WorldWideScience

Sample records for thermosynechococcus elongatus bp-1

  1. The structure of allophycocyanin from Thermosynechococcus elongatus at 3.5 Å resolution

    Energy Technology Data Exchange (ETDEWEB)

    Murray, James William; Maghlaoui, Karim; Barber, James, E-mail: j.barber@imperial.ac.uk [Division of Molecular Biosciences, Imperial College, Exhibition Road, London SW7 2AZ (United Kingdom)

    2007-12-01

    The crystal structure of a light-harvesting protein that interacts with photosystem II is reported. Cyanobacteria and red algae use light-harvesting pigments bound by proteins to capture solar radiation and to channel excitation energy into their reaction centres. In most cyanobacteria, a multi-megadalton soluble structure known as the phycobilisome is a major light-harvesting system. Allophycocyanin is the main component of the phycobilisome core, forming a link between the rest of the phycobilisome and the reaction-centre core. The crystal structure of allophycocyanin from Thermosynechococcus elongatus (TeAPC) has been determined and refined at 3.5 Å resolution to a crystallographic R value of 26.0% (R{sub free} = 28.5%). The structure was solved by molecular replacement using the allophycocyanin structure from Spirulina platensis as the search model. The asymmetric unit contains an (αβ) monomer which is expanded by symmetry to a crystallographic trimer.

  2. Crystal structure at 1.5Å resolution of the PsbV2 cytochrome from the cyanobacterium Thermosynechococcus elongatus.

    Science.gov (United States)

    Suga, Michihiro; Lai, Thanh-Lan; Sugiura, Miwa; Shen, Jian-Ren; Boussac, Alain

    2013-10-01

    PsbV2 is a c-type cytochrome present in a very low abundance in the thermophilic cyanobacterium Thermosynechococcus elongatus. We purified this cytochrome and solved its crystal structure at a resolution of 1.5Å. The protein existed as a dimer in the crystal, and has an overall structure similar to other c-type cytochromes like Cytc6 and Cytc550, for example. However, the 5th and 6th heme iron axial ligands were found to be His51 and Cys101, respectively, in contrast to the more common bis-His or His/Met ligands found in most cytochromes. Although a few other c-type cytochromes were suggested to have this axial coordination, this is the first crystal structure reported for a c-type heme with this unusual His/Cys axial coordination. Previous spectroscopic characterizations of PsbV2 are discussed in relation to its structural properties. Copyright © 2013 Federation of European Biochemical Societies. Published by Elsevier B.V. All rights reserved.

  3. Rational ‘correction’ of the amino-acid sequence of RbcX protein from the thermophilic cyanobacterium Thermosynechococcus elongatus dramatically improves crystallization

    International Nuclear Information System (INIS)

    Tarnawski, Miroslaw; Krzywda, Szymon; Szczepaniak, Andrzej; Jaskolski, Mariusz

    2008-01-01

    Recombinant RuBisCO chaperone from T. elongatus, TeRbcX, was aggregated and could not be crystallized. Mutations of an unusual Cys residue in the TeRbcX sequence yielded much better behaved proteins that could rapidly be crystallized. RbcX is a dimeric protein found in cyanobacteria that assists in the assembly of the oligomeric RuBisCO complex. RbcX from the thermophile Thermosynechococcus elongatus (TeRbcX) contains an unusual Cys103 residue in its sequence and when expressed recombinantly the protein aggregates and cannot be crystallized. Site-directed mutagenesis of Cys103 to either Arg or Ala produced non-aggregating proteins that could be readily crystallized in several crystal forms. Synchrotron-radiation X-ray diffraction data were collected to 1.96 Å resolution and formed the basis of crystal structure analysis of TeRbcX

  4. Analysis of the solution structure of Thermosynechococcus elongatus photosystem I in n-dodecyl-β-D-maltoside using small-angle neutron scattering and molecular dynamics simulation.

    Science.gov (United States)

    Le, Rosemary K; Harris, Bradley J; Iwuchukwu, Ifeyinwa J; Bruce, Barry D; Cheng, Xiaolin; Qian, Shuo; Heller, William T; O'Neill, Hugh; Frymier, Paul D

    2014-05-15

    Small-angle neutron scattering (SANS) and molecular dynamics (MD) simulation were used to investigate the structure of trimeric photosystem I (PSI) from Thermosynechococcus elongatus (T. elongatus) stabilized in n-dodecyl-β-d-maltoside (DDM) detergent solution. Scattering curves of detergent and protein-detergent complexes were measured at 18% D2O, the contrast match point for the detergent, and 100% D2O, allowing observation of the structures of protein/detergent complexes. It was determined that the maximum dimension of the PSI-DDM complex was consistent with the presence of a monolayer belt of detergent around the periphery of PSI. A dummy-atom reconstruction of the shape of the complex from the SANS data indicates that the detergent envelope has an irregular shape around the hydrophobic periphery of the PSI trimer rather than a uniform, toroidal belt around the complex. A 50 ns MD simulation model (a DDM ring surrounding the PSI complex with extra interstitial DDM) of the PSI-DDM complex was developed for comparison with the SANS data. The results suggest that DDM undergoes additional structuring around the membrane-spanning surface of the complex instead of a simple, relatively uniform belt, as is generally assumed for studies that use detergents to solubilize membrane proteins. Copyright © 2014 Elsevier Inc. All rights reserved.

  5. Recombinant thermoactive phosphoenolpyruvate carboxylase (PEPC) from Thermosynechococcus elongatus and its coupling with mesophilic/thermophilic bacterial carbonic anhydrases (CAs) for the conversion of CO2 to oxaloacetate.

    Science.gov (United States)

    Del Prete, Sonia; De Luca, Viviana; Capasso, Clemente; Supuran, Claudiu T; Carginale, Vincenzo

    2016-01-15

    With the continuous increase of atmospheric CO2 in the last decades, efficient methods for carbon capture, sequestration, and utilization are urgently required. The possibility of converting CO2 into useful chemicals could be a good strategy to both decreasing the CO2 concentration and for achieving an efficient exploitation of this cheap carbon source. Recently, several single- and multi-enzyme systems for the catalytic conversion of CO2 mainly to bicarbonate have been implemented. In order to design and construct a catalytic system for the conversion of CO2 to organic molecules, we implemented an in vitro multienzyme system using mesophilic and thermophilic enzymes. The system, in fact, was constituted by a recombinant phosphoenolpyruvate carboxylase (PEPC) from the thermophilic cyanobacterium Thermosynechococcus elongatus, in combination with mesophilic/thermophilic bacterial carbonic anhydrases (CAs), for converting CO2 into oxaloacetate, a compound of potential utility in industrial processes. The catalytic procedure is in two steps: the conversion of CO2 into bicarbonate by CA, followed by the carboxylation of phosphoenolpyruvate with bicarbonate, catalyzed by PEPC, with formation of oxaloacetate (OAA). All tested CAs, belonging to α-, β-, and γ-CA classes, were able to increase OAA production compared to procedures when only PEPC was used. Interestingly, the efficiency of the CAs tested in OAA production was in good agreement with the kinetic parameters for the CO2 hydration reaction of these enzymes. This PEPC also revealed to be thermoactive and thermostable, and when coupled with the extremely thermostable CA from Sulphurhydrogenibium azorense (SazCA) the production of OAA was achieved even if the two enzymes were exposed to temperatures up to 60 °C, suggesting a possible role of the two coupled enzymes in biotechnological processes. Copyright © 2015 Elsevier Ltd. All rights reserved.

  6. In vitro kinetics of P700+reduction of Thermosynechococcus elongatus trimeric Photosystem I complexes by recombinant cytochrome c6using a Joliot-type LED spectrophotometer.

    Science.gov (United States)

    Nguyen, Khoa; Vaughn, Michael; Frymier, Paul; Bruce, Barry D

    2017-01-01

    The reduction rate of photo-oxidized Photosystem I (PSI) with various natural and artificial electron donors have been well studied by transient absorption spectroscopy. The electron transfer rate from various donors to P 700 + has been measured for a wide range of photosynthetic organisms encompassing cyanobacteria, algae, and plants. PSI can be a limiting component due to tedious extraction and purification methods required for this membrane protein. In this report, we have determined the in vivo, intracellular cytochrome c 6 (cyt c 6 )/PSI ratio in Thermosynechococcus elongatus (T.e.) using quantitative Western blot analysis. This information permitted the determination of P 700 + reduction kinetics via recombinant cyt c 6 in a physiologically relevant ratio (cyt c 6 : PSI) with a Joliot-type, LED-driven, pump-probe spectrophotometer. Dilute PSI samples were tested under varying cyt c 6 concentration, temperature, pH, and ionic strength, each of which shows similar trends to the reported literature utilizing much higher PSI concentrations with laser-based spectrophotometer. Our results do however indicate kinetic differences between actinic light sources (laser vs. LED), and we have attempted to resolve these effects by varying our LED light intensity and duration. The standardized configuration of this spectrophotometer will also allow a more uniform kinetic analysis of samples in different laboratories. We can conclude that our findings from the LED-based system display an added total protein concentration effect due to multiple turnover events of P 700 + reduction by cyt c 6 during the longer illumination regime.

  7. Single particle analysis of thylakoid proteins from Thermosynechococcus elongatus and Synechocystis 6803 : Localization of the CupA subunit of NDH-1

    NARCIS (Netherlands)

    Folea, I. Mihaela; Zhang, Pengpeng; Nowaczyk, Marc M.; Ogawa, Teruo; Aro, Eva-Marl; Boekema, Egbert J.; Aro, Eva-Mari

    The larger protein complexes of the cyanobacterial photosynthetic membrane of Thermosynechoccus elongatus and Synechocystis 6803 were studied by single particle electron microscopy after detergent solubilization, without any purification steps. Besides the "standard" L-shaped NDH-1L complex, related

  8. Protein (Cyanobacteria): 74944 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available in tlr1014 Thermosynechococcus elongatus BP-1 MCSVGLLLVPALLPYSLAQTSPRTDVIAPWEITTYARVVLEIEPIRQKYYRQAQAAFQGQVPSNACFGMNPQHIPSGLEAICASYGWEAIQVLKKYNMSLEQFNAITLRAQQDSTLSRRIQAEMLRLQQP ...

  9. Effects of Irregular Bimetallic Nanostructures on the Optical Properties of Photosystem I from Thermosynechococcus elongatus

    Directory of Open Access Journals (Sweden)

    Imran Ashraf

    2015-07-01

    Full Text Available The fluorescence of photosystem I (PSI trimers in proximity to bimetallic plasmonic nanostructures have been explored by single-molecule spectroscopy (SMS at cryogenic temperature (1.6 K. PSI serves as a model for biological multichromophore-coupled systems with high potential for biotechnological applications. Plasmonic nanostructures are fabricated by thermal annealing of thin metallic films. The fluorescence of PSI has been intensified due to the coupling with plasmonic nanostructures. Enhancement factors up to 22.9 and 5.1 are observed for individual PSI complexes coupled to Au/Au and Ag/Au samples, respectively. Additionally, a wavelength dependence of fluorescence enhancement is observed, which can be explained by the multichromophoric composition of PSI.

  10. CtBP1 overexpression in keratinocytes perturbs skin homeostasis.

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2014-05-01

    Carboxyl-terminal-binding protein-1 (CtBP1) is a transcriptional corepressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin-5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable to endogenous CtBP1 in acute skin wounds, the K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin, were downregulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In summary, this CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals--to our knowledge--previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggests that CtBP1 has a pathogenic role in hair follicle morphogenesis and differentiation.

  11. Crystal structure of the Psb28 accessory factor of Thermosynechococcus elongatus photosystem II at 2.3 angstrom

    Czech Academy of Sciences Publication Activity Database

    Bialek, W.; Wen, S.; Michoux, F.; Bečková, Martina; Komenda, Josef; Murray, J. W.; Nixon, P. J.

    2013-01-01

    Roč. 117, 1-3 (2013), s. 375-383 ISSN 0166-8595 R&D Projects: GA MŠk(CZ) ED2.1.00/03.0110 Institutional support: RVO:61388971 Keywords : Assembly factor * Psb28 * Psb28-2 Subject RIV: EE - Microbiology, Virology Impact factor: 3.185, year: 2013

  12. Preliminary Geological Findings on the BP-1 Simulant

    Science.gov (United States)

    Stoeser, D. B.; Rickman, D. L.; Wilson, S.

    2010-01-01

    A waste material from an aggregate producing quarry has been used to make an inexpensive lunar simulant called BP-1. The feedstock is the Black Point lava flow in northern Arizona. Although this is part of the San Francisco volcanic field, which is also the source of the JSC-1 series feedstock, BP-1 and JSC-1 are distinct. Chemically, the Black Point flow is an amygdaloidal nepheline-bearing basalt. The amygdules are filled with secondary minerals containing opaline silica, calcium carbonate, and ferric iron minerals. X-ray diffraction (XRD) detected approximately 3% quartz, which is in line with tests done by the Kennedy Space Center Industrial Hygiene Office. Users of this material should use appropriate protective equipment. XRD also showed the presence of significant halite and some bassanite. Both are interpreted to be evaporative residues due to recycling of wash water at the quarry. The size distribution of BP-1 may be superior to some other simulants for some applications.

  13. TopBP1-mediated DNA processing during mitosis.

    Science.gov (United States)

    Gallina, Irene; Christiansen, Signe Korbo; Pedersen, Rune Troelsgaard; Lisby, Michael; Oestergaard, Vibe H

    2016-01-01

    Maintenance of genome integrity is crucial to avoid cancer and other genetic diseases. Thus faced with DNA damage, cells mount a DNA damage response to avoid genome instability. The DNA damage response is partially inhibited during mitosis presumably to avoid erroneous processing of the segregating chromosomes. Yet our recent study shows that TopBP1-mediated DNA processing during mitosis is highly important to reduce transmission of DNA damage to daughter cells. (1) Here we provide an overview of the DNA damage response and DNA repair during mitosis. One role of TopBP1 during mitosis is to stimulate unscheduled DNA synthesis at underreplicated regions. We speculated that such genomic regions are likely to hold stalled replication forks or post-replicative gaps, which become the substrate for DNA synthesis upon entry into mitosis. Thus, we addressed whether the translesion pathways for fork restart or post-replicative gap filling are required for unscheduled DNA synthesis in mitosis. Using genetics in the avian DT40 cell line, we provide evidence that unscheduled DNA synthesis in mitosis does not require the translesion synthesis scaffold factor Rev1 or PCNA ubiquitylation at K164, which serve to recruit translesion polymerases to stalled forks. In line with this finding, translesion polymerase η foci do not colocalize with TopBP1 or FANCD2 in mitosis. Taken together, we conclude that TopBP1 promotes unscheduled DNA synthesis in mitosis independently of the examined translesion polymerases.

  14. Feasibility study report for the 200-BP-1 operable unit

    Energy Technology Data Exchange (ETDEWEB)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.

  15. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-06-01

    This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5

  16. Feasibility study report for the 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5

  17. Gclust Server: 121285 [Gclust Server

    Lifescience Database Archive (English)

    Full Text Available 121285 Npun1_NpF1957 Cluster Sequences Related Sequences(19) 329 ORF_ID:tlr1497~hyp...othetical protein [Thermosynechococcus elongatus BP-1] 1 1.00e-10 0.0 0.0 4.0 0.0 0.0 0.0 Show 121285 Cluster ID 1212

  18. CtBP1 over-expression in keratinocytes perturbs skin homeostasis

    Science.gov (United States)

    Deng, Hui; Li, Fulun; Li, Hong; Deng, Yu; Liu, Jing; Wang, Donna; Han, Gangwen; Wang, Xiao-Jing; Zhang, Qinghong

    2015-01-01

    Carboxyl-terminal binding protein-1 (CtBP1) is a transcriptional co-repressor with multiple in vitro targets, but its in vivo functions are largely unknown. We generated keratinocyte-specific CtBP1 transgenic mice with a keratin 5 promoter (K5.CtBP1) to probe the pathological roles of CtBP1. At transgene expression levels comparable with endogenous CtBP1 in acute skin wounds, K5.CtBP1 epidermis displayed hyperproliferation, loss of E-cadherin, and failed terminal differentiation. Known CtBP1 target genes associated with these processes, e.g., p21, Brca1, and E-cadherin were down-regulated in K5.CtBP1 skin. Surprisingly, K5.CtBP1 pups also exhibited a hair loss phenotype. We found that expression of the Distal-less 3 (Dlx3), a critical regulator of hair follicle differentiation and cycling, was decreased in K5.CtBP1 mice. Molecular studies revealed that CtBP1 directly suppressed Dlx3 transcription. Consistently, K5.CtBP1 mice displayed abnormal hair follicles with decreased expression of Dlx3 downstream targets Gata3, Hoxc13, and hair keratins. In sum, this first CtBP1 transgenic model provides in vivo evidence for certain CtBP1 functions predicted from in vitro studies, reveals to our knowledge previously unreported functions and transcriptional activities of CtBP1 in the context of epithelial-mesenchymal interplay, and suggest CtBP1 has a pathogenesis role in hair follicle morphogenesis and differentiation. PMID:24280726

  19. Lamin A/C-dependent interaction with 53BP1 promotes cellular responses to DNA damage

    DEFF Research Database (Denmark)

    Gibbs-Seymour, Ian; Markiewicz, Ewa; Bekker-Jensen, Simon

    2015-01-01

    damage. Lamins A/C regulate 53BP1 levels and consequently lamin A/C-null HDF display a 53BP1 null-like phenotype. Our data favour a model in which lamins A/C maintain a nucleoplasmic pool of 53BP1 in order to facilitate its rapid recruitment to sites of DNA damage and could explain why an absence...

