the product for the 10-week period, which would be beneficial to consumers.

  17. Dietary Lactobacillus acidophilus positively influences growth performance, gut morphology, and gut microbiology in rurally reared chickens.

    Science.gov (United States)

    Forte, C; Manuali, E; Abbate, Y; Papa, P; Vieceli, L; Tentellini, M; Trabalza-Marinucci, M; Moscati, L

    2018-03-01

    In a market undergoing constant evolution, the production of chicken meat that consumers would perceive as "natural" and "animal friendly" is crucial. The use of probiotics in rurally reared chickens could represent a major opportunity to achieve mutual benefit for both the industry and consumers. A total of 264 male Kabir chicks were randomly distributed to one of 2 dietary treatments: the L group received a commercial feed supplemented with 2.0 g/100 kg of Lactobacillus acidophilus D2/CSL, while the C group received the same basal diet without the additive. To assess the effects of probiotic supplementation in the chickens' diet, productive performance was evaluated at d 21 and 42, whereas microbiological analyses of the intestinal content and intestinal histology and morphometry were performed at the end of the trial (d 42). At d 21 and 42, L birds showed better (P D2/CSL (CECT 4529) in rurally reared chicken breeds with positive effects on performance and gut health.

  18. Development of effervescent products, in powder and tablet form, supplemented with probiotics Lactobacillus acidophilus and Saccharomyces boulardii

    Directory of Open Access Journals (Sweden)

    Agnes Izumi Nagashima

    2013-12-01

    Full Text Available Probiotics are living microorganisms, which when administered in adequate amounts confer health benefits on the host through a beneficial influence on the intestinal microbiota related to competition and to antagonistic and immunological effects. Thus, the objective of this study was the development of effervescent products (tablets and powder supplemented with the probiotics Lactobacillus acidophilus and Saccharomyces boulardii, and the identification of the best formulation in terms of viability of these microorganisms. The physical properties of the tablets (compressive force applied, mean weight, hardness, and friability were assessed, and the viability of the microorganisms in the gastrointestinal tract and their stability during storage were also determined. The results show that the microorganisms remained stable and viable during the 60-day storage period in the effervescent powder. However, the results indicated that the effect of compression force affected the viability of the microorganisms during the production of the effervescent tablets.

  19. Synbiotic yogurt-ice cream produced via incorporation of microencapsulated lactobacillus acidophilus (la-5) and fructooligosaccharide.

    Science.gov (United States)

    Ahmadi, Abbas; Milani, Elnaz; Madadlou, Ashkan; Mortazavi, Seyed Ali; Mokarram, Reza Rezaei; Salarbashi, Davoud

    2014-08-01

    Yogurt-ice cream is a nutritious product with a refreshing taste and durability profoundly longer than that of yogurt. The probiotic Lactobacillus acidophilus (La-5) cells either in free or encapsulated form were incorporated into yog-ice cream and their survivability were studied. Fructooligosaccharide (FOS) as a prebiotic compound at three levels (0, 4 & 8 % w/w) was added to yogurt-ice cream mix and its effects on some chemical properties, overrun and firmness of product were evaluated. The higher the incorporated FOS concentration, the lower were the pH value and higher the total solid content of treatments. FOS incorporation (8 %) significantly increased the overrun of treatments and reduced their firmness. The viable counts of free probiotics decreased from ~9.55 to ~7.3 log cfu/g after 60 days of frozen storage while that of encapsulated cells merely decreased less than 1 log cycle. Encapsulation with alginate microbeads protected the probiotic cells against injuries in the freezing stage as well as, during frozen storage.

  20. Effect of dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529 on caecum microbioma and productive performance in broiler chickens.

    Directory of Open Access Journals (Sweden)

    Alessandra De Cesare

    Full Text Available This study examines the effects of the dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529 (LA on productive performances, incidence of foot pad dermatitis and caecum microbioma in broiler chickens. A total of 1,100 one-day old male Ross 308 chicks were divided into 2 groups of 16 replicates with 25 birds each and reared from 1-41 d. One group was fed a basal diet (CON and the other group the same diet supplemented with LA. Caecum contents were collected from 4 selected birds at day one and 5 selected birds at the end of the rearing period. Then, they were submitted to DNA extraction and whole DNA shotgun metagenomic sequencing. Overall, the LA supplementation produced a significant beneficial effect on body weight gain between 15-28 d and improved feed conversion rate in the overall period. On the contrary, litter moisture, pH and incidence of the foot pad lesions were not affected by LA. Birds treated with LA showed a lower occurrence of pasty vent at both 14 and 28 d. At the end of the rearing period, Lachanospiraceae were significantly higher in LA birds in comparison to CON (17.07 vs 14.39%; P = 0.036. Moreover, Ruminococcus obeum, Clostridium clostridioforme, Roseburia intestinalis, Lachnospiraceae bacterium 14-2T and Coprococcus eutactus were significantly higher in LA birds in comparison to CON. The relative abundance of Lactobacillus acidophilus was comparable between LA and CON groups. However, a positive effect was observed in relation to the metabolic functions in the treated group, with particular reference to the higher abundance of β-glucosidase. In conclusion, the LA supplementation improved broiler productive performances and metabolic functions promoting animal health.

  1. Effect of dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529) on caecum microbioma and productive performance in broiler chickens.

    Science.gov (United States)

    De Cesare, Alessandra; Sirri, Federico; Manfreda, Gerardo; Moniaci, Paola; Giardini, Alberto; Zampiga, Marco; Meluzzi, Adele

    2017-01-01

    This study examines the effects of the dietary supplementation with Lactobacillus acidophilus D2/CSL (CECT 4529) (LA) on productive performances, incidence of foot pad dermatitis and caecum microbioma in broiler chickens. A total of 1,100 one-day old male Ross 308 chicks were divided into 2 groups of 16 replicates with 25 birds each and reared from 1-41 d. One group was fed a basal diet (CON) and the other group the same diet supplemented with LA. Caecum contents were collected from 4 selected birds at day one and 5 selected birds at the end of the rearing period. Then, they were submitted to DNA extraction and whole DNA shotgun metagenomic sequencing. Overall, the LA supplementation produced a significant beneficial effect on body weight gain between 15-28 d and improved feed conversion rate in the overall period. On the contrary, litter moisture, pH and incidence of the foot pad lesions were not affected by LA. Birds treated with LA showed a lower occurrence of pasty vent at both 14 and 28 d. At the end of the rearing period, Lachanospiraceae were significantly higher in LA birds in comparison to CON (17.07 vs 14.39%; P = 0.036). Moreover, Ruminococcus obeum, Clostridium clostridioforme, Roseburia intestinalis, Lachnospiraceae bacterium 14-2T and Coprococcus eutactus were significantly higher in LA birds in comparison to CON. The relative abundance of Lactobacillus acidophilus was comparable between LA and CON groups. However, a positive effect was observed in relation to the metabolic functions in the treated group, with particular reference to the higher abundance of β-glucosidase. In conclusion, the LA supplementation improved broiler productive performances and metabolic functions promoting animal health.

  2. THE USE OF A DOMESTIC PROBIOTIC WITH LACTOBACILLUS ACIDOPHILUS FOR THE TREATMENT OF ACUTE INTESTINAL INFECTIONS AND OTHER PATHOLOGIES IN CHILDREN

    Directory of Open Access Journals (Sweden)

    A. A. Novokshonov

    2017-01-01

    Full Text Available The results of studies showing the effectiveness of the use of the domestic probiotic Acipol containing Lactobacillus acidophilus and the kefiric fungal polysaccharide are summarized in a wide range of diseases in children, such as acute intestinal infections of bacterial, viral (rotavirus and mixed etiology, for the prevention of the development of antibiotic-associated diarrhea, for the normalization of the intestinal microflora in various conditions (acute respiratory diseases, atopic dermatitis, often ill children, etc.. The appointment of Acipol contributed to a reduction in the duration of clinical manifestations, restoration of normoflora, rapid elimination of pathogenic and conditionally pathogenic microorganisms, and reduced the risk of developing of antibiotic-associated diarrhea.

  3. The geomicrobiology of bauxite deposits

    Directory of Open Access Journals (Sweden)

    Xiluo Hao

    2010-10-01

    Full Text Available Bauxite deposits are studied because of their economic value and because they play an important role in the study of paleoclimate and paleogeography of continents. They provide a rare record of the weathering and evolution of continental surfaces. Geomicrobiological analysis makes it possible to verify that microorganisms have played a critical role during the formation of bauxite with the possibility already intimated in previous studies. Ambient temperature, abundance of water, organic carbon and bioavailable iron and other metal substrates provide a suitable environment for microbes to inhabit. Thiobacillus, Leptospirilum, Thermophilic bacteria and Heterotrophs have been shown to be able to oxidize ferrous iron and to reduce sulfate-generating sulfuric acid, which can accelerate the weathering of aluminosilicates and precipitation of iron oxyhydroxides. Microorganisms referred to the genus Bacillus can mediate the release of alkaline metals. Although the dissimilatory iron-reducing and sulfate-reducing bacteria in bauxites have not yet been identified, some recorded authigenic carbonates and “bacteriopyrites” that appear to be unique in morphology and grain size might record microbial activity. Typical bauxite minerals such as gibbsite, kaolinite, covellite, galena, pyrite, zircon, calcium plagioclase, orthoclase, and albite have been investigated as part of an analysis of microbial mediation. The paleoecology of such bauxitic microorganisms inhabiting continental (sub surfaces, revealed through geomicrobiological analysis, will add a further dimension to paleoclimatic and paleoenvironmental studies.

  4. Simultaneous bioreduction of nitrate and chromate using sulfur-based mixotrophic denitrification process

    Energy Technology Data Exchange (ETDEWEB)

    Sahinkaya, Erkan, E-mail: erkansahinkaya@yahoo.com [Istanbul Medeniyet University, Bioengineering Department, Goztepe, Istanbul (Turkey); Kilic, Adem [Harran University, Environmental Engineering Department, Osmanbey Campus, 63000 Sanliurfa (Turkey); Calimlioglu, Beste; Toker, Yasemin [Istanbul Medeniyet University, Bioengineering Department, Goztepe, Istanbul (Turkey)

    2013-11-15

    Highlights: • Simultaneous heterotrophic and autotrophic denitrification was stimulated. • Simultaneous bioreduction of nitrate and chromate was achieved. • Total chromium decreased <50 μg/L when the influent Cr(VI) was ≤5 mg/L. -- Abstract: This study aims at evaluating simultaneous chromate and nitrate reduction using sulfur-based mixotrophic denitrification process in a column reactor packed with elemental sulfur and activated carbon. The reactor was supplemented with methanol at C/N ratio of 1.33 or 2. Almost complete denitrification was achieved at influent NO{sub 3}{sup −}–N and Cr(VI) concentrations of 75 mg/L and 10 mg/L, respectively, and 3.7 h HRT. Maximum denitrification rate was 0.5 g NO{sub 3}{sup −}–N/(L.d) when the bioreactor was fed with 75 mg/L NO{sub 3}{sup −}–N, 150 mg/L methanol and 10 mg/L Cr(VI). The share of autotrophic denitrification was between 12% and 50% depending on HRT, C/N ratio and Cr(VI) concentration. Effluent total chromium was below 50 μg/L provided that influent Cr(VI) concentration was equal or below 5 mg/L. DGGE results showed stable microbial community throughout the operation and the presence of sulfur oxidizing denitrifying bacteria (Thiobacillus denitrificans) and Cr(VI) reducing bacteria (Exiguobacterium spp.) in the column bed.

  5. Polyphasic bacterial community analysis of an aerobic activated sludge removing phenols and thiocyanate from coke plant effluent

    Energy Technology Data Exchange (ETDEWEB)

    Felfoldi, T.; Szekely, A.J.; Goral, R.; Barkacs, K.; Scheirich, G.; Andras, J.; Racz, A.; Marialigeti, K. [Eotvos Lorand University, Budapest (Hungary). Dept. of Microbiology

    2010-05-15

    Biological purification processes are effective tools in the treatment of hazardous wastes such as toxic compounds produced in coal coking. In this study, the microbial community of a lab-scale activated sludge system treating coking effluent was assessed by cultivation-based (strain isolation and identification, biodegradation tests) and culture-independent techniques (sequence-aided T-RFLP, taxon-specific PCR). The results of the applied polyphasic approach showed a simple microbial community dominated by easily culturable heterotrophic bacteria. Comamonas badia was identified as the key microbe of the system, since it was the predominant member of the bacterial community, and its phenol degradation capacity was also proved. Metabolism of phenol, even at elevated concentrations (up to 1500 mg/L), was also presented for many other dominant (Pseudomonas, Rhodanobacter, Oligella) and minor (Alcaligenes, Castellaniella, Microbacterium) groups, while some activated sludge bacteria (Sphingomonas, Rhodopseudomonas) did not tolerate it even in lower concentrations (250 mg/L). In some cases, closely related strains showed different tolerance and degradation properties. Members of the genus Thiobacillus were detected in the activated sludge, and were supposedly responsible for the intensive thiocyanate biodegradation observed in the system. Additionally, some identified bacteria (e.g. C. badia and the Ottowia-related strains) might also have had a significant impact on the structure of the activated sludge due to their floc-forming abilities.

  6. Distribution and Diversity of Bacteria and Fungi Colonization in Stone Monuments Analyzed by High-Throughput Sequencing.

    Science.gov (United States)

    Li, Qiang; Zhang, Bingjian; He, Zhang; Yang, Xiaoru

    The historical and cultural heritage of Qingxing palace and Lingyin and Kaihua temple, located in Hangzhou of China, include a large number of exquisite Buddhist statues and ancient stone sculptures which date back to the Northern Song (960-1219 A.D.) and Qing dynasties (1636-1912 A.D.) and are considered to be some of the best examples of ancient stone sculpting techniques. They were added to the World Heritage List in 2011 because of their unique craftsmanship and importance to the study of ancient Chinese Buddhist culture. However, biodeterioration of the surface of the ancient Buddhist statues and white marble pillars not only severely impairs their aesthetic value but also alters their material structure and thermo-hygric properties. In this study, high-throughput sequencing was utilized to identify the microbial communities colonizing the stone monuments. The diversity and distribution of the microbial communities in six samples collected from three different environmental conditions with signs of deterioration were analyzed by means of bioinformatics software and diversity indices. In addition, the impact of environmental factors, including temperature, light intensity, air humidity, and the concentration of NO2 and SO2, on the microbial communities' diversity and distribution was evaluated. The results indicate that the presence of predominantly phototrophic microorganisms was correlated with light and humidity, while nitrifying bacteria and Thiobacillus were associated with NO2 and SO2 from air pollution.

  7. Biotransformation of nitrogen- and sulfur-containing pollutants during coking wastewater treatment: Correspondence of performance to microbial community functional structure.

    Science.gov (United States)

    Joshi, Dev Raj; Zhang, Yu; Gao, Yinxin; Liu, Yuan; Yang, Min

    2017-09-15

    Although coking wastewater is generally considered to contain high concentration of nitrogen- and sulfur-containing pollutants, the biotransformation processes of these compounds have not been well understood. Herein, a high throughput functional gene array (GeoChip 5.0) in combination with Illumina MiSeq sequencing of the 16S rRNA gene were used to identify microbial functional traits and their role in biotransformation of nitrogen- and sulfur-containing compounds in a bench-scale aerobic coking wastewater treatment system operated for 488 days. Biotransformation of nitrogen and sulfur-containing pollutants deteriorated when pH of the bioreactor was increased to >8.0, and the microbial community functional structure was significantly associated with pH (Mantels test, P functional microbial community structure (P functional genes for biotransformation of nitrogen- and sulfur-containing pollutants. Functional characterization of taxa and network analysis suggested that Burkholderiales, Actinomycetales, Rhizobiales, Pseudomonadales, and Hydrogenophiliales (Thiobacillus) were key functional taxa. Variance partitioning analysis showed that pH and influent ammonia nitrogen jointly explained 25.9% and 35.5% of variation in organic pollutant degrading genes and microbial community structure, respectively. This study revealed a linkage between microbial community functional structure and the likely biotransformation of nitrogen- and sulfur-containing pollutants, along with a suitable range of pH (7.0-7.5) for stability of the biological system treating coking wastewater. Copyright © 2017 Elsevier Ltd. All rights reserved.

  8. Microbial leaching of low grade sandstone uranium ores: column leaching studies

    International Nuclear Information System (INIS)

    Bhatti, T.M.; Malik, K.A.; Khalid, A.M.

    1991-01-01

    Microbial leaching studies on a low-grade sandstone uranium ore from Baghalchur Ore Deposits, D. G. Khan, Pakistan, containing 0.027 % U/sub 3/O/sub 8/ for extraction of uranium, were conducted in columns. Baghalchur sandstone uranium ore which is alkaline in nature, contained 5.0% calcite [CaCo/sub 3/], 2-3 % Fe/sub 2/O/sub 3/ and pyrite [FeS/sub 2/] less than 0.1 %. The ore amended with sulfur and/or sulfur slag as external energy source was found to leach with indigenous microflora mostly belonging to the genus Thiobacillus which are present in the uranium mine water. Column leaching studies revealed that when the ore was amended with elemental sulfur and irrigated with mine water (pH 3.5) 53 % U/sub 3/O/sub 8/ could be solubilized from it. However, when the natural mine water was used as such (pH 7.4) the solubilization of uranium was decreased to 41 % U/sub 3/O/sub 8/ in 90 days under similar conditions of percolation rate and temperature. The addition of (NH/sub 4/)/sub 2/SO/sub 4/ (3.0 g/L) in mine water was found to enhance the uranium leaching to 70 % U/sub 3/O/sub 8/ from the columns containing ore amended with sulfur slag. (author)

  9. The Oxidative Metabolism of Fossil Hydrocarbons and Sulfide Minerals by the Lithobiontic Microbial Community Inhabiting Deep Subterrestrial Kupferschiefer Black Shale

    Directory of Open Access Journals (Sweden)

    Agnieszka Włodarczyk

    2018-05-01

    Full Text Available Black shales are one of the largest reservoirs of fossil organic carbon and inorganic reduced sulfur on Earth. It is assumed that microorganisms play an important role in the transformations of these sedimentary rocks and contribute to the return of organic carbon and inorganic sulfur to the global geochemical cycles. An outcrop of deep subterrestrial ~256-million-year-old Kupferschiefer black shale was studied to define the metabolic processes of the deep biosphere important in transformations of organic carbon and inorganic reduced sulfur compounds. This outcrop was created during mining activity 12 years ago and since then it has been exposed to the activity of oxygen and microorganisms. The microbial processes were described based on metagenome and metaproteome studies as well as on the geochemistry of the rock. The microorganisms inhabiting the subterrestrial black shale were dominated by bacterial genera such as Pseudomonas, Limnobacter, Yonghaparkia, Thiobacillus, Bradyrhizobium, and Sulfuricaulis. This study on black shale was the first to detect archaea and fungi, represented by Nitrososphaera and Aspergillus genera, respectively. The enzymatic oxidation of fossil aliphatic and aromatic hydrocarbons was mediated mostly by chemoorganotrophic bacteria, but also by archaea and fungi. The dissimilative enzymatic oxidation of primary reduced sulfur compounds was performed by chemolithotrophic bacteria. The geochemical consequences of microbial activity were the oxidation and dehydrogenation of kerogen, as well as oxidation of sulfide minerals.

  10. Development and use of tuf gene-based primers for the multiplex PCR detection of Lactobacillus acidophilus, Lactobacillus casei group, Lactobacillus delbrueckii, and Bifidobacterium longum in commercial dairy products.

    Science.gov (United States)

    Sheu, Sen-Je; Hwang, Wen-zhe; Chen, Hsin-Chih; Chiang, Yu-Cheng; Tsen, Hau-Yang

    2009-01-01

    PCR primers specific for the detection of Lactobacillus acidophilus, Lactobacillus casei group, Lactobacillus delbrueckii, and Bifidobacterium longum were designed based on the elongation factor Tu gene (tuf). The specificity of these four primer sets were confirmed by PCR with 88 bacterial strains of Lactobacillus, Enterococcus, Bifidobacterium, and other bacterial species. Results indicated that these primer sets generated predicted PCR products of 397, 230, 202, and 161 bp for L. acidophilus, L. delbrueckii, L. casei group, and B. longum, respectively. Bacterial species other than the target organisms tested did not generate false-positive results. When these four primer sets were combined for the simultaneous detection of the lactic acid bacteria (LAB) in fermented milk products including yogurt, the LAB species listed on the labels of these products could be identified without the preenrichment step. The identification limit for each LAB strain with this multiplex PCR method was N X 10(3) CFU/ml in milk samples. The results of our multiplex PCR method were confirmed by PCR assay using primers based on the 16S rDNA or the 16S-23S intergenic spacer region and by biochemical tests using the API 50 CHL kit. When this multiplex PCR method was used with the determination of counts of total viable LAB and bifidobacteria, the quality of commercial fermented milk products could be assured.

  11. Stability of free and immobilized Lactobacillus acidophilus and Bifidobacterium lactis in acidified milk and of immobilized B. lactis in yoghurt Estabilidade de Lactobacillus acidophilus e Bifidobacterium lactis nas formas livre e imobilizada em leite acidificado e de B. lactis imobilizado em iogurte

    Directory of Open Access Journals (Sweden)

    Carlos Raimundo Ferreira Grosso

    2004-06-01

    Full Text Available This study evaluated the stability of Bifidobacterium lactis (Bb-12 and of Lactobacillus acidophilus (La-05 both free and immobilized in calcium alginate, in milk and in acidified milk (pH 5.0, 4.4 and 3.8. The stability of immobilized B. lactis in yoghurt (fermented to pH 4.2, during 28 days of refrigerated storage was also evaluated. The efficiency of two culture media (modified MRS agar and Reinforced Clostridial Agar plus Prussian Blue for counting of B. lactis in yoghurt was determined. Lee's agar was used to count Streptococcus thermophilus and Lactobacillus delbrueckii ssp. bulgaricus when B. lactis were counted in the MRS medium. B. lactis and L. acidophilus in both free and immobilized forms presented satisfactory rates of survival in milk and acidified milk because the average reduction of the population was only one log cycle after 21 days of storage. The number of viable cells of immobilized B. lactis in yoghurt presented a gradual decline throughout the storage period, passing from 10(8 cfu/ml to no count after 28 days of storage. When the cultures were not in equilibrium just the selective medium was efficient in counting B. lactis in yoghurt. The results showed that both microorganisms can be added to milk and acidified milk, because their population was only slightly affected during storage. The presence of traditional culture of yoghurt seems to be harmful for survival of immobilized B. lactis and the immobilization in calcium alginate failed as an effective barrier to protect the cells in all analysed treatments.Este trabalho avaliou a estabilidade de Bifidobacterium lactis (Bb-12 e de Lactobacillus acidophilus (La-05 nas formas livre e imobilizada em alginato de cálcio, em leite e leite acidificado (pHs 5.0, 4.4 e 3.8, e a estabilidade de B. lactis imobilizado em iogurte (fermentado até pH 4.2, durante 28 dias de estocagem refrigerada. Também foi estudada a eficiência de dois meios de cultura (ágar MRS modificado e

  12. The prebiotic and protective effects of buckwheat flour and oat bran on Lactobacillus acidophilus

    Directory of Open Access Journals (Sweden)

    Aida VASILE

    2016-12-01

    Full Text Available During conservation, the probiotic bacteria currently used in food industry have been shown to have less viability in the matter of fermented products microbiota and also to present lower levels of colonization and survival in vivo. This study describes a new way of improving the behavior and functionality of Lactobacillus acidophilus - LA 5® commercial strain by using buckwheat flour (Fagopyrum esculentum and oat bran (Avena sativa as fermentation ingredients, in view of their high content of bioactive compounds that have a great impact both on fermentation microorganisms and consumers’ health. The effect of these two raw vegetal products on LA 5® strain was studied by cultivation on MRS broth and on milk. The supplementation of the fermentation medium with 4.0% - 6.0% of buckwheat flour or oat bran, respectively, had a positive effect on metabolic activity and viability of lactic acid bacteria. Thus, the rapid decrease of the pH and the increase of the multiplication rate were observed after 6 hours of lactic acid fermentation. Furthermore, the presence of the vegetal substrates substantially improved the cells survival during the storage of the fermented products for 28 days at 4 °C, comparing to samples without supplementation used as control.

  13. Using biological and physico-chemical test methods to assess the role of concrete mixture design in resistance to microbially induced corrosion

    Science.gov (United States)

    House, Mitchell Wayne

    Concrete is the most widely used material for construction of wastewater collection, storage, and treatment infrastructure. The chemical and physical characteristics of hydrated portland cement make it susceptible to degradation under highly acidic conditions. As a result, some concrete wastewater infrastructure may be susceptible to a multi-stage degradation process known as microbially induced corrosion, or MIC. MIC begins with the production of aqueous hydrogen sulfide (H2S(aq)) by anaerobic sulfate reducing bacteria present below the waterline. H2S(aq) partitions to the gas phase where it is oxidized to sulfuric acid by the aerobic sulfur oxidizing bacteria Thiobacillus that resides on concrete surfaces above the waterline. Sulfuric acid then attacks the cement paste portion of the concrete matrix through decalcification of calcium hydroxide and calcium silica hydrate coupled with the formation of expansive corrosion products. The attack proceeds inward resulting in reduced service life and potential failure of the concrete structure. There are several challenges associated with assessing a concrete's susceptibility to MIC. First, no standard laboratory tests exist to assess concrete resistance to MIC. Straightforward reproduction of MIC in the laboratory is complicated by the use of microorganisms and hydrogen sulfide gas. Physico-chemical tests simulating MIC by immersing concrete specimens in sulfuric acid offer a convenient alternative, but do not accurately capture the damage mechanisms associated with biological corrosion. Comparison of results between research studies is difficult due to discrepancies that can arise in experimental methods even if current ASTM standards are followed. This thesis presents two experimental methods to evaluate concrete resistance to MIC: one biological and one physico-chemical. Efforts are made to address the critical aspects of each testing method currently absent in the literature. The first method presented is a new test

  14. Efeitos das cepas probioticas de Lactobacillus acidophilus ATCC 4356, Lactobacillus rhamnosus ATCC 1465 e ATCC 7469 sobre o crescimento planctonico e formação de biofilme de Streptococcus mutans UA 159

    OpenAIRE

    Carneiro, Tamara Rodrigues de Andrade [UNESP

    2015-01-01

    Most probiotic bacteria used in commercial products belong to the genus Lactobacillus. However, the effects of Lactobacillus probiotic strains in the oral health need to be further investigated. The objective of this study is to evaluate the effects of probiotic Lactobacillus strains, on Streptococcus mutans. Lactobacillus strains acidophilus ATCC 4356, Lactobacillus rhamnosus ATCC 1465, Lactobacillus rhamnosus ATCC 7469 were tested on planktonic and biofilm growth of Streptococcus mutans (UA...

  15. Probiotic Lactobacillus acidophilus NCFM and Bifidobacterium animalis subsp lactis Bl-04 interactions with prebiotic carbohydrates using differential proteomics and protein characterization

    DEFF Research Database (Denmark)

    Hansen, Morten Ejby

    of probiotics, primarily non-digestible carbohydrates, are termed prebiotics. The knowledge of prebiotic utilization and in particular the specificities of carbohydrate transport and metabolism are limited, hampering robust understanding for the basis of selective utilization of known prebiotics...... and the discovery and documentation of novel ones. In this project we set out to investigate the metabolism of carbohydrates that are prebiotic or potential prebiotic compounds utilized by the probiotic organisms Lactobacillus acidophilus NCFM (NCFM) and Bifidobacterium animalis subsp. lactis BL-04 (Bl-04). The aim...... of this Ph.D. thesis was the study of probiotic NCFM and Bl-04 interaction with prebiotic carbohydrates using differential proteomics and protein characterization. Proteomics is a potential omics tool to investigate probiotic bacteria and its response to prebiotic carbohydrates at the protein level...

  16. The Differential Proteome of the Probiotic Lactobacillus acidophilus NCFM Grown on the Potential Prebiotic Cellobiose Shows Upregulation of Two beta-Glycoside Hydrolases

    DEFF Research Database (Denmark)

    van Zanten, Gabriella Christina; Sparding, Nadja; Majumder, Avishek

    2015-01-01

    Probiotics, prebiotics, and combinations there of, that is, synbiotics, are known to exert beneficial health effects in humans; however interactions between pro-and prebiotics remain poorly understood at the molecular level. The present study describes changes in abundance of different proteins...... of the probiotic bacterium Lactobacillus acidophilus NCFM (NCFM) when grown on the potential prebiotic cellobiose as compared to glucose. Cytosolic cell extract proteomes after harvest at late exponential phase of NCFM grown on cellobiose or glucose were analyzed by two dimensional difference gel electrophoresis....... Many of these proteins were associated with energy metabolism, including the cellobiose related glycoside hydrolases phospho-β-glucosidase (LBA0881) and phospho-β-galactosidase II (LBA0726). The data provide insight into the utilization of the candidate prebiotic cellobiose by the probiotic bacterium...

  17. The effects of low-intensity electromagnetic irradiation at the frequencies of 51.8 and 53 GHz and antibiotic ceftazidime on Lactobacillus acidophilus F0F1 ATP-ase activity

    International Nuclear Information System (INIS)

    Soghomonyan, D.R.

    2013-01-01

    The effects of low intensity electromagnetic irradiation (EMI) at the frequencies 51.8 and 53 GHz and antibiotic ceftazidime on N,N'-dicyclohexylcarbodiimide (DCCD), inhibited ATP-ase activity of Lactobacillus acidophilus membrane vesicles were investigated. It was shown that both frequencies decreased the ATP-ase activity, moreover, ceftazidime increase the sensitivity of cells to DCCD, inhibitor of the F 0 F 1 -ATP-ase. EMI combined with ceftazidime and DCCD markedly decreased the ATPase activity. The F 0 F 1 -ATP-ase is suggested can be a target for the effects observed

  18. Effect of light on Thiobacilli

    International Nuclear Information System (INIS)

    Le Roux, N.W.; Marshall, V.M.

    1977-01-01

    The aim was to study the effect of visible and ultra-violet light on some members of the genus Thiobacillus. This genus is one more example of an aerobic organism which undergoes what appears to be the widespread phenomenon of light inhibition. Light inhibition of thiobacilli has been observed before and these other observations are presented. In the present study the effect of both visible and U-V light on three species was considered, viz. T. thiooxidans, T. thioparus and T. ferrooxidans, the latter species being studied more thoroughly with respect to different intensities and wavelengths of light and the shielding effect of bacterial numbers and ferric iron. The photoreactivation of T. ferrooxidans cells after irradiation by U-V light was also examined. Using unfiltered, visible light, there was an inhibitory effect on all three of the thiobacilli irrespective of the source being used. When selected wavelengths were studied it was seen that the blue end of the visible spectrum was most inhibitory. A relationship between ferric iron concentration and protection from visible light was shown and the beneficial protective effect of particulate suspensions was demonstrated. The sensitivity of T. ferrooxidans and T. thioparus to U-V light and the protection afforded by ferric iron and cell numbers was assessed. Photoreactivation of U-V irradiated cells by exposure to visible light showed that this phenomenon occurred using wavelengths of visible light which, by themselves, were inhibitory. Some practical implication of these findings are offered. (orig.) [de

  19. Microbial community in high arsenic shallow groundwater aquifers in Hetao Basin of Inner Mongolia, China.

    Directory of Open Access Journals (Sweden)

    Ping Li

    Full Text Available A survey was carried out on the microbial community of 20 groundwater samples (4 low and 16 high arsenic groundwater and 19 sediments from three boreholes (two high arsenic and one low arsenic boreholes in a high arsenic groundwater system located in Hetao Basin, Inner Mongolia, using the 454 pyrosequencing approach. A total of 233,704 sequence reads were obtained and classified into 12-267 operational taxonomic units (OTUs. Groundwater and sediment samples were divided into low and high arsenic groups based on measured geochemical parameters and microbial communities, by hierarchical clustering and principal coordinates analysis. Richness and diversity of the microbial communities in high arsenic sediments are higher than those in high arsenic groundwater. Microbial community structure was significantly different either between low and high arsenic samples or between groundwater and sediments. Acinetobacter, Pseudomonas, Psychrobacter and Alishewanella were the top four genera in high arsenic groundwater, while Thiobacillus, Pseudomonas, Hydrogenophaga, Enterobacteriaceae, Sulfuricurvum and Arthrobacter dominated high arsenic sediments. Archaeal sequences in high arsenic groundwater were mostly related to methanogens. Biota-environment matching and co-inertia analyses showed that arsenic, total organic carbon, SO4(2-, SO4(2-/total sulfur ratio, and Fe(2+ were important environmental factors shaping the observed microbial communities. The results of this study expand our current understanding of microbial ecology in high arsenic groundwater aquifers and emphasize the potential importance of microbes in arsenic transformation in the Hetao Basin, Inner Mongolia.

  20. Microbial community in high arsenic shallow groundwater aquifers in Hetao Basin of Inner Mongolia, China.

    Science.gov (United States)

    Li, Ping; Wang, Yanhong; Dai, Xinyue; Zhang, Rui; Jiang, Zhou; Jiang, Dawei; Wang, Shang; Jiang, Hongchen; Wang, Yanxin; Dong, Hailiang

    2015-01-01

    A survey was carried out on the microbial community of 20 groundwater samples (4 low and 16 high arsenic groundwater) and 19 sediments from three boreholes (two high arsenic and one low arsenic boreholes) in a high arsenic groundwater system located in Hetao Basin, Inner Mongolia, using the 454 pyrosequencing approach. A total of 233,704 sequence reads were obtained and classified into 12-267 operational taxonomic units (OTUs). Groundwater and sediment samples were divided into low and high arsenic groups based on measured geochemical parameters and microbial communities, by hierarchical clustering and principal coordinates analysis. Richness and diversity of the microbial communities in high arsenic sediments are higher than those in high arsenic groundwater. Microbial community structure was significantly different either between low and high arsenic samples or between groundwater and sediments. Acinetobacter, Pseudomonas, Psychrobacter and Alishewanella were the top four genera in high arsenic groundwater, while Thiobacillus, Pseudomonas, Hydrogenophaga, Enterobacteriaceae, Sulfuricurvum and Arthrobacter dominated high arsenic sediments. Archaeal sequences in high arsenic groundwater were mostly related to methanogens. Biota-environment matching and co-inertia analyses showed that arsenic, total organic carbon, SO4(2-), SO4(2-)/total sulfur ratio, and Fe(2+) were important environmental factors shaping the observed microbial communities. The results of this study expand our current understanding of microbial ecology in high arsenic groundwater aquifers and emphasize the potential importance of microbes in arsenic transformation in the Hetao Basin, Inner Mongolia.

  1. Microbiological desulfurization and conversion of coal

    International Nuclear Information System (INIS)

    Quigley, D.R.; Stoner, D.L.; Dugan, P.R.

    1991-01-01

    Bio processing of coal is a young and emerging technology. Until the early 1980's it consisted primarily of coal depyritization using Thiobacillus ferro oxidans to either oxidize pyritic sulfur or to alter particle wettability or floatation properties by binding to exposed pyrite inclusions. Since then, other major avenues of research have been pursued. One of these is the microbiologically mediated liquefaction of coal. Initial work indicated that microorganisms were able to transform low rank coal into a black liquid that was later identified as water solubilized by alkaline substances produced by the microbes and could be enhanced by the removal of multi valent cations from coal. Current work at the INEL involves of the identification and characterization of microorganisms that are able to alter the structure of polymeric desulfurization of coal. This work initially focused on the ability of microorganisms to oxidatively remove organic sulfur from model compounds that were representative of those sulfur containing moieties identified as being in coals (e.g., dibenzo thiophene). The work also focused on those organisms that were could remove the organic sulfur without degrading the carbon structure. While some organisms that are able to perform such these reactions will effectively remove organo sulfur from coal. These concerns stem from steric hindrance considerations and the thermodynamically unfavourable nature of reaction. Current work at the INEL involves the isolation and biochemical characterization of microorganisms that are able to desulfurize and solubilized coals that have high organic sulfur contents. (author)

  2. Distribution and Diversity of Bacteria and Fungi Colonization in Stone Monuments Analyzed by High-Throughput Sequencing.

    Directory of Open Access Journals (Sweden)

    Qiang Li

    Full Text Available The historical and cultural heritage of Qingxing palace and Lingyin and Kaihua temple, located in Hangzhou of China, include a large number of exquisite Buddhist statues and ancient stone sculptures which date back to the Northern Song (960-1219 A.D. and Qing dynasties (1636-1912 A.D. and are considered to be some of the best examples of ancient stone sculpting techniques. They were added to the World Heritage List in 2011 because of their unique craftsmanship and importance to the study of ancient Chinese Buddhist culture. However, biodeterioration of the surface of the ancient Buddhist statues and white marble pillars not only severely impairs their aesthetic value but also alters their material structure and thermo-hygric properties. In this study, high-throughput sequencing was utilized to identify the microbial communities colonizing the stone monuments. The diversity and distribution of the microbial communities in six samples collected from three different environmental conditions with signs of deterioration were analyzed by means of bioinformatics software and diversity indices. In addition, the impact of environmental factors, including temperature, light intensity, air humidity, and the concentration of NO2 and SO2, on the microbial communities' diversity and distribution was evaluated. The results indicate that the presence of predominantly phototrophic microorganisms was correlated with light and humidity, while nitrifying bacteria and Thiobacillus were associated with NO2 and SO2 from air pollution.

  3. The role of heterotrophic microorganism Galactomyces sp. Z3 in improving pig slurry bioleaching.

    Science.gov (United States)

    Zhou, Jun; Zheng, Guanyu; Zhou, Lixiang; Liu, Fenwu; Zheng, Chaocheng; Cui, Chunhong

    2013-01-01

    The feasibility of removing heavy metals and eliminating pathogens from pig slurry through bioleaching involving the fungus Galactomyces sp. Z3 and two acidophilic thiobacillus (A. ferrooxidans LX5 and A. thiooxidans TS6) was investigated. It was found that the isolated pig slurry dissolved organic matter (DOM) degrader Z3 was identified as Galactomyces sp. Z3, which could grow well at pH 2.5-7 and degrade pig slurry DOM from 1973 to 942 mg/l within 48 h. During the successive multi-batch bioleaching systems, the co-inoculation of pig slurry degrader Galactomyces sp. Z3 and the two Acidithiobacillus species could improve pig slurry bioleaching efficiency compared to the single system without Galactomyces sp. Z3. The removal efficiency of Zn and Cu exceeded 94% and 85%, respectively. In addition, the elimination efficiencies of pathogens, including both total coliform and faecal coliform counts, exceeded 99% after bioleaching treatment. However, the counts of Galactomyces sp. Z3 decreased with the fall of pH and did not restore to the initial level during successive multi-batch bioleaching systems, and it is necessary to re-inoculate Galactomyces sp. Z3 cells into the bioleaching system to maintain its role in degrading pig slurry DOM. Therefore, a bioleaching technique involving both Galactomyces sp. Z3 and Acidithiobacillus species is an efficient method for removing heavy metals and eliminating pathogens from pig slurry.

  4. Polyphasic analysis of an Azoarcus-Leptothrix-dominated bacterial biofilm developed on stainless steel surface in a gasoline-contaminated hypoxic groundwater.