  20. Levels of the E2 interacting protein TopBP1 modulate papillomavirus maintenance stage replication

    Energy Technology Data Exchange (ETDEWEB)

    Kanginakudru, Sriramana, E-mail: skangina@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); DeSmet, Marsha, E-mail: mdesmet@iupui.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Thomas, Yanique, E-mail: ysthomas@umail.iu.edu [Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States); Morgan, Iain M., E-mail: immorgan@vcu.edu [VCU Philips Institute for Oral Health Research, Virginia Commonwealth University, Richmond, Virginia (United States); Androphy, Elliot J., E-mail: eandro@iu.edu [Department of Dermatology, Indiana University School of Medicine, Indianapolis, IN (United States); Department of Microbiology and Immunology, Indiana University School of Medicine, Indianapolis, IN (United States)

    2015-04-15

    The evolutionarily conserved DNA topoisomerase II beta-binding protein 1 (TopBP1) functions in DNA replication, DNA damage response, and cell survival. We analyzed the role of TopBP1 in human and bovine papillomavirus genome replication. Consistent with prior reports, TopBP1 co-localized in discrete nuclear foci and was in complex with papillomavirus E2 protein. Similar to E2, TopBP1 is recruited to the region of the viral origin of replication during G1/S and early S phase. TopBP1 knockdown increased, while over-expression decreased transient virus replication, without affecting cell cycle. Similarly, using cell lines harboring HPV-16 or HPV-31 genome, TopBP1 knockdown increased while over-expression reduced viral copy number relative to genomic DNA. We propose a model in which TopBP1 serves dual roles in viral replication: it is essential for initiation of replication yet it restricts viral copy number. - Highlights: • Protein interaction study confirmed In-situ interaction between TopBP1 and E2. • TopBP1 present at papillomavirus ori in G1/S and early S phase of cell cycle. • TopBP1 knockdown increased, over-expression reduced virus replication. • TopBP1 protein level change did not influence cell survival or cell cycle. • TopBP1 displaced from papillomavirus ori after initiation of replication.

  1. BRCA1 Directs the Repair Pathway to Homologous Recombination by Promoting 53BP1 Dephosphorylation

    Directory of Open Access Journals (Sweden)

    Mayu Isono

    2017-01-01

    Full Text Available BRCA1 promotes homologous recombination (HR by activating DNA-end resection. By contrast, 53BP1 forms a barrier that inhibits DNA-end resection. Here, we show that BRCA1 promotes DNA-end resection by relieving the 53BP1-dependent barrier. We show that 53BP1 is phosphorylated by ATM in S/G2 phase, promoting RIF1 recruitment, which inhibits resection. 53BP1 is promptly dephosphorylated and RIF1 released, despite remaining unrepaired DNA double-strand breaks (DSBs. When resection is impaired by CtIP/MRE11 endonuclease inhibition, 53BP1 phosphorylation and RIF1 are sustained due to ongoing ATM signaling. BRCA1 depletion also sustains 53BP1 phosphorylation and RIF1 recruitment. We identify the phosphatase PP4C as having a major role in 53BP1 dephosphorylation and RIF1 release. BRCA1 or PP4C depletion impairs 53BP1 repositioning, EXO1 recruitment, and HR progression. 53BP1 or RIF1 depletion restores resection, RAD51 loading, and HR in PP4C-depleted cells. Our findings suggest that BRCA1 promotes PP4C-dependent 53BP1 dephosphorylation and RIF1 release, directing repair toward HR.

  2. BP1 Homeoprotein Enhances Metastatic Potential in ER-negative Breast Cancer

    Science.gov (United States)

    Fu, Yebo; Lian, Yi; Kim, Kyung Soon; Zhang, Lei; Hindle, A. Katharine; Brody, Fred; Siegel, Robert S.; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER-) tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. We sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target for ER- breast cancer. PMID:20842225

  3. TopBP1 associates with NBS1 and is involved in homologous recombination repair

    International Nuclear Information System (INIS)

    Morishima, Ken-ichi; Sakamoto, Shuichi; Kobayashi, Junya; Izumi, Hideki; Suda, Tetsuji; Matsumoto, Yoshiyuki; Tauchi, Hiroshi; Ide, Hiroshi; Komatsu, Kenshi; Matsuura, Shinya

    2007-01-01

    TopBP1 is involved in DNA replication and DNA damage checkpoint. Recent studies have demonstrated that TopBP1 is a direct positive effecter of ATR. However, it is not known how TopBP1 recognizes damaged DNA. Here, we show that TopBP1 formed nuclear foci after exposure to ionizing radiation, but such TopBP1 foci were abolished in Nijmegen breakage syndrome cells. We also show that TopBP1 physically associated with NBS1 in vivo. These results suggested that NBS1 might regulate TopBP1 recruitment to the sites of DNA damage. TopBP1-depleted cells showed hypersensitivity to Mitomycin C and ionizing radiation, an increased frequency of sister-chromatid exchange level, and a reduced frequency of DNA double-strand break induced homologous recombination repair. Together, these results suggested that TopBP1 might be a mediator of DNA damage signaling from NBS1 to ATR and promote homologous recombination repair

  4. BP1, an Isoform of DLX4 Homeoprotein, Negatively Regulates BRCA1 in Sporadic Breast Cancer

    Science.gov (United States)

    Kluk, Brian J.; Fu, Yebo; Formolo, Trina A.; Zhang, Lei; Hindle, Anne K.; Man, Yan-gao; Siegel, Robert S.; Berg, Patricia E.; Deng, Chuxia; McCaffrey, Timothy A.; Fu, Sidney W.

    2010-01-01

    Introduction: Several lines of evidence point to an important role for BP1, an isoform of DLX4 homeobox gene, in breast carcinogenesis and progression. BRCA1 is a well-known player in the etiology of breast cancer. While familial breast cancer is often marked by BRCA1 mutation and subsequent loss of heterozygosity, sporadic breast cancers exhibit reduced expression of wild type BRCA1, and loss of BRCA1 expression may result in tumor development and progression. Methods: The Cister algorithm and Genomatix program were used to identify potential BP1 binding sites in BRCA1 gene. Real-time PCR, Western blot and immunohistochemistry analysis were performed to verify the expression of BRCA1 and BP1 in cell lines and breast cancer tissues. Double-stranded siRNA transfection was carried out for silencing BP1 expression. ChIP and EMSA were used to confirm that BP1 specifically binds to BRCA1. Results: A putative BP1 binding site was identified in the first intron of BRCA1, which was confirmed by chromatin immunoprecipiation and electrophoresis mobility shift assay. BP1 and BRCA1 expression were inversely correlated in breast cancer cell lines and tissues, suggesting that BP1 may suppress BRCA1 transcription through consensus sequence binding. Conclusions: BP1 homeoprotein represses BRCA1 expression through direct binding to its first intron, which is consistent with a previous study which identified a novel transcriptional repressor element located more than 500 base pairs into the first intron of BRCA1, suggesting that the first intron plays an important role in the negative regulation of BRCA1. Although further functional studies are necessary to confirm its repressor activity towards BRCA1, the elucidation of the role of BP1 in breast tumorigenesis holds great promise in establishing BP1 as a novel target for drug therapy. PMID:20877436

  5. APP-BP1 inhibits Aβ42 levels by interacting with Presenilin-1

    Directory of Open Access Journals (Sweden)

    Neve Rachael L

    2007-02-01

    Full Text Available Abstract Background The β-amyloid precursor protein (APP is sequentially cleaved by the β- and then γ-secretase to generate the amyloid β-peptides Aβ40 and Aβ42. Increased Aβ42/Aβ40 ratios trigger amyloid plaque formations in Alzheimer's disease (AD. APP binds to APP-BP1, but the biological consequence is not well understood. Results We report that when the endogenous APP-BP1 was suppressed by small interfering RNAs (siRNAs, cell-associated Aβ42 was dramatically increased in APP695 expressing primary neurons. The accumulation of Aβ42 was accompanied by significant increases in APP and APP-CTF in APP-BP1 siRNA expressing neurons. In contrast, APP-BP1 overexpression in primary neurons significantly decreased the levels of Aβ and endogenous APP but not APLPs. We also investigated the potential mechanism of APP-BP1-mediated APP processing. APP-BP1 co-precipitated with Presenilin-1 (PS1 in native rat brain extracts, co-migrated with the γ-secretase components in brain membrane extracts in glycerol gradient centrifugation, and colocalized in primary neurons. Further, the endogenous PS1-CTF was significantly downregulated by APP-BP1 expression. Conclusion Our data suggest that APP-BP1 may inhibit Aβ42 production by interacting with PS1 under physiological conditions.

  6. BP1 Homeoprotein Enhances Metastatic Potential in Er-Negative Breast Cancer

    Directory of Open Access Journals (Sweden)

    Yebo Fu, Yi Lian, Kyung Soon Kim, Lei Zhang, A. Katharine Hindle, Fred Brody, Robert S. Siegel, Timothy A. McCaffrey, Sidney W. Fu

    2010-01-01

    Full Text Available Tumor invasion and metastasis remain a major cause of mortality in breast cancer patients. It was reported that BP1, a homeobox isoform of DLX4, is overexpressed in 80% of breast cancer patients and in 100% of estrogen receptor negative (ER- tumors. The prevalence of BP1 positive cells and the intensity of BP1 immunoreactivity increased with the extent of ductal proliferation and tumorigenesis. These findings imply that BP1 may play an important role in ER- breast cancer. I sought to determine the effects and mechanisms of BP1 on cell proliferation and metastasis using ER- Hs578T cells as a model. Cells were transfected with either pcDNA3.2 plasmid containing BP1 gene, or pcDNA3.2 vector, then selected and cloned. Overexpression of BP1 increased cell proliferation rate by 2-5 fold (p<0.005, and enhanced the in vitro invasive activity by 25-65 fold (p<0.001. Microarray experiments were performed to identify differentially expressed genes when BP1 is overexpressed. The gene expression profile of the transfected cell lines were compared, resulting in 71 differentially expressed genes with a fold-change of >=2.0. Of those genes, 49 were up-regulated and 22 were down-regulated. Significant pathways were identified involving cell proliferation and metastasis. These data demonstrated that overexpression of BP1 significantly enhanced cell proliferation and metastatic potential in ER- Hs578T cells. Further analysis with more ER- cell lines and patient samples is warranted to establish BP1 as a therapeutic target.

  7. Reproductive biology of the Del Norte salamander (Plethodon elongatus).

    Science.gov (United States)

    Clara A. Wheeler; Hartwell H. Welsh Jr.; Lisa M. Ollivier

    2013-01-01

    We examined seasonal reproductive patterns of the Del Norte Salamander, Plethodon elongatus, in mixed conifer and hardwood forests of northwestern California and southwestern Oregon. Seasonal size differences in reproductive structures suggested that maximum spermatogenic activity occurred during the late summer, with spermatozoa transfer to the...

  8. studies on trace metal concentration pseudotolithus elongatus from ...

    African Journals Online (AJOL)

    DJFLEX

    ecological and human health implications of Lead (Pb) pollution are discussed. KEY WORDS: Trace metals, Lead Pollution, Pseudotolithus elongatus, Mbo coastal waters, Nigeria. INTRODUCTION. Anthropogenic activities which have taken place for the past two decades have greatly impacted on the marine ecosystem ...

  9. ALS mutant SOD1 interacts with G3BP1 and affects stress granule dynamics.

    Science.gov (United States)

    Gal, Jozsef; Kuang, Lisha; Barnett, Kelly R; Zhu, Brian Z; Shissler, Susannah C; Korotkov, Konstantin V; Hayward, Lawrence J; Kasarskis, Edward J; Zhu, Haining

    2016-10-01

    Amyotrophic lateral sclerosis (ALS) is a fatal neurodegenerative disease. Mutations in Cu/Zn superoxide dismutase (SOD1) are responsible for approximately 20 % of the familial ALS cases. ALS-causing SOD1 mutants display a gain-of-toxicity phenotype, but the nature of this toxicity is still not fully understood. The Ras GTPase-activating protein-binding protein G3BP1 plays a critical role in stress granule dynamics. Alterations in the dynamics of stress granules have been reported in several other forms of ALS unrelated to SOD1. To our surprise, the mutant G93A SOD1 transgenic mice exhibited pathological cytoplasmic inclusions that co-localized with G3BP1-positive granules in spinal cord motor neurons. The co-localization was also observed in fibroblast cells derived from familial ALS patient carrying SOD1 mutation L144F. Mutant SOD1, unlike wild-type SOD1, interacted with G3BP1 in an RNA-independent manner. Moreover, the interaction is specific for G3BP1 since mutant SOD1 showed little interaction with four other RNA-binding proteins implicated in ALS. The RNA-binding RRM domain of G3BP1 and two particular phenylalanine residues (F380 and F382) are critical for this interaction. Mutant SOD1 delayed the formation of G3BP1- and TIA1-positive stress granules in response to hyperosmolar shock and arsenite treatment in N2A cells. In summary, the aberrant mutant SOD1-G3BP1 interaction affects stress granule dynamics, suggesting a potential link between pathogenic SOD1 mutations and RNA metabolism alterations in ALS.

  10. Purification, characterization and stability of barley grain peroxidase BP1, a new type of plant peroxidase

    DEFF Research Database (Denmark)

    Rasmussen, Christine B; Henriksen, Anette; Abelskov, A. Katrine

    1997-01-01

    -protoporphyrin IX, which is characteristic of plant peroxidases. BP 1 is stable from pH 3 to 11, indicating that its unusual spectral characteristics do not result from enzyme instability. The thermostability is also normal with a melting temperature of 75 degrees C at pH 6.6, and 67 degrees C at pH 4.0 and 8......The major peroxidase of barley grain (BP 1) has enzymatic and spectroscopic properties that are very differeant from those of other known plant peroxidases (EC 1.11.1.7) and can therefore contribute to the understanding of the many physiological functions ascribed to these enzymes. To study.......3. It is clear that the unusual properties of BP 1 are genuine, and reflect a novel regulation of plant peroxidase function....

  11. TopBP1/Dpb11 binds DNA anaphase bridges to prevent genome instability

    DEFF Research Database (Denmark)

    Germann, Susanne M; Schramke, Vera; Pedersen, Rune Troelsgaard

    2014-01-01

    yeast Saccharomyces cerevisiae and the avian DT40 cell line as model systems for studying DNA anaphase bridges and show that TopBP1/Dpb11 plays an evolutionarily conserved role in their metabolism. Together with the single-stranded DNA binding protein RPA, TopBP1/Dpb11 binds to UFBs, and depletion......DNA anaphase bridges are a potential source of genome instability that may lead to chromosome breakage or nondisjunction during mitosis. Two classes of anaphase bridges can be distinguished: DAPI-positive chromatin bridges and DAPI-negative ultrafine DNA bridges (UFBs). Here, we establish budding...

  12. APP-BP1 inhibits Aβ42 levels by interacting with Presenilin-1

    OpenAIRE

    Chen, Yuzhi; Bodles, Angela M; McPhie, Donna L; Neve, Rachael L; Mrak, Robert E; Griffin, W Sue T

    2007-01-01

    Abstract Background The β-amyloid precursor protein (APP) is sequentially cleaved by the β- and then γ-secretase to generate the amyloid β-peptides Aβ40 and Aβ42. Increased Aβ42/Aβ40 ratios trigger amyloid plaque formations in Alzheimer's disease (AD). APP binds to APP-BP1, but the biological consequence is not well understood. Results We report that when the endogenous APP-BP1 was suppressed by small interfering RNAs (siRNAs), cell-associated Aβ42 was dramatically increased in APP695 express...

  13. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob

    2015-01-01

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon...... temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin...

  14. Inhibition of HIF-1{alpha} activity by BP-1 ameliorates adjuvant induced arthritis in rats

    Energy Technology Data Exchange (ETDEWEB)

    Shankar, J. [Department of Microbiology and Immunology, University of Illinois at Chicago, Chicago (United States); Thippegowda, P.B., E-mail: btprabha@uic.edu [Department of Pharmacology, (M/C 868), College of Medicine, University of Illinois at Chicago, 835 S. Wolcott Ave., Chicago, IL 60612 (United States); Kanum, S.A. [Department of Chemistry, Yuvaraj' s College, University of Mysore, Mysore (India)

    2009-09-18

    Rheumatoid arthritis (RA) is a chronic inflammatory, angiogenic disease. Inflamed synovitis is a hallmark of RA which is hypoxic in nature. Vascular endothelial growth factor (VEGF), one of the key regulators of angiogenesis, is overexpressed in the pathogenesis of RA. VEGF expression is regulated by hypoxia-inducible factor-1{alpha} (HIF-1{alpha}), a master regulator of homeostasis which plays a pivotal role in hypoxia-induced angiogenesis. In this study we show that synthetic benzophenone analogue, 2-benzoyl-phenoxy acetamide (BP-1) can act as a novel anti-arthritic agent in an experimental adjuvant induced arthritis (AIA) rat model by targeting VEGF and HIF-1{alpha}. BP-1 administered hypoxic endothelial cells and arthritic animals clearly showed down regulation of VEGF expression. Further, BP-1 inhibits nuclear translocation of HIF-1{alpha}, which in turn suppresses transcription of the VEGF gene. These results suggest a further possible clinical application of the BP-1 derivative as an anti-arthritic agent in association with conventional chemotherapeutic agents.

  15. 53BP1 fosters fidelity of homology-directed DNA repair

    DEFF Research Database (Denmark)

    Ochs, Fena; Somyajit, Kumar; Altmeyer, Matthias

    2016-01-01

    fosters its fidelity. These findings illuminate causes and consequences of synthetic viability acquired through 53BP1 silencing in cells lacking the BRCA1 tumor suppressor. We show that such cells survive DSB assaults at the cost of increasing reliance on RAD52-mediated HDR, which may fuel genome...

  16. Purification, characterization and stability of barley grain peroxidase BP1, a new type of plant peroxidase

    DEFF Research Database (Denmark)

    Rasmussen, Christine B; Henriksen, Anette; Abelskov, A. Katrine

    1997-01-01

    The major peroxidase of barley grain (BP 1) has enzymatic and spectroscopic properties that are very differeant from those of other known plant peroxidases (EC 1.11.1.7) and can therefore contribute to the understanding of the many physiological functions ascribed to these enzymes. To study...

  17. Subversion of CtBP1-controlled macropinocytosis by human adenovirus serotype 3.

    Science.gov (United States)

    Amstutz, Beat; Gastaldelli, Michele; Kälin, Stefan; Imelli, Nicola; Boucke, Karin; Wandeler, Eliane; Mercer, Jason; Hemmi, Silvio; Greber, Urs F

    2008-04-09

    Endocytosis supports cell communication, growth, and pathogen infection. The species B human adenovirus serotype 3 (Ad3) is associated with epidemic conjunctivitis, and fatal respiratory and systemic disease. Here we show that Ad3 uses dynamin-independent endocytosis for rapid infectious entry into epithelial and haematopoietic cells. Unlike Ad5, which uses dynamin-dependent endocytosis, Ad3 endocytosis spatially and temporally coincided with enhanced fluid-phase uptake. It was sensitive to macropinocytosis inhibitors targeting F-actin, protein kinase C, the sodium-proton exchanger, and Rac1 but not Cdc42. Infectious Ad3 macropinocytosis required viral activation of p21-activated kinase 1 (PAK1) and the C-terminal binding protein 1 of E1A (CtBP1), recruited to macropinosomes. These macropinosomes also contained the Ad3 receptors CD46 and alpha v integrins. CtBP1 is a phosphorylation target of PAK1, and is bifunctionally involved in membrane traffic and transcriptional repression of cell cycle, cancer, and innate immunity pathways. Phosphorylation-defective S147A-CtBP1 blocked Ad3 but not Ad5 infection, providing a direct link between PAK1 and CtBP1. The data show that viruses induce macropinocytosis for infectious entry, a pathway used in antigen presentation and cell migration.

  18. Linker proteins enable ultrafast excitation energy transfer in the phycobilisome antenna system of Thermosynechococcus vulcanus.

    Science.gov (United States)

    Nganou, C; David, L; Adir, N; Mkandawire, M

    2016-01-01

    We applied a femtosecond flash method, using induced transient absorption changes, to obtain a time-resolved view of excitation energy transfer in intact phycobilisomes of Thermosynechococcus vulcanus at room temperature. Our measurement of an excitation energy transfer rate of 888 fs in phycobilisomes shows the existence of ultrafast kinetics along the phycocyanin rod subcomplex to the allophycocyanin core that is faster than expected for previous excitation energy transfer based on Förster theory in phycobilisomes. Allophycocyanin in the core further transfers energy to the terminal emitter(s) in 17 ps. In the phycobilisome, rod doublets composed of hexameric phycocyanin discs and internal linker proteins are arranged in a parallel fashion, facilitating direct rod-rod interactions. Excitonic splitting likely drives rod absorption at 635 nm as a result of strong coupling between β84 chromophores (20 ± 1 Å) in adjacent hexamers. In comparison to the absorbance of the phycobilisome antenna system of the cyanobacterium Acaryochloris marina, which possesses a single rod structure, the linkers in T. vulcanus rods induce a 17 nm red shift in the absorbance spectrum. Furthermore, the kinetics of 888 fs indicates that the presence of the linker protein induces ultrafast excitation energy transfer between phycocyanin and allophycocyanin inside the phycobilisome, which is faster than all previous excitation energy transfer in phycobilisome subunits or sub-complexes reported to date.

  19. Phase 1 remedial investigation report for 200-BP-1 operable unit. Volume 1

    Energy Technology Data Exchange (ETDEWEB)

    1993-09-01

    The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit.

  20. Phase 1 remedial investigation report for 200-BP-1 operable unit

    International Nuclear Information System (INIS)

    1993-09-01

    The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit

  1. Snail determines the therapeutic response to mTOR kinase inhibitors by transcriptional repression of 4E-BP1.

    Science.gov (United States)

    Wang, Jun; Ye, Qing; Cao, Yanan; Guo, Yubin; Huang, Xiuping; Mi, Wenting; Liu, Side; Wang, Chi; Yang, Hsin-Sheng; Zhou, Binhua P; Evers, B Mark; She, Qing-Bai

    2017-12-20

    Loss of 4E-BP1 expression has been linked to cancer progression and resistance to mTOR inhibitors, but the mechanism underlying 4E-BP1 downregulation in tumors remains unclear. Here we identify Snail as a strong transcriptional repressor of 4E-BP1. We find that 4E-BP1 expression inversely correlates with Snail level in cancer cell lines and clinical specimens. Snail binds to three E-boxes present in the human 4E-BP1 promoter to repress transcription of 4E-BP1. Ectopic expression of Snail in cancer cell lines lacking Snail profoundly represses 4E-BP1 expression, promotes cap-dependent translation in polysomes, and reduces the anti-proliferative effect of mTOR kinase inhibitors. Conversely, genetic and pharmacological inhibition of Snail function restores 4E-BP1 expression and sensitizes cancer cells to mTOR kinase inhibitors by enhancing 4E-BP1-mediated translation-repressive effect on cell proliferation and tumor growth. Our study reveals a critical Snail-4E-BP1 signaling axis in tumorigenesis, and provides a rationale for targeting Snail to improve mTOR-targeted therapies.

  2. cDNA, amino acid carbohydrate sequence of barley seed-specific peroxidase BP 1

    DEFF Research Database (Denmark)

    Johansson, A.; Rasmussen, Søren Kjærsgård; Harthill, J.E.

    1992-01-01

    of 69% in the translated region, a 90% G or C preference in the wobble position of the codons and a typical signal peptide sequence. N-terminal amino acid sequencing and sequence analysis of tryptic peptides verified 98% of the sequence of the mature BP 1 which contains 309 amino acid residues. BP 1...... biological role of this enzyme. The barley peroxidase is processed at the C-terminus and might be targeted to the vacuole. The single site of glycosylation is located near the C-terminus in the N-glycosylation sequon -Asn-Cys-Ser- in which Cys forms part of a disulphide bridge. The major glycan is a typical...

  3. The Functional Role of TopBP1 in DNA Maintenance at Mitosis

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard

    When cells traverse mitosis, genome integrity of the emerging daughter cells is dependent on replication of the entire genome during the preceding S-phase and accurate chromosome segregation in mitosis. Replication stress may cause cells to enter mitosis with underreplicated loci, consisting...... can lead to anaphase bridges that impair accurate chromosome segregation. The recent decade featured many advances in our understanding of how cells cope with underreplicated loci in mitosis. A major advance was the description of ultra-fine anaphase bridges (UFBs), a class of anaphase bridges...... established Saccharomyces cerevisiae as a model organism to study anaphase bridges, and we identified Dpb11/TopBP1 as a novel UFB-associated protein in yeast and avian DT40 cells, respectively. TopBP1 localized to confined areas on replication-stress induced UFBs. Upon onset of mitosis we observed a burst...

  4. Regulation of 4E-BP1 activity in the mammalian oocyte

    Czech Academy of Sciences Publication Activity Database

    Jansová, Denisa; Končická, Markéta; Tětková, Anna; Černá, Renata; Malík, Radek; del Llano, Edgar; Kubelka, Michal; Šušor, Andrej

    2017-01-01

    Roč. 16, č. 10 (2017), s. 927-939 ISSN 1538-4101 R&D Projects: GA ČR GA13-12291S; GA ČR GA15-22765S; GA MŠk EF15_003/0000460 Institutional support: RVO:67985904 ; RVO:68378050 Keywords : 4E-BP1 * CDK1 * cumulus cells Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology Impact factor: 3.530, year: 2016

  5. TopBP1 is required at mitosis to reduce transmission of DNA damage to G1 daughter cells

    Science.gov (United States)

    Pedersen, Rune Troelsgaard; Kruse, Thomas; Nilsson, Jakob

    2015-01-01

    Genome integrity is critically dependent on timely DNA replication and accurate chromosome segregation. Replication stress delays replication into G2/M, which in turn impairs proper chromosome segregation and inflicts DNA damage on the daughter cells. Here we show that TopBP1 forms foci upon mitotic entry. In early mitosis, TopBP1 marks sites of and promotes unscheduled DNA synthesis. Moreover, TopBP1 is required for focus formation of the structure-selective nuclease and scaffold protein SLX4 in mitosis. Persistent TopBP1 foci transition into 53BP1 nuclear bodies (NBs) in G1 and precise temporal depletion of TopBP1 just before mitotic entry induced formation of 53BP1 NBs in the next cell cycle, showing that TopBP1 acts to reduce transmission of DNA damage to G1 daughter cells. Based on these results, we propose that TopBP1 maintains genome integrity in mitosis by controlling chromatin recruitment of SLX4 and by facilitating unscheduled DNA synthesis. PMID:26283799

  6. Uptake of uranium from sea water by Synechococcus elongatus

    International Nuclear Information System (INIS)

    Horikoshi, Takao; Nakajima, Akira; Sakaguchi, Takashi

    1979-01-01

    Basic features of the uranium uptake by Synechococcus elongatus, and the factors affecting it were examined. Synechococcus elongatus was grown in Roux flasks containing 1 liter of culture solution in light (20,000 lux) and with aeration at 30 deg C. Synechococcus cells in the linear growth phase were collected by centrifugation at 6,000 x g for 5 minutes, washed with sea water, and used for the uranium-uptake experiments. The uptake of uranium from sea water containing 1 ppm of the element was strongly affected by the pH of sea water. The optimum uptake was at pH 5. Presence of carbonate ions markedly inhibited and decarbonation of sea water greatly enhanced the uptake. Absorption of uranium by Synechococcus cells was initially rapid, and reached a plateau within 24 hours. The uranium accumulation capacity of Synechococcus cells was increased by heat treatment, the capacity of scalded cells being about twice as much as that of living cells. Most of the uranium absorbed by Synechococcus was found in the inner space of the cells, and only a small amount was present in the cell walls. (Kaihara, S.)

  7. Feasibility study report for the 200-BP-1 operable unit. Revision 1

    Energy Technology Data Exchange (ETDEWEB)

    1994-01-01

    This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 {times} 10{sup 5}.

  8. Nucleoporin NUP153 guards genome integrity by promoting nuclear import of 53BP1

    Czech Academy of Sciences Publication Activity Database

    Moudrý, Pavel; Lukas, C.; Macůrek, Libor; Neumann, B.; Heriche, J.K.; Pepperkok, R.; Ellenberg, J.; Hodný, Zdeněk; Lukas, J.; Bartek, Jiří

    2012-01-01

    Roč. 19, č. 5 (2012), s. 798-807 ISSN 1350-9047 R&D Projects: GA ČR GA301/08/0353; GA ČR GAP301/10/1525; GA ČR GPP305/10/P420 Grant - others:7.RP EU(XE) CZ.1.05/2.1.00/01.0030 Institutional research plan: CEZ:AV0Z50520514 Keywords : DNA damage response * NUP153 * 53BP1 nuclear import Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 8.371, year: 2012

  9. Dpb11/TopBP1 contributes to genomicstability via homologous recombinationand checkpoint signaling

    DEFF Research Database (Denmark)

    Germann, Susanne Manuela

    for recruitment. Also, the chicken homologue TopBP1 colocalizes with RPA1 as well as Rad51 when DNA damage is induced. Previously, dpb11 mutants have been shown to be sensitive to DNA-damaging agents that cause DSBs, DNA alkylation and stalled replication forks. Interestingly, we found the point mutants dpb11-PF...... and dpb11-R being exclusively sensitive to DSB-inducing agents, suggesting a separation of function between DNA repair and replication. These two mutants interact significantly less with members of the 9-1-1 complex or the Rad24 clamp loader in a two-hybrid analysis, suggesting a defect in checkpoint...

  10. GEMC1 is a TopBP1-interacting protein required for chromosomal DNA replication.

    Science.gov (United States)

    Balestrini, Alessia; Cosentino, Claudia; Errico, Alessia; Garner, Elizabeth; Costanzo, Vincenzo

    2010-05-01

    Many of the factors required for chromosomal DNA replication have been identified in unicellular eukaryotes. However, DNA replication is poorly understood in multicellular organisms. Here, we report the identification of GEMC1 (geminin coiled-coil containing protein 1), a novel vertebrate protein required for chromosomal DNA replication. GEMC1 is highly conserved in vertebrates and is preferentially expressed in proliferating cells. Using Xenopus laevis egg extract we show that Xenopus GEMC1 (xGEMC1) binds to the checkpoint and replication factor TopBP1, which promotes binding of xGEMC1 to chromatin during pre-replication complex (pre-RC) formation. We demonstrate that xGEMC1 interacts directly with replication factors such as Cdc45 and the kinase Cdk2-CyclinE, through which it is heavily phosphorylated. Phosphorylated xGEMC1 stimulates initiation of DNA replication, whereas depletion of xGEMC1 prevents the onset of DNA replication owing to the impairment of Cdc45 loading onto chromatin. Similarly, inhibition of GEMC1 expression with morpholino and siRNA oligos prevents DNA replication in embryonic and somatic vertebrate cells. These data suggest that GEMC1 promotes initiation of chromosomal DNA replication in multicellular organisms by mediating TopBP1- and Cdk2-dependent recruitment of Cdc45 onto replication origins.

  11. GEMC1 is a TopBP1 interacting protein required for chromosomal DNA replication

    Science.gov (United States)

    Balestrini, Alessia; Cosentino, Claudia; Errico, Alessia; Garner, Elizabeth; Costanzo, Vincenzo

    2010-01-01

    Many factors required for chromosomal DNA replication have been identified in unicellular eukaryotes. However, DNA replication in complex multicellular organisms is poorly understood. Here, we report the identification of GEMC1, a novel vertebrate protein required for chromosomal DNA replication. GEMC1 is highly conserved in vertebrates and is preferentially expressed in proliferating cells. Using Xenopus egg extract we show that Xenopus GEMC1 (xGEMC1) binds to checkpoint and replication factor TopBP1, which promotes xGEMC1 binding to chromatin during pre-replication complex (pre-RC) formation. We demonstrate that xGEMC1 directly interacts with replication factors such as Cdc45 and Cdk2-CyclinE by which it is heavily phosphorylated. Phosphorylated xGEMC1 stimulates initiation of DNA replication whereas depletion of xGEMC1 prevents DNA replication onset due to impairment of Cdc45 loading onto chromatin. Likewise, inhibition of GEMC1 expression by morpholino and siRNA oligos prevents DNA replication in embryonic and somatic vertebrate cells. These data suggest that GEMC1 promotes initiation of chromosomal DNA replication in higher eukaryotes by mediating TopBP1 and Cdk2 dependent recruitment of Cdc45 onto replication origins. PMID:20383140

  12. Biological Observations on the Mudskipper Pseudapocryptes elongatus in the Mekong Delta, Vietnam

    DEFF Research Database (Denmark)

    Bucholtz, R. H.; Meilvang, A. S.; Cedhagen, Tomas

    2009-01-01

    Aspects of the population biology of the mudskipper, Pseudapocryptes elongatus, (Cuvier, 1816) were studied in Bac Lieu Province in the Lower Mekong Delta, Vietnam, including sex ratio, length–frequency distribution, sexual dimorphism, hepatosomatic index (HSI), female gonadosomatic index (GSI...

  13. The Functional Role of TopBP1 in DNA Maintenance at Mitosis

    DEFF Research Database (Denmark)

    Pedersen, Rune Troelsgaard

    that are devoid of histones and do not stain with DAPI. Some of these UFBs are induced by replication stress and interlink CFSs on segregating sister chromatids in anaphase. Another major advance was the discovery of active processing of underreplicated loci by structure-selective endonucleases MUS81 and GEN1......When cells traverse mitosis, genome integrity of the emerging daughter cells is dependent on replication of the entire genome during the preceding S-phase and accurate chromosome segregation in mitosis. Replication stress may cause cells to enter mitosis with underreplicated loci, consisting....... This active processing was found to be an underlying mechanism of CFS expression. A final advance was the description of how DNA damage, arising as a consequence of replication stress in S-phase, was shielded in 53BP1 nuclear bodies (NBs), preventing untimely DNA repair during the subsequent G1-phase. We...

  14. A Damage-Independent Role for 53BP1 that Impacts Break Order and Igh Architecture during Class Switch Recombination

    Directory of Open Access Journals (Sweden)

    Pedro P. Rocha

    2016-06-01

    Full Text Available During class switch recombination (CSR, B cells replace the Igh Cμ or δ exons with another downstream constant region exon (CH, altering the antibody isotype. CSR occurs through the introduction of AID-mediated double-strand breaks (DSBs in switch regions and subsequent ligation of broken ends. Here, we developed an assay to investigate the dynamics of DSB formation in individual cells. We demonstrate that the upstream switch region Sμ is first targeted during recombination and that the mechanism underlying this control relies on 53BP1. Surprisingly, regulation of break order occurs through residual binding of 53BP1 to chromatin before the introduction of damage and independent of its established role in DNA repair. Using chromosome conformation capture, we show that 53BP1 mediates changes in chromatin architecture that affect break order. Finally, our results explain how changes in Igh architecture in the absence of 53BP1 could promote inversional rearrangements that compromise CSR.

  15. 53BP1 nuclear bodies form around DNA lesions generated by mitotic transmission of chromosomes under replication stress

    DEFF Research Database (Denmark)

    Lukas, Claudia; Savic, Velibor; Bekker-Jensen, Simon

    2011-01-01

    stress increases the frequency of chromosomal lesions that are transmitted to daughter cells. Throughout G1, these lesions are sequestered in nuclear compartments marked by p53-binding protein 1 (53BP1) and other chromatin-associated genome caretakers. We show that the number of such 53BP1 nuclear bodies...... increases after genetic ablation of BLM, a DNA helicase associated with dissolution of entangled DNA. Conversely, 53BP1 nuclear bodies are partially suppressed by knocking down SMC2, a condensin subunit required for mechanical stability of mitotic chromosomes. Finally, we provide evidence that 53BP1 nuclear...... bodies shield chromosomal fragile sites sequestered in these compartments against erosion. Together, these data indicate that restoration of DNA or chromatin integrity at loci prone to replication problems requires mitotic transmission to the next cell generations....

  16. Quantitative analysis of the interplay between hsc70 and its co-chaperone HspBP1

    Directory of Open Access Journals (Sweden)

    Hicham Mahboubi

    2015-12-01

    Full Text Available Background. Chaperones and their co-factors are components of a cellular network; they collaborate to maintain proteostasis under normal and harmful conditions. In particular, hsp70 family members and their co-chaperones are essential to repair damaged proteins. Co-chaperones are present in different subcellular compartments, where they modulate chaperone activities.Methods and Results. Our studies assessed the relationship between hsc70 and its co-factor HspBP1 in human cancer cells. HspBP1 promotes nucleotide exchange on hsc70, but has also chaperone-independent functions. We characterized the interplay between hsc70 and HspBP1 by quantitative confocal microscopy combined with automated image analyses and statistical evaluation. Stress and the recovery from insult changed significantly the subcellular distribution of hsc70, but had little effect on HspBP1. Single-cell measurements and regression analysis revealed that the links between the chaperone and its co-factor relied on (i the physiological state of the cell and (ii the subcellular compartment. As such, we identified a linear relationship and strong correlation between hsc70 and HspBP1 distribution in control and heat-shocked cells; this correlation changed in a compartment-specific fashion during the recovery from stress. Furthermore, we uncovered significant stress-induced changes in the colocalization between hsc70 and HspBP1 in the nucleus and cytoplasm.Discussion. Our quantitative approach defined novel properties of the co-chaperone HspBP1 as they relate to its interplay with hsc70. We propose that changes in cell physiology promote chaperone redistribution and thereby stimulate chaperone-independent functions of HspBP1.