    Science.gov (United States)

    Benedek, Tibor; Táncsics, András; Szabó, István; Farkas, Milán; Szoboszlay, Sándor; Fábián, Krisztina; Maróti, Gergely; Kriszt, Balázs

    2016-05-01

    Pump and treat systems are widely used for hydrocarbon-contaminated groundwater remediation. Although biofouling (formation of clogging biofilms on pump surfaces) is a common problem in these systems, scarce information is available regarding the phylogenetic and functional complexity of such biofilms. Extensive information about the taxa and species as well as metabolic potential of a bacterial biofilm developed on the stainless steel surface of a pump submerged in a gasoline-contaminated hypoxic groundwater is presented. Results shed light on a complex network of interconnected hydrocarbon-degrading chemoorganotrophic and chemolitotrophic bacteria. It was found that besides the well-known hydrocarbon-degrading aerobic/facultative anaerobic biofilm-forming organisms (e.g., Azoarcus, Leptothrix, Acidovorax, Thauera, Pseudomonas, etc.), representatives of Fe(2+)-and Mn(2+)-oxidizing (Thiobacillus, Sideroxydans, Gallionella, Rhodopseudomonas, etc.) as well as of Fe(3+)- and Mn(4+)-respiring (Rhodoferax, Geobacter, Magnetospirillum, Sulfurimonas, etc.) bacteria were present in the biofilm. The predominance of β-Proteobacteria within the biofilm bacterial community in phylogenetic and functional point of view was revealed. Investigation of meta-cleavage dioxygenase and benzylsuccinate synthase (bssA) genes indicated that within the biofilm, Azoarcus, Leptothrix, Zoogloea, and Thauera species are most probably involved in intrinsic biodegradation of aromatic hydrocarbons. Polyphasic analysis of the biofilm shed light on the fact that subsurface microbial accretions might be reservoirs of novel putatively hydrocarbon-degrading bacterial species. Moreover, clogging biofilms besides their detrimental effects might supplement the efficiency of pump and treat systems.

  5. Effects of toxic organic flotation reagent (aniline aerofloat) on an A/O submerged membrane bioreactor (sMBR): Microbial community dynamics and performance.

    Science.gov (United States)

    Lin, Weixiong; Sun, Shuiyu; Wu, Chun; Xu, Pingting; Ye, Ziwei; Zhuang, Shengwei

    2017-08-01

    Bio-treatment of flotation wastewater has been proven to be both effective and economical, as a treatment method. Despite this, little is known regarding the effects of toxic organic floatation reagents such as Dianilinodithiophosphoric acid (DDA), on the microbial community performance or dynamics, which are critical to the effective performance of the bio-treatment reactor. A submerged membrane bioreactor (sMBR) was constructed to continuously treat simulated wastewater contaminated with DDA, an organic flotation reagent that is now considered a significant pollutant. The performance of the sMBR system was investigated at different DDA loading concentrations, with assessment of the effects of DDA on the microbial communities within the sMBR, in particular the biodiversity and succession within the microbial community. Results showed that, with increased DDA loadings, the performance of the sMBR was initially negatively affected, but the system adapted efficiently and consistently reached a COD removal rate of up to 80%. Increased DDA loading concentrations had an adverse effect on the activity of both the activated sludge and microbial communities, resulting in a large alteration in microbial dynamics, especially during the start-up stage and the high DDA loading stage. Strains capable of adapting to the presence of DDA, capable of degrading DDA or utilizing its byproducts, were enriched within the sMBR community, such as Zoogloea, Clostridium, Sideroxydans lithotrophicus, Thiobacillus, Thauera amino aromatica and Alicycliphilus denitrificans. Copyright © 2017 Elsevier Inc. All rights reserved.

  6. Development of methodology to evaluate microbially influenced degradation of cement-solidified low-level radioactive waste forms

    International Nuclear Information System (INIS)

    Rogers, R.D.; Hamilton, M.A.; Veeh, R.H.; McConnell, J.W.

    1994-01-01

    Because of its apparent structural integrity, cement has been widely used in the United States as a binder to solidify Class B and C low-level radioactive waste (LLW). However, the resulting cement preparations are susceptible to failure due to the actions of stress and environment. An environmentally mediated process that could affect cement stability is the action of naturally occurring microorganisms. The US Nuclear Regulatory Commission (NRC), recognizing this eventuality, stated that the effects of microbial action on waste form integrity must be addressed. This paper provides present results from an ongoing program that addresses the effects of microbially influenced degradation (MID) on cement-solidified LLW. Data are provided on the development of an evaluation method using acid-producing bacteria. Results are from work with one type of these bacteria, the sulfur-oxidizing Thiobacillus. This work involved the use of a system in which laboratory- and vendor-manufactured, simulated waste forms were exposed on an intermittent basis to media containing thiobacilli. Testing demonstrated that MID has the potential to severely compromise the structural integrity of ion-exchange resin and evaporator-bottoms waste that is solidified with cement. In addition, it was found that a significant percentage of calcium and other elements were leached from the treated waste forms. Also, the surface pH of the treated specimens decreased to below 2. These conditions apparently contributed to the physical deterioration of simulated waste forms after 60 days of exposure to the thiobacilli

  7. Conversion of sulfur compounds and microbial community in anaerobic treatment of fish and pork waste.

    Science.gov (United States)

    He, Ruo; Yao, Xing-Zhi; Chen, Min; Ma, Ruo-Chan; Li, Hua-Jun; Wang, Chen; Ding, Shen-Hua

    2018-04-07

    Volatile sulfur compounds (VSCs) are not only the main source of malodor in anaerobic treatment of organic waste, but also pose a threat to human health. In this study, VSCs production and microbial community was investigated during the anaerobic degradation of fish and pork waste. The results showed that after the operation of 245 days, 94.5% and 76.2% of sulfur compounds in the fish and pork waste was converted into VSCs. Among the detected VSCs including H 2 S, carbon disulfide, methanethiol, ethanethiol, dimethyl sulfide, dimethyl disulfide and dimethyl trisulfide, methanethiol was the major component with the maximum concentration of 4.54% and 3.28% in the fish and pork waste, respectively. The conversion of sulfur compounds including total sulfur, SO 4 2- -S, S 2- , methionine and cysteine followed the first-order kinetics. Miseq sequencing analysis showed that Acinetobacter, Clostridium, Proteus, Thiobacillus, Hyphomicrobium and Pseudomonas were the main known sulfur-metabolizing microorganisms in the fish and pork waste. The C/N value had most significant influence on the microbial community in the fish and pork waste. A main conversion of sulfur compounds with CH 3 SH as the key intermediate was firstly hypothesized during the anaerobic degradation of fish and pork waste. These findings are helpful to understand the conversion of sulfur compounds and to develop techniques to control ordor pollution in the anaerobic treatment of organic waste. Copyright © 2018. Published by Elsevier Ltd.

  8. Poultry offal ensiled with lactobacillus acidophilus for growing and finishing swine diets.

    Science.gov (United States)

    Tibbetts, G W; Seerley, R W; McCampbell, H C

    1987-01-01

    Poultry offal (heads, feet, viscera) from a broiler processing plant was ground and mixed with corn, dried molasses and a Lactobacillus acidophilus culture. Fermentation was shown to be effective in batch sizes of 3.8, 75.7 and 208.1 liters, as well as a 1,360-kg silo. It was generally complete at 72 h. In trial 1, rats were fed silage mixtures of 60:30:5:5, 45:45:5:5 and 30:60:5:5, offal, corn, molasses and inoculant, respectively. Rats did not gain as well when fed the silage diets (P less than .05) as when fed the basal diet; however, the ranking of silages was 45:45, 60:30 and 30:60, offal-to-corn ratio for rat daily gains and feed conversions. In trial 2, growing-finishing pigs were fed the 60:30:5:5 silage at rates of 0, 10, 20 and 30% of the diet. Average daily gains and feed-to-gain ratios were not affected by including offal silage at up to 20% of the diet, but 30% offal silage in diets resulted in depressed gains (P less than .05) and increased feed-to-gain ratios. Carcasses were not different among treatments for dressing percentage, length, average backfat and percentage of ham, loin, shoulder, lean cuts and primal cuts. Carcasses from pigs fed 20 and 30% offal silage had significantly darker and firmer loin-eyes than those from control fed pigs. Marbling was higher (P less than .05) in loin-eyes from pigs fed 30% offal silage as compared with those from pigs fed 0% offal silage.(ABSTRACT TRUNCATED AT 250 WORDS)

  9. Influence of Spirulina platensis powder on the microflora of yoghurt and acidophilus milk

    Directory of Open Access Journals (Sweden)

    Metin Guldas

    2010-12-01

    Full Text Available The main purpose of this research was to monitor the influence of the powdered Cyanobacterium Spirulina platensis addition to plain yoghurt and the yoghurt containing Lactobacillus acidophiluson survival of the microbiota during the refrigerated storage. The cell viability of yoghurt starter cultures (Lactobacillus delbrueckii subsp. bulgaricus and Streptococcus thermophilus and Lactobacillus acidophilus under refrigeration conditions in yoghurts prepared with (0.5 or 1.0 (w/w % and without the addition of Spirulina powder was investigated. The yoghurts were prepared under hygienic laboratory conditions and their pH and acidity were controlled during the process. The samples of yoghurts were stored at 4 °C and investigated on days 1, 5, 10, 15, 20, 25 and 30. Viable counts of the lactic acid bacteria were above 6 cfu g-1of all “spirulina powder” added samples whereas control yoghurt samples contained lower lactic acid bacteria count at the end of the storage period. Addition of 1 % Spirulina platensis powder into the yoghurts did not cause significant differences on the viable lactic acid bacteria (p≤0.05. The results showed the positive effect of S. platensis powder on the survival of the lactic acid bacteria during storage of yoghurt (P≤0.05. The sensory analysis was also performed for the yoghurt samples. Sensory scores of 0.5 % spirulina powder added yoghurt samples were better than 1 % spirulina powder added ones. It was determined that spirulina powder added yoghurt is a good medium of lactic acid bacteria during the 30 days of refrigerated storage.

  10. Can Lactobacillus fermentum LF10 and Lactobacillus acidophilus LA02 in a slow-release vaginal product be useful for prevention of recurrent vulvovaginal candidiasis?: A clinical study.

    Science.gov (United States)

    Murina, Filippo; Graziottin, Alessandra; Vicariotto, Franco; De Seta, Francesco

    2014-01-01

    To assess the effectiveness of the association of 2 specific strains, Lactobacillus fermentum LF10 (DSM 19187) and Lactobacillus acidophilus LA02 (DSM 21717), specifically formulated in slow-release effervescent tablets, in patients with recurrent vulvovaginal candidiasis. The study was a clinical trial of 58 women diagnosed with recurrent VVC (≥4 culture-confirmed episodes in a 12-mo period). All patients were given 200 mg of fluconazole orally as an induction dose for 3 alternate days during the first treatment week. Afterward, the patients were given a new product formulated in slow-release vaginal tablets containing at least 0.4 billion live cells of each of lactobacillus L. fermentum LF10 and L. acidophilus LA02 (first phase of the prophylactic period), on alternate days for 10 consecutive nights. Patients who were still free of symptoms were given 1 vaginal tablet every week for the next 10 weeks (second phase of the prophylactic period). Patients asymptomatic after the total duration of the observation phase (7 mo) were considered as responders. During the second 10-week prophylactic phase, 49 of 57 (86.0%) patients remained free of clinical recurrence, whereas symptomatic VVC occurred in 8 patients (14.0%). During the 7-month follow-up, 42 patients of 49 (85.7%) were symptom free at the end of the protocol, whereas clinical recurrences occurred in 7 women (14.3%). Overall, 42 of 58 women enrolled in the study (72.4%) experienced no clinical recurrence throughout the 7-month observation phase (responders). This study strengthens the evidence supporting the use of specific lactobacilli with well-demonstrated activities associated with the creation and maintenance of a vaginal biofilm that hinders the persistence of an infection caused by Candida.

  11. Effects of synbiotic fermented milk containing Lactobacillus acidophilus La-5 and Bifidobacterium animalis ssp. lactis BB-12 on the fecal microbiota of adults with irritable bowel syndrome: A randomized double-blind, placebo-controlled trial.

    Science.gov (United States)

    Bogovič Matijašić, Bojana; Obermajer, Tanja; Lipoglavšek, Luka; Sernel, Tjaša; Locatelli, Igor; Kos, Mitja; Šmid, Alenka; Rogelj, Irena

    2016-07-01

    We conducted a randomized double-blind, placebo-controlled multicentric study to investigate the influence of a synbiotic fermented milk on the fecal microbiota composition of 30 adults with irritable bowel syndrome (IBS). The synbiotic product contained Lactobacillus acidophilus La-5, Bifidobacterium animalis ssp. lactis BB-12, Streptococcus thermophilus, and dietary fiber (90% inulin, 10% oligofructose), and a heat-treated fermented milk without probiotic bacteria or dietary fiber served as placebo. Stool samples were collected after a run-in period, a 4-wk consumption period, and a 1-wk follow-up period, and were subjected to real-time PCR and 16S rDNA profiling by next-generation sequencing. After 4wk of synbiotic (11 subjects) or placebo (19 subjects) consumption, a greater increase in DNA specific for L. acidophilus La-5 and Bifidobacterium animalis ssp. lactis was detected in the feces of the synbiotic group compared with the placebo group by quantitative real-time PCR. After 1wk of follow-up, the content of L. acidophilus La-5 and B. animalis ssp. lactis decreased to levels close to initial levels. No significant changes with time or differences between the groups were observed for Lactobacillus, Enterobacteriaceae, Bifidobacterium, or all bacteria. The presence of viable BB-12- and La-5-like bacteria in the feces resulting from the intake of synbiotic product was confirmed by random amplification of polymorphic DNA (RAPD)-PCR. At the end of consumption period, the feces of all subjects assigned to the synbiotic group contained viable bacteria with a BB-12-like RAPD profile, and after 1wk of follow-up, BB-12-like bacteria remained in the feces of 87.5% of these subjects. The presence of La-5-like colonies was observed less frequently (37.5 and 25% of subjects, respectively). Next-generation sequencing of 16S rDNA amplicons revealed that only the percentage of sequences assigned to Strep. thermophilus was temporarily increased in both groups, whereas the

  12. Effects of nitrate on the stability of uranium in a bioreduced region of the subsurface

    International Nuclear Information System (INIS)

    Wu, Weimin; Carley, Jack M.; Green, Stefan; Luo, Jian; Kelly, Shelly D.; Van Nostrand, Joy; Lowe, Kenneth Alan; Mehlhorn, Tonia L.; Carroll, Sue L.; Boonchayanant, Benjaporn; Loeffler, Frank E.; Jardine, Philip M.; Criddle, Craig

    2010-01-01

    The effects of nitrate on the stability of reduced, immobilized uranium were evaluated in field experiments at a U.S. Department of Energy site in Oak Ridge, TN. Nitrate (2.0 mM) was injected into a reduced region of the subsurface containing high levels of previously immobilized U(IV). The nitrate was reduced to nitrite, ammonium, and nitrogen gas; sulfide levels decreased; and Fe(II) levels increased then deceased. Uranium remobilization occurred concomitant with nitrite formation, suggesting nitrate-dependent, iron-accelerated oxidation of U(IV). Bromide tracer results indicated changes in subsurface flowpaths likely due to gas formation and/or precipitate. Desorption-adsorption of uranium by the iron-rich sediment impacted uranium mobilization and sequestration. After rereduction of the subsurface through ethanol additions, background groundwater containing high levels of nitrate was allowed to enter the reduced test zone. Aqueous uranium concentrations increased then decreased. Clone library analyses of sediment samples revealed the presence of denitrifying bacteria that can oxidize elemental sulfur, H 2 S, Fe(II), and U(IV) (e.g., Thiobacillus spp.), and a decrease in relative abundance of bacteria that can reduce Fe(III) and sulfate. XANES analyses of sediment samples confirmed changes in uranium oxidation state. Addition of ethanol restored reduced conditions and triggered a short-term increase in Fe(II) and aqueous uranium, likely due to reductive dissolution of Fe(III) oxides and release of sorbed U(VI). After two months of intermittent ethanol addition, sulfide levels increased, and aqueous uranium concentrations gradually decreased to <0.1 μM.

  13. A dynamic mathematical model for microbial removal of pyritic sulfur from coal.

    Science.gov (United States)

    Kargi, F; Weissman, J G

    1984-06-01

    A dynamic mathematical model has been developed to describe microbial desulfurization of coal by Thiobacillus ferrooxidans. The model considers adsorption and desorption of cells on coal particles and microbial oxidation of pyritic sulfur on particle surfaces. The influence of certain parameters, such as microbial growth rate constants, adsorption-description constants, pulp density, coal particle size, initial cell and solid phase substrate concentration on the maximum rate of pyritic sulfur removal, have been elucidated. The maximum rate of pyritic sulfur removal was strongly dependent upon the number of attached cells per coal particle. At sufficiently high initial cell concentrations, the surfaces of coal particles are nearly saturated by the cells and the maximum leaching rate is limited either by total external surface area of coal particles or by the concentration of pyritic sulfur in the coal phase. The maximum volumetric rate of pyritic sulfur removal (mg S/h cm(3) mixture) increases with the pulp density of coal and reaches a saturation level at high pulp densities (e.g. 45%). The maximum rate also increases with decreasing particle diameter in a hyperbolic form. Increases in adsorption coefficient or decreases in the desorption coefficient also result in considerable improvements in this rate. The model can be applied to other systems consisting of suspended solid substrate particles in liquid medium with microbial oxidation occurring on the particle surfaces (e.g., bacterial ore leaching). The results obtained from this model are in good agreement with published experimental data on microbial desulfurization of coal and bacterial ore leaching.

  14. GeoChip-based analysis of the microbial community functional structures in simultaneous desulfurization and denitrification process.

    Science.gov (United States)

    Yu, Hao; Chen, Chuan; Ma, Jincai; Liu, Wenzong; Zhou, Jizhong; Lee, Duu-Jong; Ren, Nanqi; Wang, Aijie

    2014-07-01

    The elemental sulfur (S°) recovery was evaluated in the presence of nitrate in two development models of simultaneous desulfurization and denitrification (SDD) process. At the loading rates of 0.9 kg S/(m³·day) for sulfide and 0.4 kg N/(m³·day) for nitrate, S° conversion rate was 91.1% in denitrifying sulfide removal (DSR) model which was higher than in integrated simultaneous desulfurization and denitrification (ISDD) model (25.6%). A comprehensive analysis of functional diversity, structure and metabolic potential of microbial communities was examined in two models by using functional gene array (GeoChip 2.0). GeoChip data indicated that diversity indices, community structure, and abundance of functional genes were distinct between two models. Diversity indices (Simpson's diversity index (1/D) and Shannon-Weaver index (H')) of all detected genes showed that with elevated influent loading rate, the functional diversity decreased in ISDD model but increased in DSR model. In contrast to ISDD model, the overall abundance of dsr genes was lower in DSR model, while some functional genes targeting from nitrate-reducing sulfide-oxidizing bacteria (NR-SOB), such as Thiobacillus denitrificans, Sulfurimonas denitrificans, and Paracoccus pantotrophus were more abundant in DSR model which were highly associated with the change of S(0) conversion rate obtained in two models. The results obtained in this study provide additional insights into the microbial metabolic mechanisms involved in ISDD and DSR models, which in turn will improve the overall performance of SDD process. Copyright © 2014. Published by Elsevier B.V.

  15. A Microbial Community in Sediments Beneath the Western Antarctic Ice Sheet, Ice Stream C (Kamb)

    Science.gov (United States)

    Skidmore, M.; Han, S.; Foo, W.; Bui, D.; Lanoil, B.

    2004-12-01

    In 2000, an ice-drilling project focusing on the "sticky spot" of Ice Stream C recovered cores of sub-glacial sediments from beneath the Western Antarctic Ice Sheet. We have characterized several chemical and microbiological parameters of the sole intact sediment core. Pore waters extracted from these sediments were brackish and some were supersaturated with respect to calcite. Ion chromatography demonstrated the presence of several organic acids at low, but detectable, levels in the pore water. DAPI direct cell counts were approximately 107 cells g-1. Aerobic viable plate counts were much lower than direct cell counts; however, they were two orders of magnitude higher on plates incubated at low temperature (4 ° C; 3.63 x 105 CFU ml-1) than at higher temperatures (ca. 22° C; 1.5 x 103 CFU ml-1); no colonies were detected on plates incubated anaerobically at either temperature. 16S rDNA clone library analysis indicates extremely limited bacterial diversity in these samples: six phylogenetic clades were detected. The three dominant bacterial phylogenetic clades in the clone libraries (252 clones total) were most closely related to Thiobacillus thioparus (180 clones), Polaromonas vacuolata (34 clones), and Gallionella ferruginea (35 clones) and their relatives; one clone each represented the other three phylogenetic clades (most closely related to Ralstonia pickettii, Lysobacter antibioticus, and Xylella fastidiosa, respectively). These sequences match closely with sequences previously obtained from other subglacial environments in Alaska, Ellesmere Island, Canada and New Zealand. Implications of this microbial community to subglacial chemistry and microbial biogeography will be discussed.

  16. Metagenome-scale analysis yields insights into the structure and function of microbial communities in a copper bioleaching heap.

    Science.gov (United States)

    Zhang, Xian; Niu, Jiaojiao; Liang, Yili; Liu, Xueduan; Yin, Huaqun

    2016-01-19

    Metagenomics allows us to acquire the potential resources from both cultivatable and uncultivable microorganisms in the environment. Here, shotgun metagenome sequencing was used to investigate microbial communities from the surface layer of low grade copper tailings that were industrially bioleached at the Dexing Copper Mine, China. A bioinformatics analysis was further performed to elucidate structural and functional properties of the microbial communities in a copper bioleaching heap. Taxonomic analysis revealed unexpectedly high microbial biodiversity of this extremely acidic environment, as most sequences were phylogenetically assigned to Proteobacteria, while Euryarchaeota-related sequences occupied little proportion in this system, assuming that Archaea probably played little role in the bioleaching systems. At the genus level, the microbial community in mineral surface-layer was dominated by the sulfur- and iron-oxidizing acidophiles such as Acidithiobacillus-like populations, most of which were A. ferrivorans-like and A. ferrooxidans-like groups. In addition, Caudovirales were the dominant viral type observed in this extremely environment. Functional analysis illustrated that the principal participants related to the key metabolic pathways (carbon fixation, nitrogen metabolism, Fe(II) oxidation and sulfur metabolism) were mainly identified to be Acidithiobacillus-like, Thiobacillus-like and Leptospirillum-like microorganisms, indicating their vital roles. Also, microbial community harbored certain adaptive mechanisms (heavy metal resistance, low pH adaption, organic solvents tolerance and detoxification of hydroxyl radicals) as they performed their functions in the bioleaching system. Our study provides several valuable datasets for understanding the microbial community composition and function in the surface-layer of copper bioleaching heap.

  17. Effects of Single and Combined Application of Organic and Biological Fertilizers on Quantitative and Qualitative Yield of Anisum (Pimpinella anisum

    Directory of Open Access Journals (Sweden)

    N Kamayestani

    2015-07-01

    Full Text Available In order to study the effects of single and combined applications of biofertilazer and organic fertilizers on quantitative and qualitative characteristics of anisum (Pimpinella anisum, an experiment was conducted based on a Randomized Complete Block Design with three replications and fifteen treatments at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, in 2011 year. Treatments were: (1 mycorrhiza (Glomus intraradices, (2 mycorrhiza + cow manure, (3 mycorrhiza + vermicompost, (4 mycorrhiza+ compost, (5 mycorrhiza + chemical fertilizer, (6 biosulfur (Thiobacillus sp. + Bentonite, (7 biosulfur + chemical fertilizer, (8 biosulfur + cow manure, (9 biosulfur + vermicompost, (10 biosulfur+compost,11 (cow manure, (12 vermicompost, (13 chemical fertilizer (NPK, (14compost and (15 control. The results showed that application of fertilizer treatments had significant effect on most characteristics of anisum. The highest number of seed per umbelet (7.24, economic yield (1263.4kg/ha were obtained fram biosulfur treatment. The highest dry matter yield (4504.1 kg/ha resulted from combined application of biosulfur + chemical fertilizer and the highest harvest index (25.97% observed in biosulfur+cow manure. The combined application of mycorrhiza affected some qualification traits, as the highest number of umbel per plant (65.7, 1000 seed-weight (3.24 g and essential oil percentage (5.3% resulted from combined application of mycorrhiza+chemical fertilizer. In general, it can be concluded that application of organic and biological fertilizer particularly mycorrhiza and biosulfur had a significant effect on improving of quantitative and qualitative characteristics of anisum. Furthermore, the combined application of organic and biological fertilizer had higher positive effects than their single application.

  18. Improved bioavailability of dietary phenolic acids in whole grain barley and oat groat following fermentation with probiotic Lactobacillus acidophilus , Lactobacillus johnsonii , and Lactobacillus reuteri.

    Science.gov (United States)

    Hole, Anastasia S; Rud, Ida; Grimmer, Stine; Sigl, Stefanie; Narvhus, Judith; Sahlstrøm, Stefan

    2012-06-27

    The aim of this study was to improve the bioavailability of the dietary phenolic acids in flours from whole grain barley and oat groat following fermentation with lactic acid bacteria (LAB) exhibiting high feruloyl esterase activity (FAE). The highest increase of free phenolic acids was observed after fermentation with three probiotic strains, Lactobacillus johnsonii LA1, Lactobacillus reuteri SD2112, and Lactobacillus acidophilus LA-5, with maximum increases from 2.55 to 69.91 μg g(-1) DM and from 4.13 to 109.42 μg g(-1) DM in whole grain barley and oat groat, respectively. Interestingly, higher amounts of bound phenolic acids were detected after both water treatment and LAB fermentation in whole grain barley, indicating higher bioaccessibility, whereas some decrease was detected in oat groat. To conclude, cereal fermentation with specific probiotic strains can lead to significant increase of free phenolic acids, thereby improving their bioavailability.

  19. Predominant genera of fecal microbiota in children with atopic dermatitis are not altered by intake of probiotic bacteria Lactobacillus acidophilus NCFM and Bifidobacterium animalis subsp.lactis Bi-07

    DEFF Research Database (Denmark)

    Larsen, Nadejda Nikolajevna; Vogensen, Finn Kvist; Gøbel, Rikke Juul

    2011-01-01

    randomized to intake of one of the probiotic strain or placebo. Microbial composition was characterized by denaturing gradient gel electrophoresis, quantitative PCR and, in a subset of subjects, by pyrosequencing of the 16S rRNA gene. The core population of the Lactobacillus group was identified...... significantly after intervention, indicating survival of the ingested bacteria. The levels of Bifidobacterium correlated positively (P = 0.03), while the levels of the Lactobacillus group negatively (P = 0.01) with improvement of atopic eczema evaluated by the Severity Scoring of Atopic Dermatitis index......The effect of probiotic bacteria Lactobacillus acidophilus NCFM and Bifidobacterium lactis Bi-07 on the composition of the Lactobacillus group, Bifidobacterium and the total bacterial population in feces from young children with atopic dermatitis was investigated. The study included 50 children...

  20. Inhibition effect of Bifidobacterium longum, Lactobacillus acidophilus, Streptococcus thermophilus and Enterococcus faecalis and their related products on human colonic smooth muscle in vitro.

    Directory of Open Access Journals (Sweden)

    Jing Gong

    Full Text Available To investigate the effects of four strains, generally used in clinic, including Bifidobacterium longum, Lactobacillus acidophilus, Streptococcus thermophilus and Enterococcus faecalis, and their related products on human colonic smooth muscle in vitro.Human colonic circular muscle strips obtained from disease-free margins of resected segments from 25 patients with colorectal cancer were isometrically examined in a constant-temperature organ bath and exposed to different concentrations of living bacteria, sonicated cell fractions and cell-free supernatant (CFS. The area under the curve (AUC representing the contractility of smooth muscle strips was calculated.(1 The four living probiotics inhibited the contractility of human colonic muscle strips only at high concentration (1010 CFUs/mL, all P0.05.Four common probiotics related products, including the sonicated cell fractions and the CFS, obviously inhibited human colonic smooth muscles strips contraction in a dose-dependent manner. Only high concentration living probiotics (1010 CFUs/mL can inhibit the colonic smooth muscles strips contraction. The NO pathway may be partly involved in the inhibitory effect of CFS from Streptococcus thermophilus and Enterococcus faecalis.

  1. Biodesulfurization techniques: Application of selected microorganisms for organic sulfur removal from coals. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Elmore, B.B.

    1993-08-01

    As an alternative to post-combustion desulfurization of coal and pre-combustion desulfurization using physicochemical techniques, the microbial desulfurization of coal may be accomplished through the use of microbial cultures that, in an application of various microbial species, may remove both the pyritic and organic fractions of sulfur found in coal. Organisms have been isolated that readily depyritize coal but often at prohibitively low rates of desulfurization. Microbes have also been isolated that may potentially remove the organic-sulfur fraction present in coal (showing promise when acting on organic sulfur model compounds such as dibenzothiophene). The isolation and study of microorganisms demonstrating a potential for removing organic sulfur from coal has been undertaken in this project. Additionally, the organisms and mechanisms by which coal is microbially depyritized has been investigated. Three cultures were isolated that grew on dibenzothiophene (DBT), a model organic-sulfur compound, as the sole sulfur source. These cultures (UMX3, UMX9, and IGTS8) also grew on coal samples as the sole sulfur source. Numerous techniques for pretreating and ``cotreating`` coal for depyritization were also evaluated for the ability to improve the rate or extent of microbial depyritization. These include prewashing the coal with various solvents and adding surfactants to the culture broth. Using a bituminous coal containing 0.61% (w/w) pyrite washed with organic solvents at low slurry concentrations (2% w/v), the extent of depyritization was increased approximately 25% in two weeks as compared to controls. At slurry concentrations of 20% w/v, a tetrachloroethylene treatment of the coal followed by depyritization with Thiobacillus ferrooxidans increased both the rate and extent of depyritization by approximately 10%.

  2. Response of soil microbial communities and microbial interactions to long-term heavy metal contamination.

    Science.gov (United States)

    Li, Xiaoqi; Meng, Delong; Li, Juan; Yin, Huaqun; Liu, Hongwei; Liu, Xueduan; Cheng, Cheng; Xiao, Yunhua; Liu, Zhenghua; Yan, Mingli

    2017-12-01

    Due to the persistence of metals in the ecosystem and their threat to all living organisms, effects of heavy metal on soil microbial communities were widely studied. However, little was known about the interactions among microorganisms in heavy metal-contaminated soils. In the present study, microbial communities in Non (CON), moderately (CL) and severely (CH) contaminated soils were investigated through high-throughput Illumina sequencing of 16s rRNA gene amplicons, and networks were constructed to show the interactions among microbes. Results showed that the microbial community composition was significantly, while the microbial diversity was not significantly affected by heavy metal contamination. Bacteria showed various response to heavy metals. Bacteria that positively correlated with Cd, e.g. Acidobacteria_Gp and Proteobacteria_thiobacillus, had more links between nodes and more positive interactions among microbes in CL- and CH-networks, while bacteria that negatively correlated with Cd, e.g. Longilinea, Gp2 and Gp4 had fewer network links and more negative interactions in CL and CH-networks. Unlike bacteria, members of the archaeal domain, i.e. phyla Crenarchaeota and Euryarchaeota, class Thermoprotei and order Thermoplasmatales showed only positive correlation with Cd and had more network interactions in CH-networks. The present study indicated that (i) the microbial community composition, as well as network interactions was shift to strengthen adaptability of microorganisms to heavy metal contamination, (ii) archaea were resistant to heavy metal contamination and may contribute to the adaption to heavy metals. It was proposed that the contribution might be achieved either by improving environment conditions or by cooperative interactions. Copyright © 2017 Elsevier Ltd. All rights reserved.

  3. Structural characterization of the bacterial proteasome homolog BPH reveals a tetradecameric double-ring complex with unique inner cavity properties.

    Science.gov (United States)

    Fuchs, Adrian C D; Maldoner, Lorena; Hipp, Katharina; Hartmann, Marcus D; Martin, Jörg

    2018-01-19

    Eukaryotic and archaeal proteasomes are paradigms for self-compartmentalizing proteases. To a large extent, their function requires interplay with hexameric ATPases associated with diverse cellular activities (AAA+) that act as substrate unfoldases. Bacteria have various types of self-compartmentalizing proteases; in addition to the proteasome itself, these include the proteasome homolog HslV, which functions together with the AAA+ HslU; the ClpP protease with its partner AAA+ ClpX; and Anbu, a recently characterized ancestral proteasome variant. Previous bioinformatic analysis has revealed a novel bacterial member of the proteasome family Betaproteobacteria proteasome homolog (BPH). Using cluster analysis, we here affirmed that BPH evolutionarily descends from HslV. Crystal structures of the Thiobacillus denitrificans and Cupriavidus metallidurans BPHs disclosed a homo-oligomeric double-ring architecture in which the active sites face the interior of the cylinder. Using small-angle X-ray scattering (SAXS) and electron microscopy averaging, we found that BPH forms tetradecamers in solution, unlike the dodecamers seen in HslV. Although the highly acidic inner surface of BPH was in striking contrast to the cavity characteristics of the proteasome and HslV, a classical proteasomal reaction mechanism could be inferred from the covalent binding of the proteasome-specific inhibitor epoxomicin to BPH. A ligand-bound structure implied that the elongated BPH inner pore loop may be involved in substrate recognition. The apparent lack of a partner unfoldase and other unique features, such as Ser replacing Thr as the catalytic residue in certain BPH subfamilies, suggest a proteolytic function for BPH distinct from those of known bacterial self-compartmentalizing proteases. © 2018 by The American Society for Biochemistry and Molecular Biology, Inc.

  4. Denitrification of groundwater using a sulfur-oxidizing autotrophic denitrifying anaerobic fluidized-bed MBR: performance and bacterial community structure.

    Science.gov (United States)

    Zhang, Lili; Zhang, Chao; Hu, Chengzhi; Liu, Huijuan; Qu, Jiuhui

    2015-03-01

    This paper investigates a novel sulfur-oxidizing autotrophic denitrifying anaerobic fluidized bed membrane bioreactor (AnFB-MBR) that has the potential to overcome the limitations of conventional sulfur-oxidizing autotrophic denitrification systems. The AnFB-MBR produced consistent high-quality product water when fed by a synthetic groundwater with NO3 (-)-N ranging 25-80 mg/L and operated at hydraulic retention times of 0.5-5.0 h. A nitrate removal rate of up to 4.0 g NO3 (-)-N/Lreactord was attained by the bioreactor, which exceeded any reported removal capacity. The flux of AnFB-MBR was maintained in the range of 1.5-15 L m(-2) h(-1). Successful membrane cleaning was practiced with cleaning cycles of 35-81 days, which had no obvious effect on the AnFB-MBR performance. The (15) N-tracer analyses elucidated that nitrogen was converted into (15) N2-N and (15) N-biomass accounting for 88.1-93.1 % and 6.4-11.6 % of the total nitrogen produced, respectively. Only 0.3-0.5 % of removed nitrogen was in form of (15)N2O-N in sulfur-oxidizing autotrophic denitrification process, reducing potential risks of a significant amount of N2O emissions. The sulfur-oxidizing autotrophic denitrifying bacterial consortium was composed mainly of bacteria from Proteobacteria, Chlorobi, and Chloroflexi phyla, with genera Thiobacillus, Sulfurimonas, and Ignavibacteriales dominating the consortium. The pyrosequencing assays also suggested that the stable microbial communities corresponded to the elevated performance of the AnFB-MBR. Overall, this research described relatively high nitrate removal, acceptable flux, indicating future potential for the technology in practice.

  5. EXAFS investigation of uranium(6) complexes formed at Acidithiobacillus ferro oxidans types

    International Nuclear Information System (INIS)

    Merroun, M.; Reich, T.; Hennig, Ch.; Selenska-Pobell, S.

    2002-01-01

    Mining activities have brought excessive amounts of uranium into the environment. In uranium deposits a number of acidophilic chemo-litho-autotrophic bacteria have been identified which are able to oxidize sulphide minerals, elemental sulphur, ferrous iron and also (in the presence of uranium mineral) U(IV). In particular, the interaction of one representative of the group Acidithiobacillus ferro oxidans (new designation of Thiobacillus ferro oxidans) with uranium has been investigated. Uranium(VI) complex formations at the surfaces of Acidithiobacillus ferro oxidans were studied using uranium L III -edge extended X-ray absorption fine structure (EXAFS) spectroscopy. In all samples uranium is co-ordinated by two axial oxygen atoms (O ax ) at a distance of 1.77-1.78 angstrom. The average distance between uranium and the equatorial oxygen atoms (O eq ) is 2.35 angstrom. The co-ordination number for O eq is 5-6. In comparison to the uranium crystal structure data, the U-O eq distance indicates a co-ordination number of the equatorial oxygen of 5. Within the experimental error, there are no differences in the U-O bond distances between samples from the three types of A. ferro oxidans investigated. The fit to the EXAFS data of samples measured as wet pastes gave the same results as for dried samples. No significant structural differences were observed for the uranium complexes formed by the eco-types of A. ferro oxidans. However, the EXAFS spectra do indicate a formation of uranium complexes which are different from those formed by Bacilli where the bond length of 2.28 angstrom indicates a co-ordination number of 4 for the equatorial oxygen atoms. (authors)

  6. Microbial reduction of SO{sub 2} and NO{sub x} as a means of by-product recovery/disposal from regenerable processes for the desulfurization of flue gas. Technical progress report, September 11, 1992--December 11, 1992

    Energy Technology Data Exchange (ETDEWEB)

    Sublette, K.L.

    1992-12-31

    With the continual increase in the utilization of high sulfur and high nitrogen containing fossil fuels, the release of airborne pollutants into the environment has become a critical problem. The fuel sulfur is converted to SO{sub 2} during combustion. Fuel nitrogen and a fraction of the nitrogen from the combustion air are converted to nitric oxide and nitrogen dioxide, NO{sub x}. For the past five years Combustion Engineering (now Asea Brown Boveri or ABB) and, since 1986, the University of Tulsa (TU) have been investigating the oxidation of H{sub 2}S by the facultatively anaerobic and autotrophic bacterium Thiobacillus denitrificans and have developed a process, concept for the microbial removal of H{sub 2}S from a gas stream the simultaneous removal of SO{sub 2} and NO by D. desulfuricans and T. denitrificans co-cultures and cultures-in-series was demonstrated. These systems could not be sustained due to NO inhibition of D. desulfuricans. However, a preliminary economic analysis has shown that microbial reduction of SO{sub 2} to H{sub 2}S with subsequent conversion to elemental sulfur by the Claus process is both technically and economically feasible if a less expensive carbon and/or energy source can be found. It has also been demonstrated that T. denitrificans can be grown anaerobically on NO(g) as a terminal electron acceptor with reduction to elemental nitrogen. Microbial reduction of NO{sub x} is a viable process concept for the disposal of concentrated streams of NO{sub x} as may be produced by certain regenerable processes for the removal of SO{sub 2} and NO{sub x} from flue gas.

  7. Role of Lactobacillus acidophilus loaded floating beads in chronic fatigue syndrome: behavioral and biochemical evidences.