  17. Replication-Coupled Dilution of H4K20me2 Guides 53BP1 to Pre-replicative Chromatin.

    Science.gov (United States)

    Pellegrino, Stefania; Michelena, Jone; Teloni, Federico; Imhof, Ralph; Altmeyer, Matthias

    2017-05-30

    The bivalent histone modification reader 53BP1 accumulates around DNA double-strand breaks (DSBs), where it dictates repair pathway choice decisions by limiting DNA end resection. How this function is regulated locally and across the cell cycle to channel repair reactions toward non-homologous end joining (NHEJ) in G1 and promote homology-directed repair (HDR) in S/G2 is insufficiently understood. Here, we show that the ability of 53BP1 to accumulate around DSBs declines as cells progress through S phase and reveal that the inverse relationship between 53BP1 recruitment and replicated chromatin is linked to the replication-coupled dilution of 53BP1's target mark H4K20me2. Consistently, premature maturation of post-replicative chromatin restores H4K20me2 and rescues 53BP1 accumulation on replicated chromatin. The H4K20me2-mediated chromatin association of 53BP1 thus represents an inbuilt mechanism to distinguish DSBs in pre- versus post-replicative chromatin, allowing for localized repair pathway choice decisions based on the availability of replication-generated template strands for HDR. Copyright © 2017 The Author(s). Published by Elsevier Inc. All rights reserved.

  18. BRCA1-associated exclusion of 53BP1 from DNA damage sites underlies temporal control of DNA repair

    Science.gov (United States)

    Chapman, J. Ross; Sossick, Alex J.; Boulton, Simon J.; Jackson, Stephen P.

    2012-01-01

    Summary Following irradiation, numerous DNA-damage-responsive proteins rapidly redistribute into microscopically visible subnuclear aggregates, termed ionising-radiation-induced foci (IRIF). How the enrichment of proteins on damaged chromatin actually relates to DNA repair remains unclear. Here, we use super-resolution microscopy to examine the spatial distribution of BRCA1 and 53BP1 proteins within single IRIF at subdiffraction-limit resolution, yielding an unprecedented increase in detail that was not previously apparent by conventional microscopy. Consistent with a role for 53BP1 in promoting DNA double-strand break repair by non-homologous end joining, 53BP1 enrichment in IRIF is most prominent in the G0/G1 cell cycle phases, where it is enriched in dense globular structures. By contrast, as cells transition through S phase, the recruitment of BRCA1 into the core of IRIF is associated with an exclusion of 53BP1 to the focal periphery, leading to an overall reduction of 53BP1 occupancy at DNA damage sites. Our data suggest that the BRCA1-associated IRIF core corresponds to chromatin regions associated with repair by homologous recombination, and the enrichment of BRCA1 in IRIF represents a temporal switch in the DNA repair program. We propose that BRCA1 antagonises 53BP1-dependent DNA repair in S phase by inhibiting its interaction with chromatin proximal to damage sites. Furthermore, the genomic instability exhibited by BRCA1-deficient cells might result from a failure to efficiently exclude 53BP1 from such regions during S phase. PMID:22553214

  19. 200-BP-1 Prototype Hanford Barrier -- 15 Years of Performance Monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Anderson L.; Draper, Kathryn E.; Link, Steven O.; Clayton, Ray E.

    2011-09-30

    Monitoring is an essential component of engineered barrier system design and operation. A composite capacitive cover, including a capillary break and an evapotranspiration (ET) barrier at the Hanford Site, is generating data that can be used to help resolve these issues. The prototype Hanford barrier was constructed over the 216-B-57 Crib in 1994 to evaluate surface-barrier constructability, construction costs, and physical and hydrologic performance at the field scale. The barrier has been routinely monitored between November 1994 and September 1998 as part of a Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) treatability test of barrier performance for the 200 BP 1 Operable Unit. Since FY 1998, monitoring has focused on a more limited set of key water balance, stability, and biotic parameters. In FY 2009, data collection was focused on: (1) water-balance monitoring, consisting of precipitation, runoff, soil moisture storage, and drainage measurements with evapotranspiration calculated by difference; (2) stability monitoring, consisting of asphalt-layer-settlement, basalt-side-slope-stability, and surface-elevation measurements; (3) vegetation dynamics; and (4) animal use. September 2009 marked 15 years since the start of monitoring and the collection of performance data. This report describes the results of monitoring activities during the period October 1, 2008, through September 30, 2009, and summarizes the 15 years of performance data collected from September 1994 through September 2009.

  20. Expanding the BP1-BP2 15q11.2 Microdeletion Phenotype: Tracheoesophageal Fistula and Congenital Cataracts

    Directory of Open Access Journals (Sweden)

    D. Wong

    2013-01-01

    Full Text Available The proximal q arm of chromosome 15 contains breakpoint regions BP1–BP5 with the classic deletion of BP1–BP3 best known to be associated with Prader-Willi and Angelman syndromes. The region is approximately 500 kb and microdeletions within the BP1-BP2 region have been reported in patients with developmental delay, behavioral abnormalities, and motor apraxia as well as dysmorphic features including hypertelorism, cleft or narrow palate, ear abnormalities, and recurrent upper airway infections. We report two patients with unique, never-before-reported 15q11.2 BP1-2 microdeletion syndrome findings, one with proximal esophageal atresia and distal tracheoesophageal fistula (type C and one with congenital cataracts. Cataracts have been described in Prader-Willi syndrome but we could not find any description of cataracts in Angelman syndrome. Esophageal atresia and tracheoesophageal fistula have not been reported to our knowledge in either syndrome. A chance exists that both cases are sporadic birth defects; however, the findings of the concomitant microdeletion cannot be overlooked as a possible cause. Based on our review of the literature and the presentation of our patients, we recommend that esophageal atresia and distal tracheoesophageal fistula as well as congenital cataracts be included in the phenotypic spectrum of 15q11.2 BP1-2 microdeletion syndrome.

  1. CtBP1/BARS is an activator of phospholipase D1 necessary for agonist-induced macropinocytosis.

    Science.gov (United States)

    Haga, Yuki; Miwa, Noriko; Jahangeer, Saleem; Okada, Taro; Nakamura, Shun-ichi

    2009-05-06

    Vesicular trafficking such as macropinocytosis is a dynamic process that requires coordinated interactions between specialized proteins and lipids. A recent report suggests the involvement of CtBP1/BARS in epidermal growth factor (EGF)-induced macropinocytosis. Detailed mechanisms as to how lipid remodelling is regulated during macropinocytosis are still undefined. Here, we show that CtBP1/BARS is a physiological activator of PLD1 required in agonist-induced macropinocytosis. EGF-induced macropinocytosis was specifically blocked by 1-butanol but not by 2-butanol. In addition, stimulation of cells by serum or EGF resulted in the association of CtBP1/BARS with PLD1. Finally, CtBP1/BARS activated PLD1 in a synergistic manner with other PLD activators, including ADP-ribosylation factors as demonstrated by in vitro and intact cell systems. The present results shed light on the molecular basis of how the 'fission protein' CtBP1/BARS controls vesicular trafficking events including macropinocytosis.

  2. Increased 4E-BP1 Expression Protects against Diet-Induced Obesity and Insulin Resistance in Male Mice

    Directory of Open Access Journals (Sweden)

    Shih-Yin Tsai

    2016-08-01

    Full Text Available Obesity is a major risk factor driving the global type II diabetes pandemic. However, the molecular factors linking obesity to disease remain to be elucidated. Gender differences are apparent in humans and are also observed in murine models. Here, we link these differences to expression of eukaryotic translation initiation factor 4E binding protein 1 (4E-BP1, which, upon HFD feeding, becomes significantly reduced in the skeletal muscle and adipose tissue of male but not female mice. Strikingly, restoring 4E-BP1 expression in male mice protects them against HFD-induced obesity and insulin resistance. Male 4E-BP1 transgenic mice also exhibit reduced white adipose tissue accumulation accompanied by decreased circulating levels of leptin and triglycerides. Importantly, transgenic 4E-BP1 male mice are also protected from aging-induced obesity and metabolic decline on a normal diet. These results demonstrate that 4E-BP1 is a gender-specific suppressor of obesity that regulates insulin sensitivity and energy metabolism.

  3. First Record of Two Gobiid Fishes, Luciogobius elongatus, L. platycephalus (Perciformes: Gobiidae from Korea

    Directory of Open Access Journals (Sweden)

    Seung-Ho Choi

    2014-01-01

    Full Text Available Two species of small gobiid fishes genus Luciogobius, i.e., L. elongatus, L. platycephalus were described as the first records from Korea based on specimens collected from gravel beaches of Gijang-gun, Busan-si, Korea. Luciogobius elongatus is distinguished from congeners by very elongated and naked body, 42-44 vertebrae, 6-7 dorsal soft rays, and no free rays on pectoral fin, and L. platycephalus is characterized by having very depressed head, naked body, 40-41 vertebrae, 10-11 dorsal soft rays, and pectoral fin with only upper 2-4 free rays. We propose the new Korean name “Ga-neun-mi-kkeun-mang-dug”, “Nab-jak-mi-kkeunmang- dug” for L. elongatus and L. platycephalus, respectively.

  4. G3BP1 restricts HIV-1 replication in macrophages and T-cells by sequestering viral RNA

    NARCIS (Netherlands)

    Cobos Jiménez, Viviana; Martinez, Fernando O.; Booiman, Thijs; van Dort, Karel A.; van de Klundert, Maarten A. A.; Gordon, Siamon; Geijtenbeek, Teunis B. H.; Kootstra, Neeltje A.

    2015-01-01

    HIV-1 exploits the cellular machinery for replication and therefore several interactions with cellular factors take place, some of which are yet unknown. We identified GTPase-activating protein-(SH3 domain)-binding protein 1 (G3BP1) as a cellular factor that restricts HIV-1, by analyzing

  5. A Damage-Independent Role for 53BP1 that Impacts Break Order and Igh Architecture during Class Switch Recombination.

    Science.gov (United States)

    Rocha, Pedro P; Raviram, Ramya; Fu, Yi; Kim, JungHyun; Luo, Vincent M; Aljoufi, Arafat; Swanzey, Emily; Pasquarella, Alessandra; Balestrini, Alessia; Miraldi, Emily R; Bonneau, Richard; Petrini, John; Schotta, Gunnar; Skok, Jane A

    2016-06-28

    During class switch recombination (CSR), B cells replace the Igh Cμ or δ exons with another downstream constant region exon (CH), altering the antibody isotype. CSR occurs through the introduction of AID-mediated double-strand breaks (DSBs) in switch regions and subsequent ligation of broken ends. Here, we developed an assay to investigate the dynamics of DSB formation in individual cells. We demonstrate that the upstream switch region Sμ is first targeted during recombination and that the mechanism underlying this control relies on 53BP1. Surprisingly, regulation of break order occurs through residual binding of 53BP1 to chromatin before the introduction of damage and independent of its established role in DNA repair. Using chromosome conformation capture, we show that 53BP1 mediates changes in chromatin architecture that affect break order. Finally, our results explain how changes in Igh architecture in the absence of 53BP1 could promote inversional rearrangements that compromise CSR. Copyright © 2016 The Author(s). Published by Elsevier Inc. All rights reserved.

  6. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    International Nuclear Information System (INIS)

    Gago-Ferrero, Pablo; Badia-Fabregat, Marina; Olivares, Alba; Piña, Benjamin; Blánquez, Paqui; Vicent, Teresa; Caminal, Gloria; Díaz-Cruz, M. Silvia

    2012-01-01

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: ► Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. ► BP3 is not degraded under simulated sunlight. ► Glycoconjugates have been identified as the main intermediate metabolites. ► Decrease in endocrine activity was found in both photodegradation and biodegradation.

  7. Evaluation of fungal- and photo-degradation as potential treatments for the removal of sunscreens BP3 and BP1

    Energy Technology Data Exchange (ETDEWEB)

    Gago-Ferrero, Pablo, E-mail: pablo.gago@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Badia-Fabregat, Marina, E-mail: marina.badia@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Olivares, Alba, E-mail: esalba.olivares@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Pina, Benjamin, E-mail: benjami.pina@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); Blanquez, Paqui, E-mail: paqui.blanquez@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Vicent, Teresa, E-mail: teresa.vicent@uab.cat [Departament d' Enginyeria Quimica, Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Caminal, Gloria, E-mail: gloria.caminal@uab.cat [Unitat de Biocatalisi Aplicada associada al IQAC (CSIC-UAB). Escola d' Enginyeria, Universitat Autonoma de Barcelona, 08193 Bellaterra, Barcelona (Spain); Diaz-Cruz, M. Silvia, E-mail: silvia.diaz@idaea.csic.es [Departament de Quimica Ambiental, IDAEA-CSIC, C/ Jordi Girona 18-26, 08034 Barcelona (Spain); and others

    2012-06-15

    Photodecomposition might be regarded as one of the most important abiotic factors affecting the fate of UV absorbing compounds in the environment and photocatalysis has been suggested as an effective method to degrade organic pollutants. However, UV filters transformation appears to be a complex process, barely addressed to date. The white rot fungus Trametes versicolor is considered as a promising alternative to conventional aerobic bacterial degradation, as it is able to metabolise a wide range of xenobiotics. This study focused on both degradation processes of two widely used UV filters, benzophenone-3 (BP3) and benzophenone-1 (BP1). Fungal treatment resulted in the degradation of more than 99% for both sunscreens in less than 24 h, whereas photodegradation was very inefficient, especially for BP3, which remained unaltered upon 24 h of simulated sunlight irradiation. Analysis of metabolic compounds generated showed BP1 as a minor by-product of BP3 degradation by T. versicolor while the main intermediate metabolites were glycoconjugate derivatives. BP1 and BP3 showed a weak, but significant estrogenic activity (EC50 values of 0.058 mg/L and 12.5 mg/L, respectively) when tested by recombinant yeast assay (RYA), being BP1 200-folds more estrogenic than BP3. Estrogenic activity was eliminated during T. versicolor degradation of both compounds, showing that none of the resulting metabolites possessed significant estrogenic activity at the concentrations produced. These results demonstrate the suitability of this method to degrade both sunscreen agents and to eliminate estrogenic activity. - Highlights: Black-Right-Pointing-Pointer Fungus T. versicolor is able to degrade totally BP3 and BP1 in few hours in a fluidised bed bioreactor. Black-Right-Pointing-Pointer BP3 is not degraded under simulated sunlight. Black-Right-Pointing-Pointer Glycoconjugates have been identified as the main intermediate metabolites. Black-Right-Pointing-Pointer Decrease in endocrine activity

  8. Functional interaction between type III-secreted protein IncA of Chlamydophila psittaci and human G3BP1.

    Science.gov (United States)

    Borth, Nicole; Litsche, Katrin; Franke, Claudia; Sachse, Konrad; Saluz, Hans Peter; Hänel, Frank

    2011-01-31

    Chlamydophila (Cp.) psittaci, the causative agent of psittacosis in birds and humans, is the most important zoonotic pathogen of the family Chlamydiaceae. These obligate intracellular bacteria are distinguished by a unique biphasic developmental cycle, which includes proliferation in a membrane-bound compartment termed inclusion. All Chlamydiaceae spp. possess a coding capacity for core components of a Type III secretion apparatus, which mediates specific delivery of anti-host effector proteins either into the chlamydial inclusion membrane or into the cytoplasm of target eukaryotic cells. Here we describe the interaction between Type III-secreted protein IncA of Cp. psittaci and host protein G3BP1 in a yeast two-hybrid system. In GST-pull down and co-immunoprecipitation experiments both in vitro and in vivo interaction between full-length IncA and G3BP1 were shown. Using fluorescence microscopy, the localization of G3BP1 near the inclusion membrane of Cp. psittaci-infected Hep-2 cells was demonstrated. Notably, infection of Hep-2 cells with Cp. psittaci and overexpression of IncA in HEK293 cells led to a decrease in c-Myc protein concentration. This effect could be ascribed to the interaction between IncA and G3BP1 since overexpression of an IncA mutant construct disabled to interact with G3BP1 failed to reduce c-Myc concentration. We hypothesize that lowering the host cell c-Myc protein concentration may be part of a strategy employed by Cp. psittaci to avoid apoptosis and scale down host cell proliferation.

  9. Development of a sperm cryopreservation protocol for redside dace, Clinostomus elongatus: implications for genome resource banking

    DEFF Research Database (Denmark)

    Butts, Ian A.E.; Mokdad, A.; Trippel, E.A.

    2013-01-01

    Populations of Redside Dace Clinostomus elongatus have declined in many areas across the species’North American range. Therefore, the development of sperm cryopreservation technology would provide an invaluable means of preserving genetic diversity in populations that are in imminent danger...

  10. Collapsing aged culture of the cyanobacterium Synechococcus elongatus produces compound(s toxic to photosynthetic organisms.

    Directory of Open Access Journals (Sweden)

    Assaf Cohen

    Full Text Available Phytoplankton mortality allows effective nutrient cycling, and thus plays a pivotal role in driving biogeochemical cycles. A growing body of literature demonstrates the involvement of regulated death programs in the abrupt collapse of phytoplankton populations, and particularly implicates processes that exhibit characteristics of metazoan programmed cell death. Here, we report that the cell-free, extracellular fluid (conditioned medium of a collapsing aged culture of the cyanobacterium Synechococcus elongatus is toxic to exponentially growing cells of this cyanobacterium, as well as to a large variety of photosynthetic organisms, but not to eubacteria. The toxic effect, which is light-dependent, involves oxidative stress, as suggested by damage alleviation by antioxidants, and the very high sensitivity of a catalase-mutant to the conditioned medium. At relatively high cell densities, S. elongatus cells survived the deleterious effect of conditioned medium in a process that required de novo protein synthesis. Application of conditioned medium from a collapsing culture caused severe pigment bleaching not only in S. elongatus cells, but also resulted in bleaching of pigments in a cell free extract. The latter observation indicates that the elicited damage is a direct effect that does not require an intact cell, and therefore, is mechanistically different from the metazoan-like programmed cell death described for phytoplankton. We suggest that S. elongatus in aged cultures are triggered to produce a toxic compound, and thus, this process may be envisaged as a novel regulated death program.

  11. The distribution of exocrine glands in Lepeophtheirus salmonis and Caligus elongatus (Copepoda: Caligidae)

    NARCIS (Netherlands)

    Bell, S.; Bron, J.E.; Sommerville, C.

    2000-01-01

    The morphology, function and distribution of exocrine glands of copepods have rarely been studied in detail and almost nothing is known about them in the sea lice species L. salmonis and C. elongatus. This study utilised a novel application of a light-microscopy staining technique to reveal a

  12. Dpb11/TopBP1 plays distinct roles in DNA replication, checkpoint response and homologous recombination

    DEFF Research Database (Denmark)

    Germann, Susanne Manuela; Østergaard, Vibe Hallundbæk; Haas, Caroline

    2011-01-01

    DPB11/TopBP1 is an essential evolutionarily conserved gene involved in initiation of DNA replication and checkpoint signaling. Here, we show that Saccharomyces cerevisiae Dpb11 forms nuclear foci that localize to sites of DNA damage in G1, S and G2 phase, a recruitment that is conserved for its...... homologue TopBP1 in Gallus gallus. Damage-induced Dpb11 foci are distinct from Sld3 replication initiation foci. Further, Dpb11 foci are dependent on the checkpoint proteins Mec3 (9-1-1 complex) and Rad24, and require the C-terminal domain of Dpb11. Dpb11 foci are independent of the checkpoint kinases Mec1...

  13. Crystal structures of the human G3BP1 NTF2-like domain visualize FxFG Nup Repeat Specificity

    DEFF Research Database (Denmark)

    Vognsen, Tina Reinholdt; Möller, Ingvar Rúnar; Kristensen, Ole

    2013-01-01

    Ras GTPase Activating Protein SH3 Domain Binding Protein (G3BP) is a potential anti-cancer drug target implicated in several cellular functions. We have used protein crystallography to solve crystal structures of the human G3BP1 NTF2-like domain both alone and in complex with an FxFG Nup repeat...... peptide. Despite high structural similarity, the FxFG binding site is located between two alpha helices in the G3BP1 NTF2-like domain and not at the dimer interface as observed for nuclear transport factor 2. ITC studies showed specificity towards the FxFG motif but not FG and GLFG motifs. The unliganded...

  14. Mechanisms of Abnormal Growth Regulation in Prostatic Adenocarcinoma Using Abi1/Hssh3bp1 Conditional Knockout Mouse Model

    Science.gov (United States)

    2009-06-01

    deletion involving two microsatellite markers, D10S89 and D10S111, did not express Abi1/Hssh3bp1. Additionally, 5 of 11 tumors that were diploid for...such as viruses, bacteria , and apoptotic fragments can be internalized by macropinocytosis (Fiorentini et al., 2003; Krysko et al., 21 2006; Meier and...Rho GTPases by protein toxins and apoptosis: molecular strategies of pathogenic bacteria . Cell Death Differ. 10:147-52. Funato, Y., T. Terabayashi, N

  15. Localized Movement and Levels of 53BP1 Protein Are Changed by gamma-irradiation in PML Deficient Cells

    Czech Academy of Sciences Publication Activity Database

    Legartová, Soňa; Sehnalová, Petra; Malyšková, B.; Kuntziger, T.; Collas, P.; Cmarko, D.; Raška, I.; Sorokin, D.V.; Kozubek, Stanislav; Bártová, Eva

    2016-01-01

    Roč. 117, č. 11 (2016), s. 2583-2596 ISSN 0730-2312 R&D Projects: GA ČR GBP302/12/G157; GA ČR GA13-07822S; GA MŠk 7F14369 Institutional support: RVO:68081707 Keywords : DNA REPAIR * 53BP1 PROTEIN * PML BODIES Subject RIV: BO - Biophysics Impact factor: 3.085, year: 2016

  16. Restoration of microRNA-708 sensitizes ovarian cancer cells to cisplatin via IGF2BP1/Akt pathway.

    Science.gov (United States)

    Qin, Xuying; Sun, Linlin; Wang, Jing

    2017-10-01

    A previous study has shown that microRNA-708 (miR-708) functions as a metastasis suppressor in ovarian cancer. In this study, we aimed to explore its implication in regulating cisplatin sensitivity in ovarian cancer cells. To this end, ovarian cancer cells were transfected with miR-708-expressing plasmids or vector before treatment with different concentrations of cisplatin for 48 h. The 50% inhibitory concentration (IC 50 ) value was calculated. Apoptosis was analyzed by measuring caspase-3 activity. The target gene mediating the function of miR-708 was identified. Ectopic expression of miR-708 sensitized SKOV3 and A2780 cells to cisplatin, decreasing the IC 50 value by two- to threefold. miR-708 overexpression significantly augmented cisplatin-induced apoptosis in ovarian cancer cells, which was coupled with increased caspase-3 activity by two- to fourfold. Similarly, overexpression of miR-708 increased the sensitivity of cisplatin-resistant SKOV3/DDP and A2780/DDP cells to cisplatin-induced toxicity, reducing the IC 50 by three- and fivefold, respectively. Delivery of miR-708 enhanced cisplatin-induced elevation in caspase-3 activity in both cisplatin-resistant and parental ovarian cancer cells. Mechanistically, miR-708 downregulated the expression of insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) and suppressed Akt phosphorylation. Silencing of IGF2BP1 markedly blocked the phosphorylation of Akt. Overexpression of IGF2BP1 restored cisplatin resistance and Akt phosphorylation in miR-708-overexpressing ovarian cancer cells. Collectively, miR-708 increases the susceptibility of ovarian cancer cells to cisplatin by targeting IGF2BP1 and inhibiting Akt signaling. Delivery of miR-708 may represent a promising strategy for improving cisplatin chemotherapy. © 2017 International Federation for Cell Biology.

  17. Transcriptional signature of accessory cells in the lateral line, using the Tnk1bp1:EGFP transgenic zebrafish line.

    Science.gov (United States)

    Behra, Martine; Gallardo, Viviana E; Bradsher, John; Torrado, Aranza; Elkahloun, Abdel; Idol, Jennifer; Sheehy, Jessica; Zonies, Seth; Xu, Lisha; Shaw, Kenna M; Satou, Chie; Higashijima, Shin-ichi; Weinstein, Brant M; Burgess, Shawn M

    2012-01-24

    Because of the structural and molecular similarities between the two systems, the lateral line, a fish and amphibian specific sensory organ, has been widely used in zebrafish as a model to study the development/biology of neuroepithelia of the inner ear. Both organs have hair cells, which are the mechanoreceptor cells, and supporting cells providing other functions to the epithelium. In most vertebrates (excluding mammals), supporting cells comprise a pool of progenitors that replace damaged or dead hair cells. However, the lack of regenerative capacity in mammals is the single leading cause for acquired hearing disorders in humans. In an effort to understand the regenerative process of hair cells in fish, we characterized and cloned an egfp transgenic stable fish line that trapped tnks1bp1, a highly conserved gene that has been implicated in the maintenance of telomeres' length. We then used this Tg(tnks1bp1:EGFP) line in a FACsorting strategy combined with microarrays to identify new molecular markers for supporting cells. We present a Tg(tnks1bp1:EGFP) stable transgenic line, which we used to establish a transcriptional profile of supporting cells in the zebrafish lateral line. Therefore we are providing a new set of markers specific for supporting cells as well as candidates for functional analysis of this important cell type. This will prove to be a valuable tool for the study of regeneration in the lateral line of zebrafish in particular and for regeneration of neuroepithelia in general.

  18. Anatomy and systematics of Anodontites Elongatus (Swainson) from Amazon and Parana Basins, Brazil (Mollusca, Bivalvia, Unionoida, Mycetopodidae)

    OpenAIRE

    Simone, Luiz Ricardo L

    1997-01-01

    The anatomy of Anodontiies elongatus (Swainson, 1823), a rare species restricted to the Amazon and Parana Basins, is described by first time, showing a group of conchological and anatomical characters exclusive of this species that may be analyzed to identify it. Diagnosis of A. elongatus: shell long antero-posteriorly, umbones prominent, periostracum opaque and smooth, two posterior radial striae; middle fold of mantle edge veiy tall; gill long antero-posteriorly and short dorso-ventrally, e...

  19. Bcl3-dependent stabilization of CtBP1 is crucial for the inhibition of apoptosis and tumor progression in breast cancer

    Energy Technology Data Exchange (ETDEWEB)

    Choi, Hee June; Lee, Ji Min; Kim, Hyunkyung; Nam, Hye Jin; Shin, Hi-Jai R.; Kim, Dongha [Department of Biological Sciences, Creative Research Initiative Center for Chromatin Dynamics, Seoul National University, Seoul 151-742 (Korea, Republic of); Ko, Enyoung; Noh, Dong-Young [Department of Surgery and Cancer Research Institute, Seoul National University College of Medicine, Seoul 110-744 (Korea, Republic of); Kim, Keun Il [Department of Biological Sciences, Sookmyung Women' s University, Seoul 140-742 (Korea, Republic of); Kim, Jung Hwa [Department of Medical Sciences, Inha University, Incheon 402-751 (Korea, Republic of); Baek, Sung Hee, E-mail: sbaek@snu.ac.kr [Department of Biological Sciences, Creative Research Initiative Center for Chromatin Dynamics, Seoul National University, Seoul 151-742 (Korea, Republic of)

    2010-09-24

    Research highlights: {yields} CtBP1 as a new binding partner of Bcl3. {yields} Bcl3 stabilizes CtBP1 by inhibiting ubiquitination of CtBP1. {yields} Bcl3 antagonizes CtBP1-mediated apoptotic responses. {yields} Positive correlation between increased Bcl3 and CtBP1 protein levels in breast cancer tissues. -- Abstract: B-cell lymphoma 3 (Bcl3) is a proto-oncogene upregulated in a wide range of cancers, including breast cancer. Although Bcl3 is known to promote cell proliferation and inhibit apoptosis, the molecular mechanisms underlying the proto-oncogenic function of Bcl3 have not been completely elucidated. To gain insight into the oncogenic role of Bcl3, we applied a proteomic approach, which led to the identification of C-terminal binding protein 1 (CtBP1) as a binding partner of Bcl3. A PXDLS/R motif embedded in Bcl3 was found to mediate the interaction between Bcl3 and CtBP1, which caused the stabilization of CtBP1 by blocking proteasome-dependent degradation. Apoptotic stimuli-induced degradation of CtBP1 was significantly abolished by the upregulation of Bcl3, leading to the sustained repression of pro-apoptotic gene expression and subsequent inhibition of apoptosis. Intriguingly, a strong positive correlation between the protein levels of Bcl3 and CtBP1 was detected in breast cancer patient samples. Our study reveals a novel combinatorial role for Bcl3 and CtBP1, providing an explanation for the acquisition of resistance to apoptosis in cancer cells, which is a major requirement for cancer development.

  20. Mitotic protein kinase CDK1 phosphorylation of mRNA translation regulator 4E-BP1 Ser83 may contribute to cell transformation

    Energy Technology Data Exchange (ETDEWEB)

    Velasquez, Celestino; Cheng, Erdong; Shuda, Masahiro; Lee-Oesterreich, Paula J.; Pogge von Strandmann, Lisa; Gritsenko, Marina A.; Jacobs, Jon M.; Moore, Patrick S.; Chang, Yuan

    2016-07-11

    mTOR-directed 4E-BP1 phosphorylation promotes cap-dependent translation and tumorigen-esis. During mitosis, CDK1 substitutes for mTOR and fully phosphorylates 4E-BP1 at canoni-cal as well a non-canonical S83 site resulting in a mitosis-specific hyperphosphorylated δ isoform. Colocalization studies with a phospho-S83 specific antibody indicate that 4E-BP1 S83 phosphorylation accumulates at centrosomes during prophase, peaks at metaphase, and decreases through telophase. While S83 phosphorylation of 4E-BP1 does not affect in vitro cap-dependent translation, nor eIF4G/4E-BP1 cap-binding, expression of an alanine substitution mutant 4E-BP1.S83A partially reverses rodent cell transformation induced by Merkel cell polyomavirus (MCV) small T (sT) antigen viral oncoprotein. In contrast to inhibitory mTOR 4E-BP1 phosphorylation, these findings suggest that mitotic CDK1-directed phosphorylation of δ-4E-BP1 may yield a gain-of-function, distinct from translation regulation, that may be important in tumorigenesis and mitotic centrosome function.

  1. Coprorhexy, coprophagy, and coprochaly in the copepods Calanus helgolandicus, Pseudocalanus elongatus, and Oithona similis

    DEFF Research Database (Denmark)

    Iversen, Morten; Poulsen, Louise K.

    2007-01-01

    is mainly thought to be caused by coprophagy (ingestion of fecal pellets) by copepods, and especially by the ubiquitous copepods Oithona spp. We examined fecal pellet ingestion rate and feeding behavior of O. similis and 2 other dominant copepod species from the North Sea (Calanus helgolandicus...... and Pseudocalanus elongatus). All investigations were done with fecal pellets as the sole food source and with fecal pellets offered together with an alternative suitable food source. The ingestion of fecal pellets by all 3 copepod species was highest when offered together with an alternative food source....... No feeding behavior was determined for O. similis due to the lack of pellet capture in those experiments. Fecal pellets offered together with an alternative food source increased the filtration activity by C. helgolandicus and P. elongatus and thereby the number of pellets caught in their feeding current...

  2. Spatial Genetic Structure and Mitochondrial DNA Phylogeography of Argentinean Populations of the Grasshopper Dichroplus elongatus

    OpenAIRE

    Rosetti, Natalia; Remis, Maria Isabel

    2012-01-01

    Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of ...

  3. Transcriptional signature of accessory cells in the lateral line, using the Tnk1bp1:EGFP transgenic zebrafish line

    Directory of Open Access Journals (Sweden)

    Behra Martine

    2012-01-01

    Full Text Available Abstract Background Because of the structural and molecular similarities between the two systems, the lateral line, a fish and amphibian specific sensory organ, has been widely used in zebrafish as a model to study the development/biology of neuroepithelia of the inner ear. Both organs have hair cells, which are the mechanoreceptor cells, and supporting cells providing other functions to the epithelium. In most vertebrates (excluding mammals, supporting cells comprise a pool of progenitors that replace damaged or dead hair cells. However, the lack of regenerative capacity in mammals is the single leading cause for acquired hearing disorders in humans. Results In an effort to understand the regenerative process of hair cells in fish, we characterized and cloned an egfp transgenic stable fish line that trapped tnks1bp1, a highly conserved gene that has been implicated in the maintenance of telomeres' length. We then used this Tg(tnks1bp1:EGFP line in a FACsorting strategy combined with microarrays to identify new molecular markers for supporting cells. Conclusions We present a Tg(tnks1bp1:EGFP stable transgenic line, which we used to establish a transcriptional profile of supporting cells in the zebrafish lateral line. Therefore we are providing a new set of markers specific for supporting cells as well as candidates for functional analysis of this important cell type. This will prove to be a valuable tool for the study of regeneration in the lateral line of zebrafish in particular and for regeneration of neuroepithelia in general.

  4. Protein phosphatase PPM1G regulates protein translation and cell growth by dephosphorylating 4E binding protein 1 (4E-BP1).

    Science.gov (United States)

    Liu, Jianyu; Stevens, Payton D; Eshleman, Nichole E; Gao, Tianyan

    2013-08-09

    Protein translation initiation is a tightly controlled process responding to nutrient availability and mitogen stimulation. Serving as one of the most important negative regulators of protein translation, 4E binding protein 1 (4E-BP1) binds to translation initiation factor 4E and inhibits cap-dependent translation in a phosphorylation-dependent manner. Although it has been demonstrated previously that the phosphorylation of 4E-BP1 is controlled by mammalian target of rapamycin in the mammalian target of rapamycin complex 1, the mechanism underlying the dephosphorylation of 4E-BP1 remains elusive. Here, we report the identification of PPM1G as the phosphatase of 4E-BP1. A coimmunoprecipitation experiment reveals that PPM1G binds to 4E-BP1 in cells and that purified PPM1G dephosphorylates 4E-BP1 in vitro. Knockdown of PPM1G in 293E and colon cancer HCT116 cells results in an increase in the phosphorylation of 4E-BP1 at both the Thr-37/46 and Ser-65 sites. Furthermore, the time course of 4E-BP1 dephosphorylation induced by amino acid starvation or mammalian target of rapamycin inhibition is slowed down significantly in PPM1G knockdown cells. Functionally, the amount of 4E-BP1 bound to the cap-dependent translation initiation complex is decreased when the expression of PPM1G is depleted. As a result, the rate of cap-dependent translation, cell size, and protein content are increased in PPM1G knockdown cells. Taken together, our study has identified protein phosphatase PPM1G as a novel regulator of cap-dependent protein translation by negatively controlling the phosphorylation of 4E-BP1.

  5. Combining 53BP1 with BRCA1 as a biomarker to predict the sensitivity of poly(ADP-ribose) polymerase (PARP) inhibitors.

    Science.gov (United States)

    Yang, Zhong-Min; Liao, Xue-Mei; Chen, Yi; Shen, Yan-Yan; Yang, Xin-Ying; Su, Yi; Sun, Yi-Ming; Gao, Ying-Lei; Ding, Jian; Zhang, Ao; He, Jin-Xue; Miao, Ze-Hong

    2017-07-01

    Over half of patients with BRCA1-deficient cancers do not respond to treatment with poly(ADP-ribose) polymerase (PARP) inhibitors. In this study, we report that a combination of 53BP1 and BRCA1 may serve as a biomarker of PARP inhibitor sensitivity. Based on the mRNA levels of four homologous recombination repair (HR) genes and PARP inhibitor sensitivity, we selected BRCA1-deficient MDA-MB-436 cells to conduct RNA interference. Reducing expression of 53BP1, but not the other three HR genes, was found to lower simmiparib sensitivity. Additionally, we generated 53BP1 -/- /BRCA1 -/- clonal variants by the transcription activator-like effector nuclease (TALEN) technique and found that depleting 53BP1 impaired PARP inhibitor sensitivity with a 36.7-fold increase in their IC 50 values. Consistent with its effect on PARP inhibitor sensitivity, 53BP1 loss alleviated cell cycle arrest and apoptosis and partially restored HR function. Importantly, 53BP1 depletion dramatically reduced the ability of PARP inhibitors to suppress tumor growth in vivo. The inhibition rate of simmiparib was 74.16% for BRCA1-deficient MDA-MB-436 xenografts, but only 7.79% for 53BP1/BRCA1-deficient xenografts. Re-expressing 53BP1 in the dual-deficient cells restored PARP inhibitor sensitivity and the levels of HR regulators. Considering that at least 10% of BRCA1-deficient breast and ovarian cancers have reduced expression of 53BP1, using a combination of 53BP1 with BRCA1 as a biomarker for patient selection should reduce the number of patients undergoing futile treatment with PARP inhibitors.