    Science.gov (United States)

    Singh, P K; Chopra, K; Kuhad, A; Kaur, I P

    2012-04-01

      In recent years the interface between neuropsychiatry and gastroenterology has converged in to a new discipline referred to as enteric neuroscience. Implications of brain-gut communication in the pathogenesis of psychiatric disorders indicate a possible role of suitably packaged/delivered probiotics as newer therapeutic options. In the present study probable role of per-oral administration of free Lactobacillus acidophilus (LAB) and LAB loaded alginate beads in attenuation of the symptoms associated with chronic fatigue syndrome (CFS) were evaluated.   Chronic fatigue syndrome following physical fatigue was induced in rats by forcing them to swim (forced swim test; FST) in water till exhaustion, after weighing them down with 10% their body weight, daily for 28 days. Immobility (I) and postswim fatigue time (PSF) were taken as suitable markers. Free LAB and LAB loaded floating beads (FBs) were administered, from 21 to 28 days.   Immobility and PSF were found to increase considerably in FST rats (665 ± 22 s and 196 ± 6 s) as compared with the naïve (32 ± 7 s and 22 ± 2 s) at 20 days, establishing severe fatigue like behavior. FST control group exhibited significant (P < 0.05) hypertrophy of spleen, hypotrophy of thymus, and increased oxido-nitrosative stress in brain and tumor necrosis factor-α (TNF-α) levels in serum. Treatment with LAB and LAB FBs significantly decreased I and PSF and attenuated (P < 0.05) oxido-nitrosative stress and TNF-α levels. Spleen and thymus were also restored to their original size in this group.   The findings suggest a valuable therapeutic role of LAB especially when incorporated into alginate beads for the treatment of CFS. © 2012 Blackwell Publishing Ltd.

  8. Evaluation of the Effect of Psyllium on the Viability of Lactobacillus Acidophilus in Alginate-Polyl Lysine Beads.

    Science.gov (United States)

    Esmaeilzadeh, Jaleh; Nazemiyeh, Hossein; Maghsoodi, Maryam; Lotfipour, Farzaneh

    2016-09-01

    Purpose: Psylliumseeds are used in traditional herbal medicine to treat various disorders. Moreover, as a soluble fiber, psyllium has potential to stimulate bacterial growth in digestive system. We aimed to substitute alkali-extractable polysaccharides of psyllium for alginate in beads with second coat of poly-l-lysine to coat Lactobacillus acidophilus. Methods: Beads were prepared using extrusion technique. Poly-l-lysine as second coat was incorporated on optimum alginate/psyllium beads using immersion technique. Beads were characterized in terms of size, encapsulation efficiency, integrity and bacterial survival in harsh conditions. Results: Beads with narrow size distribution ranging from 1.85 ± 0.05 to 2.40 ± 0.18 mm with encapsulation efficiency higher than 96% were achieved. Psyllium concentrations in beads did not produce constant trend in bead sizes. Surface topography by SEM showed that substitution of psyllium enhanced integrity of obtained beads. Psyllium successfully protected the bacteria against acidic condition and lyophilization equal to alginate in the beads. Better survivability with beads of alginate/psyllium-poly-l-lysine was achieved with around 2 log rise in bacterial count in acid condition compared to the corresponding single coat beads. Conclusion: Alginate/psyllium (1:2) beads with narrow size distribution and high encapsulation efficiency of the bacteria have been achieved. Presence of psyllium produced a much smoother and integrated surface texture for the beads with sufficient protection of the bacteria against acidic condition as much as alginate. Considering the health benefits of psyllium and its prebiotic activity, psyllium can be beneficially replaced in part for alginate in probiotic coating.

  9. Cell growth and proteolytic activity of Lactobacillus acidophilus, Lactobacillus helveticus, Lactobacillus delbrueckii ssp. bulgaricus, and Streptococcus thermophilus in milk as affected by supplementation with peptide fractions.

    Science.gov (United States)

    Gandhi, Akanksha; Shah, Nagendra P

    2014-12-01

    The present investigation examined the effects of supplementation of milk peptide fractions produced by enzymatic hydrolysis on the fermentation of reconstituted skim milk (RSM). Changes in pH, cell growth, proteolytic activity, and angiotensin-converting enzyme (ACE)-inhibitory activity were monitored during fermentation of RSM by pure cultures of Lactobacillus acidophilus, Lactobacillus helveticus, Lactobacillus delbrueckii ssp. bulgaricus, and Streptococcus thermophilus. The study showed that supplementation with peptide fractions of different molecular weights did not significantly affect the bacterial growth in RSM. All bacteria showed an increased proteolytic activity in RSM supplemented with large peptides (>10 kDa), and L. helveticus in general exhibited the highest proteolytic activity among the bacteria studied. The ACE-inhibitory activity was observed to be the maximum in RSM supplemented with larger peptides (>10 kDa) for all bacteria. The results suggest that proteolysis by bacteria leads to increased production of ACE-inhibitory peptides compared to the supplemented peptides produced by enzymatic hydrolysis.

  10. Some Soil Characters and Qualitative Traits of Sunflower Seeds to Different Nutritional Regimes

    Directory of Open Access Journals (Sweden)

    F Soleymani

    2018-05-01

    Full Text Available Introduction To achieve the high economic yield in crops, supplying enough nutrients for plants is important, that much of it, supplied by chemical fertilizers. But excessive use of chemical fertilizers led to environmental problems that these negative effects have caused attention to healthy and ecological sustainable farming systems. One solution to reduce dependence on chemical fertilizers is application of organic and biological products for plant nutrition. Bio-fertilizers are made from one or more species of beneficial microorganisms with preservatives and or their products. In addition, vermicompost is an organic fertilizer and mixed of very active biological bacteria, enzymes, plant residues, manure and earthworm capsule which leads to continued organic matter decomposition and development of microbial and enzymatic activities in soil. Several experiments have shown that the using of biological and organic fertilizers improve growth and quality of products. Materials and Methods To investigate the effect of various nutritional regimes on seed quality characteristics of sunflower (Euroflour cv. and some soil characters, an experiment was carried out as a randomized complete block design with 3 replications in 2015 at the Agricultural Faculty of Bu-Ali Sina University.Treatments included no biological or chemical fertilizer application, 100% of the recommended NP fertilizers (250 kg urea per hectare, 50 kg triple superphosphate per hectare, ½ recomended NP fertilizers, vermicompost (15 ton per hectare mixed with soil, phosphonitrokara (including Bacillus coagulans, Azotobacter chroococcum, Azospirillum lipoferum, 110 ml to inoculate 10 kg seeds, biosulfur (including Thiobacillus,mix 6 kg of fertilizer with 300 kg sulphur for 1 hectare, vermicompost+ phosphonitrokara, vermicompost+ biosulfur, vermicompost+½ NP fertilizers, phosphonitrokara+½ NP fertilizers, biosulfur+½ NP fertilizers, vermicompost+ phosphonitrokara+½ NP fertilizers

  11. Stability and properties of quasi-stable conformational states in the LH2 light-harvesting complex of Rbl. acidophilus bacteria formed by hexacoordination of bacteriochlorophyll a magnesium atom

    Science.gov (United States)

    Belov, Aleksandr S.; Khokhlov, Daniil V.; Glebov, Ilya O.; Poddubnyy, Vladimir V.; Eremin, Vadim V.

    2017-06-01

    Single-molecule spectroscopic experiments on several light-harvesting complexes revealed the existence of a set of metastable conformational states with different spectroscopic properties and lifetimes spanning from milliseconds to tens of seconds. In the absence of explicit structural data, a number of probable structural changes underlying the observed spectroscopic shifts were proposed. We examine the donor-acceptor interaction between the magnesium atom and the acetyl group of the adjacent bacteriochlorophylls a as a possible origin of metastable conformational states in the LH2 light-harvesting complex of Rbl. acidophilus bacteria. The results of QM/MM and molecular dynamics simulations show that such ligation can occur at room temperature and leads to one metastable coordination bond per pair of bacteriochlorophylls in the B850 ring. According to the results of Poisson-TrESP modeling, such coordination lowers the energies of the excited states of the complex by up to 163 cm-1 which causes red spectral shift of the B850 band.

  12. Salivary mutans streptococci and lactobacilli modulations in young children on consumption of probiotic ice-cream containing Bifidobacterium lactis Bb12 and Lactobacillus acidophilus La5.

    Science.gov (United States)

    Singh, Richa Polka; Damle, Satyawan Gangaram; Chawla, Amrita

    2011-11-01

    To compare the levels of mutans streptococci and lactobacilli in saliva of school children, before and after consumption of probiotic and control ice-cream. A double-blind, cross-over, placebo-controlled trial was carried out in forty, 12-14 year-old children, with no clinically detectable caries. The selected children were randomized equally into two groups I and II. Following an initial run-in period of 1 week, children in group I and II were given ice-creams 'A' and 'B', respectively, for 10 days. Being a cross-over study, the ice-creams were interchanged in the two groups after a 2-week wash-out period. Saliva samples at baseline and follow-up were assessed using Dentocult SM and Dentocult LB kits. On statistical evaluation, it was seen that probiotic ice-cream brought about a statistically significant reduction (p-value = 0.003) in salivary mutans streptococci levels with no significant effect on lactobacilli levels. In conclusion, probiotic ice-cream containing Bifidobacterium lactis Bb-12 ATCC27536 and Lactobacillus acidophilus La-5 can reduce the levels of certain caries-associated micro-organisms in saliva.

  13. Absolute Enumeration of Probiotic Strains Lactobacillus acidophilus NCFM® and Bifidobacterium animalis subsp. lactis Bl-04® via Chip-Based Digital PCR

    Directory of Open Access Journals (Sweden)

    Sarah J. Z. Hansen

    2018-04-01

    Full Text Available The current standard for enumeration of probiotics to obtain colony forming units by plate counts has several drawbacks: long time to results, high variability and the inability to discern between bacterial strains. Accurate probiotic cell counts are important to confirm the delivery of a clinically documented dose for its associated health benefits. A method is described using chip-based digital PCR (cdPCR to enumerate Bifidobacterium animalis subsp. lactis Bl-04 and Lactobacillus acidophilus NCFM both as single strains and in combination. Primers and probes were designed to differentiate the target strains against other strains of the same species using known single copy, genetic differences. The assay was optimized to include propidium monoazide pre-treatment to prevent amplification of DNA associated with dead probiotic cells as well as liberation of DNA from cells with intact membranes using bead beating. The resulting assay was able to successfully enumerate each strain whether alone or in multiplex. The cdPCR method had a 4 and 5% relative standard deviation (RSD for Bl-04 and NCFM, respectively, making it more precise than plate counts with an industry accepted RSD of 15%. cdPCR has the potential to replace traditional plate counts because of its precision, strain specificity and the ability to obtain results in a matter of hours.

  14. Performance and microbial community composition in a long-term sequential anaerobic-aerobic bioreactor operation treating coking wastewater.

    Science.gov (United States)

    Joshi, Dev Raj; Zhang, Yu; Tian, Zhe; Gao, Yingxin; Yang, Min

    2016-09-01

    The combined anaerobic-aerobic biosystem is assumed to consume less energy for the treatment of high strength industrial wastewater. In this study, pollutant removal performance and microbial diversity were assessed in a long-term (over 300 days) bench-scale sequential anaerobic-aerobic bioreactor treating coking wastewater. Anaerobic treatment removed one third of the chemical oxygen demand (COD) and more than half of the phenols with hydraulic retention time (HRT) of 42 h, while the combined system with total HRT of 114 h removed 81.8, 85.6, 99.9, 98.2, and 85.4 % of COD, total organic carbon (TOC), total phenols, thiocyanate, and cyanide, respectively. Two-dimensional gas chromatography with time-of-flight mass spectrometry showed complete removal of phenol derivatives and nitrogenous heterocyclic compounds (NHCs) via the combined system, with the anaerobic process alone contributing 58.4 and 58.6 % removal on average, respectively. Microbial activity in the bioreactors was examined by 454 pyrosequencing of the bacterial, archaeal, and fungal communities. Proteobacteria (61.2-93.4 %), particularly Betaproteobacteria (34.4-70.1 %), was the dominant bacterial group. Ottowia (14.1-46.7 %), Soehngenia (3.0-8.2 %), and Corynebacterium (0.9-12.0 %), which are comprised of phenol-degrading and hydrolytic bacteria, were the most abundant genera in the anaerobic sludge, whereas Thiobacillus (6.6-43.6 %), Diaphorobacter (5.1-13.0 %), and Comamonas (0.2-11.1 %) were the major degraders of phenol, thiocyanate, and NHCs in the aerobic sludge. Despite the low density of fungi, phenol degrading oleaginous yeast Trichosporon was abundant in the aerobic sludge. This study demonstrated the feasibility and optimization of less energy intensive treatment and the potential association between abundant bacterial groups and biodegradation of key pollutants in coking wastewater.

  15. Integrated micro-biochemical approach for phytoremediation of cadmium and lead contaminated soils using Gladiolus grandiflorus L cut flower.

    Science.gov (United States)

    Mani, Dinesh; Kumar, Chitranjan; Patel, Niraj Kumar

    2016-02-01

    The potential of vermicompost, elemental sulphur, Thiobacillus thiooxidans and Pseudomonas putida for phytoremediation is well known individually but their integrated approach has not been discovered so far. The present work highlights the consideration of so far overlooked aspects of their integrated treatment by growing the ornamental plant, Gladiolus grandiflorus L in uncontaminated and sewage-contaminated soils (sulphur-deficient alluvial Entisols, pH 7.6-7.8) for phytoremediation of cadmium and lead under pot experiment. Between vermicompost and elemental sulphur, the response of vermicompost was higher towards improvement in the biometric parameters of plants, whereas the response of elemental sulphur was higher towards enhanced bioaccumulation of heavy metals under soils. The integrated treatment (T7: vermicompost 6g and elemental sulphur 0.5gkg(-1) soil and co-inoculation of the plant with T. thiooxidans and P. putida) was found superior in promoting root length, plant height and dry biomass of the plant. The treatment T7 caused enhanced accumulation of Cd up to 6.96 and 6.45mgkg(-1) and Pb up to 22.6 and 19.9mgkg(-1) in corm and shoot, respectively at the contaminated soil. T7 showed maximum remediation efficiency of 0.46% and 0.19% and bioaccumulation factor of 2.92 and 1.21 and uptake of 6.75 and 21.4mgkg(-1) dry biomass for Cd and Pb respectively in the contaminated soil. The integrated treatment T7 was found significant over the individual treatments to promote plant growth and enhance phytoremediation. Hence, authors conclude to integrate vermicompost, elemental sulphur and microbial co-inoculation for the enhanced clean-up of Cd and Pb-contaminated soils. Copyright © 2015 Elsevier Inc. All rights reserved.

  16. Vegetation successfully prevents oxidization of sulfide minerals in mine tailings.

    Science.gov (United States)

    Li, Yang; Sun, Qingye; Zhan, Jing; Yang, Yang; Wang, Dan

    2016-07-15

    The oxidization of metal sulfide in tailings causes acid mine drainage. However, it remains unclear whether vegetation prevents the oxidization of metal sulfides. The oxidization characteristics and microbial indices of the tailings in the presence of various plant species were investigated to explore the effects of vegetation on the oxidization of sulfide minerals in tailings. The pH, reducing sulfur, free iron oxides (Fed), chemical oxygen consumption (COC) and biological oxygen consumption (BOC) were measured. Key iron- and sulfur-oxidizing bacteria (Acidithiobacillus spp., Leptospirillum spp. and Thiobacillus spp.) were quantified using real-time PCR. The results indicate that vegetation growing on tailings can effectively prevent the oxidization of sulfide minerals in tailings. A higher pH and reducing-sulfur content and lower Fed were observed in the 0-30 cm depth interval in the presence of vegetation compared to bare tailings (BT). The COC gradually decreased with depth in all of the soil profiles; specifically, the COC rapidly decreased in the 10-20 cm interval in the presence of vegetation but gradually decreased in the BT profiles. Imperata cylindrica (IC) and Chrysopogon zizanoides (CZ) profiles contained the highest BOC in the 10-20 cm interval. The abundance of key iron- and sulfur-oxidizing bacteria in the vegetated tailings were significantly lower than in the BT; in particular, IC was associated with the lowest iron- and sulfur-oxidizing bacterial abundance. In conclusion, vegetation successfully prevented the oxidization of sulfide minerals in the tailings, and Imperata cylindrica is the most effective in reducing the number of iron- and sulfur-oxidizing bacteria and helped to prevent the oxidization of sulfide minerals in the long term. Copyright © 2016 Elsevier Ltd. All rights reserved.

  17. Site-Specific Bioconjugation of an Organometallic Electron Mediator to an Enzyme with Retained Photocatalytic Cofactor Regenerating Capacity and Enzymatic Activity

    Directory of Open Access Journals (Sweden)

    Sung In Lim

    2015-04-01

    Full Text Available Photosynthesis consists of a series of reactions catalyzed by redox enzymes to synthesize carbohydrates using solar energy. In order to take the advantage of solar energy, many researchers have investigated artificial photosynthesis systems mimicking the natural photosynthetic enzymatic redox reactions. These redox reactions usually require cofactors, which due to their high cost become a key issue when constructing an artificial photosynthesis system. Combining a photosensitizer and an Rh-based electron mediator (RhM has been shown to photocatalytically regenerate cofactors. However, maintaining the high concentration of cofactors available for efficient enzymatic reactions requires a high concentration of the expensive RhM; making this process cost prohibitive. We hypothesized that conjugation of an electron mediator to a redox enzyme will reduce the amount of electron mediators necessary for efficient enzymatic reactions. This is due to photocatalytically regenerated NAD(PH being readily available to a redox enzyme, when the local NAD(PH concentration near the enzyme becomes higher. However, conventional random conjugation of RhM to a redox enzyme will likely lead to a substantial loss of cofactor regenerating capacity and enzymatic activity. In order to avoid this issue, we investigated whether bioconjugation of RhM to a permissive site of a redox enzyme retains cofactor regenerating capacity and enzymatic activity. As a model system, a RhM was conjugated to a redox enzyme, formate dehydrogenase obtained from Thiobacillus sp. KNK65MA (TsFDH. A RhM-containing azide group was site-specifically conjugated to p-azidophenylalanine introduced to a permissive site of TsFDH via a bioorthogonal strain-promoted azide-alkyne cycloaddition and an appropriate linker. The TsFDH-RhM conjugate exhibited retained cofactor regenerating capacity and enzymatic activity.

  18. RNA-based molecular survey of biodiversity of limestone tombstone microbiota in response to atmospheric sulphur pollution.

    Science.gov (United States)

    Villa, F; Vasanthakumar, A; Mitchell, R; Cappitelli, F

    2015-01-01

    Outdoor stoneworks sustain biofilm formation and are constantly at risk of deterioration by micro-organisms. In this study, the biofilm microflora of historic limestone tombstones located in a highly polluted urban environment (Cambridge, MA) and in a less polluted location (Lexington, MA) were compared using comprehensive RNA-based molecular analyses of 16S rRNA gene sequences as well as sequences of genes for different pathways of sulphur metabolism (soxB, apsA, dsrA). The metabolically active micro-organisms detected by denaturing gradient gel electrophoresis analysis of 16S rRNA fragments were predominantly represented by cyanobacteria (belonging to the family Nostocaceae and to the genus Chroococcidiopsis) in both polluted and unpolluted environments. The investigation of soxB, apsA, dsrA transcripts reflected the abundance and the diversity of sulphur-oxidizing and sulphate-reducing bacteria in the Cambridge samples in comparison with the Lexington samples. The investigation revealed that in addition to phototrophic sulphur bacteria belonging to the genera Thiocapsa, Halochromatium, Allochromatium, Thiococcus and Thermochromatium, other sulphate-oxidizing prokaryotes (e.g. the genus Thiobacillus) as well as sequences of Deltaproteobacteria from the genus Desulfovibrio occurred at the polluted urban site. The interactions between the main functional groups retrieved from the limestone tombstones were discussed. The biofilm microflora inhabiting historic limestones are a multi-component open ecosystem sensitively reacting to all environmental factors including air pollutants. Little is known about specific target groups that are active in the biofilm and their physiological functions. For the first time, transcripts involved in important energy-yielding processes were investigated to reveal the metabolic capabilities of the microflora in response to atmospheric sulphur pollution. This work provides novel and important information about the ecology of limestone

  19. Bioprocessing of coal - 10 - an application of microbial flotation to mineral processing

    Energy Technology Data Exchange (ETDEWEB)

    Nagaoka, T. [and others] [CRIEPI, Abiko-shi (Japan). Abiko Research Lab.

    1996-09-01

    Microbial flotation for coal desulfurization is being developed. Pyrite in coal is removed by bacterial adhesion by changing the surface property of pyrite. The bacterial adhesion of Thiobacillus ferrooxidans to sulfide minerals (pyrite, galena, molybdenite, chalcocite and millerite), and pyrite removal from the mixture of these sulfide minerals by microbial flotation was investigated. To compare the adhesion of T. ferrooxidans to pyrite with that to the other four minerals mentioned, the surface areas of the minerals, where the bacterium could adhere, was measured. It was observed that the roughness on the mineral surfaces was much smaller than the size of the bacterial cells. Hence, it was suggested that the roughness did not affect the bacterial adhesion to mineral surfaces. Bacterial adhesion to pyrite was compared with that to the other minerals. The amount of adhering bacterium was estimated on the basis of the adherable surface area measured with microscopic method. The amount of adhering cells to pyrite was 421.6 x 10{sup 8} cells/cm{sup 2}. On the other hand, the amounts of adhering cells to the minerals, except for pyrite were in a range of 77.1 to 160.8 x 10{sup 8} cells/cm{sup 2}. The bacterium adheres more to pyrite than to the other minerals, and only adheres to pyrite even if the pyrite is mixed with other minerals. Hence, T. ferrooxidans could adhere selectively to pyrite. Pyrite removal from the mineral mixtures was investigated with microbial flotation. Pyrite removal was in a range of 83.7% to 95.1% and mineral recovery was 72.9% to 100%. The grade of recovered minerals was in a range of 79.2 to 86.0% and that of rejected pyrite was in a range of 78.7 to 90.0%. These results suggest that microbial flotation can be a novel technology for mineral processing.

  20. Extraction of metals from ores by bacterial leaching: present status and future prospects

    International Nuclear Information System (INIS)

    Kelly, D.P.

    1977-01-01

    The principal organism effecting bacterial leaching of ferrous and sulfide ores is Thiobacillus ferrooxidans, though other thiobacilli and other bacteria may be involved. The process depends on (a) direct solubilization of metal sulfides by bacterial oxidation; (b) dissolution of metal sulfides or oxides by ferric iron produced by bacterial pyrite oxidation. Mining spoil dumps and low grade ores can be leached for copper or uranium by cheap low-level technology. Dump leaching enables maximum recovery of valuable metal from any ore, but makes possible exploitation of very low grade Cu and U ores. Continuous extraction processes are possible where a continuously growing bacterial culture is fed with pyritic ores (or FeSO 4 or other sulfide) and continuous metal solubilization proceeds. Intimate contact between the bacteria and the ore to be leached (especially with uranium oxide ores) is not always necessary: leaching of UO 2 ores probably depends only on ferric iron reaction with the ore. Degradation of pyrite-containing rocks may also be developed as part of future recovery processes for petroleum from oil shales. Two-stage leaching systems present the best prospect for developing a higher-level technology for metal extraction. State 1: bacterial generation of Fe 3+ from pyrite or a Fe 2+ source; Stage 2: chemical leaching of ore by Fe 3+ in acid solution. Two-stage processes can be surface processes using crushed or milled ores or can be applied to underground solution mining, when an ore (e.g. uranium) can be leached by pumping Fe 3+ solutions through shattered underground deposits, metal recovered (e.g. solvent extraction) and Fe 3+ regenerated by bacterial oxidation at the surface. The use of controlled continuous microbial cultures to generate either bacteria or ferric iron is outlined

  1. Genome Analysis of the Biotechnologically Relevant Acidophilic Iron Oxidising Strain JA12 Indicates Phylogenetic and Metabolic Diversity within the Novel Genus "Ferrovum".

    Directory of Open Access Journals (Sweden)

    Sophie R Ullrich

    Full Text Available Members of the genus "Ferrovum" are ubiquitously distributed in acid mine drainage (AMD waters which are characterised by their high metal and sulfate loads. So far isolation and microbiological characterisation have only been successful for the designated type strain "Ferrovum myxofaciens" P3G. Thus, knowledge about physiological characteristics and the phylogeny of the genus "Ferrovum" is extremely scarce.In order to access the wider genetic pool of the genus "Ferrovum" we sequenced the genome of a "Ferrovum"-containing mixed culture and successfully assembled the almost complete genome sequence of the novel "Ferrovum" strain JA12.The genome-based phylogenetic analysis indicates that strain JA12 and the type strain represent two distinct "Ferrovum" species. "Ferrovum" strain JA12 is characterised by an unusually small genome in comparison to the type strain and other iron oxidising bacteria. The prediction of nutrient assimilation pathways suggests that "Ferrovum" strain JA12 maintains a chemolithoautotrophic lifestyle utilising carbon dioxide and bicarbonate, ammonium and urea, sulfate, phosphate and ferrous iron as carbon, nitrogen, sulfur, phosphorous and energy sources, respectively.The potential utilisation of urea by "Ferrovum" strain JA12 is moreover remarkable since it may furthermore represent a strategy among extreme acidophiles to cope with the acidic environment. Unlike other acidophilic chemolithoautotrophs "Ferrovum" strain JA12 exhibits a complete tricarboxylic acid cycle, a metabolic feature shared with the closer related neutrophilic iron oxidisers among the Betaproteobacteria including Sideroxydans lithotrophicus and Thiobacillus denitrificans. Furthermore, the absence of characteristic redox proteins involved in iron oxidation in the well-studied acidophiles Acidithiobacillus ferrooxidans (rusticyanin and Acidithiobacillus ferrivorans (iron oxidase indicates the existence of a modified pathway in "Ferrovum" strain JA12

  2. Effects of organic, biological and chemical fertilizers on vegetative indices and essential oil content of coriander (Coriandrum sativum L.

    Directory of Open Access Journals (Sweden)

    M Aghhavani Shajari

    2016-05-01

    Full Text Available This experiment was conducted to study the effects of single and combined application of organic, biological and chemical fertilizers on qualitative and quantitative characteristics of vegetative part of coriander, (Coriandrum sativum L.. The experiment was carried out as split plot in time based on Complete Randomized Block Design with three replications and 12 treatments at Research Station, Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, during growing season of 2010-2011. Treatments included: (1 mycorrhiza (Glomus mosseae, (2 biosulfur (Thiobacillus sp., (3 chemical fertilizer (NPK, (4 cow manure, (5 vermicompost, (6 mycorrhiza + chemical fertilizer, (7 mycorrhiza + cow manure, (8 mycorrhiza + vermicompost, (9 biosulfur + chemical fertilizer, (10 biosulfur + cow manure, (11 biosulfur + vermicompost and (12 control. Vegetative parts of coriander were cut at 5% of flowering stage in two dates (19 May and 5 June. Results showed that the highest plant height (28 cm and lateral branches (5.2 were obtained in combined application of biosulfur with cow manure treatment. The highest fresh and dry leaf weight, fresh and dry matter yield and stem dry matter weight were obtained in single application of chemical fertilizer. Single application of biosulfur increased leaf/stem ratio. The highest essential oil percentage and essential oil yield were observed in cow manure treatment (0.2% and 1753 g.ha-1, respectively. The maximum leaf/stem ratio were observed in the first cutting, while the highest lateral branches, stem fresh and dry matter yield, essential oil percentage and essential oil yield were obtained in second cut. Overall, results of this study showed that the plant vegetative yield increased by using chemical fertilizer, while essential oil percentage and essential oil yield of coriander were improved by using organic and biological fertilizers.

  3. A novel approach for rapidly and cost-effectively assessing toxicity of toxic metals in acidic water using an acidophilic iron-oxidizing biosensor.

    Science.gov (United States)

    Yang, Shih-Hung; Cheng, Kuo-Chih; Liao, Vivian Hsiu-Chuan

    2017-11-01

    Contamination by heavy metals and metalloids is a serious environmental and health concern. Acidic wastewaters are often associated with toxic metals which may enter and spread into agricultural soils. Several biological assays have been developed to detect toxic metals; however, most of them can only detect toxic metals in a neutral pH, not in an acidic environment. In this study, an acidophilic iron-oxidizing bacterium (IOB) Strain Y10 was isolated, characterized, and used to detect toxic metals toxicity in acidic water at pH 2.5. The colorimetric acidophilic IOB biosensor was based on the inhibition of the iron oxidizing ability of Strain Y10, an acidophilic iron-oxidizing bacterium, by metals toxicity. Our results showed that Strain Y10 is acidophilic iron-oxidizing bacterium. Thiobacillus caldus medium (TCM) (pH 2.5) supplied with both S 4 O 6 2- and glucose was the optimum growth medium for Strain Y10. The optimum temperature and pH for the growth of Strain Y10 was 45 °C and pH 2.5, respectively. Our study demonstrates that the color-based acidophilic IOB biosensor can be semi-quantitatively observed by eye or quantitatively measured by spectrometer to detect toxicity from multiple toxic metals at pH 2.5 within 45 min. Our study shows that monitoring toxic metals in acidic water is possible by using the acidophilic IOB biosensor. Our study thus provides a novel approach for rapid and cost-effective detection of toxic metals in acidic conditions that can otherwise compromise current methods of chemical analysis. This method also allows for increased efficiency when screening large numbers of environmental samples. Copyright © 2017 Elsevier Ltd. All rights reserved.

  4. Effect of Sulfur Application on Spinach Phytoremedaiton Process of Cadmium in Contaminated Calcareous Soils

    Directory of Open Access Journals (Sweden)

    Ali Kasraian

    2012-07-01

    Full Text Available Recently, cadmium (Cd concentration has increased in croplands through sewage sludge and phosphorous fertilizers application. On the other hand, some special methods, like phytoremedation, were introduced in order to decrease soil contamination hazard. Calcium carbonate plays an important role in Cd solubility in highly calcareous soils. Sulfurs oxidation, by dissolving Cd carbonate fraction, may improve phytoremediation efficiency. An experiment was conducted to study the effects of S application (equivalent to 0, 2, 4 and 6 Mg S ha-1 on Diethylene Triamine Pentaacetic Acid  (DTPA extractable Cd and also on Cd uptake and extraction by spinach (Spinacea oleracea L. in calcareous soils which were contaminated by 40mg Cd kg-1. To ensure biological S oxidation, all S-treated samples were inoculated by Thiobacillus spp. and incubated for 50 days. The soil pH, EC and soluble sulfate were affected by S application and it clearly showed that S oxidation process was occurred in Cd treated soils. The most significant change for pH and sulfate were observed at 4 Mg S ha-1 and for electrical conductivity (EC of soil it occurred at 6Mg S ha-1. Application of S had no effect on DTPA extractable Cd in soils whereas; its concentration increased 73.55% in average in plant tissue. Plant dry matter decreased significantly (about 63 percent following Cd application. Although the highest rate of S oxidation was observed at 4 and 6 Mg S ha-1 tٰٰٰhe maximum Cd extraction (2.5µg Cd pot-1 was observed at 2 Mg S ha-1 . This may be due to adverse effect of Cd toxicity and increase of soluble salt resulted by S oxidation in higher level of S application.

  5. Improved quinoa growth, physiological response, and seed nutritional quality in three soils having different stresses by the application of acidified biochar and compost.

    Science.gov (United States)

    Ramzani, Pia Muhammad Adnan; Shan, Lin; Anjum, Shazia; Khan, Waqas-Ud-Din; Ronggui, Hu; Iqbal, Muhammad; Virk, Zaheer Abbas; Kausar, Salma

    2017-07-01

    Quinoa (Chenopodium quinoa Willd.) is a traditional Andean agronomical resilient seed crop having immense significance in terms of high nutritional qualities and its tolerance against various abiotic stresses. However, finite work has been executed to evaluate the growth, physiological, chemical, biochemical, antioxidant properties, and mineral nutrients bioavailability of quinoa under abiotic stresses. Depending on the consistency in the stability of pH, intended rate of S was selected from four rates (0.1, 0.2, 0.3, 0.4 and 0.5% S) for the acidification of biochar and compost in the presence of Thiobacillus thiooxidans by pH value of 4. All three soils were amended with 1% (w/w) acidified biochar (BC A ) and compost (CO A ). Results revealed that selective plant growth, yield, physiological, chemical and biochemical improved significantly by the application of BC A in all stressed soils. Antioxidants in quinoa fresh leaves increased in the order of control > CO A  > BC A , while reactive oxygen species decreased in the order of control < CO A  < BC A . A significant reduction in anti-nutrients (phytate and polyphenols) was observed in all stressed soils with the application of BC A . Moreover, incorporation of CO A and BC A reduced the pH of rhizosphere soil by 0.4-1.6 units in all stressed soils, while only BC A in bulk soil decreased pH significantly by 0.3 units. These results demonstrate that BC A was more effective than CO A to enhance the bioavailability, translocation of essential nutrients from the soil to plant and their enhanced bioavailability in the seed. Copyright © 2017. Published by Elsevier Masson SAS.

  6. The effect of plant growth promoting rhizobacteria (PGPR on quantitative and qualitative characteristics of Sesamum indicum L. with application of cover crops of Lathyrus sp. and Persian clover (Trifolium resopinatum L.

    Directory of Open Access Journals (Sweden)

    M. Jahan

    2016-05-01

    Full Text Available Cover crops cultivation and application of plant growth rhizobacteria are the key factors to enhance agroecosystem health. A field experiment was conducted at the Research Farm of Faculty of Agriculture, Ferdowsi University of Mashhad, Iran, during growing season of 2009-2010. A split plot arrangement based on a complete randomized block design with three replications was used. Cultivation and no cultivation of Lathyrus sp. and Persian clover (Trifolium resopinatum in autumn assigned to the main plots. The sub plot factor consisted of three different types of biofertilizers plus control, including 1-nitroxin (containing of Azotobacter sp. and Azospirillum sp., 2- phosphate solubilizing bacteria (PSB (containing of Bacillus sp. and Pseudomonas sp., 3- biosulfur (containing of Thiobacillus ssp. and 4- control (no fertilizer. The results showed the effect of cover crops on seed number and seed weight per plant, biological and seed yield was significant, as the seed yield increased of 9 %. In general, biofertilizers showed superiority due to the most studied traits compared to control. Nitroxin, PSB and biosulfur increased biological yield of 44, 28 and 26 % compared to control, respectively. Cover crops and biofertilizers interactions, showed significant effect on all studied traits, as the highest and the lowest harvest index resulted in cover crop combined with biofertilizers (22.1% and cultivation and no cultivation of cover crops combined with control (15.3%, respectively. The highest seed oil and protein content resulted from cover crops plus biofertilizers (42.4% and cover crops plus PSB (22.5%, respectively. In general, the results showed cover crops cultivation in combination with biofertilizers application could be an ecological alternative for chemical fertilizers, in addition of achieving advantages of cover crops. According to the results, it should be possible to design an ecological cropping system and produce appropriate and healthy

  7. Early administration of probiotic Lactobacillus acidophilus and/or prebiotic inulin attenuates pathogen-mediated intestinal inflammation and Smad 7 cell signaling

    Science.gov (United States)

    Foye, Ondulla T.; Huang, I-Fei; Chiou, Christine C.; Walker, W. Allan; Shi, Hai Ning

    2014-01-01

    Immaturity of gut-associated immunity may contribute to pediatric mortality associated with enteric infections. A murine model to parallel infantile enteric disease was used to determine the effects of probiotic, Lactobacillus acidophilus (La), prebiotic, inulin, or both (synbiotic, syn) on pathogen-induced inflammatory responses, NF-κB, and Smad 7 signaling. Newborn mice were inoculated bi-weekly for 4 weeks with La, inulin, or syn and challenged with Citrobacter rodentium (Cr) at 5 weeks. Mouse intestinal epithelial cells (CMT93) were exposed to Cr to determine temporal alterations in NF-Kappa B and Smad 7 levels. Mice with pretreatment of La, inulin, and syn show reduced intestinal inflammation following Cr infection compared with controls, which is associated with significantly reduced bacterial colonization in La, inulin, and syn animals. Our results further show that host defense against Cr infection correlated with enhanced colonic IL-10 and transforming growth factor-β expression and inhibition of NF-κB in syn-treated mice, whereas mice pretreated with syn, La, or inulin had attenuation of Cr-induced Smad 7 expression. There was a temporal Smad 7 and NF-κB intracellular accumulation post-Cr infection and post-tumor necrosis factor stimulation in CMT93 cells. These results, therefore, suggest that probiotic, La, prebiotic inulin, or synbiotic may promote host-protective immunity and attenuate Cr-induced intestinal inflammation through mechanisms affecting NF-κB and Smad 7 signaling. PMID:22524476

  8. Lactobacillus rhamnosus HN001 and Lactobacillus acidophilus La-14 Attenuate Gardnerella vaginalis-Infected Bacterial Vaginosis in Mice.

    Science.gov (United States)

    Jang, Se-Eun; Jeong, Jin-Ju; Choi, Su-Young; Kim, Hyunji; Han, Myung Joo; Kim, Dong-Hyun

    2017-05-23

    Oral administration of a probiotic mixture (PM; Respecta ® ) consisting of Lactobacillus rhamnosus HN001 (L1), Lactobacillus acidophilus La-14 (L2), and lactoferrin RCXTM results in colonization of these probiotics in the vagina of healthy women. Therefore, we examined whether vaginal colonization of the PM ingredients L1 and L2 could attenuate bacterial vaginosis (BV). BV was induced in mice via β-estradiol-3-benzoate-induced immunosuppression and intravaginal inoculation with Gardnerella vaginalis (GV). Inflammatory markers were analyzed using enzyme-linked immunosorbent assay, immunoblotting, quantitative polymerase chain reaction, and flow cytometry. Oral or intravaginal administration of PM resulted in colonization of L1 and L2 in the vagina. Oral or intravaginal administration of L1, L2, or PM significantly inhibited GV-induced epithelial cell disruption, myeloperoxidase activity, NF-κB activation, and IL-1β and TNF-α expression ( p < 0.05). Administration of these probiotics also inhibited IL-17 and RORγt expression but increased IL-10 and Foxp3 expression. Of these probiotics, L2 most effectively attenuated GV-induced BV, followed by L1 and PM. Oral administration was more effective against GV-induced BV than intravaginal administration. L1 and L2 also significantly inhibited the adherence of GV to HeLa cells (a human cervical cancer cell line) and GV growth in vitro. In addition, L1 and L2 inhibited lipopolysaccharide-induced NF-κB activation in macrophages and the differentiation of splenocytes into Th17 cells in vitro, but increased their differentiation into Treg cells. Our study suggests that L1, L2, and PM attenuated GV-induced vaginosis by regulating both vaginal and systemic innate and adaptive immune responses rather than direct competition or killing of GV in the vagina.

  9. Antagonistic Activity of Probiotic Organism Against Vibrio cholerae and Cryptococcus neoformans

    Directory of Open Access Journals (Sweden)

    Vidya, R.

    2010-01-01

    Full Text Available The microbes are useful in many ways in the modern world. Probiotics one of them, which refers to, acid adherence bacteria in the intestinal cells, are able to survive at low pH and produce large amount of lactic acid. The present investigation deals with the antagonistic activity of Lactobacillus acidophilus organism against pathogens. The organism was isolated from the curd sample. Identification of bacteria was done by various biochemical testing. The present study revealed that L. acidophilus inhibits Vibrio cholerae more efficiently than Streptococcus pneumoniae and Shigella dysentriae. When L. acidophilus and V. cholerae were grown together, L. acidophilus dominated the growth and competitively inhibited the growth of V. cholerae. L. acidophilus was also found to inhibit Cryptococcus neoformans.