  6. Purification, crystallization and preliminary X-ray diffraction of the G3BP1 NTF2-like domain

    DEFF Research Database (Denmark)

    Vognsen, Tina; Möller, Ingvar Rúnar; Kristensen, Ole

    2011-01-01

    The nuclear transport factor 2-like (NTF2-like) domain of human G3BP1 was subcloned, overexpressed in Escherichia coli and purified. Crystals were obtained using the hanging-drop vapour-diffusion method. Diffraction data were collected to 3.6 Å resolution using synchrotron radiation. The crystals...... belonged to the hexagonal space group P6(3)22, with unit-cell parameters a=b=89.84, c=70.02 Å. The crystals contained one molecule per asymmetric unit, with an estimated solvent content of 56%. Initial phases were obtained by molecular replacement....

  7. Direct Conversion of CO2to α-Farnesene Using Metabolically Engineered Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Lee, Hyun Jeong; Lee, Jiwon; Lee, Sun-Mi; Um, Youngsoon; Kim, Yunje; Sim, Sang Jun; Choi, Jong-Il; Woo, Han Min

    2017-12-06

    Direct conversion of carbon dioxide (CO 2 ) to value-added chemicals by engineering of cyanobacteria has received attention as a sustainable strategy in food and chemical industries. Herein, Synechococcus elongatus PCC 7942, a model cyanobacterium, was engineered to produce α-farnesene from CO 2 . As a result of the lack of farnesene synthase (FS) activity in the wild-type cyanobacterium, we metabolically engineered S. elongatus PCC 7942 to express heterologous FS from either Norway spruce or apple fruit, resulting in detectable peaks of α-farnesene. To enhance α-farnesene production, an optimized methylerythritol phosphate (MEP) pathway was introduced in the farnesene-producing strain to supply farnesyl diphosphate. Subsequent cyanobacterial culture with a dodecane overlay resulted in photosynthetic production of α-farnesene (4.6 ± 0.4 mg/L in 7 days) from CO 2 . To the best of our knowledge, this is the first report of the photosynthetic production of α-farnesene from CO 2 in the unicellular cyanobacterium S. elongatus PCC 7942.

  8. Transcriptome landscape of Synechococcus elongatus PCC 7942 for nitrogen starvation responses using RNA-seq

    Science.gov (United States)

    Choi, Sun Young; Park, Byeonghyeok; Choi, In-Geol; Sim, Sang Jun; Lee, Sun-Mi; Um, Youngsoon; Woo, Han Min

    2016-01-01

    The development of high-throughput technology using RNA-seq has allowed understanding of cellular mechanisms and regulations of bacterial transcription. In addition, transcriptome analysis with RNA-seq has been used to accelerate strain improvement through systems metabolic engineering. Synechococcus elongatus PCC 7942, a photosynthetic bacterium, has remarkable potential for biochemical and biofuel production due to photoautotrophic cell growth and direct CO2 conversion. Here, we performed a transcriptome analysis of S. elongatus PCC 7942 using RNA-seq to understand the changes of cellular metabolism and regulation for nitrogen starvation responses. As a result, differentially expressed genes (DEGs) were identified and functionally categorized. With mapping onto metabolic pathways, we probed transcriptional perturbation and regulation of carbon and nitrogen metabolisms relating to nitrogen starvation responses. Experimental evidence such as chlorophyll a and phycobilisome content and the measurement of CO2 uptake rate validated the transcriptome analysis. The analysis suggests that S. elongatus PCC 7942 reacts to nitrogen starvation by not only rearranging the cellular transport capacity involved in carbon and nitrogen assimilation pathways but also by reducing protein synthesis and photosynthesis activities. PMID:27488818

  9. Cross-amplification of heterologous microsatellite markers in Rhamdia quelen and Leporinus elongatus

    Directory of Open Access Journals (Sweden)

    Nelson Mauricio Lopera-Barrero

    2016-02-01

    Full Text Available Native fish species in Brazil are an asset in fish farming, but their natural stocks have been significantly reduced in recent years. To mitigate this negative impact, studies on fish conservation are being conducted and genetic tools for the discrimination of population parameters are increasingly achieving great importance. Current analysis evaluates a set of microsatellite heterologous primers in the jundiá (Rhamdia quelen and in the piapara (Leporinus elongatus. Samples from the caudal fin of 15 broodstock from each species were analyzed. DNA extraction was performed with NaCl protocol and the integrity of the extracted DNA was checked with agarose gel 1%. Twenty primers developed for Piaractus mesopotamicus, Colossoma macropomum, Prochilodus lineatus, Brycon opalinus and Oreochromis niloticus were evaluated. Cross amplification of four primers of the B. opalinus and P. lineatus species (BoM12, Pli43 and Pli60 in R. quelen and BoM2, Pli43 and Pli60 in L. elongatus was assessed. Primers of P. mesopotamicus, C. macropomum and O. niloticus showed no cross amplification in the two species analyzed. Results revealed the possibility of using the four amplified heterologous primers in genetic studies for R. quelen and L. elongatus.

  10. Further phenotypic expansion of 15q11.2 BP1-BP2 microdeletion (Burnside-Butler) syndrome.

    Science.gov (United States)

    Jerkovich, Adria M; Butler, Merlin G

    2014-01-01

    We report a 10-year-old Caucasian male identified with copy number variation detected by microarray analysis including a maternally inherited 15q11.2 microdeletion involving 4 genes, paternally inherited 13q12.2 microdeletion with 10 genes, and a de novo 2q14.3 duplication involving 4 genes. He had a history of speech delay, cognitive deficits, attention deficit hyperactivity disorder and a posterior lenticonus cataract removed at 5 yr of age. The genes on chromosomes 2 and 13 are not known to be involved with cataract formation, which lends further support of the role of the 15q11.2 region and additional evidence for phenotypic expansion of the 15q11.2 BP1-BP2 microdeletion (termed Burnside-Butler) syndrome.

  11. Blueprint for a minimal photoautotrophic cell: conserved and variable genes in Synechococcus elongatus PCC 7942

    Directory of Open Access Journals (Sweden)

    Peretó Juli

    2011-01-01

    Full Text Available Abstract Background Simpler biological systems should be easier to understand and to engineer towards pre-defined goals. One way to achieve biological simplicity is through genome minimization. Here we looked for genomic islands in the fresh water cyanobacteria Synechococcus elongatus PCC 7942 (genome size 2.7 Mb that could be used as targets for deletion. We also looked for conserved genes that might be essential for cell survival. Results By using a combination of methods we identified 170 xenologs, 136 ORFans and 1401 core genes in the genome of S. elongatus PCC 7942. These represent 6.5%, 5.2% and 53.6% of the annotated genes respectively. We considered that genes in genomic islands could be found if they showed a combination of: a unusual G+C content; b unusual phylogenetic similarity; and/or c a small number of the highly iterated palindrome 1 (HIP1 motif plus an unusual codon usage. The origin of the largest genomic island by horizontal gene transfer (HGT could be corroborated by lack of coverage among metagenomic sequences from a fresh water microbialite. Evidence is also presented that xenologous genes tend to cluster in operons. Interestingly, most genes coding for proteins with a diguanylate cyclase domain are predicted to be xenologs, suggesting a role for horizontal gene transfer in the evolution of Synechococcus sensory systems. Conclusions Our estimates of genomic islands in PCC 7942 are larger than those predicted by other published methods like SIGI-HMM. Our results set a guide to non-essential genes in S. elongatus PCC 7942 indicating a path towards the engineering of a model photoautotrophic bacterial cell.

  12. Biological observations on the mudskipper Pseudapocryptes elongatus in the Mekong Delta, Vietnam

    DEFF Research Database (Denmark)

    Bucholtz, Rikke Hagstrøm; Meilvang, A. S.; Cedhagen, T.

    2009-01-01

    Aspects of the population biology of the mudskipper, Pseudapocryptes elongatus, (Cuvier, 1816) were studied in Bac Lieu Province in the Lower Mekong Delta, Vietnam, including sex ratio, length-frequency distribution, sexual dimorphism, hepatosomatic index (HSI), female gonadosomatic index (GSI......), gonad histology, fecundity and some observations on post-larvae and juveniles. In the population studied the sex ratio was skewed toward males. Females had a shorter mean length and a lower mean growth rate than males. No mature males or females were observed among mudskippers sampled in estuarine...

  13. Phenotypic Variation and Sexual Size Dimorphism in Dichroplus elongatus (Orthoptera: Acrididae).

    Science.gov (United States)

    Rosetti, N; Remis, M I

    2015-08-01

    Patterns of body size evolution are of particular interest because body size can affect virtually all the physiological and life history traits of an organism. Sexual size dimorphism (SSD), a difference in body size between males and females, is a widespread phenomenon in insects. Much of the variation in SSD is genetically based and likely due to differential selection acting on males and females. The importance of environmental variables and evolutionary processes affecting phenotypeic variation in both sexes may be useful to gain insights into insect ecology and evolution. Dichroplus elongatus Giglio-Tos is a South American grasshopper widely distributed throughout Argentina, Uruguay, most of Chile, and southern Brazil. In this study, we analyzed 122 adult females of D. elongatus collected in eight natural populations from central-east Argentina. Females show large body size variation among the analyzed populations and this variation exhibits a strong relationship with fecundity. Our results have shown that larger females were more fecund than smaller ones. We found that ovariole number varied along a latitudinal gradient, with higher ovariole numbers in populations from warmer locations. A considerable female-biased SSD was detected. SSD for three analyzed morphometric traits scaled isometrically. However, SSD for thorax length displayed a considerable variation across the studied area, indicating a larger relative increase in female size than in male size in warmer environmental conditions. © The Authors 2015. Published by Oxford University Press on behalf of Entomological Society of America. All rights reserved. For Permissions, please email: journals.permissions@oup.com.

  14. Hepatitis C virus core protein targets 4E-BP1 expression and phosphorylation and potentiates Myc-induced liver carcinogenesis in transgenic mice.

    Science.gov (United States)

    Abdallah, Cosette; Lejamtel, Charlène; Benzoubir, Nassima; Battaglia, Serena; Sidahmed-Adrar, Nazha; Desterke, Christophe; Lemasson, Matthieu; Rosenberg, Arielle R; Samuel, Didier; Bréchot, Christian; Pflieger, Delphine; Le Naour, François; Bourgeade, Marie-Françoise

    2017-08-22

    Hepatitis C virus (HCV) is a leading cause of liver diseases including the development of hepatocellular carcinoma (HCC). Particularly, core protein has been involved in HCV-related liver pathologies. However, the impact of HCV core on signaling pathways supporting the genesis of HCC remains largely elusive. To decipher the host cell signaling pathways involved in the oncogenic potential of HCV core, a global quantitative phosphoproteomic approach was carried out. This study shed light on novel differentially phosphorylated proteins, in particular several components involved in translation. Among the eukaryotic initiation factors that govern the translational machinery, 4E-BP1 represents a master regulator of protein synthesis that is associated with the development and progression of cancers due to its ability to increase protein expression of oncogenic pathways. Enhanced levels of 4E-BP1 in non-modified and phosphorylated forms were validated in human hepatoma cells and in mouse primary hepatocytes expressing HCV core, in the livers of HCV core transgenic mice as well as in HCV-infected human primary hepatocytes. The contribution of HCV core in carcinogenesis and the status of 4E-BP1 expression and phosphorylation were studied in HCV core/Myc double transgenic mice. HCV core increased the levels of 4E-BP1 expression and phosphorylation and significantly accelerated the onset of Myc-induced tumorigenesis in these double transgenic mice. These results reveal a novel function of HCV core in liver carcinogenesis potentiation. They position 4E-BP1 as a tumor-specific target of HCV core and support the involvement of the 4E-BP1/eIF4E axis in hepatocarcinogenesis.

  15. An interaction between human papillomavirus 16 E2 and TopBP1 is required for optimum viral DNA replication and episomal genome establishment.

    Science.gov (United States)

    Donaldson, Mary M; Mackintosh, Lorna J; Bodily, Jason M; Dornan, Edward S; Laimins, Laimonis A; Morgan, Iain M

    2012-12-01

    In human papillomavirus DNA replication, the viral protein E2 forms homodimers and binds to 12-bp palindromic DNA sequences surrounding the origin of DNA replication. Via a protein-protein interaction, it then recruits the viral helicase E1 to an A/T-rich origin of replication, whereupon a dihexamer forms, resulting in DNA replication initiation. In order to carry out DNA replication, the viral proteins must interact with host factors that are currently not all known. An attractive cellular candidate for regulating viral replication is TopBP1, a known interactor of the E2 protein. In mammalian DNA replication, TopBP1 loads DNA polymerases onto the replicative helicase after the G(1)-to-S transition, and this process is tightly cell cycle controlled. The direct interaction between E2 and TopBP1 would allow E2 to bypass this cell cycle control, resulting in DNA replication more than once per cell cycle, which is a requirement for the viral life cycle. We report here the generation of an HPV16 E2 mutant compromised in TopBP1 interaction in vivo and demonstrate that this mutant retains transcriptional activation and repression functions but has suboptimal DNA replication potential. Introduction of this mutant into a viral life cycle model results in the failure to establish viral episomes. The results present a potential new antiviral target, the E2-TopBP1 interaction, and increase our understanding of the viral life cycle, suggesting that the E2-TopBP1 interaction is essential.

  16. Evidence for accumulation of Synechococcus elongatus (Cyanobacteria: Cyanophyceae) in the tissues of the oyster Crassostrea gigas (Mollusca: Bivalvia).

    Science.gov (United States)

    Avila-Poveda, Omar Hernando; Torres-Ariño, Alejandra; Girón-Cruz, Diego Ademir; Cuevas-Aguirre, Angel

    2014-10-01

    Cyanobacteria appear to have direct relations with mollusks in several aspects. This is the first time, distinguishing Gram-negative cyanoprokaryotic Synechococcus elongatus as bright yellow-gold autofluorescence by Lillie's and Hiss' staining methods on paraffin-embedded tissues of Crassostrea gigas. Three diets: cyanoprokaryotes, cyanoprokaryotes with microalgae, and only microalgae were evaluated. Cyanoprokaryotes were intact, densely bundled, and immersed in the cytosol of the digestive gland, connective tissue, mantle, and gonad of C. gigas, revealing an accumulation systemic without tissue damage observed by histology. Unexpectedly, cyanoprokaryotes were slightly most accumulated with microalgae diet by each of the tissues of the C. gigas than with any other diets. Cyanoprokaryotes tend to be in mean slightly higher in the digestive gland than in any other tissues respectively for each diet, although these values are closely similar to connective tissue. A possible order of exposure of the oyster tissues to accumulation of cyanoprokaryotes was digestive gland, connective tissue, mantle, and gonad. Thereby, the digestive gland could be the major target tissue for the accumulation. Our observations provide a valuable insight regarding the ability of cyanoprokaryotes to penetrate, spread, and remain inside the oyster tissues, suggesting for S. elongatus: (1) a pre-accumulation in oyster tissues from the natural environment, (2) a phagocytosis and/or endocytosis process rather than ingestion and extracellular digestion, (3) an apparent cellular division in the cytosol of oyster tissues, (4) an apparent inter-tissue movement, and (5) a possible endosymbiosis between C. gigas and S. elongatus. Hereby, it is possible that S. elongatus have a well-developed host-endobiont relationship with oysters, and thereby support future work toward a description of the escape and spreading mechanisms of S. elongatus inside the tissues of mollusks, and put forward questions as

  17. Low p53 Binding Protein 1 (53BP1) Expression Is Associated With Increased Local Recurrence in Breast Cancer Patients Treated With Breast-Conserving Surgery and Radiotherapy

    International Nuclear Information System (INIS)

    Neboori, Hanmanth J.R.; Haffty, Bruce G.; Wu Hao; Yang Qifeng; Aly, Amal; Goyal, Sharad; Schiff, Devora; Moran, Meena S.; Golhar, Ryan; Chen Chunxia; Moore, Dirk

    2012-01-01

    Purpose: To investigate whether the expression of p53 binding protein 1 (53BP1) has prognostic significance in a cohort of early-stage breast cancer patients treated with breast-conserving surgery and radiotherapy (BCS+RT). Methods and Materials: A tissue microarray of early-stage breast cancer treated with BCS+RT from a cohort of 514 women was assayed for 53BP1, estrogen receptor, progesterone receptor, and HER2 expression by immunohistochemistry. Through log–rank tests and univariate and multivariate models, the staining profile of each tumor was correlated with clinical endpoints, including ipsilateral breast recurrence–free survival (IBRFS), distant metastasis–free survival (DMFS), cause-specific survival (CSS), recurrence-free survival (RFS), and overall survival (OS). Results: Of the 477 (93%) evaluable tumors, 63 (13%) were scored as low. Low expression of 53BP1 was associated with worse outcomes for all endpoints studied, including 10-year IBRFS (76.8% vs. 90.5%; P=.01), OS (66.4% vs. 81.7%; P=.02), CSS (66.0% vs. 87.4%; P<.01), DMFS (55.9% vs. 87.0%; P<.01), and RFS (45.2% vs. 80.6%; P<.01). Multivariate analysis incorporating various clinico-pathologic markers and 53BP1 expression found that 53BP1 expression was again an independent predictor of all endpoints (IBRFS: P=.0254; OS: P=.0094; CSS: P=.0033; DMFS: P=.0006; RFS: P=.0002). Low 53BP1 expression was also found to correlate with triple-negative (TN) phenotype (P<.01). Furthermore, in subset analysis of all TN breast cancer, negative 53BP1 expression trended for lower IBRFS (72.3% vs. 93.9%; P=.0361) and was significant for worse DMFS (48.2% vs. 86.8%; P=.0035) and RFS (37.8% vs. 83.7%; P=.0014). Conclusion: Our data indicate that low 53BP1 expression is an independent prognostic indicator for local relapse among other endpoints in early-stage breast cancer and TN breast cancer patients treated with BCS+RT. These results should be verified in larger cohorts of patients to validate their

  18. Blind dating - mate finding in planktonic copepods. II. The pheromone cloud of Pseudocalanus elongatus

    DEFF Research Database (Denmark)

    Kiørboe, Thomas; Bagøien, E.; Thygesen, Uffe Høgsbro

    2005-01-01

    as an almost spherical cloud with a very heterogeneous internal structure. This is very different from the long, distinct pheromone trails deposited by females of many cruising copepods and appears to be characteristic of hovering females. We estimate the encounter cross-section area of the pheromone plume...... of P. elongatus and find that it enhances the mate encounter probability by a factor of about 40, and we show that this area increases in proportion to the rate at which pheromones are released. We also show that pheromone clouds are affected by—but still quite robust to—turbulence, with the encounter...... cross section declining with the turbulent dissipation rate raised to a power of 1/2. The sensitivity of mate encounter rates to turbulence is similar among copepods that produce pheromone trails and pheromone clouds....

  19. Spatial genetic structure and mitochondrial DNA phylogeography of Argentinean populations of the grasshopper Dichroplus elongatus.

    Science.gov (United States)

    Rosetti, Natalia; Remis, Maria Isabel

    2012-01-01

    Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of Minisatellite Regions (DAMD) and partial sequences of the cytochrome oxydase 1 (COI) mitochondrial gene to investigate intraspecific structure, demographic history and gene flow patterns in twenty Argentinean populations of this species belonging to different geographic and biogeographic regions. DAMD data suggest that, although genetic drift and migration occur within and between populations, measurable relatedness among neighbouring populations declines with distance and dispersal over distances greater than 200 km is not typical, whereas effective gene flow may occur for populations separated by less than 100 km. Landscape analysis was useful to detect genetic discontinuities associated with environmental heterogeneity reflecting the changing agroecosystem. The COI results indicate the existence of strong genetic differentiation between two groups of populations located at both margins of the Paraná River which became separated during climate oscillations of the Middle Pleistocene, suggesting a significant restriction in effective dispersion mediated by females and large scale geographic differentiation. The number of migrants between populations estimated through mitochondrial and DAMD markers suggest that gene flow is low prompting a non-homogeneous spatial structure and justifying the variation through space. Moreover, the genetic analysis of both markers allows us to conclude that males appear to disperse more than females, reducing the chance of the genetic loss

  20. Spatial genetic structure and mitochondrial DNA phylogeography of Argentinean populations of the grasshopper Dichroplus elongatus.

    Directory of Open Access Journals (Sweden)

    Natalia Rosetti

    Full Text Available Many grasshopper species are considered of agronomical importance because they cause damage to pastures and crops. Comprehension of pest population dynamics requires a clear understanding of the genetic diversity and spatial structure of populations. In this study we report on patterns of genetic variation in the South American grasshopper Dichroplus elongatus which is an agricultural pest of crops and forage grasses of great economic significance in Argentina. We use Direct Amplification of Minisatellite Regions (DAMD and partial sequences of the cytochrome oxydase 1 (COI mitochondrial gene to investigate intraspecific structure, demographic history and gene flow patterns in twenty Argentinean populations of this species belonging to different geographic and biogeographic regions. DAMD data suggest that, although genetic drift and migration occur within and between populations, measurable relatedness among neighbouring populations declines with distance and dispersal over distances greater than 200 km is not typical, whereas effective gene flow may occur for populations separated by less than 100 km. Landscape analysis was useful to detect genetic discontinuities associated with environmental heterogeneity reflecting the changing agroecosystem. The COI results indicate the existence of strong genetic differentiation between two groups of populations located at both margins of the Paraná River which became separated during climate oscillations of the Middle Pleistocene, suggesting a significant restriction in effective dispersion mediated by females and large scale geographic differentiation. The number of migrants between populations estimated through mitochondrial and DAMD markers suggest that gene flow is low prompting a non-homogeneous spatial structure and justifying the variation through space. Moreover, the genetic analysis of both markers allows us to conclude that males appear to disperse more than females, reducing the chance of the

  1. Association mapping of the high-grade myopia MYP3 locus reveals novel candidates UHRF1BP1L, PTPRR, and PPFIA2

    DEFF Research Database (Denmark)

    Hawthorne, Felicia; Feng, Sheng; Metlapally, Ravikanth

    2013-01-01

    protein tyrosine phosphatase genes PTPRR and PPFIA2, which are in the same gene family, as differentially expressed in normal rapidly growing fetal relative to normal adult ocular tissue (confirmed by RT-qPCR). CONCLUSIONS: In an independent high-grade myopia cohort, an intronic SNP in UHRF1BP1L, rs...

  2. A G3BP1-interacting lncRNA promotes ferroptosis and apoptosis in cancer via nuclear sequestration of p53.

    Science.gov (United States)

    Mao, Chao; Wang, Xiang; Liu, Yating; Wang, Min; Yan, Bin; Jiang, Yiqun; Shi, Ying; Shen, Yi; Liu, Xiaoli; Liai, Weiwei; Yang, Rui; Xiao, Desheng; Cheng, Yan; Liu, Shuang; Zhou, Hu; Cao, Ya; Yu, Weishi; Muegge, Kathrin; Yu, Herbert; Tao, Yongguang

    2018-03-27

    Long non-coding RNAs (lncRNA) have been associated with various types of cancer, however, the precise role of many lncRNAs in tumorigenesis remains elusive. Here we demonstrate that the cytosolic lncRNA P53RRA is downregulated in cancers and functions as a tumor suppressor by inhibiting cancer progression. Chromatin remodeling proteins LSH and Cfp1 silenced or increased P53RRA expression respectively. P53RRA bound Ras GTPase-activating protein-binding protein 1 (G3BP1) using nucleotides 1 and 871 of P53RRA and the RRM interaction domain of G3BP1 (aa 177-466). The cytosolic P53RRA-G3BP1 interaction displaced p53 from a G3BP1 complex resulting in greater p53 retention in the nucleus which led to cell cycle arrest, apoptosis, and ferroptosis. P53RRA promoted ferroptosis and apoptosis by affecting transcription of several metabolic genes. Low P53RRA expression significantly correlated with poor survival in patients with breast and lung cancers harboring wild-type p53. These data show that lncRNAs can directly interact with the functional domain of signaling proteins in the cytoplasm, thus regulating p53 modulators to suppress cancer progression. Copyright ©2018, American Association for Cancer Research.

  3. DNA damage response mediators MDC1 and 53BP1: constitutive activation and aberrant loss in breast and lung cancer, but not in testicular germ cell tumours

    Czech Academy of Sciences Publication Activity Database

    Bartkova, J.; Hořejší, Zuzana; Sehested, M.; Nesland, J.M.; Rajpert-De Meyts, E.; Skakkebaek, N.E.; Stucki, M.; Jackson, S.; Lukas, J.; Bartek, Jiří

    2007-01-01

    Roč. 26, č. 53 (2007), s. 7414-7422 ISSN 0950-9232 Institutional research plan: CEZ:AV0Z50520514 Keywords : DNA damage response * cancer * MDC1 and 53BP1 defects * tumour suppressors Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 6.440, year: 2007

  4. Role of G3BP1 in glucocorticoid receptor-mediated microRNA-15b and microRNA-23a biogenesis in endothelial cells

    KAUST Repository

    Kwok, Hoi-Hin

    2017-05-18

    MicroRNAs (miRNAs) are a family of non-coding RNAs that play crucial roles in regulating various normal cellular responses. Recent studies revealed that the canonical miRNA biogenesis pathway is subject to sophisticated regulation. Hormonal control of miRNA biogenesis by androgen and estrogen has been demonstrated, but the direct effects of the glucocorticoid receptor (GR) on miRNA biogenesis are unknown. This study revealed the role of GR in miRNA maturation. We showed that two GR agonists, dexamethasone and ginsenoside-Rg1 rapidly suppressed the expression of mature miR-15b, miR-23a, and miR-214 in human endothelial cells. RNA pulldown coupled with proteomic analysis identified GTPase-activating protein (SH3 domain) binding protein 1 (G3BP1) as one of the RNA-binding proteins mediating GR-regulated miRNA maturation. Activated GR induced phosphorylation of v-AKT Murine Thymoma Viral Oncogene Homologue (AKT) kinase, which in turn phosphorylated and promoted nuclear translocation of G3BP1. The nuclear G3BP1 bound to the G3BP1 consensus sequence located on primary miR-15b~16-2 and miR-23a~27a~24-2 to inhibit their maturation. The findings from this study have advanced our understanding of the non-genomic effects of GR in the vascular system.

  5. 53BP1 and USP28 mediate p53-dependent cell cycle arrest in response to centrosome loss and prolonged mitosis.

    Science.gov (United States)

    Fong, Chii Shyang; Mazo, Gregory; Das, Tuhin; Goodman, Joshua; Kim, Minhee; O'Rourke, Brian P; Izquierdo, Denisse; Tsou, Meng-Fu Bryan

    2016-07-02

    Mitosis occurs efficiently, but when it is disturbed or delayed, p53-dependent cell death or senescence is often triggered after mitotic exit. To characterize this process, we conducted CRISPR-mediated loss-of-function screens using a cell-based assay in which mitosis is consistently disturbed by centrosome loss. We identified 53BP1 and USP28 as essential components acting upstream of p53, evoking p21-dependent cell cycle arrest in response not only to centrosome loss, but also to other distinct defects causing prolonged mitosis. Intriguingly, 53BP1 mediates p53 activation independently of its DNA repair activity, but requiring its interacting protein USP28 that can directly deubiquitinate p53 in vitro and ectopically stabilize p53 in vivo. Moreover, 53BP1 can transduce prolonged mitosis to cell cycle arrest independently of the spindle assembly checkpoint (SAC), suggesting that while SAC protects mitotic accuracy by slowing down mitosis, 53BP1 and USP28 function in parallel to select against disturbed or delayed mitosis, promoting mitotic efficiency.

  6. FhCaBP1 (FH22): A Fasciola hepatica calcium-binding protein with EF-hand and dynein light chain domains.

    Science.gov (United States)

    Cheung, Sarah; Thomas, Charlotte M; Timson, David J

    2016-11-01

    FH22 has been previously identified as a calcium-binding protein from the common liver fluke, Fasciola hepatica. It is part of a family of at least four proteins in this organism which combine an EF-hand containing N-terminal domain with a C-terminal dynein light chain-like domain. Here we report further biochemical properties of FH22, which we propose should be renamed FhCaBP1 for consistency with other family members. Molecular modelling predicted that the two domains are linked by a flexible region and that the second EF-hand in the N-terminal domain is most likely the calcium ion binding site. Native gel electrophoresis demonstrated that the protein binds both calcium and manganese ions, but not cadmium, magnesium, strontium, barium, cobalt, copper(II), iron (II), nickel, zinc, lead or potassium ions. Calcium ion binding alters the conformation of the protein and increases its stability towards thermal denaturation. FhCaBP1 is a dimer in solution and calcium ions have no detectable effect on the protein's ability to dimerise. FhCaBP1 binds to the calmodulin antagonists trifluoperazine and chlorpromazine. Overall, the FhCaBP1's biochemical properties are most similar to FhCaBP2 a fact consistent with the close sequence and predicted structural similarity between the two proteins. Copyright © 2016 Elsevier Inc. All rights reserved.

  7. Overexpression of Phosphorylated 4E-BP1 Predicts for Tumor Recurrence and Reduced Survival in Cervical Carcinoma Treated With Postoperative Radiotherapy

    International Nuclear Information System (INIS)

    Benavente, Sergio; Verges, Ramona; Hermosilla, Eduardo; Fumanal, Victor; Casanova, Nathalie; Garcia, Angel; Ramon y Cajal, Santiago; Giralt, Jordi

    2009-01-01

    Purpose: To examine the prognostic value of the 4E-BP1 activation state and related upstream/downstream signaling proteins on the clinical outcome of patients with intermediate- or high-risk early-stage cervical carcinoma treated with postoperative radiotherapy and to determine the optimal treatment of early-stage cervical carcinoma. Methods and Materials: Immunohistochemical staining was performed on 64 formalin-fixed, paraffin-embedded cervical carcinoma surgical specimens for each protein of the panel (p4E-BP1, phosphorylated mitogen-activated protein kinase, pAkt, vascular endothelial growth factor, KDR, Bcl-2, TP53, receptor for activated C-kinase 1). The expression patterns were related to the clinical data. All patients received postoperative radiotherapy. Concurrent chemotherapy was added if high-risk features were present. The median follow-up was 40 months. Results: Of the 64 patients, 13 received concomitant chemotherapy. p4E-BP1 overexpression in moderate/high-risk early-stage cervical carcinoma correlated significantly with disease-free survival (hazard ratio, 4.39; p = .009) and overall survival (hazard ratio, 4.88; p = .005). Vascular endothelial growth factor, and its receptor KDR, had positive immunoreactivity in all tumor samples. No correlation with clinical outcome was found for the remaining proteins evaluated. Conclusion: In this study, moderate/high-risk early-stage cervical carcinoma with low p4E-BP1 expression was highly curable with the current postoperative treatments. For tumors with p4E-BP1 overexpression, new investigational strategies are needed.

  8. Anatomy and systematics of Anodontites Elongatus (Swainson from Amazon and Parana Basins, Brazil (Mollusca, Bivalvia, Unionoida, Mycetopodidae

    Directory of Open Access Journals (Sweden)

    Luiz Ricardo L Simone

    1997-12-01

    Full Text Available The anatomy of Anodontiies elongatus (Swainson, 1823, a rare species restricted to the Amazon and Parana Basins, is described by first time, showing a group of conchological and anatomical characters exclusive of this species that may be analyzed to identify it. Diagnosis of A. elongatus: shell long antero-posteriorly, umbones prominent, periostracum opaque and smooth, two posterior radial striae; middle fold of mantle edge veiy tall; gill long antero-posteriorly and short dorso-ventrally, extending about a half of it total length beyond visceral mass; palps proportionally small, several furrows in its outer surface; stomach without esophageal transversal ridjp, dorsal hood and gastric shield poorly developed, major typhlosole entering in ddd , posterior pouch of sa³ very-long; style sac reduced, without crystalline style; distal region of intestine and rectum with a well developed typhlosole, "T" in section, other intestinal regions without folds; gonad gonochoristic.

  9. ParA-like protein influences the distribution of multi-copy chromosomes in cyanobacterium Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Watanabe, Satoru; Noda, Aska; Ohbayashi, Ryudo; Uchioke, Kana; Kurihara, Ami; Nakatake, Shizuka; Morioka, Sayumi; Kanesaki, Yu; Chibazakura, Taku; Yoshikawa, Hirofumi

    2018-01-01

    While many bacteria, such as Escherichia coli and Bacillus subtilis, harbour a single-copy chromosome, freshwater cyanobacteria have multiple copies of each chromosome per cell. Although it has been reported that multi-copy chromosomes are evenly distributed along the major axis of the cell in cyanobacterium Synechococcus elongatus PCC 7942, the distribution mechanism of these chromosomes remains unclear. In S. elongatus, the carboxysome, a metabolic microcompartment for carbon fixation that is distributed in a similar manner to the multi-copy chromosomes, is regulated by ParA-like protein (hereafter ParA). To elucidate the role of ParA in the distribution of multi-copy chromosomes, we constructed and analysed ParA disruptant and overexpressing strains of S. elongatus. Our fluorescence in situ hybridization assay revealed that the parA disruptants displayed an aberrant distribution of their multi-copy chromosomes. In the parA disruptant the multiple origin and terminus foci, corresponding to the intracellular position of each chromosomal region, were aggregated, which was compensated by the expression of exogenous ParA from other genomic loci. The parA disruptant is sensitive to UV-C compared to the WT strain. Additionally, giant cells appeared under ParA overexpression at the late stage of growth indicating that excess ParA indirectly inhibits cell division. Screening of the ParA-interacting proteins by yeast two-hybrid analysis revealed four candidates that are involved in DNA repair and cell membrane biogenesis. These results suggest that ParA is involved in the pleiotropic cellular functions with these proteins, while parA is dispensable for cell viability in S. elongatus.

  10. Digalactosyldiacylglycerol is essential in Synechococcus elongatus PCC 7942, but its function does not depend on its biosynthetic pathway.

    Science.gov (United States)

    Maida, Eri; Awai, Koichiro

    2016-09-01

    Digalactosyldiacylglycerol (DGDG) is a major component of thylakoid membranes, occupying approximately 20% of the membrane system. This lipid composition is conserved from cyanobacteria to the chloroplasts of terrestrial plants, suggesting that DGDG is important for the function of photosynthetic membranes. Here we isolated the gene for DGDG synthase in the cyanobacterium Synechococcus elongatus PCC 7942 (7942dgdA) and found that this gene is essential for this species. 7942dgdA could be knocked out only when genes for cyanobacterial or plant DGDG synthases were expressed, indicating that the important factor was not the specific synthetic pathway but the lipid product. Lack of DGDG could not be compensated by the other membrane lipids in S. elongatus PCC 7942 or by glucosylgalactosyldiacylglycerol synthesized by the β-GlcT gene of Chloroflexus aurantiacus. These results reveal that DGDG has an indispensable role in S. elongatus PCC 7942 and that the second galactose molecule is key. Conservation and distribution of the galactolipid synthetic pathway among oxygenic phototrophs is discussed. This article is part of a Special Issue entitled: Plant Lipid Biology edited by Kent D. Chapman and Ivo Feussner. Copyright © 2016 Elsevier B.V. All rights reserved.

  11. Growth engineering of Synechococcus elongatus PCC 7942 for mixotrophy under natural light conditions for improved feedstock production.

    Science.gov (United States)

    Sarnaik, Aditya; Pandit, Reena; Lali, Arvind

    2017-09-01

    Synechococcus elongatus PCC 7942 has been widely explored as cyanobacterial cell factory through genetic modifications for production of various value-added compounds. However, successful industrial scale-ups have not been reported for the system predominantly due to its obligate photoautotrophic metabolism and use of artificial light in photobioreactors. Hence, engineering the organism to perform mixotrophy under natural light could serve as an effective solution. Thus, we applied a genetically engineered strain of Synechococcus elongatus PCC 7942 expressing heterologous hexose transporter gene (galP) to perform mixotrophy under natural light in a temperature controlled environmental chamber (EC). We systematically studied the comparative performances of these transformants using autotrophy and mixotrophy, which showed 3.4 times increase in biomass productivity of mixotrophically grown transformants over autotrophs in EC. Chlorophyll a yield was found to have decreased in mixotrophic conditions, possibly indicating reduced dependency on light for energy metabolism. Although pigment yield decreases under mixotrophy, titer was found to have improved due to increased biomass productivity. Carotenoid analysis showed that zeaxanthin is the major carotenoid produced by the species which is essential for photoprotection. Our work thus demonstrates that mixotrophy under temperature controlled natural light can serve as the viable solution to improve biomass productivity of Synechococcus elongatus PCC 7942 and for commercial production of natural or engineered value added compounds from the system. © 2017 American Institute of Chemical Engineers Biotechnol. Prog., 33:1182-1192, 2017. © 2017 American Institute of Chemical Engineers.