  10. The Differential Proteome of the Probiotic Lactobacillus acidophilus NCFM Grown on the Potential Prebiotic Cellobiose Shows Upregulation of Two β-Glycoside Hydrolases

    Directory of Open Access Journals (Sweden)

    Gabriella C. van Zanten

    2015-01-01

    Full Text Available Probiotics, prebiotics, and combinations thereof, that is, synbiotics, are known to exert beneficial health effects in humans; however interactions between pro- and prebiotics remain poorly understood at the molecular level. The present study describes changes in abundance of different proteins of the probiotic bacterium Lactobacillus acidophilus NCFM (NCFM when grown on the potential prebiotic cellobiose as compared to glucose. Cytosolic cell extract proteomes after harvest at late exponential phase of NCFM grown on cellobiose or glucose were analyzed by two dimensional difference gel electrophoresis (2D-DIGE in the acidic (pH 4–7 and the alkaline (pH 6–11 regions showing a total of 136 spots to change in abundance. Proteins were identified by MS or MS/MS from 81 of these spots representing 49 unique proteins and either increasing 1.5–13.9-fold or decreasing 1.5–7.8-fold in relative abundance. Many of these proteins were associated with energy metabolism, including the cellobiose related glycoside hydrolases phospho-β-glucosidase (LBA0881 and phospho-β-galactosidase II (LBA0726. The data provide insight into the utilization of the candidate prebiotic cellobiose by the probiotic bacterium NCFM. Several of the upregulated or downregulated identified proteins associated with utilization of cellobiose indicate the presence of carbon catabolite repression and regulation of enzymes involved in carbohydrate metabolism.

  11. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available inoimidazole-succinocarboxamidesynthase ... [Lactobacillus acidophilus NCFM] gb|AAV43376.1| ... ... ... phosphoribosylaminoimidazole-succinocarboxamidesynthase ... [Lactobacillus acidophilus NCFM] ...

  12. Inhibition of H9N2 virus invasion into dendritic cells by the S-layer protein from L. acidophilus ATCC 4356

    Directory of Open Access Journals (Sweden)

    Xue Gao

    2016-10-01

    Full Text Available Probiotics are essential for the prevention of virus invasion and the maintenance of the immune balance. However, the mechanism of competition between probiotics and virus are unknown. The objectives of this study were to isolate the surface layer (S-layer protein from L. acidophilus ATCC 4356 as a new antiviral material, to evaluate the stimulatory effects of the S-layer protein on mouse dendritic cells (DCs and to verify its ability to inhibit the invasion of H9N2 avian influenza virus (AIV in DCs. We found that the S-layer protein induced DCs activation and up-regulated the IL-10 secretion. The invasion and replication of the H9N2 virus in mouse DCs was successfully demonstrated. However, the invasion of H9N2 virus into DCs could be inhibited by treatment with the S-layer protein prior to infection, which was verified by the reduced hemagglutinin (HA and neuraminidase (NA mRNA expression, and nucleoprotein (NP protein expression in the DCs. Furthermore, treatment with the S-layer protein increases the Mx1, Isg15, and Ddx58 mRNA expressions, and remits the inflammatory process to inhibit H9N2 AIV infection. In conclusion, the S-layer protein stimulates the activation of mouse DCs, inhibits H9N2 virus invasion of DCs, and stimulates the IFN-I signalling pathway. Thus, the S-layer protein from Lactobacillus is a promising biological antiviral material for AIV prevention.

  13. DİYET ACIDOPHILUS BIFIDUS YOĞURDU VE DİYET YOĞURDUN KALİTE NİTELİKLERİNİN İNCELENMESİ

    Directory of Open Access Journals (Sweden)

    Oğuz GÜRSOY

    1999-03-01

    Full Text Available Bu araştırmada, yağ oranı % 1'in altına düşürülmüş sütten; normal yoğurt bakterileri (Streptococcus thermophilus ve Lactobacillus delbrueckii subsp. bulgaricus kullanılarak diyet yoğurt ve yoğurt bakterilerinin yanı sıra Lactobacillus acidophilus ve Bifidobakterileri içeren freeze dried DVS bakteri kültürü kullanılarak diyet Asidofilus bifudus yoğurdu üretilmiş, bu ürünlerin kimyasal, mikrobiyolojik ve duyusal özellikleri karşılaştırmalı olarak incelenmiştir. Genel olarak diyet yoğurt ile diyet Asidofilus bifidus yoğurdunun ağızda hissedilen kıvam dışındaki duyusal özellikleriyle, kimyasal ve mikrobiyolojik özellikleri yönünden birbirine benzer ürünler oldukları tespit edilmiştir. Sonuç olarak bu ürünlerin, normal yoğurt ve yoğurt benzeri ürünlere göre yağ oranlarının düşük olması yanında diyet Asidofilus bifidus yoğurdunda kullanılan kültürün dietetik ve terapötik etkisinden dolayı daha sağlıklı olabilecekleri kanısına varılmıştır.

  14. Viability, Acid and Bile Tolerance of Spray Dried Probiotic Bacteria and Some Commercial Probiotic Supplement Products Kept at Room Temperature.

    Science.gov (United States)

    Dianawati, Dianawati; Mishra, Vijay; Shah, Nagendra P

    2016-06-01

    Production of probiotic food supplements that are shelf-stable at room temperature has been developed for consumer's convenience, but information on the stability in acid and bile environment is still scarce. Viability and acid and bile tolerance of microencapsulated Bifidobacterium spp. and Lactobacillus acidophilus and 4 commercial probiotic supplements were evaluated. Bifidobacterium and L. acidophilus were encapsulated with casein-based emulsion using spray drying. Water activity (aw ) of the microspheres containing Bifidobacterium or L. acidophilus (SD GM product) was adjusted to 0.07 followed by storage at 25 °C for 10 wk. Encapsulated Bifidobacterium spp. and Lactobacillus acidophilus and 4 commercial probiotic supplement products (AL, GH, RE, and BM) were tested. Since commercial probiotic products contained mixed bacteria, selective media MRS-LP (containing L-cysteine and Na-propionate) and MRS-clindamycin agar were used to grow Bifidobacterium spp. or L. acidophilus, respectively, and to inhibit the growth of other strains. The results showed that aw had a strong negative correlation with the viability of dehydrated probiotics of the 6 products. Viable counts of Bifidobacterium spp. and L. acidophilus of SD GM, AL, and GH were between 8.3 and 9.2 log CFU/g, whereas that of BM and RE were between 6.7 and 7.3 log CFU/g. Bifidobacterium in SD GM, in AL, and in GH products and L. acidophilus in SD GM, in AL, and in BM products demonstrated high tolerance to acid. Most of dehydrated probiotic bacteria were able to survive in bile environment except L. acidophilus in RE product. Exposure to gastric juice influenced bacterial survivability in subsequent bile environment. © 2016 Institute of Food Technologists®

  15. Stability of free and encapsulated Lactobacillus acidophilus ATCC 4356 in yogurt and in an artificial human gastric digestion system.

    Science.gov (United States)

    Ortakci, F; Sert, S

    2012-12-01

    The objective of this study was to determine the effect of encapsulation on survival of probiotic Lactobacillus acidophilus ATCC 4356 (ATCC 4356) in yogurt and during artificial gastric digestion. Strain ATCC 4356 was added to yogurt either encapsulated in calcium alginate or in free form (unencapsulated) at levels of 8.26 and 9.47 log cfu/g, respectively, and the influence of alginate capsules (1.5 to 2.5mm) on the sensorial characteristics of yogurts was investigated. The ATCC 4356 strain was introduced into an artificial gastric solution consisting of 0.08 N HCl (pH 1.5) containing 0.2% NaCl or into artificial bile juice consisting of 1.2% bile salts in de Man, Rogosa, and Sharpe broth to determine the stability of the probiotic bacteria. When incubated for 2h in artificial gastric juice, the free ATCC 4356 did not survive (reduction of >7 log cfu/g). We observed, however, greater survival of encapsulated ATCC 4356, with a reduction of only 3 log cfu/g. Incubation in artificial bile juice (6 h) did not significantly affect the viability of free or encapsulated ATCC 4356. Moreover, statistically significant reductions (~1 log cfu/g) of both free and encapsulated ATCC 4356 were observed during 4-wk refrigerated storage of yogurts. The addition of probiotic cultures in free or alginate-encapsulated form did not significantly affect appearance/color or flavor/odor of the yogurts. However, significant deficiencies were found in body/texture of yogurts containing encapsulated ATCC 4356. We concluded that incorporation of free and encapsulated probiotic bacteria did not substantially change the overall sensory properties of yogurts, and encapsulation in alginate using the extrusion method greatly enhanced the survival of probiotic bacteria against an artificial human gastric digestive system. Copyright © 2012 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  16. Drug: D04349 [KEGG MEDICUS

    Lifescience Database Archive (English)

    Full Text Available D04349 Drug Lactomin (JAN); Lactobacillus acidophilus; Biolact (TN) ... Enterococcus faecalis [TAX...:1351], Enterococcus faecium [TAX:1352], Lactobacillus acidophilus [TAX:1579], Lactobacillus bulgaricus [TAX

  17. Unveiling of novel regio-selective fatty acid double bond hydratases from Lactobacillus acidophilus involved in the selective oxyfunctionalization of mono- and di-hydroxy fatty acids.

    Science.gov (United States)

    Kim, Kyoung-Rok; Oh, Hye-Jin; Park, Chul-Soon; Hong, Seung-Hye; Park, Ji-Young; Oh, Deok-Kun

    2015-11-01

    The aim of this study is the first time demonstration of cis-12 regio-selective linoleate double-bond hydratase. Hydroxylation of fatty acids, abundant feedstock in nature, is an emerging alternative route for many petroleum replaceable products thorough hydroxy fatty acids, carboxylic acids, and lactones. However, chemical route for selective hydroxylation is still quite challenging owing to low selectivity and many environmental concerns. Hydroxylation of fatty acids by hydroxy fatty acid forming enzymes is an important route for selective biocatalytic oxyfunctionalization of fatty acids. Therefore, novel fatty acid hydroxylation enzymes should be discovered. The two hydratase genes of Lactobacillus acidophilus were identified by genomic analysis, and the expressed two recombinant hydratases were identified as cis-9 and cis-12 double-bond selective linoleate hydratases by in vitro functional validation, including the identification of products and the determination of regio-selectivity, substrate specificity, and kinetic parameters. The two different linoleate hydratases were the involved enzymes in the 10,13-dihydroxyoctadecanoic acid biosynthesis. Linoleate 13-hydratase (LHT-13) selectively converted 10 mM linoleic acid to 13S-hydroxy-9(Z)-octadecenoic acid with high titer (8.1 mM) and yield (81%). Our study will expand knowledge for microbial fatty acid-hydroxylation enzymes and facilitate the designed production of the regio-selective hydroxy fatty acids for useful chemicals from polyunsaturated fatty acid feedstocks. © 2015 Wiley Periodicals, Inc.

  18. Probiotics for Rectal Volume Variation During Radiation Therapy for Prostate Cancer

    International Nuclear Information System (INIS)

    Ki, Yongkan; Kim, Wontaek; Nam, Jiho; Kim, Donghyun; Lee, Juhye; Park, Dahl; Jeon, Hosang; Ha, Honggu; Kim, Taenam; Kim, Dongwon

    2013-01-01

    Purpose: To investigate the effect of the probiotic Lactobacillus acidophilus on the percentage volume change of the rectum (PVC R ), a crucial factor of prostate movement. Methods and Materials: Prostate cancer patients managed with tomotherapy as a radical treatment were enrolled in the study to take a probiotic capsule containing 1.0 × 10 8 colony-forming units of L acidophilus or a placebo capsule twice daily. Radiation therapy was performed at a dose of 78 Gy in 39 fractions. The PVC R , defined as the difference in rectal volume between the planning computed tomographic (CT) and daily megavoltage CT images, was analyzed. Results: Forty patients were randomized into 2 groups. The L acidophilus group showed significantly lower median rectal volume and median PVC R values than the placebo group. L acidophilus showed a significant reduction effect on the PVC R (P R . Conclusions: L acidophilus was useful in reducing the PVC R , which is the most important determining factor of prostate position, during radiation therapy for prostate cancer

  19. Impact of lactic acid bacteria on conjugated linoleic acid content and atherogenic index of butter

    Directory of Open Access Journals (Sweden)

    L Roufegari-Nejad

    2012-11-01

    Full Text Available This is a study aimed to investigate the effect of lactic acid bacteria including Lactobacillus acidophilus and Sterptococcus thermophilus (as thermophilic culture, Lactococcus lactis subsp. lactis, cremoris and diacetylactis, Leuconostoc citrovorum (as mesophilic culture, Lactobacillus acidophilus, Lactobacillus casei, Bifidobacterium lactis and a mixed culture of L.acidophilus, L. casei and B. lactis on fatty acid profile, conjugated linoleic acid (CLA and atherogenic index (AI of butter. Fatty acid analysis with gas chromatography indicated that application of thermophilic and mixed culture decreased the ratio of saturated to unsaturated fatty acid; whereas, the butters made with L. acidophilus had the highest content of CLA. Moreover, AI in the samples prepared with thermophilic cultures was the least. Sensory evaluation of the treatments revealed no significant differences (p> 0/05 in appearance and color. However, the butters prepared with thermophilic and mesophilic cultures had more desirable taste in comparison with the samples made with L. acidophilus, L. casei and B. lactis. From the nutritional point of view, the adverse effect of butter could be diminished via the application of selected lactic acid bacteria.

  20. Effects of Lactobacillus strains on cancer cell proliferation and oxidative stress in vitro.

    Science.gov (United States)

    Choi, S S; Kim, Y; Han, K S; You, S; Oh, S; Kim, S H

    2006-05-01

    The objective of this study was to assess in vitro, whether heat-killed (HK) lactic acid bacteria cells and fractionations of HK cells could suppress the viability of human cancer cells and inhibit the cytotoxicity associated with oxidative stress. Among the strains, the HK cells of Lactobacillus acidophilus 606 and Lactobacillus casei ATCC 393 exhibited the most profound inhibitory activity in all of the tested cell lines. HK cells of L. acidophilus 606 were determined to be less toxic to healthy human embryo fibroblasts (hEF cells) than were HK cells of L. casei ATCC 393. The soluble polysaccharides from L. acidophilus 606 evidenced the most effective anticancer activity, but inhibited hEF cell growth by only 20%. The soluble polysaccharides from L. acidophilus 606 were partly observed to induce apoptosis in the HT-29 cells by DNA fragmentation and propidium iodine staining. Both the HK cells of L. acidophilus 606 and the soluble polysaccharide components of this strain also exhibited potent antioxidative activity. Our findings suggest that the soluble polysaccharide fraction from L. acidophilus 606 may constitute a novel anticancer agent, which manifests a high degree of selectivity for human cancer cells and antioxidative agent in the food industry. These soluble polysaccharide components from Lactobacillus may be applied to various foods, and used as adjuncts for cancer therapy and prevention.

  1. Probiotic bacteria Lactobacillus acidophilus NCFM and Bifidobacterium lactis Bi-07 versus placebo for the symptoms of bloating in patients with functional bowel disorders: a double-blind study.

    Science.gov (United States)

    Ringel-Kulka, Tamar; Palsson, Olafur S; Maier, Danielle; Carroll, Ian; Galanko, Joseph A; Leyer, Gregory; Ringel, Yehuda

    2011-07-01

    Recent data suggest a role for the intestinal microbiota in the pathogenesis of functional bowel disorders (FBDs). Probiotic studies in FBDs generated inconsistent results suggesting a strain-specific and product-specific effect. To investigate the clinical efficacy of Lactobacillus acidophilus NCFM (L-NCFM) and Bifidobacterium lactis Bi-07 (B-LBi07) in nonconstipation FBDs. A double-blind, placebo-control clinical trial of the probiotic bacterias L-NCFM and B-LBi07 twice a day (2×10(11) CFU/d) versus placebo over 8 weeks. Primary endpoints were global relief of gastrointestinal symptoms and satisfaction with treatment. Secondary endpoints were change in symptoms severity, well-being, and quality of life. Microbiological effect was assessed by quantitative real time polymerase chain reaction on fecal samples. Sixty patients (probiotic, n=31; placebo, n=29), 72% females, 84% whites, mean age 37 years. Abdominal bloating improved in the probiotics compared with the placebo group at 4 weeks (4.10 vs 6.17, P=0.009; change in bloating severity P=0.02) and 8 weeks (4.26 vs 5.84, P=0.06; change in bloating severity Pbacteria in the pathophysiology of FBD and the role for probiotic bacteria in the management of these disorders.

  2. Optimasi Konsentrasi Fruktooligosakarida untuk Meningkatkan Pertumbuhan Bakteri Asam Laktat Starter Yoghurt (CONCENTRATION OPTIMIZATION OF FRUCTOOLIGOSACCHARIDES TO INCREASE GROWTH OF LACTIC ACID BACTERIA YOGHURT STARTER

    Directory of Open Access Journals (Sweden)

    Raden Haryo Bimo Setiarto

    2017-09-01

    Full Text Available Fructooligosaccharides are prebiotic source that widely used in food products, such as: fermented milk and infant formula. Prebiotics are food components that cannot be digested in the digestive tract enzymatically. However, they can be fermented by probiotic bacteria in the colon. This study aimed to determine the optimum concentrations of fructooligosaccharides in order to increase the growth of lactic acid bacteria yogurt starter (Lactobacillus acidophillus, Lactobacillus bulgaricus, Streptococcus thermophillus. Optimation concentration of fructooligosaccharides on the growth of Lactobacillus acidophilus, Lactobacillus bulgaricus, Streptococcus thermophillus can be determined based on OD (optical density, TPC (Total Plate Count, total lactic acid content and pH value. Suplementation of fructooligosaccharides 1 % (w/v on the media MRSB increased significantly the growth of L. acidophilus, L.bulgaricus, S. thermophilus. Furthermore, L. acidophilus, L. bulgaricus and S. thermophilus experienced exponential growth phase during incubation period from 6 to 18 hours. Fermentation of L. acidophilus, L. bulgaricus, S. thermophilus in MRSB medium supplemented by fructooligosaccharides decreased the pH value of the formation of organic acids from 6.00 to 4.00. ABSTRAK Fruktooligosakarida adalah sumber prebiotik yang banyak digunakan dalam produk pangan olahan seperti susu fermentasi dan susu formula. Prebiotik adalah komponen bahan pangan fungsional yang tidak dapat dicerna di dalam saluran pencernaan secara enzimatik sehingga akan difermentasi oleh bakteri probiotik dalam usus besar. Penelitian ini bertujuan menentukan konsentrasi optimum fruktooligosakarida untuk meningkatkan pertumbuhan bakteri asam laktat starter yoghurt (Lactobacillus acidophillus, Lactobacillus bulgaricus, Streptococcus thermophillus. Konsentrasi optimum fruktooligosakarida pada pertumbuhan Lactobacillus acidophilus, Lactobacillus bulgaricus, Streptococcus thermophillus dapat

  3. Estabilidade de micro-organismos potencialmente probióticos em barra de cereais - efeito da técnica de incorporação

    Directory of Open Access Journals (Sweden)

    Gustavo Almeida Bastos

    2015-10-01

    Full Text Available Este trabalho objetivou desenvolver formulações de barras de cereais contendo Lactobacillus acidophilus e Saccharomyces boulardii e avaliar a estabilidade destes micro-organismos potencialmente probióticos no produto elaborado durante o tempo de armazenamento (shelf life. Foram formuladas barras de cereais contendo separadamente os agentes probióticos S. boulardii e L. acidophilus, ambos nas formas liofilizada, granulados com lactose e encapsulados em alginato de cálcio. Foi avaliada a estabilidade dos micro-organismos durante o tempo de armazenamento. Tanto a levedura S. boulardii quanto a bactéria L. acidophilus apresentaram maior sobrevida na forma liofilizada, quando comparado com as outras formas de incorporação, mantendo contagem na faixa de 7 log UFC/g, durante oito semanas e na faixa de 7 log UFC/g, durante seis semanas, respectivamente. Comparando os resultados da incorporação dos dois micro-organismos na forma livre liofilizada observouse que a população de S. boulardii apresentou melhores resultados de viabilidade quando comparada com a população de L. acidophilus. Este estudo mostrou que é possível incorporar micro-organismos potencialmente probióticos em barras de cereais, preferencialmente na forma liofilizada, por proporcionar maior sobrevida dos micro-organismos.Palavras-chave: Barra de cereais. Probiótico. Saccharomyces boulardii. Lactobacillus acidophilus. ABSTRACT This study aims to develop formulations of cereal bars that contain Lactobacillus acidophilus and Saccharomyces boulardii and evaluate the stability of these potentially probiotic microorganisms in the elaborated product during the time of storage (shelf life. Cereal bars were designed containing separately the probiotic agents S. boulardii and L. acidophilus, both in the lyophilized form, granulated with lactose form and encapsulated in calcium alginate form. The stability of microorganisms during storage time was evaluated. Both, the yeast S

  4. Therapeutic enhancement of newly derived bacteriocins against Giardia lamblia.

    Science.gov (United States)

    Amer, Eglal I; Mossallam, Shereen F; Mahrous, Hoda

    2014-11-01

    Trials for identifying efficient anti-giardial agents are still ongoing. Nowadays, bacteriocins have attracted the attention as potential antimicrobial compounds. For the first time, the current study evaluated the therapeutic efficacy of bacteriocins derived from newly isolated Egyptian strains of probiotics Lactobacilli; L. acidophilus (P106) and L. plantarum (P164) against Giardia lamblia. Bacteriocins' efficacy was evaluated both in vitro; by growth inhibition and adherence assays, and in vivo; through estimation of parasite density, intestinal histopathological examination and ultrastructural analysis of Giardia trophozoites. In vivo bacteriocins' clinical safety was assessed. In vitro results proved that 50 µg of L. acidophilus bacteriocin induced reduction of the mean Giardia lamblia trophozoites by 58.3 ± 4.04%, while at lower concentrations of 10 and 20 µg of both L. acidophilus and L. plantarum, non significant reduction of the mean parasite density was achieved. In vitro trophozoites adherence was susceptible to the tested bacteriocins at all studied concentrations with variable degrees, while the highest adherence reduction was demonstrated using 50 µg of L acidophilus bacteriocin. In vivo, oral inoculation of 50 µg/mouse L. acidophilus bacteriocin for 5 successive days resulted in a noteworthy decline of the intestinal parasite density, along with amelioration of intestinal pathology of infected mice. Ultrastructural examination proved thatfive doses of L. acidophilus bacteriocin showed marked changes in cellular architecture of the trophozoites with evident disorganization of the cell membrane, adhesive disc and cytoplasmic components. This is the first reported study of the safe anti-giardial efficacy of L. acidophilus (P106) derived bacteriocin, hence highlighting its great promise as a potential therapeutic safe alternative to existing commercial drugs. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. The Influence of Brewer’s Yeast Autolysate and Lactic Acid Bacteria on the Production of a Functional Food Additive Based on Beetroot Juice Fermentation

    Directory of Open Access Journals (Sweden)

    Josip Baras

    2004-01-01

    Full Text Available The importance of »functional foods« in the world is increasing, and the procedures for their production are under intense development. The goal of this paper is to optimise the production of a functional food additive based on beetroot juice (Beta vulgaris L. using brewer’s yeast autolysate. In order to improve the nutritive properties of the product and to preserve it, the possibility of beetroot juice fermentation using a Lactobacillus species has been investigated. Comparative investigations of three bacteria cultures (L. plantarum A112, L. acidophilus BGSJ15-3 and L. acidophilus NCDO1748 during fermentation in two media, beetroot juice and a mixture of beetroot juice with an autolysate of brewer´s yeast, have been performed. The poorest fermentative activity and growth in both substrates was observed using the L. acidophilus NCDO1748 culture. The two cultures demonstrated better fermentative activity in the mixture of tested substrates, while acidifying activity (production of lactic acid and a decrease in pH of the L. acidophilus BGSJ15-3 culture was considerably better than that of the L. plantarum A112 culture. L. plantarum A112 culture showed better growth than L. acidophilus BGSJ15-3. From the results obtained, it has been concluded that the L. plantarum A112 and L. acidophilus BGSJ15-3 can be successfully used for fermentation of the mixture of beetroot juice and brewer’s yeast autolysate in order to obtain a functional food additive.

  6. NCBI nr-aa BLAST: CBRC-DNOV-01-0184 [SEVENS

    Lifescience Database Archive (English)

    Full Text Available CBRC-DNOV-01-0184 ref|YP_194801.1| stage III sporulation protein J [Lactobacillus a...cidophilus NCFM] gb|AAV43770.1| stage III sporulation protein J [Lactobacillus acidophilus NCFM] YP_194801.1 6.7 32% ...

  7. Probiotics for Rectal Volume Variation During Radiation Therapy for Prostate Cancer

    Energy Technology Data Exchange (ETDEWEB)

    Ki, Yongkan [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Kim, Wontaek, E-mail: rokwt@hanmail.net [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Nam, Jiho; Kim, Donghyun; Lee, Juhye; Park, Dahl; Jeon, Hosang [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of); Ha, Honggu; Kim, Taenam [Department of Urology, Medical Research Institute, Pusan National University Hospital, Pusan National University School of Medicine, Busan (Korea, Republic of); Kim, Dongwon [Department of Radiation Oncology, Pusan National University School of Medicine, Busan (Korea, Republic of)

    2013-11-15

    Purpose: To investigate the effect of the probiotic Lactobacillus acidophilus on the percentage volume change of the rectum (PVC{sub R}), a crucial factor of prostate movement. Methods and Materials: Prostate cancer patients managed with tomotherapy as a radical treatment were enrolled in the study to take a probiotic capsule containing 1.0 × 10{sup 8} colony-forming units of L acidophilus or a placebo capsule twice daily. Radiation therapy was performed at a dose of 78 Gy in 39 fractions. The PVC{sub R}, defined as the difference in rectal volume between the planning computed tomographic (CT) and daily megavoltage CT images, was analyzed. Results: Forty patients were randomized into 2 groups. The L acidophilus group showed significantly lower median rectal volume and median PVC{sub R} values than the placebo group. L acidophilus showed a significant reduction effect on the PVC{sub R} (P<.001). However, the radiation therapy fraction number did not significantly influence the PVC{sub R}. Conclusions: L acidophilus was useful in reducing the PVC{sub R}, which is the most important determining factor of prostate position, during radiation therapy for prostate cancer.

  8. System evaluation and microbial analysis of a sulfur cycle-based wastewater treatment process for Co-treatment of simple wet flue gas desulfurization wastes with freshwater sewage.

    Science.gov (United States)

    Qian, Jin; Liu, Rulong; Wei, Li; Lu, Hui; Chen, Guang-Hao

    2015-09-01

    A sulfur cycle-based wastewater treatment process, namely the Sulfate reduction, Autotrophic denitrification and Nitrification Integrated process (SANI(®) process) has been recently developed for organics and nitrogen removal with 90% sludge minimization and 35% energy reduction in the biological treatment of saline sewage from seawater toilet flushing practice in Hong Kong. In this study, sulfate- and sulfite-rich wastes from simple wet flue gas desulfurization (WFGD) were considered as a potential low-cost sulfur source to achieve beneficial co-treatment with non-saline (freshwater) sewage in continental areas, through a Mixed Denitrification (MD)-SANI process trialed with synthetic mixture of simple WFGD wastes and freshwater sewage. The system showed 80% COD removal efficiency (specific COD removal rate of 0.26 kg COD/kg VSS/d) at an optimal pH of 7.5 and complete denitrification through MD (specific nitrogen removal rate of 0.33 kg N/kg VSS/d). Among the electron donors in MD, organics and thiosulfate could induce a much higher denitrifying activity than sulfide in terms of both NO3(-) reduction and NO2(-) reduction, suggesting a much higher nitrogen removal rate in organics-, thiosulfate- and sulfide-based MD in MD-SANI compared to sulfide alone-based autotrophic denitrification in conventional SANI(®). Diverse sulfate/sulfite-reducing bacteria (SRB) genera dominated in the bacterial community of sulfate/sulfite-reducing up-flow sludge bed (SRUSB) sludge without methane producing bacteria detected. Desulfomicrobium-like species possibly for sulfite reduction and Desulfobulbus-like species possibly for sulfate reduction are the two dominant groups with respective abundance of 24.03 and 14.91% in the SRB genera. Diverse denitrifying genera were identified in the bacterial community of anoxic up-flow sludge bed (AnUSB) sludge and the Thauera- and Thiobacillus-like species were the major taxa. These results well explained the successful operation of the lab

  9. Effect of particle-particle shearing on the bioleaching of sulfide minerals.

    Science.gov (United States)

    Chong, N; Karamanev, D G; Margaritis, A

    2002-11-05

    The biological leaching of sulfide minerals, used for the production of gold, copper, zinc, cobalt, and other metals, is very often carried out in slurry bioreactors, where the shearing between sulfide particles is intensive. In order to be able to improve the efficiency of the bioleaching, it is of significant importance to know the effect of particle shearing on the rate of leaching. The recently proposed concept of ore immobilization allowed us to study the effect of particle shearing on the rate of sulfide (pyrite) leaching by Thiobacillus ferrooxidans. Using this concept, we designed two very similar bioreactors, the main difference between which was the presence and absence of particle-particle shearing. It was shown that when the oxygen mass transfer was not the rate-limiting step, the rate of bioleaching in the frictionless bioreactor was 2.5 times higher than that in a bioreactor with particle friction (shearing). The concentration of free suspended cells in the frictionless bioreactor was by orders of magnitude lower than that in the frictional bioreactor, which showed that particle friction strongly reduces the microbial attachment to sulfide surface, which, in turn, reduces the rate of bioleaching. Surprisingly, it was found that formation of a layer of insoluble iron salts on the surface of sulfide particles is much slower under shearless conditions than in the presence of particle-particle shearing. This was explained by the effect of particle friction on liquid-solid mass transfer rate. The results of this study show that reduction of the particle friction during bioleaching of sulfide minerals can bring important advantages not only by increasing significantly the bioleaching rate, but also by increasing the rate of gas-liquid oxygen mass transfer, reducing the formation of iron precipitates and reducing the energy consumption. One of the efficient methods for reduction of particle friction is ore immobilization in a porous matrix. Copyright 2002

  10. A Novel Uncultured Bacterium of the Family Gallionellaceae: Description and Genome Reconstruction Based on the Metagenomic Analysis of Microbial Community in Acid Mine Drainage.

    Science.gov (United States)

    Kadnikov, V V; Ivasenko, D A; Beletsky, A V; Mardanov, A V; Danilova, E V; Pimenov, N V; Karnachuk, O V; Ravin, N V

    2016-07-01

    Drainage waters at the metal mining areas often have low pH and high content of dissolved metals due to oxidation of sulfide minerals. Extreme conditions limit microbial diversity in- such ecosystems. A drainage water microbial community (6.5'C, pH 2.65) in an open pit at the Sherlovaya Gora polymetallic open-cast mine (Transbaikal region, Eastern Siberia, Russia) was studied using metagenomic techniques. Metagenome sequencing provided information for taxonomic and functional characterization of the micro- bial community. The majority of microorganisms belonged to a single uncultured lineage representing a new Betaproteobacteria species of the genus Gallionella. While no.acidophiles are known among the cultured members of the family Gallionellaceae, similar 16S rRNA gene sequences were detected in acid mine drain- ages. Bacteria ofthe genera Thiobacillus, Acidobacterium, Acidisphaera, and Acidithiobacillus,-which are com- mon in acid mine drainage environments, were the minor components of the community. Metagenomic data were -used to determine the almost complete (-3.4 Mb) composite genome of the new bacterial. lineage desig- nated Candidatus Gallionella acididurans ShG14-8. Genome analysis revealed that Fe(II) oxidation probably involved the cytochromes localized on the outer membrane of the cell. The electron transport chain included NADH dehydrogenase, a cytochrome bc1 complex, an alternative complex III, and cytochrome oxidases of the bd, cbb3, and bo3 types. Oxidation of reduced sulfur compounds probably involved the Sox system, sul- fide-quinone oxidoreductase, adenyl sulfate reductase, and sulfate adenyltransferase. The genes required for autotrophic carbon assimilation via the Calvin cycle were present, while no pathway for nitrogen fixation was revealed. High numbers of RND metal transporters and P type ATPases were probably responsible for resis- tance to heavy metals. The new microorganism was an aerobic chemolithoautotroph of the group of

  11. Microbial control of hydrogen sulfide production

    Energy Technology Data Exchange (ETDEWEB)

    Montgomery, A.D.; Bhupathiraju, V.K.; Wofford, N.; McInerney, M.J. [Univ. of Oklahoma, Tulsa, OK (United States)] [and others

    1995-12-31

    A sulfide-resistant strain of Thiobacillus denitrificans, strain F, prevented the accumulation of sulfide by Desulfovibrio desulfuricans when both organisms were grown in liquid medium. The wild-type strain of T. denitrificans did not prevent the accumulation of sulfide produced by D. desulfuricans. Strain F also prevented the accumulation of sulfide by a mixed population of sulfate-reducing bacteria enriched from an oil field brine. Fermentation balances showed that strain F stoichiometrically oxidized the sulfide produced by D. desulfuricans and the oil field brine enrichment to sulfate. The ability of a strain F to control sulfide production in an experimental system of cores and formation water from the Redfield, Iowa, natural gas storage facility was also investigated. A stable, sulfide-producing biofilm was established in two separate core systems, one of which was inoculated with strain F while the other core system (control) was treated in an identical manner, but was not inoculated with strain F. When formation water with 10 mM acetate and 5 mM nitrate was injected into both core systems, the effluent sulfide concentrations in the control core system ranged from 200 to 460 {mu}M. In the test core system inoculated with strain F, the effluent sulfide concentrations were lower, ranging from 70 to 110 {mu}M. In order to determine whether strain F could control sulfide production under optimal conditions for sulfate-reducing bacteria, the electron donor was changed to lactate and inorganic nutrients (nitrogen and phosphate sources) were added to the formation water. When nutrient-supplemented formation water with 3.1 mM lactate and 10 mM nitrate was used, the effluent sulfide concentrations of the control core system initially increased to about 3,800 {mu}M, and then decreased to about 1,100 {mu}M after 5 weeks. However, in the test core system inoculated with strain F, the effluent sulfide concentrations were much lower, 160 to 330 {mu}M.

  12. A field demonstration of the microbial treatment of sour produced water

    Energy Technology Data Exchange (ETDEWEB)

    Sublette, K.L. [Univ. of Tulsa, OK (United States); Morse, D.; Raterman, K. [Amoco Production Co., Tulsa, OK (United States)

    1995-12-31

    The potential for detoxification and deodorization of sulfide-laden water (sour water) by microbial treatment was evaluated at a petroleum production site under field conditions. A sulfide-tolerant strain of the chemautotroph and facultative anaerobe, Thiobacillus denitrificans, was introduced into an oil-skimming pit of the Amoco Production Company LACT 10 Unit of the Salt Creek Field, Wyoming. Field-produced water enters this pit from the oil/water separation treatment train at an average flowrate of 5,000 bbl/D (795 m{sup 3}/D) with a potential maximum of 98,000 bbl/D (15,580 m{sup 3}/D). Water conditions at the pit inlet are 4,800 mg/l TDS, 100 mg/l sulfide, pH 7.8, and 107{degrees}F. To this water an aqueous solution of ammonium nitrate and diphosphorous pentoxide was added to provide required nutrients for the bacteria. The first 20% of the pit was aerated to a maximum depth of 5 ft (1.5 m) to facilitate the aerobic oxidation of sulfide. No provisions for pH control or biomass recovery and recycle were made. Pilot operations were initiated in October 1992 with the inoculation of the 19,000 bbl (3,020 m{sup 3}) pit with 40 lb (18.1 kg) of dry weight biomass. After a brief acclimation period, a nearly constant mass flux of 175 lb/D (80 kg/D) sulfide was established to the pit. Bio-oxidation of sulfide to elemental sulfur and sulfate was immediate and complete. Subsequent pilot operations focused upon process optimization and process sensitivity to system upsets. The process appeared most sensitive to large variations in sulfide loading due to maximum water discharge events. However, recoveries from such events could be accomplished within hours. This paper details all pertinent aspects of pilot operation, performance, and economics. Based on this body of evidence, it is suggested that the oxidation of inorganic sulfides by T denitrificans represents a viable concept for the treatment of sour water coproduced with oil and gas.

  13. Genome Analysis of the Biotechnologically Relevant Acidophilic Iron Oxidising Strain JA12 Indicates Phylogenetic and Metabolic Diversity within the Novel Genus “Ferrovum”

    Science.gov (United States)

    Ullrich, Sophie R.; Poehlein, Anja; Tischler, Judith S.; González, Carolina; Ossandon, Francisco J.; Daniel, Rolf; Holmes, David S.; Schlömann, Michael; Mühling, Martin

    2016-01-01

    Background Members of the genus “Ferrovum” are ubiquitously distributed in acid mine drainage (AMD) waters which are characterised by their high metal and sulfate loads. So far isolation and microbiological characterisation have only been successful for the designated type strain “Ferrovum myxofaciens” P3G. Thus, knowledge about physiological characteristics and the phylogeny of the genus “Ferrovum” is extremely scarce. Objective In order to access the wider genetic pool of the genus “Ferrovum” we sequenced the genome of a “Ferrovum”-containing mixed culture and successfully assembled the almost complete genome sequence of the novel “Ferrovum” strain JA12. Phylogeny and Lifestyle The genome-based phylogenetic analysis indicates that strain JA12 and the type strain represent two distinct “Ferrovum” species. “Ferrovum” strain JA12 is characterised by an unusually small genome in comparison to the type strain and other iron oxidising bacteria. The prediction of nutrient assimilation pathways suggests that “Ferrovum” strain JA12 maintains a chemolithoautotrophic lifestyle utilising carbon dioxide and bicarbonate, ammonium and urea, sulfate, phosphate and ferrous iron as carbon, nitrogen, sulfur, phosphorous and energy sources, respectively. Unique Metabolic Features The potential utilisation of urea by “Ferrovum” strain JA12 is moreover remarkable since it may furthermore represent a strategy among extreme acidophiles to cope with the acidic environment. Unlike other acidophilic chemolithoautotrophs “Ferrovum” strain JA12 exhibits a complete tricarboxylic acid cycle, a metabolic feature shared with the closer related neutrophilic iron oxidisers among the Betaproteobacteria including Sideroxydans lithotrophicus and Thiobacillus denitrificans. Furthermore, the absence of characteristic redox proteins involved in iron oxidation in the well-studied acidophiles Acidithiobacillus ferrooxidans (rusticyanin) and Acidithiobacillus

  14. Bacterial diversity exploration in hydrocarbon polluted soil: metabolic potential and degrader community evolution revealed by isotope labeling

    International Nuclear Information System (INIS)

    Martin, F.

    2011-01-01

    Polycyclic aromatic hydrocarbons (PAHs) are ubiquitous compounds produced by incomplete combustion of organic matter. They are a source of environmental pollution, especially associated to oil product exploitation, and represent a threat for living organisms including human beings because of their toxicity. Many bacteria capable of degrading PAHs have been isolated and studied. However, since less than 5% of soil bacteria can be cultivated in the laboratory, bacterial species able to degrade PAHs in situ have been poorly studied. The first goal of this study was to identify bacteria that degrade PAHs in soil using culture-independent molecular methods. To this end, a strategy known a stable isotope probing has been implemented based on the use of phenanthrene, a three rings PAH, in which the natural isotope of carbon was replaced by 13 C. This molecule has been introduced as a tracer in microcosms containing soil from a constructed wetlands collecting contaminated water from highway runoff. Bacteria having incorporated the 13 C were then identified by 16 S rRNA gene sequence analysis after PCR amplification from labeled genomic DNA extracted from soil. The results show that so far little studied Betaproteobacteria, belonging to the genera Acidovorax, Rhodoferax, Hydrogenophaga and Thiobacillus, as well as Rhodocyclaceae, were the key players in phenanthrene degradation. Predominance of Betaproteobacteries was established thanks to quantitative PCR measurements. A dynamic analysis of bacterial diversity also showed that the community structure of degraders depended on phenanthrene bioavailability. In addition, the phylogenetic diversity of ring-hydroxylating di-oxygenases, enzymes involved in the first step of PAH degradation, has been explored. We detected new sequences, mostly related to di-oxygenases from Sphingomonadales and Burkholderiales. For the first time, we were able to associate a catalytic activity for oxidation of PAHs to partial gene sequences

  15. Lactobacillus acidophilus CL1285, Lactobacillus casei LBC80R, and Lactobacillus rhamnosus CLR2 (Bio-K+): Characterization, Manufacture, Mechanisms of Action, and Quality Control of a Specific Probiotic Combination for Primary Prevention of Clostridium difficile Infection.

    Science.gov (United States)

    Auclair, Julie; Frappier, Martin; Millette, Mathieu

    2015-05-15

    A specific probiotic formulation composed of Lactobacillus acidophilus CL1285, Lactobacillus casei LBC80R, and Lactobacillus rhamnosus CLR2 (Bio-K+) has been marketed in North America since 1996. The strains and the commercial products have been evaluated for safety, identity, gastrointestinal survival, and stability throughout shelf life. The capacity of both the fermented beverages and the capsules to reduce incidences of antibiotic-associated diarrhea and Clostridium difficile infection (CDI) has been demonstrated in human clinical trials. Individual strains and the finished products have shown antimicrobial activity against C. difficile and toxin A/B neutralization capacity in vitro. The use of this specific probiotic formulation as part of a bundle of preventive measures to control CDI in healthcare settings is discussed. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  16. Antibacterial Activity of Lactic Acid Bacteria Isolated from Healthy ...

    African Journals Online (AJOL)

    Abstract. Lactic acid bacteria (LAB), namely, Lactobacillus acidophilus 1, Lactobacillus acidophilus 2, Lactobacillus brevis 1, Lactobacillus rhamnosus 1, Lactococcus lactis subsp. lactis 1, Lactococcus lactis subsp. lactis 2, Lactococcus raffinolactis 1, Pediococcus acidilactici 1, Pediococcus pentosaceus 1, and Pediococcus ...

  17. Effect of green tea supplementation on the microbiological, antioxidant, and sensory properties of probiotic milks.

    Science.gov (United States)

    Najgebauer-Lejko, Dorota

    2014-01-01

    Green tea and its constituents are known for a wide range of health-promoting properties. They may exert antimicrobial action but without altering lactic acid bacteria. The aim of the present study was to estimate the effect of green tea addition on the selected properties of probiotic milks. Bioyogurts (fermented with ABT-1 coculture of Streptococcus thermophilus , Lactobacillus acidophilus LA-5, Bifidobacterium animalis subsp. lactis BB-12) and acidophilus milks (fermented with pure L. acidophilus LA-5 culture) with addition of 0, 5, 10, or 15% ( v / v ) green tea infusion (GTI) were produced and analyzed for the antioxidant capacity by the "diphenyl picrylhydrazyl" (DPPH) and "ferric-reducing antioxidant power" (FRAP) methods, acidity, the count of starter bacteria, and sensory properties at the 1st, 7th, 14th, and 21st day of cold storage. The 15% addition of GTI to the acidophilus milk significantly reduced the lactic acid production during the whole study. The GTI had no impact on the level of S. thermophilus and B. lactis BB-12 in bioyogurts, and its effect on the count of L. acidophilus LA-5 depended on the concentration and probiotic milk type. GTI similarly and in a dose-dependent manner enhanced the antioxidant capacity of both milk types. There were no significant differences between the sensory notes received for bioyogurts, whereas acidophilus milks with tea were less appreciated by the panelists. In conclusion, green tea could be successfully used as a functional additive for selected probiotic milks enhancing their health benefits, but the proper selection of tea additive and starter culture is recommended.

  18. Anti-glucan effects of propolis ethanol extract on Lactobacillus acidophillus

    Directory of Open Access Journals (Sweden)

    Ira Widjiastuti

    2017-03-01

    Full Text Available Background: In deep dentinal caries cases, bacteria mostly found are Lactobacillus acidophilus classified as gram positive bacteria and as facultative aerobes producing glucosyltransferase (GTF enzyme. GTF enzyme can alter sucrose into glucans. Glucan is sticky and insoluble in water. As a result, GTF enzyme can facilitate plaque formation and microorganism colonization on tooth surface. In addition, Lactobacillus acidophilus also can form acid leading to demineralization of organic and inorganic materials, resulting in dental caries. Multidrug-resistant phenomena, on the other hand, have led to the use of natural resources, one of which is propolis as an antimicrobial material and as a new anti-infective therapeutic strategy. Propolis is a resinous substances collected by worker bees (Apismellifera from barks and leaves of plants. Propolis has a complex chemical composition and biological properties, such as antibacterial, antiviral, antifungal, anti-inflammatory, and antitumor. Purpose: This research aimed to reveal anti-glucan effects of propolis ethanol extract generated from honey bee, Apis mellifera spp on Lactobacillus acidophilus bacteria. Method: Before antiglucan test was conducted, glucan-formation test was performed on Lactobacillus acidophilus bacteria using SDSpage. Meanwhile, anti-glucan adhesion test on Lactobacillus acidophilus bacteria was carried by culturing the bacteria at 37ºC temperature in a jar with 10% CO2. Test tubes were placed at an angle of 30º for 18 hours to review the attachment of bacteria at the glass surfaces. After the incubation, the culture of bacteria was vibrated using a mixer vortex for a few minutes, and then cultured in solid MRS A media. Bacteria grown were measured by using colony counter. Result: The ethanol extract of propolis with a concentration of 1.56% was the lowest concentration inhibiting the attachment of glucan to Lactobacillus acidophilus bacteria. Conclusion: The ethanol extract of

  19. The expressions of NF-kb and TGFb-1 on odontoblast-like cells of human dental pulp injected with propolis extracts

    Directory of Open Access Journals (Sweden)

    Ira Widjiastuti

    2014-03-01

    Full Text Available Background: Propolis is known to have beneficial effects, namely anti- bacterial, anti-viral, anti-inflammatory, antioxidant, and immunomodulatory. Propolis extracts with anti-inflammatory properties are expected to be useful in treating inflamed pulp tissue with a diagnosis of reversible pulpitis. The inflammation of pulp tissue is caused by bacteria, namely Lactobacillus acidophilus. This research used odontoblast like cells derived from pulp tissue of human third molars. Odontoblast like cells exposed to Lactobacillus achidophilus were used as a model of proinflammatory cytokine signaling. This research examined the effects of propolis extracts on odontoblast like cells exposed to Lactobacillus acidophilus. Purpose: This research was aimed to determine the effectiveness of propolis extracts on the activities of odontoblast-like cells exposed to Lactobacillus acidophillus by measuring the expressions of NFkb and TGF- b1. Methods: First, pulp odontoblast cultures were derived from human dental pulp tissues of impacted third molars removed by using digestion method. Next, odontoblast-like cells exposed to inactive Lactobacillus acidophilus bacteria were given propolis extract. Finally, the activities of odontoblast-like cells were monitored by measuring the expressions of NF-kb and TGFb-1 with immunocytochemistry technique. Results: A decline NF-kb expression and on increase of TGFb-1 expression on odontoblast like cells exposed to inactive Lactobacillus acidophilus. Conclusion: Propolis extracts inhibit the expression of NF-kb, and increase the expression of TGF-b1 in pulp odontoblast-like cells exposed to inactive Lactobacillus acidophillus.Latar belakang: Propolis dilaporkan mempunyai efek menguntungkan yaitu bersifat anti bakteri, anti virus, anti inflamasi, anti oksidan, dan imunomodulator. Ekstrak propolis dengan sifat anti inflamasi diharapkan bermanfaat untuk mengobati jaringan pulpa yang mengalami inflamasi dengan diagnosis pulpitis

  20. Inhibition of Cronobacter sakazakii by heat labile bacteriocins produced by probiotic LAB isolated from healthy infants.

    Science.gov (United States)

    Awaisheh, Saddam S; Al-Nabulsi, Anas A; Osaili, Tareq M; Ibrahim, Salam; Holley, Richard

    2013-09-01

    Cronobacter sakazakii is an opportunistic pathogen that can cause bacteremia, meningitis, and necrotizing enterocolitis, most often in neonates with case-fatality rates that may reach 80%. The antimicrobial activity of lactic acid bacteria against a wide range of foodborne pathogens is well-established in different types of food products. The objective of the current study was to investigate the antibacterial activity of Lactobacillus acidophilus and L. casei isolated from feces of healthy infants against different strains of C. sakazakii in agar and a rehydrated infant milk formula (RIMF) model. The inhibition zones of C. sakazakii around L. acidophilus or L. casei ranged from 22 to 32 mm on eMan Rogosa Sharpe (MRS) agar under aerobic conditions, while a slight reduction in antibacterial activity was noted on modified MRS (0.2% glucose) under anaerobic conditions. It was observed that pH-neutralized cell-free supernatant (CFS) of L. acidophilus or L. casei was inhibitory against tested C. sakazakii strains. The inhibition zones of neutralized CFS were lower than the antibacterial activities of live cultures. The antibacterial activity of CFS was abolished when CFS from L. acidophilus or L. casei was heated at 60 or 80 °C for either 10 min or 2 h, or treated with trypsin or pepsin. This was considered strong evidence that the inhibition was due to the production of bacteriocins by L. casei and L. acidophilus. Both the CFS and active growing cells of L. casei and L. acidophilus were able to reduce the viability of C. sakazakii in the RIMF model. The results may extend the use of natural antimicrobials instead of conventional preservation methods to improve the safety of RIMF. © 2013 Institute of Food Technologists®

  1. Impact of Bifidobacterium animalis subsp. lactis BB-12 and, Lactobacillus acidophilus LA-5-containing yoghurt, on fecal bacterial counts of healthy adults.

    Science.gov (United States)

    Savard, Patricia; Lamarche, Benoît; Paradis, Marie-Eve; Thiboutot, Hélène; Laurin, Émilie; Roy, Denis

    2011-09-01

    This randomized, placebo-controlled, double blind, parallel dose-response study investigated the impact of 4-week commercial yoghurt consumption supplemented with Bifidobacterium animalis subsp. lactis (BB-12) and Lactobacillus acidophilus (LA-5) on fecal bacterial counts of healthy adults. Fifty-eight volunteers were randomly assigned to three different groups: 1. placebo (no probiotic, no starter and no green tea extract); 2. Yoptimal (10(9)cfu/100g of BB-12 and LA-5 and 40mg of green tea extract) and 3. Yoptimal-10 (10(10)cfu/100g of BB-12, 10(9)cfu/100g of LA-5 and 40mg of green tea extract). These yoghurt products also contained Lactobacillus delbrueckii subsp. bulgaricus (10(7)cfu/100g) and Streptococcus thermophilus (10(10)cfu/100g). The quantitative PCR (qPCR) results showed that there were significant increases (P=0.02) in bifidobacteria counts with the Yoptimal treatment as compared to baseline. The fecal numbers of B. animalis subsp. lactis and LA-5 significantly increased in the two probiotic treatments compared to the placebo treatment. Viable counts of fecal lactobacilli were significantly higher (P=0.05) and those of enterococci were significantly lower (P=0.04) after the intervention when compared to placebo. No significant difference was observed between treatments in volunteers' weight, waist girth, blood pressure, fasting plasma triglyceride and HDL-C concentrations, as well as cholesterol/HDL-cholesterol ratio. However, a significant increase in plasma cholesterol levels was observed in the placebo group (P=0.0018) but the levels remained stable in the two probiotic yoghurt groups. These results show that probiotic strains supplemented in the form of yoghurt remain active during gut transit and are associated with an increase in beneficial bacteria and a reduction in potentially pathogenic bacteria. This trial was registered at clinicaltrials.gov as NCT00730626. Copyright © 2011 Elsevier B.V. All rights reserved.

  2. Phisicochemical, sensory, and microbiological evaluation and development of symbiotic fermented drink

    Directory of Open Access Journals (Sweden)

    Mônica de Lucena Lira Aguiar Dias

    2013-12-01

    Full Text Available The goal of this study was to develop a symbiotic lacteous drink, evaluate its physicochemical and sensory characteristics, and verify the viability of Lactobacillus acidophilus in the drink. The milk serum-based drink consisted of 50% milk serum containing 10% saccharose, 25% powdered milk, 15% yacon pulp, and cultures of Lactobacillus acidophilus-La 5E and Bifidobacterium bifidum BB12. It was stored for up to 21 days under refrigeration. The milk serum-based drink was analyzed for protein, ether extract, total dietary fiber, total frutans, carbohydrate content, color, pH, acidity, and contamination by coliforms, and Salmonella sp. Coliforms and Salmonella sp were not detected, and L. acidophilus and B. bifidum provided satisfactory probiotic counts up to 21 days of storage under refrigeration. Lactobacillus acidophilus resistance to gastric acids and bile salts was detected only up to seven days of storage when evaluated in vitro. Sensory analysis and purchase viability were evaluated by consumers at 0, 7, 14, and 21 days of storage. Based on the analytical results and consumer evaluation, the drink was acceptable up to seven days of storage.

  3. Effects of ascorbic acid and glucose oxidase levels on the viability of probiotic bacteria and the physical and sensory characteristics in symbiotic ice-cream

    Directory of Open Access Journals (Sweden)

    M. B. Akın

    2015-05-01

    Full Text Available In this study, the effects of addition of different amounts of ascorbic acid and glucose oxidase on the properties of symbiotic ice cream were investigated. Ice-cream containing inulin (2 % (w/w was produced by mixing fortified milk fermented with probiotic strains with the ice-cream mixes containing different ascorbic acid and glucose oxidase concentrations (0.025, 0.05, 0.1 (w/w. The cultures were grown (37 °C, 12 h in UHT skimmed milk. The fermented milk was added to the ice-cream mix up to a level of 10 % w/w. Increasing the concentration of ascorbic acid stimulated the growth of Lactobacillus acidophilus LA-5 (L. acidophilus and Bifidobacterium animalis subsp. lactis BB-12 (Bifidobacterium BB-12. On contrary, increasing the concentration of glucose oxidase negatively affected the growth of L. acidophilus and Bifidobacterium BB-12. However, both, ascorbic acid and glucose oxidase concentration had no effect on physical and sensory properties of ice cream. The results suggested that the addition of ascorbic acid stimulated the growth of L. acidophilus and Bifidobacterium BB-12 and could be recommended for ice cream production.

  4. Pembuatan Pasta Gigi Katekin Teh Hijau dan Uji Daya Hambat terhadap Bakteri Streptococcus Mutans dan Lactobascillus Ascidopillus

    Directory of Open Access Journals (Sweden)

    Fajriani Fajriani

    2015-06-01

    Peracikan formula dan pembuatan pasta gigi katekin teh hijau dilakukan sesuai hasil uji KHM (MIC. Pasta gigi katekin teh hijau ini dilakukan pengukuran kadar total flavonoid dan total polifenol, selanjutnya pengukuran uji daya hambat pasta gigi katekin teh hijau dilakukan dengan metode difusi menggunakan well (sumuran sebagai reservoar sampel uji terhadap bakteri streptococus mutans dan lactobacilus acidophilus. Hasil diperoleh prodak pasta gigi katekin teh hijau dengan kandungan kadar flavonoid 77% dan kadar polifenol 41%, sedangkan hasil uji diameter hambatan pasta gigi katekin teh hijau terhadap bakteri streptococcus mutans 17,2 mm dan bakteri lactobacillus acidophilus 19,6 mm. Hasil ini menunjukkan bahwa prodak katekin teh hijau ini sangat efektif digunakan sehari-hari sebagai perawatan gigi dan juga sebagai antibakteri kariogenik.   Making Green Tea Catechin Toothpaste and Inhibition Test Against Streptococcus Mutans and Acidophilus Lactobaccilus. The manufacture of this toothpaste is motivated by the desire of researchers to facilitate the public to use natural ingredients of green tea catechins whose result effectiveness against cariogenic bacteria was directly tested inhibition. This study is to find the right formula composition for greentea catechins toothpaste based on the result of the inhibition properties of greentea cathecins against tostreptococcus mutans dan lactobacillus acidophilus. The manufacture of greentea catechins toothpaste was after making catechins extracts and testing minimal inhibition concentration (MIC and minimal bactericidal concentration (MBC using liquid dilution method. The toothpaste was then made according to the result of MIC. The toothpaste’s flavonoid and polyphenol total contain was measured; then the inhibition property of the toothpaste to was measured using diffusion method with wells as the sample reservoar for streptococus mutans dan lactobacilus acidophilus. It is found that the toothpaste contains

  5. Comparação entre método bioquímico e reação em cadeia de polimerase para identificação de Lactobacillus spp., isolados de aves Comparison between biochemical and polymerase chain reaction methods for the identification of Lactobacillus spp. isolated from chickens

    Directory of Open Access Journals (Sweden)

    M.R. Barros

    2009-04-01

    Full Text Available Lactobacilos foram isolados do inglúvio e cecos de reprodutoras pesadas e caracterizados como Gram-positivo, catalase negativo, produtores de gás em glicose e não produtores de H2S em triple sugar iron e pela fermentação de carboidratos. Utilizaram-se os iniciadores: Lac 1/23-10C para detecção de Lactobacillus acidophilus, L. crispatus, L. amylovorus, L. gasseri, L. helveticus e L. jensenii; Lac 2/LU-1' para L. acidophilus; Fer 3/Fer 4 para L. fermentum; Reu 1/Reu 2 para L. reuteri e Sal 1 e Sal 2 para L. salivarius. L. reuteri e L. salivarius foram identificados pela reação em cadeia de polimerase (PCR e pelo teste bioquímico, enquanto L. acidophilus, L. fermentum e Lactobacillus sp. somente pelo teste bioquímico. Os resultados obtidos na PCR foram mais precisos quando comparados aos obtidos com o método bioquímico, que demonstrou ser subjetivo devido às variações na fermentação de carboidratos, principalmente na diferenciação entre L. fermentum e L. reuteri.Lactobacilli were isolated from crops and ceca of broiler breeders and characterized by positive Gram staining, negative catalase test, production of gas from glucose, and negative for H2S production from triple sugar iron, and carbohydrates fermentation. Primers: Lac1/23-10C for detecting Lactobacillus acidophilus, L. crispatus, L. amylovorus, L. gasseri, L. helveticus, and L. jensenii; Lac2/LU-1' for L. acidophilus; Fer3/Fer4 for L. fermentum; Reu1/Reu2 for L. reuteri, and Sal1/Sal2 for L. salivarius were used. L. reuteri and L. salivarius were identified by both polymerase chain reaction (PCR and biochemical tests. However, L. acidophilus, L. fermentum, and Lactobacillus sp. were only identified by biochemical tests. PCR results were more precise, considering the variability of carbohydrate fermentation among the strains, especially for identifying L. fermentum and L. reuteri.

  6. Search for the algorithm of genes distribution during the process of microbial evolution

    Science.gov (United States)

    Pikuta, Elena V.

    2015-09-01

    Previous two and three dimensional graph analysis of eco-physiological data of Archaea demonstrated specific geometry for distribution of major Prokaryotic groups in a hyperboloid function. The function of a two-sheet hyperboloid covered all known biological groups, and therefore, could be applied for the entire evolution of life on Earth. The vector of evolution was indicated from the point of hyper temperature, extreme acidity and low salinity to the point of low temperature and increased alkalinity and salinity. According to this vector, the following groups were chosen for the gene screening analysis. In the vector "High-Temperature → Low-Temperature" within extreme acidic pH (0-3), it is: 1) the hyperthermophilic Crenarchaeota - order Sulfolobales, 2) moderately thermophilic Euryarchaeota - Class Thermoplasmata, and 3) mesophilic acidophiles- genus Thiobacillus and others. In the vector "Low pH → High pH" the following groups were selected in three temperature ranges: a) Hyperthermophilic Archaea and Eubacteria, b) moderately thermophilic - representatives of the genera Anaerobacter and Anoxybacillus, and c) mesophilic haloalkaliphiles (Eubacteria and Archaea). The genes associated with acidophily (H+ pump), chemolitho-autotrophy (proteins of biochemichal cycles), polymerases, and histones were proposed for the first vector, and for the second vector the genes associated with halo-alkaliphily (Na+ pumps), enzymes of organotrophic metabolisms (sugar- and proteolytics), and others were indicated for the screening. Here, an introduction to the phylogenetic constant (ρη) is presented and discussed. This universal characteristic is calculated for two principally different life forms -Prokaryotes and Eukaryotes; Existence of the second type of living forms is impossible without the first one. The number of chromosomes in Prokaryotic organisms is limited to one (with very rare exceptions, to two), while in Eukaryotic organisms this number is larger. Currently

  7. 蔬菜连作改为蓝莓种植后土壤细菌群落多样性变化的分析%Changes in Soil Bacterial Community Diversity Caused by Cropping System Alteration from Vegetable Continuous Cropping to Blueberry Planting

    Institute of Scientific and Technical Information of China (English)

    祁石刚; 田畅; 却枫; 徐志胜; 王枫; 熊爱生

    2016-01-01

    基于第二代Illumina Miseq高通量测序平台,利用16S rDNA技术分析了江苏省宿迁市蔬菜连作改为蓝莓种植后土壤细菌多样性的分布和细菌群落多样性的变化。结果表明:Kaistobacter、假交替单胞菌属( Pseud oaltre omno as)、硫杆状菌属( Thiobacillus)、Rubritalea、浮霉菌属( Planctomyces)、Lysobacter、纤维弧菌属( Cellvibrio)、噬氢菌属( Hdy roeg nohp a-ga )、鞘脂单胞菌属( Sphingomona s)和热单胞菌属( Thermomonas)为蔬菜连作改为蓝莓种植后土壤细菌的主要类群; Spo-rosarcina、Alicyclobacillus、氨氧化古细菌( Candidatus nitrososphaera)和P ontibatc er是蔬菜连作土壤细菌的主要类群;蔬菜连作改为种植蓝莓后,土壤细菌多样性和丰度降低,优势菌群也出现了显著的变化。%Based on the second-generation high-throughput sequencing platform Illumina Miseq , using the 16S rDNA gene sequencing technology, the author analyzed the changes in soil bacterial community diversity caused by the cropping system altera-tion from vegetable continuous cropping to blueberry planting in Suqian city of Jiangsu province .The results showed that:Kaisto-bacter, Pseudoalteromonas, Thiobacillus, Rubrti alea, Planctomyces, Lysobacter, Cellvibrio, Hydrogenophaga, Sphingomonas and Thermomonas were the dominant bacterial populations in the soil after cropping system alteration from vegetable continuous crop-ping to blueberry planting;Sporosarcina, Alicyclobacillus, Cand idatus nitrososphaera and Pontbi acter were the dominant bacterial populations in the soil of continuous-cropping vegetable field;after the alteration from vegetable continuous cropping to blueberry planting, the diversity and abundance of soil bacteria were reduced , and the dominant bacterial community also changed obvious-ly.

  8. Iron sulfide oxidation as influenced by calcium carbonate application

    Energy Technology Data Exchange (ETDEWEB)

    Hossner, L.R.; Doolittle, J.J. [Texas A& M University, College Station, TX (USA). Dept. of Soil & Crop Science

    2003-06-01

    Two overburden materials, with different FeS{sub 2} contents (1.9 and 4.1%) and low acid neutralization potential, were limed with CaCO{sub 3} at rates of 0, 25,50,75, 100, and 125% based on the amount of CaCO{sub 3} needed to provide an acid-base account deficit (A/B-a) of zero (A/B-a = neutratization potential - potential acidity - exchangeable acidity). The limed overburden materials were inoculated with Thiobacillus ferrooxidans and leached weekly with deionized water. Residual FeS{sub 2} and CaCO{sub 3} were determined in samples over a 378-d period. Oxidation followed zero-order kinetics with respect to FeS{sub 2} concentration at pH values greater than 4 and first-order kinetics at pH values less than 4. Zero-order oxidation rates ranged from 0.01 to 0.46 {mu}mol g{sup -1} d{sup -1} in the overburden with 1.9% FeS{sub 2} and from 0.01 to 0.22 {mu}mol g{sup -1} d{sup -1} in the overburden with 4.1% FeS{sub 2}. Oxidation following the first-order rate law had a first-order rate constant of 0.03 d{sup -1} in the 1.9% FeS{sub 2} overburden and 0.01 d{sup -1} in the 4.1% FeS{sub 2} overburden. The calculated half-life was 23 d for the 1.9% FeS{sub 2} overburden and 69 d for the 4.1% FeS{sub 2} overburden. Additions of CaCO{sub 3} affected FeS{sub 2} oxidation by controlling the pH of the system. Liming to greater than 50% of the acid-base account deficit did not significantly affect the zero-order oxidation rate. Dissolution of the applied CaCO{sub 3} was found to be faster than the oxidation of FeS{sub 2} at pH values greater than 4. It was projected that at lime rates up to 125%, the CaCO{sub 3} would dissolve and leach out of the system before all the FeS{sub 2} oxidized, leaving the potential for acid minesoil formation.

  9. Effects of probiotics on the growth performance and intestinal micro flora of broiler chickens.

    Science.gov (United States)

    Li, Yin-bo; Xu, Qian-qian; Yang, Cun-jin; Yang, Xin; Lv, Le; Yin, Chun-hua; Liu, Xiao-lu; Yan, Hai

    2014-05-01

    Antibiotics have been used in poultry industry for decades to promote growth and protect animals from diseases, followed by various side effects. In efforts of searching for a better alternative, probiotic is of extensive attention. We investigated the effects of Bacillus subtitles, Rhodopseudomonas palustris, Candida utilis and Lactobacillus acidophilus as 0.1% (W/W) feed additives on broiler growth performance and intestinal microflora. The results showed the probiotics treatments significantly improved growth of broilers. Broilers supplemented with B. subtilis and L. acidophilus weighed 18.4% and 10.1% more than birds in control group at 42 days of age. Furthermore the feed conversion ratios of the birds in the two groups were also improved, decreasing 9.1% and 12.9%, respectively. Further study indicated a significant increase of cecal Lactobacilli concentration in briolers supplemented with probiotics, expecially in L. acidophilus treatment group. Meanwhile, the count of cecal Actinomyces in birds treated with probiotics was significantly lower compared with the control group. In conclusion, probiotics such as B. subtitles and L. acidophilus are good alternatives to antibiotics in promoting growth resulting from a beneficial modulation of the intestinal micro flora, which leads to increased efficiency of intestinal digestion in the host animal.

  10. Consumption of probiotics increases the effect of regulatory T cells in transfer colitis

    DEFF Research Database (Denmark)

    Petersen, Emil Rathsach; Claesson, Mogens Helweg; Schmidt, Esben Gjerløff Wedebye

    2012-01-01

    BACKGROUND: Probiotics may alter immune regulation. Recently, we showed that the probiotic bacteria Lactobacillus acidophilus NCFM™ influenced the activity of regulatory T cells (Tregs) in vitro. The aim of the present work was to demonstrate if L. acidophilus NCFM™ also affects the function...... of Tregs in vivo. METHODS: Development of colitis after transfer of CD4+CD25- T cells and protection from colitis by Tregs was studied in immunodeficient SCID mice which were simultaneously tube-fed with L. acidophilus NCFM™ or L. salivarius Ls-33 for 5 weeks. RESULTS: Probiotic-fed SCID mice transplanted...... with low numbers of Tregs in addition to the disease-inducing T cells were completely protected from colitis. This was in contrast to the control group, which showed intermediate levels of inflammation. In addition, feeding with probiotics lowered serum levels of inflammatory cytokines in both colitic mice...

  11. Physicochemical Characteristics and Antioxidant Capacity in Yogurt Fortified with Red Ginseng Extract

    OpenAIRE

    Jung, Jieun; Paik, Hyun-Dong; Yoon, Hyun Joo; Jang, Hye Ji; Jeewanthi, Renda Kankanamge Chaturika; Jee, Hee-Sook; Li, Xiang; Lee, Na-Kyoung; Lee, Si-Kyung

    2016-01-01

    The objective of this study was to investigate characteristics and functionality of yogurt applied red ginseng extract. Yogurts added with red ginseng extract (0.5, 1, 1.5, and 2%) were produced using Lactobacillus acidophilus and Streptococcus thermophilus and stored at refrigerated temperature. During fermentation, pH was decreased whereas titratable aicidity and viable cell counts of L. acidophilus and S. thermophilus were increased. The composition of yogurt samples was measured on day 1,...

  12. Efeito do teor de soro, açúcar e de frutooligossacarídeos sobre a população de bactérias lácticas probióticas em bebidas fermentadas Effect of whey, suggar and frutooligosacharides on the probiotic lactic acid bacteria population in fermented beverages

    Directory of Open Access Journals (Sweden)

    Karime Giannetti Thamer

    2005-09-01

    Full Text Available Nos últimos anos tem havido muito interesse por produtos alimentícios de baixas calorias e probióticos. A incorporação de Lactobacillus acidophilus e Bifidobacterium em bebidas fermentadas pode resultar em um produto lácteo com extraordinário valor terapêutico e eficaz redução calórica. O objetivo deste trabalho foi estudar o efeito do teor de soro, açúcar e de frutooligossacarídeos sobre a população de bactérias lácticas de doze formulações de bebidas fermentadas. Foram determinadas as populações de Streptococcus thermophilus, Lactobacillus delbrueckii subsp. bulgaricus, Bifidobacterium e Lactobacillus acidophilus. As maiores populações de microrganismos probióticos foram observadas nas bebidas com mais baixa acidez e elevado teor de sólidos, além de haver predominância do Streptococcus thermophilus sobre os demais microrganismos. As amostras atenderam a legislação brasileira em vigor, independente das formulações, pela presença de no mínimo 10(6 UFC/mL de bactérias lácticas. As bebidas lácteas formuladas podem ser consideradas probióticas pelas contagens elevadas de Bifidobacterium spp. e Lactobacillus acidophilusThe demand for low calories and probiotics foods has increased during the last years. The incorporation of Lactobacillus acidophilus and Bifidobacterium in fermented beverages can result in dairy products with excellent therapeutic value and efficient calories reduction. The aim of this research was study the effects of whey, sugar and fructooligosaccharides levels on the lactic acid bacteria population of twelve formulations of fermented beverages. The populations of Streptococcus thermophilus, Lactobacillus delbrueckii subsp. bulgaricus, Bifidobacterium spp. and Lactobacillus acidophilus were carried out. The highest probiotic microorganisms' populations were observed in beverages with lower acidity and higher solids level, besides there was a predominance of Streptococcus thermophilus over the

  13. Evaluation of antibacterial activity of some selected green seaweed extracts from Muttam coastal areas, Kanyakumari, Tamil Nadu, India

    Directory of Open Access Journals (Sweden)

    Pushparaj Arunachalam

    2014-02-01

    Full Text Available Objective: To investigate the antimicrobial activity of the selected marine green algae Ulva lactuca (U. lactuca, Cheatomorpha linoides and Helimeda macroloba against six strains of Gram-positive bacteria [Staphylococcus aureus (S. aureus, Bacillus subtilis and Lactobacillus acidophilus (L. acidophilus] and Gram-negative bacteria [Escherichia coli, Pseudomonas aeruginosa (P. aeruginosa and Proteus mirabilis]. Methods: The selected green seaweed extracts were experimented with four different solvents (acetone, ethanol, methanol and chloroform against the selected pathogens by using agar disc diffusion method. Results: The maximum activity (7 mm was observed by the extract of U. lactuca against Proteus mirabilis by using methanol as a solvent and the lowest activity (2 mm was recorded by the extract of U. lactuca against L. acidophilus by using chloroform as a solvent and ethanol extract against P. aeruginosa. The lowest activity (2 mm was seen in the extract of Cheatomorpha linoides by using ethanol and methanol as a solvent against S. aureus. In Helimeda macroloba extract, the lowest activity was recorded against Escherichia coli by using chloroform as a solvent. The microbial strains S. aureus, P. aeruginosa, Bacillus subtilis and L. acidophilus were resistant to the chloroform and methanol of all selected seaweeds. Conclusions: Further study should be needed to identify the prime compound which is responsible for the activity against the selected pathogens especially those causing the human diseases.

  14. Functional characteristics of Lactobacillus spp. from traditional Maasai fermented milk products in Kenya.

    Science.gov (United States)

    Mathara, Julius Maina; Schillinger, Ulrich; Guigas, Claudia; Franz, Charles; Kutima, Phillip Museve; Mbugua, Samuel K; Shin, H-K; Holzapfel, Wilhelm H

    2008-08-15

    In this study functional characteristics of 23 representative Lactobacillus strains isolated from the Maasai traditional fermented milk 'Kule naoto' were determined. The Lb. acidophilus group strains showed resistance to gastric juice and bile. In addition, some Lb. acidophilus strains expressed bile salt hydrolase activity, and had ability to assimilate cholesterol in vitro. In-vitro adhesion to HT29 MTX cells of up to 70% was recorded. Lb. fermentum strains showed almost 100% survival under simulated stomach acidic conditions and physiological salt concentrations of bile salts, hydrophobicity values were over 80%. Most strains of the Lb. casei and Lb. acidophilus groups showed aggregation abilities of above 50%. Many strains expressed a protective effect against N-methyl-N'-nitro-N-nitrosoguanidine induced DNA damage according to the 'comet assay' and none was virulent. The antibiotic minimum inhibitory concentration of selected strains was established. According to these results, the Lactobacillus spp associated with 'Kule naoto', contain potentially probiotic (functional) strains.

  15. Characterization of Selected Lactobacillus Strains for Use as Probiotics.

    Science.gov (United States)

    Song, Minyu; Yun, Bohyun; Moon, Jae-Hak; Park, Dong-June; Lim, Kwangsei; Oh, Sejong

    2015-01-01

    The aim of this study was to evaluate the functional properties of lactic acid bacteria from various sources and to identify strains for use as probiotics. Ten Lactobacillus strains were selected and their properties such as bile tolerance, acid resistance, cholesterol assimilation activity, and adherence to HT-29 cells were assessed to determine their potential as probiotics. Lactobacillus sp. JNU 8829, L. casei MB3, L. sakei MA9, L. sakei CH8, and L. acidophilus M23 were found to show full tolerance to the 0.3% bile acid. All strains without L. acidophilus M23 were the most acid-tolerant strains. After incubating the strains at pH 2.5 for 2 h, their viability decreased by 3 Log cells. Some strains survived at pH 2.5 in the presence of pepsin and 0.3% bile acid. Lactobacillus sp. JNU 8829, L. acidophilus KU41, L. acidophilus M23, L. fermentum NS2, L. plantarum M13, and L. plantarum NS3 were found to reduce cholesterol levels by >50% in vitro. In the adhesion assay, Lactobacillus sp. JNU 8829, L. casei MB3, L. sakei MA9, and L. sakei CH8 showed higher adhesion activities after 2 h of co-incubation with the intestinal cells. The results of this comprehensive analysis shows that this new probiotic strain named, Lactobacillus sp. JNU 8829 could be a promising candidate for dairy products.

  16. Antimicrobial effect of probiotics on bacterial species from dental plaque.

    Science.gov (United States)

    Zambori, Csilla; Morvay, Attila Alexandru; Sala, Claudia; Licker, Monica; Gurban, Camelia; Tanasie, Gabriela; Tirziu, Emil

    2016-03-31

    The antimicrobial role of probiotic Lactobacillus casei subspecies casei DG (L. casei DG) and of the mix culture of probiotic Lactobacillus acidophilus LA-5 and Bifidobacterium BB-12 was tested on species of Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera from supragingival sites from dogs with dental disease of different breed, age, sex, weight, and diet. The research was conducted on these four genera because of their importance in zoonotic infections after dog bites. Species from Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera were isolated and identified. To test the antimicrobial efficacy of L. casei DG and the mixed culture of probiotic L. acidophilus LA-5 and Bifidobacterium bifidum BB-12 on the pathogenic species, the agar overlay method was used. L. casei DG had a bactericidal effect on all analyzed species isolated from Staphylococcus, Streptococcus, Pasteurella, and Neisseria genera after 24 hours of incubation. The mixed probiotic culture made up of L. acidophilus LA-5 and Bifidobacterium BB-12 species had no bactericidal effect on the species of Staphylococcus and Streptococcus genera, which were resistant. However, it had a bacteriostatic effect on several species of Pasteurella and Neisseria genera. This work highlights the antimicrobial potential of probiotics in vitro, demonstrating that the probiotic L. casei DG has a bactericidal effect on all analyzed species isolated from dental plaque and that the mix culture of probiotic L. acidophilus LA-5 and Bifidobacterium BB-12 has only a bacteriostatic effect.

  17. BIOCHEMICAL CHARACTERISTICS OF LACTIC ACID PRODUCING BACTERIA AND PREPARATION OF CAMEL MILK CHEESE BY USING STARTER CULTURE

    Directory of Open Access Journals (Sweden)

    T. Ahmed and R. Kanwal

    2004-04-01

    Full Text Available Lactic acid bacteria (LAB were isolated from camel milk by culturing the milk on specific media and pure culture was obtained by sub-culturing. Purification of culture was confirmed by Gram’s staining and identified by different biochemical tests. Camel milk contained lactic acid producing bacteria like Streptococci such as S. cremoris and S. lactis and Lactobacilli such as L. acidophilus. L. acidophilus grew more rapidly in camel milk than others as its growth was supported by camel milk. Ability of each strain was tested to convert lactose of milk into lactic acid. It was observed that 66% lactose was converted by S. lactis 20, whereas S. cremoris 22 and L. acidophilus 23 converted 56 and 74% lactose into lactic acid, respectively. Effect of freeze-drying was also recorded and the results showed that in all cases there was a slight decrease in the cell count before and after the freeze-drying. The decrease was approximately 0.47, 0.078 and 0.86% for S. lactis 20, S. cremoris 22 and L. acidophilus 23, respectively. Starter culture was prepared from strains isolated from camel milk. Camel and buffalo milk cheese was prepared by using starter culture. The strains isolated from camel milk were best for acid production and coagulated the milk in less time. It is concluded that cheese can be prepared successfully from camel milk and better results can be obtained by coagulating milk with starter culture.

  18. Protective effect of probiotic diets on haematobiochemical and histopathology changes of Mystus montanus (Jerdon 1849 against Aeromonas hydrophila

    Directory of Open Access Journals (Sweden)

    Gurusamy Chelladurai

    2013-11-01

    Full Text Available Objectives: To evaluate the protective effect of probiotic diets on haemotobiochemical and histopathology changes of Mystus montanus against Aeromonas hydrophila (A. hydrophila. Methods: Three experimental groups of fish were fed with a diet supplemented with Lactobacillus acidophilus (L. acidophilus (Sporolac, comprising about 0.1 g, 0.2 g and 0.3 g. Control group of fish were fed without L. acidophilus. After 60 d of feeding the fishes in experimental group were injected with 1 mL of A. hydrophila and were supplemented with probiotic diets. The control group fishes were injected with 1 mL of physiological saline solution alone. Results: Blood samples were collected for haematobiochemical analysis, while samples of the liver, and gills were examined for path histology after 7 d of infection. The result showed that the growth parameters, weight gain, specific growth rate were better in infected group maintained on the probiotic diet compared to those in control group. The haematology parameters, erythrocyte sedimentation rate, red blood cell, white blood cell, total serum protein, Mg 2+ , Ca 2+ , Cl, glucose, cholesterol and total immunoglobulin concentration and the pathohistology of the liver, gills were better in the infected fish maintained on the probiotic diet than those in the group fed the control diet. Conclusions: The result of the present study showed that L. acidophilus is useful as a probiotic agent in Mystus montanus against A. hydrophila.

  19. Production of Synbiotic Yogurt-Like Using Indigenous Lactic Acid Bacteria as Functional Food

    Directory of Open Access Journals (Sweden)

    M. Astawan

    2012-04-01

    Full Text Available Yoghurt is a product of fermented milk using Lactobacillus bulgaricus and Streptococcus thermophilus as culture starter. Indigenous probiotic lactic acid bacteria, Lactobacillus plantarum 2C12 or Lactobacillus acidophilus 2B4, were applied in the making of functional synbiotic yoghurt-like with 5% of fructo-oligosaccharide (FOS as a prebiotic source. The aim of this study was to determine the best formula of functional synbiotic yoghurt-like among four formulas: F1 (L. bulgaricus + S. thermophilus, F2 (L. bulgaricus + S. thermophilus + L. plantarum 2C12, F3 (L. bulgaricus+ S. thermophilus + L. acidophilus 2B4, and F4 (L. bulgaricus + S. thermophilus + L. plantarum 2C12 + L. acidophilus 2B4 to be choosen and followed detection of it’s flavor to improve the product quality and consumer acceptance. The results showed that the F3 synbiotic yogurt made from mixed culture L. bulgaricus, S. thermophilus, and L. acidophilus 2B4 had the highest antibacterial effect against Enteropathogenic Escherichia coli (EPEC. Addition of 1.75% natural corn starch as a stabilizer produced optimum improvement in yoghurt consistency and minimize whey separation. Result of sensory evaluation indicated that the yoghurt with addition of 1% strawberry flavor and 0.1% vanilla flavor were ranked at first and second. Yoghurts were still good to be consumed after 15 d storage period at the refrigeration temperature (10 oC.

  20. The effects of the DDS-1 strain of lactobacillus on symptomatic relief for lactose intolerance - a randomized, double-blind, placebo-controlled, crossover clinical trial.

    Science.gov (United States)

    Pakdaman, Michael N; Udani, Jay K; Molina, Jhanna Pamela; Shahani, Michael

    2016-05-20

    Lactose intolerance is a form of lactose maldigestion where individuals experience symptoms such as diarrhea, abdominal cramping, flatulence, vomiting and bowel sounds following lactose consumption. Lactobacillus acidophilus is a species of bacteria known for its sugar fermenting properties. Preclinical studies have found that Lactobacillus acidophilus supplementation may assist in breaking down lactose; however, no human clinical trials exist evaluating its efficacy in alleviating symptoms related to lactose intolerance. The aim of this randomized, double-blind, placebo-controlled, crossover study was to evaluate the effect of a proprietary strain of Lactobacillus acidophilus on relieving discomfort related to lactose intolerance. The study enrolled healthy volunteers between 18 and 75 years of age who complained of lactose intolerance. Screening visits included a lactose challenge visit to confirm eligibility based on a score of 10 or higher on subjective assessment of the following symptoms after lactose challenge: diarrhea, abdominal cramping, vomiting, audible bowel sounds, flatulence, and overall symptoms. Qualified subjects participated in a 2-arm crossover design, with each arm consisting of 4 weeks of intervention of either active or placebo product, with a 2-week washout period during crossover. The study product consisted of the DDS-1 strain of Lactobacillus acidophilus (Nebraska Cultures, Walnut Creek, California). The placebo was formulated from maltodextrin. Study participants were instructed to take the product once daily for 4 weeks. Data collected included subjective symptom scores related to lactose intolerance. Longitudinal comparison between the DDS-1 group and placebo group demonstrated statistically significant reductions in abdominal symptom scores during the 6-h Lactose Challenge at week 4 for diarrhea (p = 0.033), abdominal cramping (p = 0.012), vomiting (p = 0.0002), and overall symptom score (p = 0.037). No adverse

  1. Probiotics in the Space Food System: Delivery, Microgravity Effects, and the Potential Benefit to Crew Health

    Science.gov (United States)

    Castro, S. L.; Ott, C. M.; Douglas, G. L.

    2014-01-01

    As mission distance and duration increase, the need grows for non-invasive disease prevention and immunomodulation, especially given the limited medical response capability expected for these missions and the immune dysregulation documented in crew. Additionally, changes in diet, lifestyle, antibiotic usage, and the environmental stresses during spaceflight may alter crewmembers' intestinal microbiome. The addition of probiotic bacteria to the space food system is expected to confer immunostimulatory benefits on crewmembers, with the potential to counteract the immune dysregulation that has been documented in spaceflight. Based on previous studies that demonstrated unique microbiological responses to the low shear environment of spaceflight, probiotic organisms hold the potential to induce enhanced beneficial responses through mechanisms, such as beneficial interactions with human immune cells and repression of colonization of pathogens on the mucosa. The work presented here will begin to address two research gaps related to providing probiotics in spaceflight: 1) delivery, and 2) the effect of the low shear microgravity environment on probiotic attributes. The probiotic Lactobacillus acidophilus was selected for investigation due to its wide commercial use and documented benefits that include inhibition of virulence related gene expression in pathogens and mucosal stimulation of immune cells. The delivery system for probiotics has not been determined for spaceflight, where the food system is shelf stable and the lack of refrigeration prevents the use of traditional dairy delivery methods. In order to demonstrate the potential of the space food system to deliver viable probiotic bacteria to crewmembers, the probiotic L. acidophilus was packaged in high barrier flight packaging in nonfat dry milk (NFDM) or retained in commercial capsule form. Viable cells were enumerated over 8 months of storage at 22, 4, and -80ºC. The survival of L. acidophilus rehydrated in NFDM

  2. The Effect of Lactobacillus plantarum ATCC 8014 and Lactobacillus acidophilus NCFM Fermentation on Antioxidant Properties of Selected in Vitro Sprout Culture of Orthosiphon aristatus (Java Tea as a Model Study

    Directory of Open Access Journals (Sweden)

    Dase Hunaefi

    2012-09-01

    Full Text Available High rosmarinic acid (RA productivity has been achieved by applying jasmonic acid and yeast extract elicitors to the in vitro sprout culture of Orthosiphon aritatus (IOSC. The highest RA accumulation from three solvents was detected in IOSC after treatment with yeast extract (5 g/L. HPLC analysis clearly confirmed a drastic increase in RA subjected to yeast extract elicitation. Therefore, this yeast extract elicited IOSC was chosen for a lactic acid bacteria (LAB fermentation study as a model system. This selected IOSC was subjected to different types of LAB fermentations (Lactobacillus plantarum ATCC 8014 and Lactobacillus acidophilus NCFM for different periods of time 24, 48 and 72 h. The LAB fermentations consisted of solid state fermentations (SSF and liquid state fermentations (LSF in a Digital Control Unit (DCU fermenter system. The aim was to determine the effect of fermentation on the antioxidant properties of the plant extract. Results indicated that all types of LAB fermentation decreased the level of RA and total phenolics, however, a slight increase in total flavonoids and flavonols was observed in SSF samples. HPLC results confirmed that the longer the fermentation, the greater the reduction in RA content. The highest reduction was obtained in the sample of LSF inoculated with L. plantarum for a period of 72 h. The temperature of fermentation (37 °C was predicted as contributing to the declining level in RA content. The loss in RA was concomitant with a loss of total antioxidant activity (1,1-diphenyl-2-picrylhydrazyl (DPPH scavenging activity, Trolox Equivalent Antioxidant Capacity (TEAC, and Superoxide Dismutase (SOD-like activity. These results indicate that RA is the major contributor to the antioxidant activity of this plant.

  3. Ultra-low-dose estriol and Lactobacillus acidophilus vaginal tablets (Gynoflor(®)) for vaginal atrophy in postmenopausal breast cancer patients on aromatase inhibitors: pharmacokinetic, safety, and efficacy phase I clinical study.

    Science.gov (United States)

    Donders, Gilbert; Neven, Patrick; Moegele, Maximilian; Lintermans, Anneleen; Bellen, Gert; Prasauskas, Valdas; Grob, Philipp; Ortmann, Olaf; Buchholz, Stefan

    2014-06-01

    Phase I pharmacokinetic (PK) study assessed circulating estrogens in breast cancer (BC) patients on a non-steroidal aromatase inhibitor (NSAI) with vaginal atrophy using vaginal ultra-low-dose 0.03 mg estriol (E3) and Lactobacillus combination vaginal tablets (Gynoflor(®)). 16 women on NSAI with severe vaginal atrophy applied a daily vaginal tablet of Gynoflor(®) for 28 days followed by a maintenance therapy of 3 tablets weekly for 8 weeks. Primary outcomes were serum concentrations and PK of E3, estradiol (E2), and estrone (E1) using highly sensitive gas chromatography-mass spectrometry. Secondary outcomes were clinical measures for efficacy and side effects; microscopic changes in vaginal epithelium and microflora; and changes in serum FSH, LH, and sex hormone-binding globulin. Compared with baseline, serum E1 and E2 did not increase in any of the women at any time following vaginal application. Serum E3 transiently increased after the first application in 15 of 16 women, with a maximum of 168 pg/ml 2-3 h post-insertion. After 4 weeks, serum E3 was slightly increased in 8 women with a maximum of 44 pg/ml. The vaginal atrophy resolved or improved in all women. The product was well tolerated, and discontinuation of therapy was not observed. The low-dose 0.03 mg E3 and Lactobacillus acidophilus vaginal tablets application in postmenopausal BC patients during AI treatment suffering from vaginal atrophy lead to small and transient increases in serum E3, but not E1 or E2, and therefore can be considered as safe and efficacious for treatment of atrophic vaginitis in BC patients taking NSAIs.

  4. Viability and growth characteristics of Lactobacillus in soymilk supplemented with B-vitamins.

    Science.gov (United States)

    Ewe, Joo-Ann; Wan-Abdullah, Wan-Nadiah; Liong, Min-Tze

    2010-02-01

    Ten strains of Lactobacillus were evaluated for their viability in soymilk. Lactobacillus acidophilus ATCC 314, L. acidophilus FTDC 8833, L. acidophilus FTDC 8633 and L. gasseri FTDC 8131 displayed higher viability in soymilk and were thus selected to be evaluated for viability and growth characteristics in soymilk supplemented with B-vitamins. Pour plate analyses showed that the supplementation of all B-vitamins studied promoted the growth of lactobacilli to a viable count exceeding 7 log CFU/ml. alpha-Galactosidase specific activity of lactobacilli as determined spectrophotometrically showed an increase upon supplementation of B-vitamins. High-performance liquid chromatography analyses revealed that this led to increased hydrolysis of soy oligosaccharides and subsequently higher utilization of simple sugars. Production of organic acids as determined via high-performance liquid chromatography also showed an increase, accompanied by a decrease in pH of soymilk. Additionally, the supplementation of B-vitamins also promoted the synthesis of riboflavin and folic acid by lactobacilli in soymilk. Our results indicated that B-vitamin-supplemented soymilk is a good proliferation medium for strains of lactobacilli.

  5. Antibacterial Properties of Calcium Fluoride-Based Composite Materials: In Vitro Study

    Science.gov (United States)

    Zarzycka, Beata; Grzegorczyk, Janina; Sokołowski, Krzysztof; Półtorak, Konrad; Sokołowski, Jerzy

    2016-01-01

    The aim of the study was to evaluate antibacterial activity of composite materials modified with calcium fluoride against cariogenic bacteria S. mutans and L. acidophilus. One commercially available conventional light-curing composite material containing fluoride ions (F2) and two commercially available flowable light-curing composite materials (Flow Art and X-Flow) modified with 1.5, 2.5, and 5.0 wt% anhydrous calcium fluoride addition were used in the study. Composite material samples were incubated in 0.95% NaCl at 35°C for 3 days; then dilution series of S. mutans and L. acidophilus strains were made from the eluates. Bacteria dilutions were cultivated on media afterwards. Colony-forming unit per 1 mL of solution (CFU/mL) was calculated. Composite materials modified with calcium fluoride highly reduced (p composite materials containing fluoride compounds. The greatest reduction in bacteria growth was observed for composite materials modified with 1.5% wt. CaF2. All three tested composite materials showed statistically greater antibacterial activity against L. acidophilus than against S. mutans. PMID:28053976

  6. Impact of clay mineral, wood sawdust or root organic matter on the bacterial and fungal community structures in two aged PAH-contaminated soils.

    Science.gov (United States)

    Cébron, Aurélie; Beguiristain, Thierry; Bongoua-Devisme, Jeanne; Denonfoux, Jérémie; Faure, Pierre; Lorgeoux, Catherine; Ouvrard, Stéphanie; Parisot, Nicolas; Peyret, Pierre; Leyval, Corinne

    2015-09-01

    development of PAH-degrading bacteria holding Gram-negative PAH-ring hydroxylating dioxygenase, catechol-1,2-dioxygenase and catechol-2,3-dioxygenase genes. Regarding the total community structure, bacteria closely related to Thiobacillus (β-Proteobacteria) and Steroidobacter (γ-Proteobacteria) genera were favoured by wood sawdust amendment. In both soils, plant rhizospheres induced the development of fungi belonging to Ascomycota and related to Alternaria and Fusarium genera. Bacteria closely related to Luteolibacter (Verrucomicrobia) and Microbacterium (Actinobacteria) were favoured in alfalfa and ryegrass rhizosphere.

  7. Chemical composition influence of cement based mortars on algal biofouling

    Science.gov (United States)

    Estelle, Dalod; Alexandre, Govin; Philippe, Grosseau; Christine, Lors; René, Guyonnet; Denis, Damidot

    2013-04-01

    The main cause of building-facade biodegradation is the growth of microorganisms. This phenomenon depends on several parameters such as the geographical situation, the environmental conditions and the surface state of the substrate. Several researches have been devoted to the study of the effect of porosity and roughness on the biofouling of stones and mortars. However, none of them have addressed the influence of the mortar chemistry on the microorganism growth kinetic. The main objective of this study is to highlight the influence of the mortar chemistry in relationship with its physical properties on biological weathering. Earlier work showed a good resistance of Calcium Aluminate Cements to biodeterioration by acidogenic bacteria (Thiobacillus) and fungi (Alternaria alternata, Aspergillus Niger and Coniosporium uncinatum). In order to characterize the influence of the mortar chemistry on biofouling, two Portland cements and two alumina cements are used. Among micro-organisms able to grow, green algae are most involved in the aesthetic deterioration of facades. Indeed, they can colonize any type of media and can be a source of nutrients for other micro-organisms such as fungi. The green algae Klebsormidium flaccidum is chosen because of its representativeness. It is indeed the species the most frequently identified and isolated from samples taken on sites. The biofouling kinetic is followed on samples exposed outdoor and on samples tested in a laboratory bench which consists in spraying an algae culture on mortar specimens. The results obtained by in situ trials are compared with the results obtained on the laboratory bench. The microorganism growth kinetic is measured by image analysis. To improve the detection of algae on the surface of the cementitious samples, the raw image is converted in the YIQ color space. Y, I and Q correspond respectively to luminance, in-phase, and quadrature. On the Q channel, the areas covered by algae and the areas of clean mortar

  8. Denitrification, anammox and fixed nitrogen removal in the water column of a tropical great lake

    Science.gov (United States)

    Darchambeau, François; Roland, Fleur; Crowe, Sean A.; De Brabandere, Loreto; Llirós, Marc; Garcia-Armisen, Tamara; Inceoglu, Ozgul; Michiels, Céline; Servais, Pierre; Morana, Cédric D. T.; Bouillon, Steven; Meysman, Filip; Veuger, Bart; Masilya, Pascal M.; Descy, Jean-Pierre; Borges, Alberto V.

    2013-04-01

    If rates of microbial denitrification in aquatic systems are poorly constrained, it is much more the case for tropical water bodies. Lake Kivu [2.50° S 1.59° S, 29.37° E 28.83° E] is one of the great lakes of the East African Rift. It is an oligotrophic lake characterized by anoxic deep waters rich in dissolved gases (methane and carbon dioxide) and nutrients, and by well oxygenated and nutrient-depleted surface waters. During the seasonally stratified rainy season (October to May), a nitrogenous zone characterized by the accumulation of nitrite (NO2-) and nitrate (NO3-) is often observed in the lower layer of the mixolimnion. It results from nitrification of ammonium released by decaying organic matter. With the seasonal uplift of the oxygen minimum zone, the nitrogenous zone becomes anoxic and might be the most preferential area for fixed nitrogen (N) removal in Lake Kivu. Our work aimed at identifying and quantifying the processes of N losses by denitrification and/or anammox in the nitrogenous zone of the Lake Kivu water column. During 5 sampling campaigns (March 2010, October 2010, June 2011, February 2012 and September 2012), isotopic labelling experiments were used to quantify denitrification and anammox rates along vertical profiles at two pelagic stations of the main lake. Moreover, N2:Ar ratios were estimated during the September 2012 campaign, and 16S rDNA pyrosequencing was used to describe bacterial community composition during the last 2 campaigns. No bacteria related to organisms performing anammox was observed and labelling experiments failed to detect anammox at any locations and any depths. In Lake Kivu, denitrifying bacteria were mainly related to Denitratisoma and Thiobacillus genus. Significant denitrification rates were observed at several occasions, especially under the oxic-anoxic interface in the bottom of the nitracline. The annual average denitrification rate was estimated at ~150 μmoles N m-2 d-1. Denitrification was not the only

  9. The interaction effect of mixing starter cultures on homemade natural yogurt’s pH and viscosity

    Directory of Open Access Journals (Sweden)

    Hadi A. Dahlan

    2017-10-01

    Full Text Available Dairy yogurts are common food products consumed by people all over the world. Due to the simple process, many people have made their own natural yogurt at home. The fermentation due to the starter culture causes the textural properties of dairy yogurt. However, the literature is surprisingly scarce on the topic of starter culture interactions in the development of textural properties of dairy yogurt. This study investigated the interaction effect of three common starter cultures, Lactobacillus acidophilus, Lactobacillus bulgaricus and Streptococcus thermophiles, on the viscosity of homemade yogurt. Using Design Expert software, a 10-run mixture model experiment was designed to examine the textural properties developed by single or multiple inoculation of these starter cultures. All yogurt formulations reached the isoelectric point of milk and had pHs in the range 3.97 to 4.32. Yogurt formulations with L. acidophilus and S. thermophilus resulted in viscosities which were similar to commercial yogurt viscosity (1.77 Pa.s, while L. bulgaricus resulted in yogurt with a lower viscosity. Based on the mixture model, L. acidophilus had most influence on the yogurt viscosity, followed by S. thermophilus and L. bulgaricus. In conclusion, L. acidophilus can be used as a single starter culture or combined with other starter cultures to develop high viscosity homemade yogurt. A Combination of S. thermophilus and L. acidphilus can also be used to develop high viscosity yogurts. However, L. bulgaricus should not be inoculated alone or become a dominant ratio in multiple starter culture inoculation as it will decrease the overall homemade yogurt viscosity.

  10. The effect of different milk diets upon strontium-85 absorption in young rats

    International Nuclear Information System (INIS)

    Gruden, N.; Mataushicj, S.

    1988-01-01

    Radiostrontium absorption and distribution in selected tissues was studied in young white rats which were fed, for one or four days, on plain cow's milk or on one of the following experimental diets: yogurt, sour milk, or acidophilus milk. The yogurt diet exhibited a slight, but statistically significant, decreasing effect upon radiostrontium deposition in the carcass and femur of neonatals and in the body, carcass, femur and brain of the weanling rats receiving the four day treatment. There was an inhibitory effect on strontium deposition in the weanling's brain to sour milk, and none to acidophilus milk. (author). 12 refs.; 1 tab

  11. A Decade of Experience in Primary Prevention of Clostridium difficile Infection at a Community Hospital Using the Probiotic Combination Lactobacillus acidophilus CL1285, Lactobacillus casei LBC80R, and Lactobacillus rhamnosus CLR2 (Bio-K+).

    Science.gov (United States)

    Maziade, Pierre-Jean; Pereira, Pascale; Goldstein, Ellie J C

    2015-05-15

    In August 2003, the 284-bed community hospital Pierre-Le Gardeur (PLGH) in Quebec experienced a major outbreak associated with the Clostridium difficile NAP1/027/BI strain. Augmented standard preventive measures (SPMs) were not able to control this outbreak. It was decided in February 2004 to give to every adult inpatient on antibiotics, without any exclusion, a probiotic (Bio-K+: Lactobacillus acidophilus CL1285, Lactobacillus casei LBC80R, and Lactobacillus rhamnosus CLR2) within 12 hours of the antibiotic prescription. Augmented SPMs were continued. The use of the probiotic in addition to SPMs was associated with a marked reduction of C. difficile infection (CDI). During the 10 years of observation, 44 835 inpatients received Bio-K+, and the CDI rate at PLGH declined from 18.0 cases per 10,000 patient-days and remained at low mean levels of 2.3 cases per 10,000 patient-days. Additionally, 10-year data collected by the Ministry of Health in Quebec comparing the CDI rate between Quebec hospitals showed that CDI rates at PLGH were consistently and continuously lower compared with those at similar hospitals. Blood cultures were monitored at PLGH for Lactobacillus bacteremia through the 10 years' experience, and no Lactobacillus bacteremias were detected. Despite the limitation of an observational study, we concluded that the probiotic Bio-K+ was safe and effective in decreasing our primary CDI rate. © The Author 2015. Published by Oxford University Press on behalf of the Infectious Diseases Society of America. All rights reserved. For Permissions, please e-mail: journals.permissions@oup.com.

  12. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... acidophilus NCFM] ... Length = 285 ... Query: 1 ... MIKLVACDLDGTLFNSEMTVSKVNAQAVKNAQENGIEFLIAT...GRAPRESRSILKDADLHT 60 ... MIKLVACDLDGTLFNSEMTVSKVNAQAVKNAQENGIEFLIATGRAPRE...SRSILKDADLHT Sbjct: 1 ... MIKLVACDLDGTLFNSEMTVSKVNAQAVKNAQENGIEFLIATGRAPRESRSILKDADLHT 60 ... Query: 121 NVAHLMVD

  13. Role of probiotics in the prevention and treatment of meticillin-resistant Staphylococcus aureus infections.

    Science.gov (United States)

    Sikorska, Hanna; Smoragiewicz, Wanda

    2013-12-01

    Meticillin-resistant Staphylococcus aureus (MRSA) is a multidrug-resistant micro-organism and is the principal nosocomial pathogen worldwide. Following initial in vitro experiments demonstrating that Lactobacillus acidophilus CL1285(®) and Lactobacillus casei LBC80R(®) commercial strains exhibit antibacterial activity against clinical MRSA isolates, we conducted a literature search to find any evidence of probiotic efficacy in decolonisation or treatment of S. aureus infection. As summarised below, many strains of lactobacilli and bifidobacteria isolated from a variety of sources inhibited the growth of S. aureus and clinical isolates of MRSA in vitro. The most active strains were Lactobacillus reuteri, Lactobacillus rhamnosus GG, Propionibacterium freudenreichii, Propionibacterium acnes, Lactobacillus paracasei, L. acidophilus, L. casei, Lactobacillus plantarum, Lactobacillus bulgaricus, Lactobacillus fermentum and Lactococcus lactis. Their effects were mediated both by direct cell competitive exclusion as well as production of acids or bacteriocin-like inhibitors. L. acidophilus also inhibited S. aureus biofilm formation and lipase production. In vitro antimicrobial activity did not necessarily assure efficacy in vivo in animal infectious models, e.g. S. aureus 8325-4 was most sensitive in vitro to L. acidophilus, whilst in vivo Bifidobacterium bifidum best inhibited experimental intravaginal staphylococcosis in mice. On the other hand, L. plantarum, which showed the highest inhibition activity against S. aureus in vitro, was also very effective topically in preventing skin wound infection with S. aureus in mice. Very few clinical data were found on the interactions between probiotics and MRSA, but the few identified clinical cases pointed to the feasibility of elimination or reduction of MRSA colonisation with probiotic use. Copyright © 2013 Elsevier B.V. and the International Society of Chemotherapy. All rights reserved.

  14. Anti-Inflammatory Activity of Lactobacillus on Carrageenan-Induced Paw Edema in Male Wistar Rats

    Directory of Open Access Journals (Sweden)

    Sarika Amdekar

    2012-01-01

    Full Text Available Introduction. Lactobacillus casei and Lactobacillus acidophilus were used to assess the anti-inflammatory properties in carrageenan induced acute inflammatory model. Materials and Methods. Diclofenac sodium was used as standard drug at concentration of 150 mg/kg of body weight. Culture of Lactobacillus  2×107 CFU/ml was given orally. Edema was induced with 1% carrageenan to all the groups after one hour of the oral treatments. Paw thickness was checked at =1, 2, 3, 4, 5, and 24 hours. Stair climbing score and motility score were assessed at =24 hours. Cytokines assay for IL-6, IL-10, and TNF-α was performed on serum samples. Results. Lactobacillus showed a statistically significant decrease in paw thickness at <0.001. L. acidophilus and L. casei decreased by 32% and 28% in paw thickness. They both significantly increased the stair climbing and motility score. Lactobacillus treatment significantly downregulated IL-6 and TNF-α while upregulated IL-10 at <0.0001. Conclusion. L. casei and L. acidophilus significantly decreased the inflammatory reactions induced by carrageenan. This study has also proposed that Lactobacillus ameliorated the inflammatory reaction by downregulating the proinflammatory cytokines pathway.

  15. Physicochemical Characteristics and Antioxidant Capacity in Yogurt Fortified with Red Ginseng Extract

    Science.gov (United States)

    Jung, Jieun; Paik, Hyun-Dong; Yoon, Hyun Joo; Jang, Hye Ji; Jeewanthi, Renda Kankanamge Chaturika; Jee, Hee-Sook; Lee, Na-Kyoung

    2016-01-01

    The objective of this study was to investigate characteristics and functionality of yogurt applied red ginseng extract. Yogurts added with red ginseng extract (0.5, 1, 1.5, and 2%) were produced using Lactobacillus acidophilus and Streptococcus thermophilus and stored at refrigerated temperature. During fermentation, pH was decreased whereas titratable aicidity and viable cell counts of L. acidophilus and S. thermophilus were increased. The composition of yogurt samples was measured on day 1, an increase of red ginseng extract content in yogurt resulted in an increase in lactose, protein, total solids, and ash content, whereas fat and moisture content decreased. The pH value and cell counts of L. acidophilus and S. thermophilus were declined, however titratable acidity was increased during storage period. The antioxidant capacity was measured as diverse methods. During refrigerated storage time, the value of antioxidant effect was decreased, however, yogurt fortified with red ginseng extract had higher capacity than plain yogurt. The antioxidant effect was improved in proportion to concentration of red ginseng extract. These data suggests that red ginseng extract could affect to reduce fermentation time of yogurt and enhance antioxidant capacity. PMID:27433113

  16. Physicochemical Characteristics and Antioxidant Capacity in Yogurt Fortified with Red Ginseng Extract.

    Science.gov (United States)

    Jung, Jieun; Paik, Hyun-Dong; Yoon, Hyun Joo; Jang, Hye Ji; Jeewanthi, Renda Kankanamge Chaturika; Jee, Hee-Sook; Li, Xiang; Lee, Na-Kyoung; Lee, Si-Kyung

    2016-01-01

    The objective of this study was to investigate characteristics and functionality of yogurt applied red ginseng extract. Yogurts added with red ginseng extract (0.5, 1, 1.5, and 2%) were produced using Lactobacillus acidophilus and Streptococcus thermophilus and stored at refrigerated temperature. During fermentation, pH was decreased whereas titratable aicidity and viable cell counts of L. acidophilus and S. thermophilus were increased. The composition of yogurt samples was measured on day 1, an increase of red ginseng extract content in yogurt resulted in an increase in lactose, protein, total solids, and ash content, whereas fat and moisture content decreased. The pH value and cell counts of L. acidophilus and S. thermophilus were declined, however titratable acidity was increased during storage period. The antioxidant capacity was measured as diverse methods. During refrigerated storage time, the value of antioxidant effect was decreased, however, yogurt fortified with red ginseng extract had higher capacity than plain yogurt. The antioxidant effect was improved in proportion to concentration of red ginseng extract. These data suggests that red ginseng extract could affect to reduce fermentation time of yogurt and enhance antioxidant capacity.

  17. Inhibition of initial adhesion of uropathogenic Enterococcus faecalis by biosurfactants from Lactobacillus isolates.

    Science.gov (United States)

    Velraeds, M M; van der Mei, H C; Reid, G; Busscher, H J

    1996-06-01

    In this study, 15 Lactobacillus isolates were found to produce biosurfactants in the mid-exponential and stationary growth phases. The stationary-phase biosurfactants from lactobacillus casei subsp. rhamnosus 36 and ATCC 7469, Lactobacillus fermentum B54, and Lactobacillus acidophilus RC14 were investigated further to determine their capacity to inhibit the initial adhesion of uropathogenic Enterococcus faecalis 1131 to glass in a parallel-plate flow chamber. The initial deposition rate of E. faecalis to glass with an adsorbed biosurfactant layer from L. acidophilus RC14 or L. fermentum B54 was significantly decreased by approximately 70%, while the number of adhering enterococci after 4 h of adhesion was reduced by an average of 77%. The surface activity of the biosurfactants and their activity inhibiting the initial adhesion of E. faecalis 1131 were retained after dialysis (molecular weight cutoff, 6,000 to 8,000) and freeze-drying. Fourier transform infrared spectroscopy and X-ray photoelectron spectroscopy revealed that the freeze-dried biosurfactants from L. acidophilus RC14 and L. fermentum B54 were richest in protein, while those from L. casei subsp. rhamnosus 36 and ATCC 7469 had relatively high polysaccharide and phosphate contents.

  18. Possibility of the production of probiotic chocolate yogurt

    Directory of Open Access Journals (Sweden)

    M. Sharifi Soltani

    2016-08-01

    Full Text Available The aim of study was to produce a low-fat cacao containing probiotic yogurt. For this reason a combination of probiotic bacteria, lactobacillus acidophilus and Bifidobacterium lactis (3% w/w together with 0.8% cacao powder, 5% sugar as a well as 1.2% cacao powder with 7% sugar were used to produce a synbiotic yogurt (0.5% and 1.5% fat. Populations of probiotics bacteria, physiochemical and sensory properties of the yogurt samples were evaluated throughout the storage period (1, 7, 14, and 21 days. Result showed that cacao as prebiotic could significantly increase the viability of L. acidophilus (P

  19. Antibacterial activity of garlic and lime on isolates of extracted ...

    African Journals Online (AJOL)

    ) on seven bacterial species (Streptococcus mutans, Lactobacillus acidophilus, Norcadia asteroides, Pseudomonas aeruginosa, Actinomyces viscosus, Staphylococcus aureus and Veillonella alcaligens) isolated from 240 extracted, carious ...

  20. Research of influence of ultrasound treatment in various liquid media on the surface microflora of semifinished meat

    Directory of Open Access Journals (Sweden)

    D. Maul

    2017-01-01

    Full Text Available In order to prevent microbial spoilage, meat and meat products could be treatedusing different types of processing. However, these methods do not ensures sterilization and can cause decrease of nutrition and biological value of food product. In this regardstudying of the innovative methods, that guaranteeing consumers safe and minimally-processed foods, is particularly relevant. The addition of lactic acid bacteria and ultrasound (US treatment have great potential in this direction.Thesurfacemicroflorainvestigations of semifinished meat products were carried out in order to state the positive influence on their microbiological stability by US treatment in different types of medium. Experiments included the study of antagonistic activity of bacteria strains of the genus Lactobacillus acidophilus(L. acidophilus in relation to typical microflora representatives of chilled meat semi-finished products. Basing on these experiments the strain 7m13 of L. acidophilus with the highest inhibitory activity was chosen. The lowest inhibitory activity was found for strain 5e. The parameters of ultrasonic treatment was established as follows: installed capacity of the treatment 350 Wt with the exposure time 2 minutes, avoiding undesired denaturation changes of muscle proteins. The handling of check samples included the following variants: control (without treatment; sample 1 – treatment in distilled water; sample 2 – treatment in milk whey; sample 3 – treatment in fermented milk whey. As the result of experiments it was found, that the strain 7m13 of L.acidophilus showed the highest antagonistic activity against used test cultures of bacteria. The quantitative and qualitative composition of the surface microflora of the check samples is not constant; coccal forms are less sensitive for ultrasound treatment in comparison with bacilli and yeast cells. The minimal surface microbial population was shown using the combination of fermented milk whey and

  1. Identification of Lactobacillus UFV H2b20 (probiotic strain using DNA-DNA hybridization Identificação de Lactobacillus UFV H2b20 (linhagem probiótica através de hibridização DNA-DNA

    Directory of Open Access Journals (Sweden)

    J.T. de Magalhães

    2008-09-01

    Full Text Available Sequence analyses of the 16S rDNA gene and DNA-DNA hybridization tests were performed for identification of the species of the probiotic Lactobacillus UFV H2b20 strain. Using these two tests, we concluded that this strain, originally considered Lact. acidophilus, should be classified as Lact. delbrueckii.Análise da seqüência do gene 16S rDNA e ensaios de hibridização DNA_DNA foram empregados para identificar a espécie da cepa probiótica Lactobacillus UFV H2b20. Empregando-se estes dois testes, concluímos que esta cepa, originalmente considerada Lact. acidophilus, deve ser classificada como Lact. delbrueckii.

  2. ORF Alignment: NC_006814 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... acidophilus NCFM] ... Length = 128 ... Query: 1 ... MVAIAFYSITGQTERFIDKIQLKAHQISDANPKYDMGQKYILIV...PSYQDFMMDSVVDFLT 60 ... MVAIAFYSITGQTERFIDKIQLKAHQISDANPKYDMGQKYILIVPSYQDF...MMDSVVDFLT Sbjct: 1 ... MVAIAFYSITGQTERFIDKIQLKAHQISDANPKYDMGQKYILIVPSYQDFMMDSVVDFLT 60 ... Query: 121 LSAGQSTK 128 ... LSAGQSTK Sbjct: 121 LSAGQSTK 128

  3. STUDY OF THE EFFECTS SHOWN BY THE ACTION OF VARIOUS MICROORGANISMS ON THE LACTIC FERMENTATION OF JUICES

    Directory of Open Access Journals (Sweden)

    Iuliana Manea

    2010-01-01

    Full Text Available Research has established the most effective lactic acid bacteria used for fermentation of fruit and vegetables juices. The cultures were used for Bifidobacteria, Lactobacillus acidophilus and culture of micro flora obtained spontaneous shoots. Lactic fermented juice was obtained from cabbage, carrots and beetroot. Working in these variants were determined lactic fermentation parameters and some of the bioactive compounds from this process: pH, reducing sugars, viable cell counts. Determination of reducing sugars calculated as glucose was conducted using the 3.5 dinitrosalicilic acid method (DNS method, pH was determined with a pH meter electronics. Chemical parameters listed were determined every two hours during the first 24 hours, then 48 and 72 hours in thermostatic conditions at 37 degrees C and 7 days storage at refrigerator temperature. At the end of the lactic fermentation, the lowest pH 4.31, which also provide juice conservation was obtained using a pure culture of Lactobacillus acidophilus. Reducing sugar is metabolized significantly when the juice of beetroot, fermented with Lactobacillus acidophilus culture, 75.19%. The results may be an argument for obtaining juice fermented lactic acid, which are popular functional foods, to obtain a chemical composition and sensory their optimum.

  4. Essential Oils from Ugandan Aromatic Medicinal Plants: Chemical Composition and Growth Inhibitory Effects on Oral Pathogens

    Directory of Open Access Journals (Sweden)

    Francis Ocheng

    2015-01-01

    Full Text Available The study assessed the growth inhibitory effects of essential oils extracted from ten Ugandan medicinal plants (Bidens pilosa, Helichrysum odoratissimum, Vernonia amygdalina, Hoslundia opposita, Ocimum gratissimum, Cymbopogon citratus, Cymbopogon nardus, Teclea nobilis, Zanthoxylum chalybeum, and Lantana trifolia used traditionally in the management of oral diseases against oral pathogens. Chemical compositions of the oils were explored by GC-MS. Inhibitory effects of the oils were assessed on periodontopathic Porphyromonas gingivalis and Aggregatibacter actinomycetemcomitans and cariogenic Streptococcus mutans and Lactobacillus acidophilus using broth dilution methods at concentrations of 1%, 0.1%, and 0.01%. The most sensitive organism was A. actinomycetemcomitans. Its growth was markedly inhibited by six of the oils at all the concentrations tested. Essential oil from C. nardus exhibited the highest activity with complete growth inhibition of A. actinomycetemcomitans and P. gingivalis at all the three concentrations tested, the major constituents in the oil being mainly oxygenated sesquiterpenes. Most of the oils exhibited limited effects on L. acidophilus. We conclude that essential oils from the studied plants show marked growth inhibitory effects on periodontopathic A. actinomycetemcomitans and P. gingivalis, moderate effects on cariogenic S. mutans, and the least effect on L. acidophilus. The present study constitutes a basis for further investigations and development of certain oils into alternative antiplaque agents.

  5. Essential Oils from Ugandan Aromatic Medicinal Plants: Chemical Composition and Growth Inhibitory Effects on Oral Pathogens

    Science.gov (United States)

    Ocheng, Francis; Bwanga, Freddie; Joloba, Moses; Softrata, Abier; Azeem, Muhammad; Pütsep, Katrin; Borg-Karlson, Anna-Karin; Obua, Celestino; Gustafsson, Anders

    2015-01-01

    The study assessed the growth inhibitory effects of essential oils extracted from ten Ugandan medicinal plants (Bidens pilosa, Helichrysum odoratissimum, Vernonia amygdalina, Hoslundia opposita, Ocimum gratissimum, Cymbopogon citratus, Cymbopogon nardus, Teclea nobilis, Zanthoxylum chalybeum, and Lantana trifolia) used traditionally in the management of oral diseases against oral pathogens. Chemical compositions of the oils were explored by GC-MS. Inhibitory effects of the oils were assessed on periodontopathic Porphyromonas gingivalis and Aggregatibacter actinomycetemcomitans and cariogenic Streptococcus mutans and Lactobacillus acidophilus using broth dilution methods at concentrations of 1%, 0.1%, and 0.01%. The most sensitive organism was A. actinomycetemcomitans. Its growth was markedly inhibited by six of the oils at all the concentrations tested. Essential oil from C. nardus exhibited the highest activity with complete growth inhibition of A. actinomycetemcomitans and P. gingivalis at all the three concentrations tested, the major constituents in the oil being mainly oxygenated sesquiterpenes. Most of the oils exhibited limited effects on L. acidophilus. We conclude that essential oils from the studied plants show marked growth inhibitory effects on periodontopathic A. actinomycetemcomitans and P. gingivalis, moderate effects on cariogenic S. mutans, and the least effect on L. acidophilus. The present study constitutes a basis for further investigations and development of certain oils into alternative antiplaque agents. PMID:26170872

  6. Evaluation of culture media for selective enumeration of bifidobacteria and lactic acid bacteria

    Directory of Open Access Journals (Sweden)

    Judit Süle

    2014-09-01

    Full Text Available The purpose of this study was to test the suitability of Transgalactosylated oligosaccharides-mupirocin lithium salt (TOS-MUP and MRS-clindamycin-ciprofloxacin (MRS-CC agars, along with several other culture media, for selectively enumerating bifidobacteria and lactic acid bacteria (LAB species commonly used to make fermented milks. Pure culture suspensions of a total of 13 dairy bacteria strains, belonging to eight species and five genera, were tested for growth capability under various incubation conditions. TOS-MUP agar was successfully used for the selective enumeration of both Bifidobacterium animalis subsp. lactis BB-12 and B. breve M-16 V. MRS-CC agar showed relatively good selectivity for Lactobacillus acidophilus, however, it also promoted the growth of Lb. casei strains. For this reason, MRS-CC agar can only be used as a selective medium for the enumeration of Lb. acidophilus if Lb. casei is not present in a product at levels similar to or exceeding those of Lb. acidophilus. Unlike bifidobacteria and coccus-shaped LAB, all the lactobacilli strains involved in this work were found to grow well in MRS pH 5.4 agar incubated under anaerobiosis at 37 °C for 72 h. Therefore, this method proved to be particularly suitable for the selective enumeration of Lactobacillus spp.

  7. Addition of grape pomace extract to probiotic fermented goat milk: the effect on phenolic content, probiotic viability and sensory acceptability.

    Science.gov (United States)

    Dos Santos, Karina Mo; de Oliveira, Isabel C; Lopes, Marcos Ac; Cruz, Ana Paula Gil; Buriti, Flávia Ca; Cabral, Lourdes M

    2017-03-01

    Grape pomace is a source of phenolic compounds, which are associated with health benefits in humans. Additionally, fermented dairy foods with probiotics can be good vehicles to deliver these bioactive compounds. The effects of the addition of grape pomace extract (GPE) on the total phenolic (TP) content, physico-chemical characteristics and viability of Lactobacillus acidophilus LA-5 or Lactobacillus rhamnosus HN001 in fermented goat milks prepared with grape juice were investigated. The TP concentration increased significantly in fermented milks with the addition of GPE. A protective effect of GPE on the viability of L. acidophilus was observed. However, after 14 days of storage, the populations of L. acidophilus were significantly lower when compared with those of L. rhamnosus, and only the last probiotic maintained its viability above 7 log CFU mL -1 throughout the period investigated. The sensory scores of flavor, color and overall acceptability of the fermented milk containing L. rhamnosus HN001 were significantly increased when GPE was added. The use of GPE might increase the functionality of probiotic fermented goat milk processed with L. rhamnosus HN001 and grape juice because grape polyphenols are known for their antioxidant properties and positive effect on the modulation of gut microbiota. © 2016 Society of Chemical Industry. © 2016 Society of Chemical Industry.

  8. Glucose and D-Allulose contained medium to support the growth of lactic acid bacteria

    Science.gov (United States)

    Al-Baarri, A. N.; Legowo, A. M.; Pramono, Y. B.; Sari, D. I.; Pangestika, W.

    2018-01-01

    Monosaccharide has been known as support agent for the growth of lactic acid bacteria. However the combination among monosaccharides for supporting the living of bacteria has not been understood well. This research was done for analyzing the combination glucose and D-allulose for the growth of Lactobacillus acidophilus and Streptococcus thermophillus. The NaCl medium containing glucose and D-allulose was used to analyse the growth of bacteria. The study showed that glucose and D-allulose have been detected as supportive agent to L. acidophilus and S. thermophillus specifically. As conclusion, glucose and D-allulose supported the growth of lactic acid bacteria equally. This finding might provide the beneficial information for industry to utilize D-allulose as well as glucose.

  9. S-layer proteins from Lactobacillus sp. inhibit bacterial infection by blockage of DC-SIGN cell receptor.

    Science.gov (United States)

    Prado Acosta, Mariano; Ruzal, Sandra M; Cordo, Sandra M

    2016-11-01

    Many species of Lactobacillus sp. possess Surface(s) layer proteins in their envelope. Among other important characteristics S-layer from Lactobacillus acidophilus binds to the cellular receptor DC-SIGN (Dendritic Cell-Specific Intercellular adhesion molecule-3-Grabbing Non-integrin; CD209), which is involved in adhesion and infection of several families of bacteria. In this report we investigate the activity of new S-layer proteins from the Lactobacillus family (Lactobacillus acidophilus, Lactobacillus brevis, Lactobacillus helveticus and Lactobacillus kefiri) over the infection of representative microorganisms important to human health. After the treatment of DC-SIGN expressing cells with these proteins, we were able to diminish bacterial infection by up to 79% in both gram negative and mycobacterial models. We discovered that pre-treatment of the bacteria with S-layers from Lactobacillus acidophilus and Lactobacillus brevis reduced bacteria viability but also prevent infection by the pathogenic bacteria. We also proved the importance of the glycosylation of the S-layer from Lactobacillus kefiri in the binding to the receptor and thus inhibition of infection. This novel characteristic of the S-layers proteins may contribute to the already reported pathogen exclusion activity for these Lactobacillus probiotic strains; and might be also considered as a novel enzymatic antimicrobial agents to inhibit bacterial infection and entry to host cells. Copyright © 2016 Elsevier B.V. All rights reserved.

  10. Application of novel starter cultures for sourdough bread production.

    Science.gov (United States)

    Plessas, S; Alexopoulos, A; Mantzourani, I; Koutinas, A; Voidarou, C; Stavropoulou, E; Bezirtzoglou, E

    2011-12-01

    Sourdough application has been extensively increased in the last years due to the consumers demand for food consumption without the addition of chemical preservatives. Several starter cultures have been applied in sourdough bread making targeting the increase of bread self-life and the improvement of sensorial character. More specific, Lactobacillus acidophilus and Lactobacillus sakei as single and mixed cultures were used for sourdough bread making. Various sourdough breads were produced with the addition of sourdough perviously prepared with 10% w/w L. acidophilus, 10% w/w L. sakei and 5% w/w L. acidophilus and 5% w/w L. sakei at the same time. Various chemical parameters were determined such as lactic acid, total titratable acidity and pH. The results revealed that the produced sourdough bread made with sourdough containing the mixed culture was preserved for more days (12 days) than all the other breads produced in the frame of this study, since it contained lactic acid in higher concentrations. The respective total titratable acidity varied between 10.5 and 11 ml NaOH N/10. The same sourdough bread had a firmer texture, better aroma, flavor and overall quality compared to other sourdough breads examined in this study, as shown by sensory evaluation tests and results obtained through SPME GC-MS analysis, which revealed significant differences among the different bread types. Copyright © 2011 Elsevier Ltd. All rights reserved.

  11. Hypolipidemic effects of lactic acid bacteria fermented cereal in rats

    Directory of Open Access Journals (Sweden)

    Banjoko Immaculata

    2012-12-01

    Full Text Available Abstract Background The objectives of the present study were to investigate the efficacy of the mixed culture of Lactobacillus acidophilus (DSM 20242, Bifidobacterium bifidum (DSM 20082 and Lactobacillus helveticus (CK60 in the fermentation of maize and the evaluation of the effect of the fermented meal on the lipid profile of rats. Methods Rats were randomly assigned to 3 groups and each group placed on a Diet A (high fat diet into which a maize meal fermented with a mixed culture of Lb acidophilus (DSM 20242, B bifidum (DSM 20082 and Lb helveticus (CK 60 was incorporated, B (unfermented high fat diet or C (commercial rat chow respectively after the first group of 7 rats randomly selected were sacrificed to obtain the baseline data. Thereafter 7 rats each from the experimental and control groups were sacrificed weekly for 4 weeks and the plasma, erythrocytes, lipoproteins and organs of the rats were assessed for cholesterol, triglyceride and phospholipids. Results Our results revealed that the mixed culture of Lb acidophilus (DSM 20242, B bifidum (DSM 20082 and Lb helveticus (CK 60 were able to grow and ferment maize meal into ‘ogi’ of acceptable flavour. In addition to plasma and hepatic hypercholesterolemia and hypertriglyceridemia, phospholipidosis in plasma, as well as cholesterogenesis, triglyceride constipation and phospholipidosis in extra-hepatic tissues characterized the consumption of unfermented hyperlipidemic diets. However, feeding the animals with the fermented maize diet reversed the dyslipidemia. Conclusion The findings of this study indicate that consumption of mixed culture lactic acid bacteria (Lb acidophilus (DSM 20242, Bifidobacterium bifidum (DSM 20082 and Lb helveticus (CK 60 fermented food results in the inhibition of fat absorption. It also inhibits the activity of HMG CoA reductase. This inhibition may be by feedback inhibition or repression of the transcription of the gene encoding the enzyme via activation of the

  12. Effect of green banana pulp on physicochemical and sensory properties of probiotic yoghurt

    Directory of Open Access Journals (Sweden)

    Elizabete Lourenço da COSTA

    Full Text Available Abstract In order to investigate the potential of the green banana as a prebiotic, and for its content of resistant starch, fermented yogurts were produced by cultures composed of Lactobacillus delbrueckii, Streptococcus thermophilus, Bifidobacterium bifidum and Lactobacillus acidophilus as well as being enriched with three concentrations of industrialized green banana pulp (GBP (3%, 5% and 10% w/v. The green banana pulp added to the yogurt stimulated the multiplication of L. acidophilus after the first day of fermentation and B. bifidum after seven days in cold storage compared to the control that consisted of yogurt without the addition of green banana pulp. The dose-response effect was not observed; however, the results show that the green banana pulp has a prebiotic potential without interfering with either the physicochemical or sensorial characteristics.

  13. Identificação bioquímica e molecular de Lactobacillus spp. isolados do íleo de frangos de corte tratados ou não com antimicrobianos Biochemical and molecular characterization of Lactobacillus spp. isolated from the ileum of broilers treated with or without antimicrobials

    Directory of Open Access Journals (Sweden)

    Surama Freitas Zanini

    2012-09-01

    Full Text Available Objetivou-se caracterizar bioquimicamente e molecularmente as espécies de Lactobacillus spp. isoladas do íleo de frangos de corte tratados ou não com antimicrobianos. Utilizou-se 400 pintos de corte alojados em 25 boxes de 2m² (16 aves/boxe, distribuídos em um delineamento inteiramente casualizado, em grupos de cinco tratamentos e cinco repetições: dieta sem promotor de crescimento; dieta com promotor de crescimento; dieta com 0,4% de óleo de aroeira-vermelha (OAV; dieta com 200mg de vitamina E kg-1; dieta com 0,4% OAV e 200mg de vitamina E kg-1. Após a caracterização fenotípica do gênero Lactobacillus, foram identificadas, em ambas as metodologias, 100 amostras de Lactobacillus spp. sendo 20 amostras por tratamento. Os resultados bioquímicos identificaram L. acidophilus, L. fermentum, L. plantarum, L. delbrueckii subsp. delbrueckii além de Lactococcus lactis subp. lactis. Para as amostras padrão ATCC, a identificação bioquímica suscitou algumas dúvidas em relação aos seus resultados. Os resultados da identificação molecular mostraram que os Lactobacillus que amplificaram ambos os iniciadores (LU-1'/ Lac-2 e (Laci-1 / 23-10C são os da espécie L. acidophilus. As amostras que amplificaram apenas com o iniciador (LU-1'/ Lac-2 tratam-se das demais espécies que compõe o grupo L. acidophilus. Já as amostras com o iniciador L. fermentum (Fer 3/Fer 4 amplificaram um fragmento de 192pb padrão para essa espécie. Conclui-se que a identificação das espécies de Lactobacillus spp. isoladas do íleo a partir da PCR apresentou-se mais sensível que o método bioquímico.This study aimed to characterize biochemically and molecular species of Lactobacillus spp. isolated from the ileum of broiler chickens treated with or without antimicrobial. A total of 400 day-old male chicks, Cobb, distributed in a randomized design in groups of five treatments and five replicates: diet without antimicrobials; diet with antimicrobials; diet

  14. Influence of starter culture of lactic acid bacteria on the shelf life of ...

    African Journals Online (AJOL)

    A total of eight lactic acid bacteria were isolated from various fermented cereal gruels (ogi). They were identified as Lactobacillus plantarum, Lactobacillus casei, Leuconostoc mesenteroides, Lactobacillus brevis, Lactobacillus fermentum, Lactobacillus delbrueckii, Lactobacillus acidophilus and Pediococcus acidilactici.

  15. Is Bifidobacterium breve effective in the treatment of childhood constipation? Results from a pilot study

    NARCIS (Netherlands)

    Tabbers, M. M.; de Milliano, I.; Roseboom, M. G.; Benninga, M. A.

    2011-01-01

    Probiotics are increasingly used in the treatment of functional gastrointestinal disorders. Studies in constipated adults with a Bifidus yoghurt (containing Bifidobacterium breve, Bifidobacterium bifidum and Lactobacillus acidophilus) showed a significant increase in defecation frequency. The aim of

  16. Conserved S-Layer-Associated Proteins Revealed by Exoproteomic Survey of S-Layer-Forming Lactobacilli

    Science.gov (United States)

    Johnson, Brant R.; Hymes, Jeffrey; Sanozky-Dawes, Rosemary; Henriksen, Emily DeCrescenzo

    2015-01-01

    The Lactobacillus acidophilus homology group comprises Gram-positive species that include L. acidophilus, L. helveticus, L. crispatus, L. amylovorus, L. gallinarum, L. delbrueckii subsp. bulgaricus, L. gasseri, and L. johnsonii. While these bacteria are closely related, they have varied ecological lifestyles as dairy and food fermenters, allochthonous probiotics, or autochthonous commensals of the host gastrointestinal tract. Bacterial cell surface components play a critical role in the molecular dialogue between bacteria and interaction signaling with the intestinal mucosa. Notably, the L. acidophilus complex is distinguished in two clades by the presence or absence of S-layers, which are semiporous crystalline arrays of self-assembling proteinaceous subunits found as the outermost layer of the bacterial cell wall. In this study, S-layer-associated proteins (SLAPs) in the exoproteomes of various S-layer-forming Lactobacillus species were proteomically identified, genomically compared, and transcriptionally analyzed. Four gene regions encoding six putative SLAPs were conserved in the S-layer-forming Lactobacillus species but not identified in the extracts of the closely related progenitor, L. delbrueckii subsp. bulgaricus, which does not produce an S-layer. Therefore, the presence or absence of an S-layer has a clear impact on the exoproteomic composition of Lactobacillus species. This proteomic complexity and differences in the cell surface properties between S-layer- and non-S-layer-forming lactobacilli reveal the potential for SLAPs to mediate intimate probiotic interactions and signaling with the host intestinal mucosa. PMID:26475115

  17. Lactobacillus rhamnosus R11 consumed in a food supplement survived human digestive transit without modifying microbiota equilibrium as assessed by real-time polymerase chain reaction.

    Science.gov (United States)

    Firmesse, Olivier; Mogenet, Agnès; Bresson, Jean-Louis; Corthier, Gérard; Furet, Jean-Pierre

    2008-01-01

    The aim of this study was to evaluate the survival of Lactobacillus rhamnosus R11 and Lactobacillus acidophilus R52 in the human digestive tract and their effects on the microbiota homeostasis. We designed an open human trial including 14 healthy volunteers. A 3-week exclusion period of fermented products was followed by a 12-day consumption period of 4 capsules daily containing 2 x 10(9)L. rhamnosus R11 and 1 x 10(8)L. acidophilus R52, and a 12-day wash-out period. The 2 strains and dominant bacterial groups of the microbiota were quantified by real-time polymerase chain reaction. At the end of the capsule consumption period, high levels of L. rhamnosus R11 were detected in faecal samples from all volunteers, reaching a mean value of 7.1 log(10) colony-forming unit (CFU) equivalents/g of stool. L. acidophilus R52 was detected in the stools of only 1 volunteer, reaching a maximum level of 6.1 log(10) CFU equivalents/g of stool. Dilution plating enumerations performed in parallel provided less consistent and generally lower levels. No significant effect of capsule consumption was observed on microbiota homeostasis for the dominant faecal populations. Mean values of 8.8, 9.2, 9.9 and 10.6 log(10) CFU equivalents/g of stool were obtained for the Clostridium coccoides, Bifidobacterium sp., Bacteroides sp. and Clostridium leptum groups, respectively.

  18. Enhancing flora balance in the gastrointestinal tract of mice by lactic acid bacteria from Chinese sourdough and enzyme activities indicative of metabolism of protein, fat, and carbohydrate by the flora.

    Science.gov (United States)

    Yang, Dong; Yu, Xiaomin; Wu, Yaoping; Chen, Xingxing; Wei, Hua; Shah, Nagendra P; Xu, Feng

    2016-10-01

    In this study, we investigated the effect of administration of 5 strains of lactic acid bacteria (LAB) isolated from traditional Chinese sourdough on the flora balance of gastrointestinal tract of mice. We specifically measured Enterococcus, Enterobacter, Bacteroides, and Lactobacillus by plate count and real-time PCR methods, and α-glucosidase, lactate dehydrogenase, esterase, and aminopeptidase activities as indicative of metabolism of sugar, fat, and protein from LAB isolated from feces of mice in vitro. The results showed that administration of Lactobacillus acidophilus LAC0201 and Lactobacillus fermentum LFE0302 lowered the uricacid index of serum. Lactobacillus acidophilus LAC0201, L. fermentum LFE0302, as well as Lactobacillus curvatus LCU0401 administration resulted in a reduction in the opportunistic pathogens (i.e., Enterococcus and Enterobacter), meanwhile, administration of L. fermentum LFE0302 and Lactobacillus sp. ULA0104 resulted in an increase in the counts of Lactobacillus. Lactobacillus fermentum LFE0302 administration increased starch digestion of intestinal flora after 4wk of feeding and also resulted in increased α-glucosidase activity in the intestinal flora after 3wk of feeding. We found a similar trend in esterase activity after administration of L. acidophilus LAC0201 for 3wk. Hence, our study suggested that LAB from Chinese sourdough might be used as potential probiotics to strengthen the flora balance in gastrointestinal tract and positively change the metabolism of nutrients through bacterial enzyme activities. Copyright © 2016 American Dairy Science Association. Published by Elsevier Inc. All rights reserved.

  19. Effect of probiotic mixture on some haematological parametres in ...

    African Journals Online (AJOL)

    ml in 1ml normal saline together with daily administration of a mixture of probiotics (Lactobacillus acidophilus, Bacillus pumilus, Bacillus subtilis and Bacillus licheniformis) at 4.5 x10 CFU/ml, Group C: lambs were administered only viable STEC ...

  20. Protection of probiotic bacteria in a synbiotic matrix following aerobic storage at 4 deg C

    Science.gov (United States)

    The survival of single strains of Bifidobacterium breve, Bifidobacterium longum, Lactobacillus acidophilus, and Lactobacillus reuteri was investigated in synbiotics that included 10 mg/mL of fructo-oligosaccharides, inulin and pectic-oligosaccharides in an alginate matrix under refrigerated (4 C) ae...

  1. The Pathogenesis and Therapy of Combined Radiation Injury

    National Research Council Canada - National Science Library

    Boudagov, R. S; Oulianova, L. P; Tsyb, A. F

    2006-01-01

    .... On the other hand, heat-killed Lactobacillus acidophilus demonstrated a weak effect on cytokine response, did not improve severe hematological disorders, but none the less increased 30 days survival in mice up to 100%, versus 50% in the untreated group.

  2. Extensive horizontal transfer of core genome genes between two Lactobacillus species found in the gastrointestinal tract

    Directory of Open Access Journals (Sweden)

    Maguin Emmanuelle

    2007-08-01

    Full Text Available Abstract Background While genes that are conserved between related bacterial species are usually thought to have evolved along with the species, phylogenetic trees reconstructed for individual genes may contradict this picture and indicate horizontal gene transfer. Individual trees are often not resolved with high confidence, however, and in that case alternative trees are generally not considered as contradicting the species tree, although not confirming it either. Here we conduct an in-depth analysis of 401 protein phylogenetic trees inferred with varying levels of confidence for three lactobacilli from the acidophilus complex. At present the relationship between these bacteria, isolated from environments as diverse as the gastrointestinal tract (Lactobacillus acidophilus and Lactobacillus johnsonii and yogurt (Lactobacillus delbrueckii ssp. bulgaricus, is ambiguous due to contradictory phenotypical and 16S rRNA based classifications. Results Among the 401 phylogenetic trees, those that could be reconstructed with high confidence support the 16S-rRNA tree or one alternative topology in an astonishing 3:2 ratio, while the third possible topology is practically absent. Lowering the confidence threshold for trees to be taken into consideration does not significantly affect this ratio, and therefore suggests that gene transfer may have affected as much as 40% of the core genome genes. Gene function bias suggests that the 16S rRNA phylogeny of the acidophilus complex, which indicates that L. acidophilus and L. delbrueckii ssp. bulgaricus are the closest related of these three species, is correct. A novel approach of comparison of interspecies protein divergence data employed in this study allowed to determine that gene transfer most likely took place between the lineages of the two species found in the gastrointestinal tract. Conclusion This case-study reports an unprecedented level of phylogenetic incongruence, presumably resulting from extensive

  3. In vitro prebiotic effects and quantitative analysis of Bulnesia sarmienti extract

    Directory of Open Access Journals (Sweden)

    Md Ahsanur Reza

    2016-10-01

    Full Text Available Prebiotics are used to influence the growth, colonization, survival, and activity of probiotics, and enhance the innate immunity, thus improving the health status of the host. The survival, growth, and activity of probiotics are often interfered with by intrinsic factors and indigenous microbes in the gastrointestinal tract. In this study, Bulnesia sarmienti aqueous extract (BSAE was evaluated for the growth-promoting activity of different strains of Lactobacillus acidophilus, and a simple, precise, cost-effective high-performance liquid chromatography (HPLC method was developed and validated for the determination of active prebiotic ingredients in the extract. Different strains of L. acidophilus (probiotic were incubated in de Man, Rogosa, and Sharpe (MRS medium with the supplementation of BSAE in a final concentration of 0.0%, 1.0%, and 3.0% (w/v as the sole carbon source. Growth of the probiotics was determined by measuring the pH changes and colony-forming units (CFU/mL using the microdilution method for a period of 24 hours. The HPLC method was designed by optimizing mobile-phase composition, flow rate, column temperature, and detection wavelength. The method was validated according to the requirements of a new method, including accuracy, precision, linearity, limit of detection, limit of quantitation, and specificity. The major prebiotic active ingredients in BSAE were determined using the validated HPLC method. The rapid growth rate of different strains of L. acidophilus was observed in growth media with BSAE, whereas the decline of pH values of cultures varied in different strains of probiotics depending on the time of culture. (+-Catechin and (−-epicatechin were identified on the basis of their retention time, absorbance spectrum, and mass spectrometry fragmentation pattern. The developed method met the limit of all validation parameters. The prebiotic active components, (+-catechin and (−-epicatechin, were quantified as 1.27% and 0

  4. Identification of exopolysaccharides-producing lactic acid bacteria ...

    African Journals Online (AJOL)

    Spacer region between 16S and 23 S rRNA genes of thirteen lactic acid bacteria strains from Burkina Faso fermented milk samples were amplified by the polymerase chain reaction (PCR). Lactobacillus delbrueckii, Lactobacillus acidophilus, Lactobacillus fermentum, Streptococcus thermophilus, Pediococcus spp, ...

  5. Inhibition of initial adhesion of uropathogenic Enterococcus faecalis by biosurfactants from Lactobacillus isolates

    NARCIS (Netherlands)

    Velraeds, MMC; vanderMei, HC; Reid, G; Busscher, HJ

    In this study, 15 Lactobacillus isolates were found to produce biosurfactants in the mid-exponential and stationary growth phases. The stationary-phase biosurfactants from Lactobacillus casei subsp. rhamnosus 36 and ATCC 7469, Lactobacillus fermentum B54, and Lactobacillus acidophilus RC14 were

  6. Physicochemical and biochemical characterization of biosurfactants released by Lactobacillus strains

    NARCIS (Netherlands)

    Velraeds, MMC; vanderMei, HC; Reid, G; Busscher, HJ

    1996-01-01

    Biosurfactants from Lactobacillus casei subsp. rhamnosus 36 and ATCC 7469, Lactobacillus fermentum B54 and Lactobacillus acidophilus RC14 were isolated from bacteria in their mid-exponential (4-5 h) and stationary growth phases (18 h) and physicochemical and biochemical properties of the

  7. Modification of digestive system microbiome of lactating dairy cows by feeding Bovamine: effect on ruminal fermentation

    Science.gov (United States)

    We evaluated the immune modulatory effects as well as effects on productivity of Bovamine® (Lactobacillus acidophilus strain NP51 and Probionibacterium freudenreichii) on the digestive system microbiome of dairy cattle during late lactation (average DIM = 202). To unveil the underlying mechanisms, ...

  8. The examination of parameters for lactic acid fermentation and nutritive value of fermented juice of beetroot, carrot and brewer’s yeast autolysate

    Directory of Open Access Journals (Sweden)

    MILAN MAKSIMOVIC

    2004-09-01

    Full Text Available The conditions for lactic acid fermentation based on a mixture of beetoot juice (Beta vulgaris L. and carrot juice (Daucus carota L. and different content of brewer’s yeast autolysate with Lactobacillus plantarum A112 and with Lactobacillus acidophilus NCDO 1748 has been studied. Both cultures showed good biochemical activity in these mixtures. The production of lactic acid has been stimulated using a higher content of brewer’s yeast autolysate. In these mixtures, L. plantarum A112 showed better growth and lactic acid production than L. acidophilus NCDO 1748. From the data obtained through chemical analyses of the fermented products, it can be seen that the mixture of beetroot and carrot juice and brewer’s yeast autolysate is richer in minerals (Ca, P, Fe and b-carotene than fermented beetroot juice with the same content of brewer’s yeast autolysate.

  9. Effect of Fixed Orthodontic Treatment on Salivary Flow, pH and Microbial Count.

    Science.gov (United States)

    Arab, Sepideh; Nouhzadeh Malekshah, Sepideh; Abouei Mehrizi, Ehsan; Ebrahimi Khanghah, Anita; Naseh, Roya; Imani, Mohammad Moslem

    2016-01-01

    The present study was designed to evaluate the changes in saliva properties and oral microbial flora in patients undergoing fixed orthodontic treatment. Two important saliva properties namely the salivary flow rate and pH as well as oral microbial flora were assessed in 30 orthodontic patients before starting fixed orthodontic treatment and after six, 12 and 18 weeks of treatment. Selective media, Sabouraud dextrose agar, Mitis salivarius agar and Rogosa agar were used for isolation of Candida albicans, Streptococcus mutans and Lactobacillus acidophilus, respectively. Statistical analysis was performed using Friedman and Dunn's tests. Porthodontic treatment, the total colony counts of Candida albicans, Streptococcus mutans and Lactobacillus acidophilus showed a significant increase. The saliva pH decreased during the orthodontic treatment (Porthodontic treatment causes major changes in the saliva properties. The changes in oral microflora and saliva properties show the importance of caries preventive measures during orthodontic treatment.

  10. AI-2 signalling is induced by acidic shock in probiotic strains of Lactobacillus spp

    DEFF Research Database (Denmark)

    Moslehi Jenabian, Saloomeh; Gori, Klaus; Jespersen, Lene

    2009-01-01

    Survival and ability to respond to various environmental stresses such as low pH are important factors for lactobacilli for their function as probiotics. LuxS-mediated quorum sensing mechanism, which is based on the production of universal signal molecule called autoinducer-2 (AI-2), regulates...... important physiological traits and a variety of adaptive processes in different bacteria. The aim of this study was to investigate the effect of acidic stress on LuxS-mediated quorum sensing (AI-2 signalling) in four probiotic strains of different Lactobacillus species. Initially, the production of AI-2...... concomitant with the reduction of pH, reaching maximum at late exponential phase (L. rhamnosus GG) or at stationary phase (L. salivarius UCC118, L. acidophilus NCFM and L. johnsonii NCC533). Acidic shock experiments were conducted on L. rhamnosus GG and L. acidophilus NCFM after exposure to different acidic...

  11. Probiotic/prebiotic correction for adverse effects of iron fortification on intestinal resistance to Salmonella infection in weaning mice.

    Science.gov (United States)

    Lin, Feifei; Wu, Haohao; Zeng, Mingyong; Yu, Guangli; Dong, Shiyuan; Yang, Huicheng

    2018-02-21

    Iron fortification has been associated with a modest increase in diarrhea risk among children. Herein, we investigate the correction for this unwanted side effect with probiotic/prebiotic supplementation in weaning mice. Iron fortification with 250 ppm and 500 ppm ferrous sulfate for 30 days significantly increased the species richness of the mouse gut microbiota compared to controls. The 500 ppm-FeSO 4 diet caused a significantly decreased abundance of potentially beneficial Lactobacillus. During infection with the foodborne pathogen Salmonella enterica serovar Typhimurium (S. Typhimurium), mice on the 500 ppm-FeSO 4 diet showed earlier appearance of poisoning symptoms, higher rates of weight and appetite loss, and lower survival rates, all of which were effectively reversed by supplementation with a probiotic (Lactobacillus acidophilus) or a prebiotic (inulin) for 7 days before infection. Iron fortification with 500 ppm ferrous sulfate also increased fecal shedding and spleen and liver load of viable S. Typhimurium, suggesting its promoting effect on pathogen colonization and translocation, and this negative effect was found to be well corrected by supplementation with Lactobacillus acidophilus or inulin. Light and transmission electron microscopic observation on the ileal villus structure revealed the histopathological impairment of the intestine by iron fortification with both 250 ppm and 500 ppm ferrous sulfate, and the intestinal lesions were markedly alleviated by supplementation with Lactobacillus acidophilus or inulin. These results provide experimental evidence for the increased diarrhea risk upon iron fortification with high pathogen load, and demonstrate that probiotic or prebiotic supplementation can be used to eliminate the potential harm of iron fortification on gut health.

  12. Dadih Susu Sapi Hasil Fermentasi Berbagai Starter Bakteri Probiotik yang Disimpan pada Suhu Rendah: II. Karakteristik Fisik, Organoleptik dan Mikrobiologi

    Directory of Open Access Journals (Sweden)

    E. Taufik

    2005-04-01

    Full Text Available This research was conducted to investigate physical, organoleptical and microbiological characteristics of dadih from cow milk fermented with different combinations of probiotic starter bacteria and stored at low temperature. The concentration of starter used to make dadih was 3% with equal comparison between starters. The combinations of probiotic starter bacteria were (L. plantarum (A1, L. plantarum + L. acidophilus (A2, L. plantarum + B. bifidum (A3 and L. plantarum + L. acidophilus + B. bifidum (A4 and stored at low temperatures (refrigerator for 0, 7 and 14 days. The observed variables were viscosity, total lactic acid bacteria, total Bifidobacterium bifidum and organoleptic properties (color, aroma, taste and firmness. The result showed that combinations of probiotic starter bacteria did not affect significantly (P>0.05 viscosity and total Bificobacterium bifidum of dadih at H-0 (before storage, but affect significantly (P<0.05 total lactic acid bacteria. The characteristics of dadih during 14 days of storage in low temperature showed that combinations of starter did not significantly affect viscosity but storage time affect significantly (P<0.05. Total Bificobacterium bifidum was not affected significantly by either starter combination or storage time.Total lactic acid bacteria was significantly affected (P<0.05 by storage time and very significantly affected (P<0.01 by starter combinations. A4 starter combination (L. plantarum + L. acidophilus + B. bifidum has the most preference modus value for firmness, color, flavor and aroma according to panelist test result. Among those four organoleptic parameters, only aroma was affected significantly by starter combination.

  13. Purification, Characterization and Antibacterial Mechanism of ...

    African Journals Online (AJOL)

    Purpose: To carry out the extraction, purification and biological characterization, and assess the antibacterial activity of bacteriocin from Lactobacillus acidophilus XH1. Methods: Chloroform extraction method was used for bacteriocin extraction while characterization of bacteriocin was carried out by flat-dug well agar ...

  14. Performance of rats orogastrically dosed with faecal strains of ...

    African Journals Online (AJOL)

    Administrator

    strains of Lactobacillus acidophilus and challenged ... Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus .... Chang et al. (2001) reported a similar observation in piglets fed probiotic strain, Lactobacillus reuteri BSA 131. Francisco et al. (1995) had earlier reported that selected ...

  15. Edwardsiellosis in fish: a brief review

    Indian Academy of Sciences (India)

    SEARCHU

    probiotics containing Bacillus subtilis, Lactobacillus acidophilus, Clostridium butyricum and Saccharomyces cerevisiae enhanced the non-specific immune system, slightly improved the survival of tilapia to salinity stress and reduced mortality due to E. tarda infection. Due to variation in the serotypes of E. tarda, a practical.

  16. Repressive efficacy of lactic acid bacteria against the human ...

    African Journals Online (AJOL)

    Different strains of lactic acid bacteria (LAB) namely Lactobacillus acidophilus NCIM 2287, Lactobacillus plantarum NCIM 2085, Lactobacillus helveticus NCIM 2126 and Lactococcus lactis NCIM 2114 were procured from the National Chemical Laboratory (NCL) Pune, India. These LAB cells were individually (107 cfu/ml) ...

  17. Role of intestinal microflora (Lactobacillus Acidophilus) in ...

    African Journals Online (AJOL)

    Fawzia H. Abo Ali

    2012-11-13

    Nov 13, 2012 ... ... University. Production and hosting by Elsevier B.V. All rights reserved. ... metabolism, gut hormone regulation and the gut–brain axis ... ity and thus left far behind as a focus of research. So, the .... Gender no (%). >0.05. Male.

  18. Lactobacillus acidophilus bacteriocin, from production to their ...

    African Journals Online (AJOL)

    USER

    2010-05-17

    May 17, 2010 ... of Science and Technology, Tianjin 300222, P.R. China. ... the fields of food preservation or safety, health care, and pharmaceutical applications. ...... New York. Morin A, Saheb SA, Bisaillon JG, Beaudet R, Sylvestre M (1980). Effect of culture medium composition on inhibition of growth of Neisseria.

  19. Lactobacillus acidophilus bacteriocin, from production to their ...

    African Journals Online (AJOL)

    activities toward closely related bacteria and undesirable harmful microorganisms. They are useful in the fields of food preservation or safety, health care, and pharmaceutical applications. The inhibition activity of these substances has been reported to be strain-dependent. Binding to the epithelial cell on the gastrointestinal ...

  20. In vitro antimicrobial characteristics of bacteriocinproducing ...

    African Journals Online (AJOL)

    A total of 50 bacteriocin-producing Lactobacillus strains isolated from some Nigerian indigenous fermented foods and beverages (ogi, fufu, garri and nono) and characterized as L. acidophilus, L. casei, L. fermentum, L. lactis and L. plantarum were screened for their inhibitory potentials against food-borne pathogenic ...

  1. 2018-04-23T14:19:08Z https://www.ajol.info/index.php/all/oai oai:ojs ...

    African Journals Online (AJOL)

    Algeria Lactic acid bacteria; Bifidobacterium; probiotic; fermented milk, growth; survival Gastrointestinal microflora exerts a high impact on its host mainly by ... pH 8. the B. breve strain support the conservation conditions in pure culture better than in mixed culture with Streptococcus thermophilus or Lactobacillus acidophilus.

  2. Effects of different feed form (dry and wet) supplemented with ...

    African Journals Online (AJOL)

    This study was conducted to evaluate the effect of different forms of feed presentation (dry and wet) supplemented with Probiotics containing Lactobacillus acidophilus on blood characteristics, microbial load and respiratory rate of growing pigs. Twenty-four crossbreed (Large white x Landrace) pigs with an initial body ...

  3. Modification of immune responses and digestive system microbiota of lactating dairy cows by feeding Bovamine(R)

    Science.gov (United States)

    We evaluated the immune modulatory effects as well as effects on productivity of Bovamine® (Lactobacillus acidophilus strain NP51 and Probionibacterium freudenreichii) fed to Holstein and Jersey dairy cows during late lactation (average DIM = 202.44 days on wk-0). Cows were randomized to treatment g...

  4. Molecular discrimination of lactobacilli used as starter and probiotic cultures by amplified ribosomal DNA restriction analysis.

    Science.gov (United States)

    Roy, D; Sirois, S; Vincent, D

    2001-04-01

    Lactic acid bacteria such as Lactobacillus helveticus, L. delbrueckii subsp. delbrueckii, L. delbrueckii subsp. lactis, L. delbrueckii subsp. bulgaricus, L. acidophilus, and L. casei related taxa which are widely used as starter or probiotic cultures can be identified by amplified ribosomal DNA restriction analysis (ARDRA). The genetic discrimination of the related species belonging to these groups was first obtained by PCR amplifications by using group-specific or species-specific 16S rDNA primers. The numerical analysis of the ARDRA patterns obtained by using CfoI, HinfI, Tru9I, and ScrFI was an efficient typing tool for identification of species of the L. acidophilus and L. casei complex. ARDRA by using CfoI was a reliable method for differentiation of L. delbrueckii subsp. bulgaricus and L. delbrueckii subsp. lactis. Finally, strains ATCC 393 and ATCC 15820 exhibited unique ARDRA patterns with CfoI and Tru9I restriction enzymes as compared with the other strains of L. casei, L. paracasei, and L. rhamnosus.

  5. The influences of fish infusion broth on the biogenic amines formation by lactic acid bacteria

    Directory of Open Access Journals (Sweden)

    Esmeray Küley

    2013-01-01

    Full Text Available The influences of fish infusion decarboxylase broth (IDB on biogenic amines (BA formation by lactic acid bacteria (LAB were investigated. BA productions by single LAB strains were tested in five different fish (anchovy, mackerel, white shark, sardine and gilthead seabream IDB. The result of the study showed that significant differences in ammonia (AMN and BA production were observed among the LAB strains in fish IDB (p < 0.05. The highest AMN and TMA production by LAB strains were observed for white shark IDB. The all tested bacteria had decarboxylation activity in fish IDB. The uppermost accumulated amines by LAB strains were tyramine (TYM, dopamine, serotonin and spermidine. The maximum histamine production was observed in sardine (101.69 mg/L and mackerel (100.84 mg/L IDB by Leuconostoc mesenteroides subsp. cremoris and Pediococcus acidophilus, respectively. Lactobacillus delbrueckii subsp. lactis and Pediococcus acidophilus had a high TYM producing capability (2943 mg/L and 1157 mg/L in sardine IDB.

  6. Screening of potential lactobacilli antigenotoxicity by microbial and mammalian cell-based tests.

    Science.gov (United States)

    Caldini, G; Trotta, F; Villarini, M; Moretti, M; Pasquini, R; Scassellati-Sforzolini, G; Cenci, G

    2005-06-25

    Antigenotoxicity is considered an important property for probiotic lactobacilli. The ability of non probiotic lactobacilli from dairy products and starters to inhibit two reference genotoxins: 4-nitroquinoline-1-oxide and N-methyl-N'-nitro-N-nitrosoguanidine was evaluated. The study was carried out using short-term assays with different targets, such as procaryotic cells (SOS-Chromotest for genotoxicity in Escherichia coli and Ames test for mutagenicity in Salmonella typhimurium) and eucaryotic cells (Comet assay for genotoxicity in Caco-2 enterocytes). A high proportion of strains inhibiting 4-nitroquinoline-1-oxide activity was found in Lactobacillus casei, Lactobacillus acidophilus, Lactobacillus rhamnosus, Lactobacillus delbrueckii subsp. bulgaricus and Lactobacillus plantarum. Inhibition of N-methyl-N'-nitro-N-nitrosoguanidine activity occurred in only one L. acidophilus strain. All the strains with antigenotoxic properties also demonstrated antimutagenic activity and produced modifications in genotoxin spectroscopic profiles. Strain viability during and after genotoxin exposure was confirmed. Concordance of the results obtained with microbial and mammalian cell-based tests is underlined.

  7. Survival of probiotic lactobacilli in the upper gastrointestinal tract using an in vitro gastric model of digestion.

    Science.gov (United States)

    Lo Curto, Alberto; Pitino, Iole; Mandalari, Giuseppina; Dainty, Jack Richard; Faulks, Richard Martin; John Wickham, Martin Sean

    2011-10-01

    The aim of this study was to investigate survival of three commercial probiotic strains (Lactobacillus casei subsp. shirota, L. casei subsp. immunitas, Lactobacillus acidophilus subsp. johnsonii) in the human upper gastrointestinal (GI) tract using a dynamic gastric model (DGM) of digestion followed by incubation under duodenal conditions. Water and milk were used as food matrices and survival was evaluated in both logarithmic and stationary phase. The % of recovery in logarithmic phase ranged from 1.0% to 43.8% in water for all tested strains, and from 80.5% to 197% in milk. Higher survival was observed in stationary phase for all strains. L. acidophilus subsp. johnsonii showed the highest survival rate in both water (93.9%) and milk (202.4%). Lactic acid production was higher in stationary phase, L. casei subsp. shirota producing the highest concentration (98.2 mM) after in vitro gastric plus duodenal digestion. Copyright © 2011 Elsevier Ltd. All rights reserved.

  8. Probiotics for the Primary and Secondary Prevention of C. difficile Infections: A Meta-analysis and Systematic Review

    Directory of Open Access Journals (Sweden)

    Lynne V. McFarland

    2015-04-01

    Full Text Available Clostridium difficile infections are a global clinical concern and are one of the leading causes of nosocomial outbreaks. Preventing these infections has benefited from multidisciplinary infection control strategies and new antibiotics, but the problem persists. Probiotics are effective in preventing antibiotic-associated diarrhea and may also be a beneficial strategy for C. difficile infections, but randomized controlled trials are scarce. This meta-analysis pools 21 randomized, controlled trials for primary prevention of C. difficile infections (CDI and four trials for secondary prevention of C. difficile recurrences and assesses the efficacy of specific probiotic strains. Four probiotics significantly improved primary CDI prevention: (Saccharomyces boulardii, Lactobacillus casei DN114001, a mixture of L. acidophilus and Bifidobacterium bifidum, and a mixture of L. acidophilus, L. casei and L. rhamnosus. None of the tested probiotics significantly improved secondary prevention of CDI. More confirmatory randomized trials are needed to establish if probiotics are useful for preventing C. difficile infections. v

  9. Impact of enzymatic hydrolyzed lactose on fermentation and growth of probiotic bacteria in whey

    Directory of Open Access Journals (Sweden)

    Katarina Lisak

    2011-06-01

    Full Text Available Taking in consideration the long time for whey fermentation using probiotic bacteria, the aim of this research was to determine if prior enzymatic hydrolysis of lactose influences microbial activities of Lactobacillus acidophilus La-5 or Bifidobacterium animalis subsp. lactis BB-12 in reconstituted sweet whey. During fermentation (at 37 °C, pH-value and viable cell counts were monitored. The fermented samples were sensory profiled. Lactose hydrolysis shortened the fermentation time of Lactobacillus acidophilus La-5 by 2 h, and viable cell count at the end of fermentation time was greater in hydrolyzed whey sample (~9.45 log10 CFU/mL when compared with the control sample (~8.91 log10 CFU/mL. In contrast, lactose hydrolysis in whey did not enhance the activity of Bifidobacterium animalis subsp. lactis BB-12. Lactose hydrolysis had slightly influence on sensory score of fermented samples, probably due to sweetness that masked the acidic taste of the product.

  10. Microbiological detection of probiotic microorganisms in fermented milk products

    Directory of Open Access Journals (Sweden)

    Radka Burdychová

    2007-01-01

    Full Text Available A number of health benefits have been claimed for probiotic bacteria such as Lactobacillus acidophilus, Bifidobacterium spp. and Lactobacillus rhamnosus. Because of the potential health benefits, these organisms are increasingly incorporated into dairy foods. However, to reach health benefits, the concentration of probiotics have to be 106 CFU/g of a product. For assessing of required probiotic bacteria quantity, it is important to have a working method for selective enumeration of these probiotic bacteria. Five bacteriological media were evaluated to assess their suitability to selectively enumerate Streptococcus thermophilus, Lactobacillus rhamnosus, Lactobacillus acidophilus and Bifidobacterium spp. Bacteriological media evaluated included Streptococcus thermophilus agar, pH modified MRS agar, MRS-vancomycine agar and BSM (Bifidus selective medium agar under different culture conditions.Seven selected fermented milk products with probiotic culture were analyzed for their bacterial populations using the described selective bacteriological media and culture conditions. All milk products contained probiotic microorganisms claimed to be present in declared quantity (106–107/g.

  11. In vitro evaluation of nutrients that selectively confer a competitive advantage to lactobacilli.

    Science.gov (United States)

    Vongsa, R A; Minerath, R A; Busch, M A; Tan, J; Koenig, D W

    2016-01-01

    An assay was developed that tested the ability of Lactobacillus acidophilus to outcompete a challenge of Escherichia coli in a mixed culture containing different test nutrients. Using this assay, addition of fructo-oligosaccharide to the media allowed L. acidophilus to outcompete a challenge of E. coli, whereas in a mixed culture without the prebiotic the trend was reversed. Growth curves generated for E. coli in a single culture showed that fructo-oligosaccharide did not affect growth, indicating that the carbohydrate was not toxic to E. coli. This indicates that fructo-oligosaccharides may increase the ability of beneficial microbes to outcompete a pathogenic challenge. These results were confirmed using a skin simulant model that incorporates growth of the organisms at an air-surface interface to mimic the vulvar environment. It is possible to use a co-culture assay as an in vitro screening tool to define nutrients that confer a competitive advantage to beneficial flora specific to the female urogenital tract.

  12. Effects of Lactic Acid Bacteria on Residual Nitrite in a Summer Style Sausage.

    Science.gov (United States)

    1984-01-01

    Lactobacillus plantarum 4008 Lactobacillus bulgaricus 11842 Lactobacillus fermentum 9338 Lactobacillus casei subsp. rhamnosus 7469 Pediococcus acidilactici...the American Type Culture Collection Culture ATCC Number Lactobacillus acidophilus 4365 0 Lactobacillus casei E393 Lactobacillus leichmannii 4797...sources (e.g., Micrococcus varians, Lactobacillus plantarum) exhibited different nitrite reducing abilities. Lactobacillus leichmannii (

  13. Performance of rats orogastrically dosed with faecal strains of ...

    African Journals Online (AJOL)

    Albino rats (Rattus norvegicus) were orogastrically dosed with faecal strains of Lactobacillus acidophilus and simultaneously infected with Escherichia coli, while the control was challenged with E. coli alone. The treatment was repeated the second day and post ingestion period of 18 days follow. It was observed that rats ...

  14. Induction of intestinal pro-inflammatory immune responses by lipoteichoic acid

    Directory of Open Access Journals (Sweden)

    Zadeh Mojgan

    2012-03-01

    Full Text Available Abstract Background The cellular and molecular mechanisms of inflammatory bowel disease are not fully understood; however, data indicate that uncontrolled chronic inflammation induced by bacterial gene products, including lipoteichoic acid (LTA, may trigger colonic inflammation resulting in disease pathogenesis. LTA is a constituent glycolipid of Gram-positive bacteria that shares many inflammatory properties with lipopolysaccharide and plays a critical role in the pathogenesis of severe inflammatory responses via Toll-like receptor 2. Accordingly, we elucidate the role of LTA in immune stimulation and induced colitis in vivo. Methods To better understand the molecular mechanisms utilized by the intestinal microbiota and their gene products to induce or subvert inflammation, specifically the effect(s of altered surface layer protein expression on the LTA-mediated pro-inflammatory response, the Lactobacillus acidophilus surface layer protein (Slp genes encoding SlpB and SlpX were deleted resulting in a SlpB- and SlpX- mutant that continued to express SlpA (assigned as NCK2031. Results Our data show profound activation of dendritic cells by NCK2031, wild-type L. acidophilus (NCK56, and purified Staphylococcus aureus-LTA. In contrary to the LTA-deficient strain NCK2025, the LTA-expressing strains NCK2031 and NCK56, as well as S. aureus-LTA, induce pro-inflammatory innate and T cell immune responses in vivo. Additionally, neither NCK2031 nor S. aureus-LTA supplemented in drinking water protected mice from DSS-colitis, but instead, induced significant intestinal inflammation resulting in severe colitis and tissue destruction. Conclusions These findings suggest that directed alteration of two of the L. acidophilus NCFM-Slps did not ameliorate LTA-induced pro-inflammatory signals and subsequent colitis.

  15. Detection and Specific Enumeration of Multi-Strain Probiotics in the Lumen Contents and Mucus Layers of the Rat Intestine After Oral Administration.

    Science.gov (United States)

    Lee, Hee Ji; Orlovich, David A; Tagg, John R; Fawcett, J Paul

    2009-12-01

    Although the detection of viable probiotic bacteria following their ingestion and passage through the gastrointestinal tract (GIT) has been well documented, their mucosal attachment in vivo is more difficult to assess. In this study, we investigated the survival and mucosal attachment of multi-strain probiotics transiting the rat GIT. Rats were administered a commercial mixture of the intestinal probiotics Lactobacillus acidophilus LA742, Lactobacillus rhamnosus L2H and Bifidobacterium lactis HN019 and the oral probiotic Streptococcus salivarius K12 every 12 h for 3 days. Intestinal contents, mucus and faeces were tested 6 h, 3 days and 7 days after the last dose by strain-specific enumeration on selective media and by denaturing gradient gel electrophoresis. At 6 h, viable cells and DNA corresponding to all four probiotics were detected in the faeces and in both the lumen contents and mucus layers of the ileum and colon. Viable probiotic cells of B. lactis and L. rhamnosus were detected for 7 days and L. acidophilus for 3 days after the last dose. B. lactis and L. rhamnosus persisted in the ileal mucus and colon contents, whereas the retention of L. acidophilus appeared to be relatively higher in colonic mucus. No viable cells of S. salivarius K12 were detected in any of the samples at either day 3 or 7. The study demonstrates that probiotic strains of intestinal origin but not of oral origin exhibit temporary colonisation of the rat GIT and that these strains may have differing relative affinities for colonic and ileal mucosa.

  16. Invitro Evaluation Of Antibacterial Activity Of Lactic Acid Bacteria Isolated From Ergo And Qotchqotcha Ethiopian Traditional Fermented Foods Against Some Selected Food Borne Pathogens

    Directory of Open Access Journals (Sweden)

    Lamenew Fenta

    2017-09-01

    Full Text Available The prevention of pathogenic bacteria by lactic acid bacteria LAB isolated directly from foods is an innovative approach. With the aim of determining the anti-bacterial activity of Lactic acid bacteria isolated from ergo and qotchqotcha Ethiopian fermented food 12 samples of each were taken from the 4 different kebeles of Assosa town. Isolation of LAB from the selected samples were carried out using MRS media. The different set of isolates were characterized using primary biochemical tests. Isolates which were gram positive catalase negative and KOH negative were considered to be presumptive LAB and further characterized by using different biochemical tests for further identification. 16 isolates from ergo samples were isolated. Based on Bergeys manual of determinative bacteriology the 16 isolates belonged to four 4 LAB species namely Lactobacillus acidophilus 18.75 Lactobacillus casei 31.25 Streptococcus thermophiles 25 and Lactobacillus bulgaricus 25. Likewise 5 isolates were isolated from Qotchqotcha and the five isolates were found to be Lactobacillus acidophilus 80 and Pediococcus acidilactici 20. Cell free solution from MRS broth culture of theses LAB was prepared and tested against Escherichia coli O157H7 and Staphylococcus aureus using agar-well diffusion method. Of the 16 isolates isolated from ergo 9 of them show antimicrobial activity against E. coli O157H7 with a largest inhibition zone measured about 7.331.20mm by EK0101 and 12 of them show antimicrobial activity against S. aureus with a largest inhibition zone measured about 11.66 0.88mm by EK0201. On the basis of morphological and biochemical test done EK0101 was found to be presumptive Lactobacillus acidophilus and EK0201 to be Streptococcus thermophiles. All of the isolates isolated from Qotchqotcha showed antimicrobial activity against the tested organisms though there was a significant difference in their activity P0.05. The isolate QK0201 showed an inhibition zone of about 6

  17. Phenotypic characterisation and assessment of the inhibitory ...

    African Journals Online (AJOL)

    Six strains of Lactobacillus spp. were isolated from fermenting corn slurry, fresh cow milk, and the faeces of pig, albino rat, and human infant. Their inhibitory action was tested against some spoilage and pathogenic bacteria. Lactobacillus acidophilus isolated from milk was found to display a higher antagonistic effect with ...

  18. Probiotics cultures in animal feed: Effects on ruminal fermentation, immune responses, and resistance to infectious diseases

    Science.gov (United States)

    We evaluated the effects of probiotics included in dairy cattle and mice feed on ruminal fermentation, immune responses, and resistance to Johne’s disease. To unveil the underlying mechanisms, dairy cattle were either fed Bovamine (1.04 x 10**9 cfu of Lactobacillus acidophilus NP51 plus 2.04 x 10**...

  19. Browse Title Index

    African Journals Online (AJOL)

    Items 8801 - 8850 of 11090 ... A Mansseri-Lamrioui, A Louerguioui, J Bonaly, ... Vol 13, No 53 (2014), Promoting increased Chlorella sorokiniana Shih. et Krauss (Chlorophyta) biomass ... Vol 16, No 3 (2017), Protection of Lactobacillus acidophilus under in vitro ... Araújo Campos, Pedro Martins Ribeiro Júnior, Fabrício Rabelo ...

  20. Nutritional evaluation of yoghurt prepared by different starter ...

    African Journals Online (AJOL)

    Yoghurt was prepared with two different types of starter cultures; Lactobacillus bulgaricus and Lactobacillus acidophilus. The preparation was made by 3, 4 and 5% concentrations. It was stored at 4°C for 12 days. To analyze the effect of the two different cultures and their concentrations on the properties of yoghurt, different ...

  1. Effect of prebiotics on viability and growth characteristics of probiotics in soymilk.

    Science.gov (United States)

    Yeo, Siok-Koon; Liong, Min-Tze

    2010-01-30

    Soy products have attracted much attention lately as carriers for probiotics. This study was aimed at enhancing the growth of probiotics in soymilk via supplementation with prebiotics. Lactobacillus sp. FTDC 2113, Lactobacillus acidophilus FTDC 8033, Lactobacillus acidophilus ATCC 4356, Lactobacillus casei ATCC 393, Bifidobacterium FTDC 8943 and Bifidobacterium longum FTDC 8643 were evaluated for their viability and growth characteristics in prebiotic-supplemented soymilk. In the presence of fructooligosaccharides (FOS), inulin, mannitol, maltodextrin and pectin, all strains showed viability exceeding 7 log(10) colony-forming units mL(-1) after 24 h. Their growth was significantly (P < 0.05) increased on supplementation with maltodextrin, pectin, mannitol and FOS. Additionally, supplementation with FOS, mannitol and maltodextrin increased (P < 0.05) the production of lactic acid. Supplementation with FOS and maltodextrin also increased the alpha-galactosidase activity of probiotics, leading to enhanced hydrolysis and utilisation of soy oligosaccharides. Finally, prebiotic supplementation enhanced the utilisation of simpler sugars such as fructose and glucose in soymilk. Supplementation with prebiotics enhances the potential of soymilk as a carrier for probiotics. (c) 2009 Society of Chemical Industry.

  2. Impact of Gluten-Friendly Bread on the Metabolism and Function of In Vitro Gut Microbiota in Healthy Human and Coeliac Subjects

    Science.gov (United States)

    Bevilacqua, Antonio; Costabile, Adele; Bergillos-Meca, Triana; Gonzalez, Isidro; Landriscina, Loretta; Ciuffreda, Emanuela; D’Agnello, Paola; Corbo, Maria Rosaria; Sinigaglia, Milena; Lamacchia, Carmela

    2016-01-01

    The main aim of this paper was to assess the in vitro response of healthy and coeliac human faecal microbiota to gluten-friendly bread (GFB). Thus, GFB and control bread (CB) were fermented with faecal microbiota in pH-controlled batch cultures. The effects on the major groups of microbiota were monitored over 48 h incubations by fluorescence in situ hybridisation. Short-chain fatty acids (SCFAs) were measured by high-performance liquid chromatography (HPLC). Furthermore, the death kinetics of Lactobacillus acidophilus, Bifidobacterium animalis subsp. lactis, Staphylococcus aureus, and Salmonella Typhimurium in a saline solution supplemented with GFB or CB were also assessed. The experiments in saline solution pinpointed that GFB prolonged the survival of L. acidophilus and exerted an antibacterial effect towards S. aureus and S. Typhimurium. Moreover, GFB modulated the intestinal microbiota in vitro, promoting changes in lactobacilli and bifidobacteria members in coeliac subjects. A final multivariate approach combining both viable counts and metabolites suggested that GFB could beneficially modulate the coeliac gut microbiome; however, human studies are needed to prove its efficacy. PMID:27632361

  3. Production and quality of kefir cultured butter

    Directory of Open Access Journals (Sweden)

    Yaşar Karaca

    2018-01-01

    Full Text Available Cream is the main raw material for the butter production and reflects its properties into butter quality. Maturation of cream with appropriate starter culture is important for butter quality, sensory properties and shelf life of the end product. Kefir grains contain important probiotics for healthy nutrition including lactic acid bacteria, acetic acid bacteria, and yeasts in high numbers. The aim of this research was to determine the properties of butter produced using natural kefir culture during a 21-day cold storage. Determination of microbial, chemical and sensory properties of butter samples was carried out. Control sample (KOTE had 6.64 log CFU g-1 Lactococcus spp. while kefir cultured butter samples had 8.58 log CFU g-1. Kefir cultured butter contained 5.24 log CFU g-1 L. acidophilus at Day 1, while control samples did not have L. acidophilus. Acetaldehyde content of kefir cultured butter was significantly higher from the uncultured butter. According to sensory evaluation performed by 12 panelists, KKTE samples had better sensory properties than those observed in the KOTE samples.

  4. ISOLATION AND IDENTIFICATION OF LACTIC ACID PRODUCING BACTERIA FROM CAMEL MILK

    Directory of Open Access Journals (Sweden)

    Toqeer Ahmad, Rashida Kanwal, Izhar Hussain Athar1, Najam Ayub

    2002-03-01

    Full Text Available Lactic acid bacteria (LAB were isolated from camel milk by culturing the camel milk on specific media and pure culture was obtained by sub culturing. Purification of culture was confirmed by Gram's staining and identified by different bio-chemical tests. Camel milk contains lactic acid producing bacteria including Strpptococci such as S. cremoris and S. lactis and Lactobacilli such as L. acidophilus L. acidophilus grows more rapidly in camel milk than others as its growth is supported by camel milk. A variety of food can be preserved by lactic acid fermentation, so starter culture was prepared from strains which were isolated from camel milk. Camel and buffalo's milk cheese was prepared by using starter culture. The strains isolated from camel milk were best for acid production and can coagulate the milk in less lime. Camel milk cheese was prepared and compared with buffalo's milk cheese. It is concluded that cheese can be prepared successfully from camel milk and better results can be obtained by coagulating milk with starter culture.

  5. Effects of Miramistin and Phosprenil on Microbial Biofilms.

    Science.gov (United States)

    Danilova, T A; Danilina, G A; Adzhieva, A A; Minko, A G; Nikolaeva, T N; Zhukhovitskii, V G; Pronin, A V

    2017-08-01

    Effects of Miramistin and Phosprenil on biofilms of S. pyogenes, S. aureus, E. coli, L. acidophilus, and L. plantarum were studied. Significant differences in the effects of these substances on mature biofilms of microorganisms and the process of their formation were observed. Miramistin had significant inhibiting effects on the forming of biofilms and on the formed biofilms of all studied microorganisms. Treatment with Miramistin inhibited biofilm formation by 2-3 times compared to the control. This effect was found already after using of Miramistin in the low doses (3.12 μg/ml). Inhibition of the growth of a formed biofilm was observed only after treatment with Miramistin in the high doses (25-50 μg/ml). Phosprenil in the high doses (15-30 mg/ml) inhibited the forming of biofilms, especially the biofilms of S. pyogenes and L. plantarum (by 3-4.5 times). Treatment of formed biofilms with the agent in doses of 6.0 and 0.6 mg/ml was associated with pronounced stimulation of its growth in S. pyogenes, S. aureus, and L. acidophilus.

  6. Acceptability of prebiotic fiber-treated whey drink fermented with ...

    African Journals Online (AJOL)

    This work aimed to develop a fermented drink by diversifying the quantities of Lactobacillus acidophilus inoculum and prebiotic fiber in the form of inulin and using the total dry extract of whey and sucrose. After fermentation, the following measurements were made after 0, 7, 14, 21 and 28 days of storage at 6°C: titratable ...

  7. Protection of Lactobacillus acidophilus under in vitro gastrointestinal ...

    African Journals Online (AJOL)

    Oscar Javier

    2017-01-18

    Jan 18, 2017 ... Probiotics are defined as live microorganisms which when administered ... polysaccharides produced by brown algae (Laminaria digitata, Laminaria .... of microorganisms added to the biopolymer dispersion. (aqueous phase) ...

  8. First Microbial Community Assessment of Borehole Fluids from the Deep Underground Science and Engineering Laboratory (DUSEL)

    Science.gov (United States)

    Moser, D. P.; Anderson, C.; Bang, S.; Jones, T. L.; Boutt, D.; Kieft, T.; Sherwood Lollar, B.; Murdoch, L. C.; Pfiffner, S. M.; Bruckner, J.; Fisher, J. C.; Newburn, J.; Wheatley, A.; Onstott, T. C.

    2010-12-01

    Proteobacteria and closely related to known or expected aerobes including: Thiobacillus, Siderooxidans, Leptothrix, Hydrogenophaga, Pseaudomonas, Methylomonas and Thiothrix, consistent with possible mine water or air contamination. Conversely, Deltaproteobacteria and Firmicute clones, often very closely related to others detected from deep mine or sediment habitats, suggests a deep subsurface component as well. Archaeal clones from 4100L were dominated by a deeply-branching clade with no cultivated representatives; whereas, those from 4850 were mostly related to known methanogens (e.g. Methanolobus). Collectively, this dataset suggests mixed end-member or deeply-sourced water partially overprinted by mine-related artifacts. However, until more is known concerning the deep hydrogeology of this system, it will be difficult to ascertain indigenous from impacted microbial communities in DUSEL.

  9. Development and characterization of an innovative synbiotic fermented beverage based on vegetable soybean

    Directory of Open Access Journals (Sweden)

    Carolina Battistini

    Full Text Available Abstract Soymilk was produced from vegetable soybean and fermented by probiotics (Lactobacillus acidophilus La-5, Bifidobacterium animalis Bb-12 in co-culture with Streptococcus thermophilus. The composition of the fermented beverage and oligosaccharides content were determined. The effect of fructooligosaccharides and inulin on the fermentation time and viability of probiotic microorganisms throughout 28 days of storage at 5 °C were evaluated. The soymilk from vegetable soybeans was fermented in just 3.2 h, when pH reached 4.8. Fermentation reduced the contents of stachyose and raffinose in soymilk. Prebiotics had no effect on acidification rate and on viability of B. animalis and S. thermophilus in the fermented beverage. The viable counts of B. animalis Bb-12 remained above 108 CFU mL-1 in the fermented soymilk during 28 days of storage at 5 °C while L. acidophilus La-5 was decreased by 1 log CFU mL-1. The fermented soymilk from vegetable soybeans showed to be a good food matrix to deliver probiotic bacteria, as well as a soy product with a lower content of non-digestible oligosaccharides.

  10. Antimicrobial activity of different disinfectants against cariogenic microorganisms

    Directory of Open Access Journals (Sweden)

    Esra UZER CELIK

    Full Text Available Abstract The aim of this study was to assess the in vitro antimicrobial effects of chlorhexidine digluconate (CHX, polyhexamethylene biguanide (PHBM, and octenidine dihydrochloride (OCT on cariogenic microorganisms by using their minimum inhibitory concentration (MIC and minimum bactericidal concentration (MBC. CHX, PHBM, and OCT were diluted in distilled water to the final test concentrations. Using the in-tube dilution method, Streptococcus mutans, Lactobacillus acidophilus, Lactobacillus rhamnosus, and Actinomyces viscosus were cultivated on blood agar and Mueller–Hinton broth (MHB at 37°C for 48 h. They were read using a spectrophotometer to detect MIC. To determine MBC, samples in the range of the turbidity threshold after 24 h were transferred onto blood agar and evaluated for growth after 24 h. Different MICs and MBCs were observed in all disinfectants against each microorganism. The lowest MIC and MBC against S. mutans (60 mg/L were obtained from PHBM. The lowest values against L. rhamnosus (15 mg/L, 30 mg/L, A. viscosus (30 mg/L, and L. acidophilus (15 mg/L, 30 mg/L were determined by OCT. PHBM and OCT have the potential to be replaced with CHX because they were effective against cariogenic microorganisms.

  11. Bacteriological evaluation of Allium sativum oil as a new medicament for pulpotomy of primary teeth.

    Science.gov (United States)

    Mohammad, Shukry Gamal; Baroudi, Kusai

    2015-01-01

    To compare the effects of Allium sativum oil and formocresol on the pulp tissue of the pulpotomized teeth. Twenty children were selected for this study. All children had a pair of non-vital primary molars. A sterile paper point was dipped in the root canals prior to the mortal pulpotomy. These paper points were collected in transfer media and immediately transported to the microbiological lab to be investigated microbiologically (for Streptococcus mutans and Lactobacillus acidophilus). Then the procedure of mortal pulpotomy was performed. After 2 weeks, the cotton pellets were removed and sterile paper points were dipped in the root canals for microbiological examination. Then comparison between the count of bacteria before and after treatment was conducted. Statistical analysis was performed using independent t-test and paired t-test at the significance level of α = 0.05. After application of both medicaments, there was a marked decrease in S. mutans and L. acidophilus counts. The difference between the mean of log values of the count before and after the application was highly significant for both medicaments (P sativum oil was used. A. sativum oil had more powerful antimicrobial effects than formocresol on the bacteria of the infected root canals.

  12. Effects of 4 Probiotic Strains in Coculture with Traditional Starters on the Flavor Profile of Yogurt.

    Science.gov (United States)

    Tian, Huaixiang; Shen, Yongbo; Yu, Haiyan; He, Yujie; Chen, Chen

    2017-07-01

    To study the influence of probiotics on the flavor profile of yogurt, 4 probiotics, including Lactobacillus acidophilus, Lactobacillus plantarum, Lactobacillus rhamnosus, and Lactobacillus casei, were cofermented with traditional starters. The changes of bacterial growth, acid contents and volatile compounds of yogurt were investigated during fermentation and refrigerated storage. The strains that exhibited a low growth rate in milk did not significantly affect the bacterial population dynamics, acidity, or organic acid content during fermentation and storage. However, high viability and enhancement of postacidification were clearly observed in the samples that contained strains with a high growth rate in milk, particularly L. casei. A total of 45 volatile compounds, detected in most samples, were identified by headspace solid-phase micro-extraction followed by gas chromatography-mass spectrometry. Among these compounds, ketones and aldehydes were the most abundant. The presence of either L. rhamnosus or L. plantarum did not significantly affect the major volatile compounds, while contributions of L. casei and L. acidophilus were found in the formation of minor volatile metabolites. Electronic nose measurements exhibited a good discrimination of samples that contained different probiotics during refrigerated storage. © 2017 Institute of Food Technologists®.

  13. Antimicrobial Effect of Jasminum grandiflorum L. and Hibiscus rosa-sinensis L. Extracts Against Pathogenic Oral Microorganisms--An In Vitro Comparative Study.

    Science.gov (United States)

    Nagarajappa, Ramesh; Batra, Mehak; Sharda, Archana J; Asawa, Kailash; Sanadhya, Sudhanshu; Daryani, Hemasha; Ramesh, Gayathri

    2015-01-01

    To assess and compare the antimicrobial potential and determine the minimum inhibitory concentration (MIC) of Jasminum grandiflorum and Hibiscus rosa-sinensis extracts as potential anti-pathogenic agents in dental caries. Aqueous and ethanol (cold and hot) extracts prepared from leaves of Jasminum grandiflorum and Hibiscus rosa-sinensis were screened for in vitro antimicrobial activity against Streptococcus mutans and Lactobacillus acidophilus using the agar well diffusion method. The lowest concentration of every extract considered as the minimum inhibitory concentration (MIC) was determined for both test organisms. Statistical analysis was performed with one-way analysis of variance (ANOVA). At lower concentrations, hot ethanol Jasminum grandiflorum (10 μg/ml) and Hibiscus rosa-sinensis (25 μg/ml) extracts were found to have statistically significant (P≤0.05) antimicrobial activity against S. mutans and L. acidophilus with MIC values of 6.25 μg/ml and 25 μg/ml, respectively. A proportional increase in their antimicrobial activity (zone of inhibition) was observed. Both extracts were found to be antimicrobially active and contain compounds with therapeutic potential. Nevertheless, clinical trials on the effect of these plants are essential before advocating large-scale therapy.

  14. Antibacterial and Antifungal Activities of Punica Granatum Peel Extracts Against Oral Pathogens

    Directory of Open Access Journals (Sweden)

    Sh. Abdollahzadeh

    2011-03-01

    Full Text Available Objective: Punica granatum has been used for many years in folk medicine due to several purposes. The aim of the present study was to evaluate the effect of methanolic extract of Punica granatum peel (MEPGP against Streptococcus mutans, Staphylococcus aureus,Streptococcus salivarius, Streptococcus sanguinis, Staphylococcus epidermidis, Actynomyces viscosus, Lactobacillus acidophilus and Candida albicans.Materials and Methods: In this in vitro study, the mentioned oral organisms were cultured in blood agar and mueller-hinton media and then paper disks containing MEPGP at concentrations of 4 mg/ml, 8 mg/ml and 12 mg/ml were inserted on medias. The antimicrobialactivity was evaluated by agar disk diffusion method. The effects of three different concentrations of MEPGP against microorganisms were compared using one-way ANOVA and Tukey tests.Results: All concentrations of MEPGP had antibacterial activity against S. aureus and S.epidermidis. Only at concentration of 8 mg/ml and 12 mg/ml MEPGP was effective against L. acidophilus, S. mutans and S. salivarius. Furthermore; no concentrations ofMEPGP inhibited A. viscosus and C. albicans.Conclusion: This study suggests that MEPGP might be used as an antibacterial agent in controlling oral infections.

  15. Influence of microencapsulation and spray drying on the viability of Lactobacillus and Bifidobacterium strains.

    Science.gov (United States)

    Goderska, Kamila; Czarnecki, Zbigniew

    2008-01-01

    Improved production methods of starter cultures, which constitute the most important element of probiotic preparations, were investigated. The aim of the presented research was to analyse changes in the viability of Lactobacillus. acidophilus and Bifidobacterium bifidum after stabilization (spray drying, liophilization, fluidization drying) and storage in refrigerated conditions for 4 months. The highest numbers of live cells, up to the fourth month of storage in refrigerated conditions, of the order of 10(7) cfu/g preparation were recorded for the B. bifidum DSM 20239 bacteria in which the N-Tack starch for spray drying was applied. Fluidization drying of encapsulated bacteria allowed obtaining a preparation of the comparable number of live bacterial cells up to the fourth month of storage with those encapsulated bacteria, which were subjected to freeze-drying but the former process was much shorter. The highest survivability of the encapsulated L. acidophilus DSM 20079 and B. bifidum DSM 20239 cells subjected to freeze-drying was obtained using skimmed milk as the cryoprotective substance. Stabilization of bacteria by microencapsulation can give a product easy to store and apply to produce dried food composition.

  16. Efficacy of polymer coating of probiotic beads suspended in pressurized and pasteurized longan juices on the exposure to simulated gastrointestinal environment.

    Science.gov (United States)

    Chaikham, Pittaya; Apichartsrangkoon, Arunee; George, Trevor; Jirarattanarangsri, Wachira

    2013-11-01

    Alginate-coated Lactobacillus acidophilus LA5 or Lactobacillus casei 01 was recoated with either 0.1-0.5% (w/v) alginate or 0.05-0.15% (w/v) poly-L-lysine (PLL) plus 0.2% (w/v) alginate or 5-15% (w/v) gelatin, after which they were determined for survivability in gastric or bile longan juices. The morphology of encapsulated probiotic cells illustrated that recoated beads with 0.5% alginate showed a more compact surface and a greater protective effect than other recoating materials. The recoated beads with 0.5% alginate and 0.05-0.15% PLL plus 0.2% alginate of both strains showed the highest viability in gastric longan juice. In bile longan juice, only 0.5% alginate showed the best protection for both recoated beads. When considering the storage stability, encapsulated L. acidophilus LA5 exhibited a higher viable count than those of the free cells, whereas L. casei 01 showed equivalent viability of both free and double-coated cells. Based on the impact of pressurization or pasteurization, both processed juices gave rise to equivalent survivability of the probiotic cells during storage.

  17. Characterization of surface layer proteins and its role in probiotic properties of three Lactobacillus strains.

    Science.gov (United States)

    Meng, Jun; Zhu, Xiao; Gao, Shu-Ming; Zhang, Qiu-Xiang; Sun, Zhen; Lu, Rong-Rong

    2014-04-01

    The objective of this study was the characterization of the surface layer proteins (SLPs) and their functional role in the probiotic activity of Lactobacillus helveticus fb213, L. acidophilus fb116 and L. acidophilus fb214. SLPs were extracted and identified by SDS-PAGE, circular dichroism spectra and LC-MS analysis. The results revealed that the molecular masses of the three proteins were 49.7 kDa, 46.0 kDa and 44.6 kDa, respectively. The secondary structures and amino acid compositions of the three proteins were found to be similar. After removing SLPs, the survival of the three lactobacilli in simulated gastric and intestinal juices was reduced by 2-3log as compared with survival of the intact cells. And the adhesion ability of the three strains to HT-29 cells decreased by 61%, 65% and 92%, respectively. SLPs also inhibited the adhesion and invasion of Escherichia coli ATCC 43893 to HT-29 cells. These results suggest that SLPs are advantageous barriers for lactobacilli in the gastrointestinal tract, and these proteins help make it possible for lactobacilli to serve their probiotic functions. Copyright © 2014 Elsevier B.V. All rights reserved.

  18. Effect of Fixed Orthodontic Treatment on Salivary Flow, pH and Microbial Count

    Directory of Open Access Journals (Sweden)

    Sepideh Arab

    2016-08-01

    Full Text Available Objectives: The present study was designed to evaluate the changes in saliva properties and oral microbial flora in patients undergoing fixed orthodontic treatment.Materials and Methods: Two important saliva properties namely the salivary flow rate and pH as well as oral microbial flora were assessed in 30 orthodontic patients before starting fixed orthodontic treatment and after six, 12 and 18 weeks of treatment. Selective media, Sabouraud dextrose agar, Mitis salivarius agar and Rogosa agar were used for isolation of Candida albicans, Streptococcus mutans and Lactobacillus acidophilus, respectively. Statistical analysis was performed using Friedman and Dunn’s tests. P< 0.05 was considered statistically significant.Results: After six, 12 and 18 weeks of commencing fixed orthodontic treatment, the total colony counts of Candida albicans, Streptococcus mutans and Lactobacillus acidophilus showed a significant increase. The saliva pH decreased during the orthodontic treatment (P< 0.05 while the salivary flow did not change significantly. Conclusions: Fixed orthodontic treatment causes major changes in the saliva properties. The changes in oral microflora and saliva properties show the importance of caries preventive measures during orthodontic treatment.

  19. Lactic acid bacteria as functional probiotic isolates for inhibiting the growth of Aspergillus flavus, A. parasiticus, A. niger and Penicillium chrysogenum.

    Science.gov (United States)

    Abbaszadeh, S; Tavakoli, R; Sharifzadeh, A; Shokri, H

    2015-12-01

    The aim of this study was to assess the potential of lactic acid bacteria (LAB) such as Lactobacillus acidophilus, L. rhamnosus, L. casei, L. paracasei and Bifidobacterium bifidum to inhibit the outgrowth of some common food-spoiling fungi including Aspergillus niger, A. flavus, A. parasiticus and Penicillium chrysogenum. Bacterial isolates were cultured on Mann Rogosa Sharpe (MRS) broth and liquid cultures and supernatants were prepared. The antifungal activity was tested using the agar well diffusion method. Both liquid culture and supernatant of L. casei isolate exhibited high antifungal activity, followed by L. acidophilus and L. paracasei isolates. The least activity was recorded for the isolates B. bifidum, while the isolate L. rhamnosus was moderately active against tested fungi. The antifungal activity of the supernatants obtained from all probiotic isolates against fungi was significantly less than that of liquid cultures (Pniger and A. parasiticus. These results suggest that probiotic bacteria strains have the ability to prevent the growth of pathogenic and mycotoxigenic fungi as antifungal agents for various biomedical applications. Copyright © 2015 Elsevier Masson SAS. All rights reserved.

  20. Antibacterial and Antifungal Activities of Punica Granatum Peel Extracts Against Oral Pathogens

    Science.gov (United States)

    Abdollahzadeh, Sh.; Mashouf, RY.; Mortazavi, H.; Moghaddam, MH.; Roozbahani, N.; Vahedi, M.

    2011-01-01

    Objective: Punica granatum has been used for many years in folk medicine due to several purposes. The aim of the present study was to evaluate the effect of methanolic extract of Punica granatum peel (MEPGP) against Streptococcus mutans, Staphylococcus aureus, Streptococcus salivarius, Streptococcus sanguinis, Staphylococcus epidermidis, Actynomyces viscosus, Lactobacillus acidophilus and Candida albicans. Materials and Methods: In this in vitro study, the mentioned oral organisms were cultured in blood agar and mueller-hinton media and then paper disks containing MEPGP at concentrations of 4 mg/ml, 8 mg/ml and 12 mg/ml were inserted on medias. The antimicrobial activity was evaluated by agar disk diffusion method. The effects of three different concentrations of MEPGP against microorganisms were compared using one-way ANOVA and Tukey tests. Results: All concentrations of MEPGP had antibacterial activity against S. aureus and S. epidermidis. Only at concentration of 8 mg/ml and 12 mg/ml MEPGP was effective against L. acidophilus, S. mutans and S. salivarius. Furthermore; no concentrations of MEPGP inhibited A. viscosus and C. albicans. Conclusion: This study suggests that MEPGP might be used as an antibacterial agent in controlling oral infections. PMID:21998800