  12. Using a Microfluidic Gradient Generator to Characterize BG-11 Medium for the Growth of Cyanobacteria Synechococcus elongatus PCC7942

    Directory of Open Access Journals (Sweden)

    Chih-Chun Yang

    2015-11-01

    Full Text Available The photosynthetic cyanobacterium Synechococcus elongatus PCC7942 has recently gained great attention for its ability to directly convert CO2 into renewable chemicals upon genetic engineering. Thus, it is of great interest to increase the growth speed and lower the medium requirement for cultivating this cyanobacterium. The cultivation medium of Synechococcus elongatus PCC7942 has been developed, which consists of many inorganic and metal ingredients with a specific composition, known as the BG-11 medium. In this work, we analyzed the concentration effect of each ingredient and identified the absolutely essential components in BG-11 medium for cyanobacteria growth using the concentration gradient generator chip (CGGC fabricated by MEMS technology. As shown by our results, removal of the individual component sodium nitrate, potassium phosphate, or magnesium sulfate from the BG-11 medium led to severe growth inhibition of Synechococcus elongatus PCC7942. Contrary to our expectation, increasing concentration of the crucial ingredients showed either insignificant or negative impact on cell growth. Overall, standard growth could be achieved without supplementation of ethylenediaminetetraacetic acid (EDTA disodium, sodium carbonate, or sodium citrate to the culture medium. Further improvement of the CGGC-based microfluidic system based on this preliminary study may broaden its application range to analyze more complicated correlations.

  13. Metabolic engineering of cyanobacteria for photosynthetic 3-hydroxypropionic acid production from CO2 using Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Lan, Ethan I; Chuang, Derrick S; Shen, Claire R; Lee, Annabel M; Ro, Soo Y; Liao, James C

    2015-09-01

    Photosynthetic conversion of CO2 to chemicals using cyanobacteria is an attractive approach for direct recycling of CO2 to useful products. 3-Hydroxypropionic acid (3 HP) is a valuable chemical for the synthesis of polymers and serves as a precursor to many other chemicals such as acrylic acid. 3 HP is naturally produced through glycerol metabolism. However, cyanobacteria do not possess pathways for synthesizing glycerol and converting glycerol to 3 HP. Furthermore, the latter pathway requires coenzyme B12, or an oxygen sensitive, coenzyme B12-independent enzyme. These characteristics present major challenges for production of 3 HP using cyanobacteria. To overcome such difficulties, we constructed two alternative pathways in Synechococcus elongatus PCC 7942: a malonyl-CoA dependent pathway and a β-alanine dependent pathway. Expression of the malonyl-CoA dependent pathway genes (malonyl-CoA reductase and malonate semialdehyde reductase) enabled S. elongatus to synthesize 3 HP to a final titer of 665 mg/L. β-Alanine dependent pathway expressing S. elongatus produced 3H P to final titer of 186 mg/L. These results demonstrated the feasibility of converting CO2 into 3 HP using cyanobacteria. Copyright © 2015 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  14. Nuclear Enterprises portable dose rate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    International Nuclear Information System (INIS)

    Burgess, P.H.; Iles, W.J.

    1979-08-01

    The performance characteristics of Nuclear Enterprises Portable Dose Rate Meter Type PDR4 are evaluated under the headings: general description, facilities and controls, radiation characteristics, electrical characteristics, environmental characteristics, mechanical characteristics, the manual, summary of performance, and conclusions. Results of an investigation of the radiation characteristics of the external probes Type BP1/1, Type BP8, and Type GP9 are also detailed. (U.K.)

  15. Microwaves from Mobile Phones Inhibit 53BP1 Focus Formation in Human Stem Cells More Strongly Than in Differentiated Cells: Possible Mechanistic Link to Cancer Risk.

    Science.gov (United States)

    Markovà, Eva; Malmgren, Lars O G; Belyaev, Igor Y

    2010-03-01

    It is widely accepted that DNA double-strand breaks (DSBs) and their misrepair in stem cells are critical events in the multistage origination of various leukemias and tumors, including gliomas. We studied whether microwaves from mobile telephones of the Global System for Mobile Communication (GSM) and the Universal Global Telecommunications System (UMTS) induce DSBs or affect DSB repair in stem cells. We analyzed tumor suppressor TP53 binding protein 1 (53BP1) foci that are typically formed at the sites of DSB location (referred to as DNA repair foci) by laser confocal microscopy. Microwaves from mobile phones inhibited formation of 53BP1 foci in human primary fibroblasts and mesenchymal stem cells. These data parallel our previous findings for human lymphocytes. Importantly, the same GSM carrier frequency (915 MHz) and UMTS frequency band (1947.4 MHz) were effective for all cell types. Exposure at 905 MHz did not inhibit 53BP1 foci in differentiated cells, either fibroblasts or lymphocytes, whereas some effects were seen in stem cells at 905 MHz. Contrary to fibroblasts, stem cells did not adapt to chronic exposure during 2 weeks. The strongest microwave effects were always observed in stem cells. This result may suggest both significant misbalance in DSB repair and severe stress response. Our findings that stem cells are most sensitive to microwave exposure and react to more frequencies than do differentiated cells may be important for cancer risk assessment and indicate that stem cells are the most relevant cellular model for validating safe mobile communication signals.

  16. An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E–PlexinD1 signaling

    Science.gov (United States)

    Tata, Aleksandra; Stoppel, David C.; Hong, Shangyu; Ben-Zvi, Ayal; Xie, Tiao

    2014-01-01

    Extracellular signals have to be precisely interpreted intracellularly and translated into diverse cellular behaviors often mediated by cytoskeletal changes. Semaphorins are one of the largest families of guidance cues and play a critical role in many systems. However, how different cell types translate extracellular semaphorin binding into intracellular signaling remains unclear. Here we developed and performed a novel image-based genome-wide functional RNAi screen for downstream signaling molecules that convert the interaction between Semaphorin 3E (Sema3E) and PlexinD1 into cellular behaviors. One of the genes identified in this screen is a RhoGAP protein, SH3-domain binding protein 1 (SH3BP1). We demonstrate that SH3BP1 mediates Sema3E-induced cell collapse through interaction with PlexinD1 and regulation of Ras-related C3 botulinum toxin substrate 1 (Rac1) activity. The identification and characterization of SH3BP1 as a novel downstream effector of Sema3E-PlexinD1 provides an explanation for how extracellular signals are translated into cytoskeletal changes and unique cell behavior, but also lays the foundation for characterizing other genes identified from our screen to obtain a more complete picture of plexin signaling. PMID:24841563

  17. An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.

    Science.gov (United States)

    Tata, Aleksandra; Stoppel, David C; Hong, Shangyu; Ben-Zvi, Ayal; Xie, Tiao; Gu, Chenghua

    2014-05-26

    Extracellular signals have to be precisely interpreted intracellularly and translated into diverse cellular behaviors often mediated by cytoskeletal changes. Semaphorins are one of the largest families of guidance cues and play a critical role in many systems. However, how different cell types translate extracellular semaphorin binding into intracellular signaling remains unclear. Here we developed and performed a novel image-based genome-wide functional RNAi screen for downstream signaling molecules that convert the interaction between Semaphorin 3E (Sema3E) and PlexinD1 into cellular behaviors. One of the genes identified in this screen is a RhoGAP protein, SH3-domain binding protein 1 (SH3BP1). We demonstrate that SH3BP1 mediates Sema3E-induced cell collapse through interaction with PlexinD1 and regulation of Ras-related C3 botulinum toxin substrate 1 (Rac1) activity. The identification and characterization of SH3BP1 as a novel downstream effector of Sema3E-PlexinD1 provides an explanation for how extracellular signals are translated into cytoskeletal changes and unique cell behavior, but also lays the foundation for characterizing other genes identified from our screen to obtain a more complete picture of plexin signaling. © 2014 Tata et al.

  18. Effect of 2,4-dihydroxybenzophenone (BP1) on early life-stage development of the marine copepod Acartia tonsa at different temperatures and salinities

    DEFF Research Database (Denmark)

    Kusk, Kresten Ole; Avdolli, Manola; Wollenberger, Leah

    2011-01-01

    Benzophenone (BP)-type ultraviolet (UV) filters are widely used in cosmetic and sunscreen products and can enter the aquatic environment. Therefore, we investigated the subchronic toxicity of 2,4-dihydroxybenzophenone (BP1) on the marine calanoid copepod Acartia tonsa in an early life-stage...... was found acutely toxic at 2.6 mg/L (48-h median lethal concentration [LC50]). The toxicity of BP1 on early life-stage development was studied in combinations of three temperatures (15, 20, 25°C) and three salinities (15, 20, 25‰) using five toxicant concentrations between 0.051 and 2 mg/L in each scenario...... a copepodite stage (DT(½) ) at the different conditions were calculated. The DT(½) values decreased from 296 h at 15°C to 89 h at 25°C and were also affected by salinity (126 h at 15‰ and 167 h at 30‰), whereas the light:dark regime and culture density influenced development only to a minor extent. BP1...

  19. Apo-states of calmodulin and CaBP1 control CaV1 voltage-gated calcium channel function through direct competition for the IQ domain

    Science.gov (United States)

    Findeisen, Felix; Rumpf, Christine; Minor, Daniel L.

    2013-01-01

    In neurons, binding of calmodulin (CaM) or calcium-binding protein 1 (CaBP1) to the CaV1 (L-type) voltage-gated calcium channel IQ domain endows the channel with diametrically opposed properties. CaM causes calcium-dependent inactivation (CDI) and limits calcium entry, whereas CaBP1 blocks CDI and allows sustained calcium influx. Here, we combine isothermal titration calorimetry (ITC) with cell-based functional measurements and mathematical modeling to show that these calcium sensors behave in a competitive manner that is explained quantitatively by their apo-state binding affinities for the IQ domain. This competition can be completely blocked by covalent tethering of CaM to the channel. Further, we show that Ca2+/CaM has a sub-picomolar affinity for the IQ domain that is achieved without drastic alteration of calcium binding properties. The observation that the apo-forms of CaM and CaBP1 compete with each other demonstrates a simple mechanism for direct modulation of CaV1 function and suggests a means by which excitable cells may dynamically tune CaV activity. PMID:23811053

  20. Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD = Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD

    Directory of Open Access Journals (Sweden)

    Patrícia Cristina Gomes

    2008-04-01

    Full Text Available Recentemente a produção aquícola brasileira tem apresentado grandeprogresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dezprimers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de Gst indicam que houvebaixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence ofthree piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia(B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

  1. CRISPR/Cas9 mediated targeted mutagenesis of the fast growing cyanobacterium Synechococcus elongatus UTEX 2973.

    Science.gov (United States)

    Wendt, Kristen E; Ungerer, Justin; Cobb, Ryan E; Zhao, Huimin; Pakrasi, Himadri B

    2016-06-23

    As autotrophic prokaryotes, cyanobacteria are ideal chassis organisms for sustainable production of various useful compounds. The newly characterized cyanobacterium Synechococcus elongatus UTEX 2973 is a promising candidate for serving as a microbial cell factory because of its unusually rapid growth rate. Here, we seek to develop a genetic toolkit that enables extensive genomic engineering of Synechococcus 2973 by implementing a CRISPR/Cas9 editing system. We targeted the nblA gene because of its important role in biological response to nitrogen deprivation conditions. First, we determined that the Streptococcus pyogenes Cas9 enzyme is toxic in cyanobacteria, and conjugational transfer of stable, replicating constructs containing the cas9 gene resulted in lethality. However, after switching to a vector that permitted transient expression of the cas9 gene, we achieved markerless editing in 100 % of cyanobacterial exconjugants after the first patch. Moreover, we could readily cure the organisms of antibiotic resistance, resulting in a markerless deletion strain. High expression levels of the Cas9 protein in Synechococcus 2973 appear to be toxic and result in cell death. However, introduction of a CRISPR/Cas9 genome editing system on a plasmid backbone that leads to transient cas9 expression allowed for efficient markerless genome editing in a wild type genetic background.

  2. The stringent response regulates adaptation to darkness in the cyanobacterium Synechococcus elongatus.

    Science.gov (United States)

    Hood, Rachel D; Higgins, Sean A; Flamholz, Avi; Nichols, Robert J; Savage, David F

    2016-08-16

    The cyanobacterium Synechococcus elongatus relies upon photosynthesis to drive metabolism and growth. During darkness, Synechococcus stops growing, derives energy from its glycogen stores, and greatly decreases rates of macromolecular synthesis via unknown mechanisms. Here, we show that the stringent response, a stress response pathway whose genes are conserved across bacteria and plant plastids, contributes to this dark adaptation. Levels of the stringent response alarmone guanosine 3'-diphosphate 5'-diphosphate (ppGpp) rise after a shift from light to dark, indicating that darkness triggers the same response in cyanobacteria as starvation in heterotrophic bacteria. High levels of ppGpp are sufficient to stop growth and dramatically alter many aspects of cellular physiology, including levels of photosynthetic pigments and polyphosphate, DNA content, and the rate of translation. Cells unable to synthesize ppGpp display pronounced growth defects after exposure to darkness. The stringent response regulates expression of a number of genes in Synechococcus, including ribosomal hibernation promoting factor (hpf), which causes ribosomes to dimerize in the dark and may contribute to decreased translation. Although the metabolism of Synechococcus differentiates it from other model bacterial systems, the logic of the stringent response remains remarkably conserved, while at the same time having adapted to the unique stresses of the photosynthetic lifestyle.

  3. Constitutive phosphorylation of the mTORC2/Akt/4E-BP1 pathway in newly derived canine hemangiosarcoma cell lines

    Directory of Open Access Journals (Sweden)

    Murai Atsuko

    2012-07-01

    Full Text Available Abstract Background Canine hemangiosarcoma (HSA is a malignant tumor with poor long-term prognosis due to development of metastasis despite aggressive treatment. The phosphatidyl-inositol-3 kinase/Akt/mammalian target of rapamycin (PI3K/Akt/mTOR pathway is involved in its endothelial pathologies; however, it remains unknown how this pathway plays a role in canine HSA. Here, we characterized new canine HSA cell lines derived from nude mice-xenografted canine HSAs and investigated the deregulation of the signaling pathways in these cell lines. Results Seven canine HSA cell lines were established from 3 xenograft canine HSAs and showed characteristics of endothelial cells (ECs, that is, uptake of acetylated low-density lipoprotein and expression of canine-specific CD31 mRNA. They showed varied morphologies and mRNA expression levels for VEGF-A, bFGF, HGF, IGF-I, EGF, PDGF-B, and their receptors. Cell proliferation was stimulated by these growth factors and fetal bovine serum (FBS in 1 cell line and by FBS alone in 3 cell lines. However, cell proliferation was not stimulated by growth factors and FBS in the remaining 3 cell lines. Phosphorylated p44/42 Erk1/2 was increased by FBS stimulation in 4 cell lines. In contrast, phosphorylation of Akt at Ser473, mTOR complex 1 (mTORC1 at Ser2448, and eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1 at Ser65 was high in serum-starved condition and not altered by FBS stimulation in 6 cell lines, despite increased phosphorylation of these residues in normal canine ECs. This suggested that the mTORC2/Akt/4E-BP1 pathway was constitutively activated in these 6 canine HSA cell lines. After cell inoculation into nude mice, canine HSA tumors were formed from 4 cell lines and showed Akt and 4E-BP1 phosphorylation identical to the parental cell lines. Conclusions Our findings suggest that the present cell lines may be useful tools for investigating the role of the mTORC2/Akt/4E-BP1 pathway in

  4. 1H, 13C and 15N resonance assignments of the GTPase-activating (GAP) and Ral binding domains (GBD) of RLIP76 (RalBP1).

    Science.gov (United States)

    Rajasekar, Karthik V; Campbell, Louise J; Nietlispach, Daniel; Owen, Darerca; Mott, Helen R

    2012-10-01

    RLIP76 (also known as RalBP1) is an effector for Ral small G proteins. RLIP76 is a multifunctional, multi-domain protein that includes a GTPase activating domain for the Rho family (RhoGAP domain) and a GTPase binding domain (GBD) for the Ral small G proteins. The juxtaposition of these two domains (GAP and GBD) may be a strategy employed to co-ordinate regulation of Rho family and Ral-controlled signalling pathways at a crossover node. Here we present the (1)H, (15)N and (13)C NMR backbone and sidechain resonance assignments of the GAP and GBD di-domain (31 kDa).

  5. Morphology, chemistry and function of the postpharyngeal gland in the South American digger wasps Trachypus boharti and Trachypus elongatus.

    Directory of Open Access Journals (Sweden)

    Gudrun Herzner

    Full Text Available Microbes pose severe threats to animals as competitors or pathogens and strongly affect the evolution of life history traits like parental care. Females of the European beewolf Philanthus triangulum, a solitary digger wasp, provision their offspring with paralyzed honeybees and embalm them with the secretion from large postpharyngeal glands (PPG that contain mainly unsaturated hydrocarbons. This coating changes the physico-chemical properties of the prey surface, causes a reduction of water condensation and retards growth of mold fungi. Here we examined the closely related South American genus Trachypus, which shows a life-history similar to Philanthus. We investigated whether Trachypus spp. also possess PPGs and embalm larval provisions. Using histological methods and 3D reconstructions we show that Trachypus boharti and T. elongatus possess PPGs that are similar to P. triangulum but somewhat smaller. The ultrastructure of the gland epithelium suggests that the gland content is at least partly sequestered from the hemolymph. Chemical analyses using gas chromatography / mass spectrometry revealed that both the cuticle and PPGs of Trachypus contain mainly unsaturated long-chain hydrocarbons. The gland of T. boharti additionally contains long-chain ketones. The hydrocarbons from the PPG of T. elongatus occurred on prey bees excavated from nests in the field but not on conspecific control bees. While the embalming only slightly elevated the amount of hydrocarbons on prey bees, the proportion of unsaturated hydrocarbons, which is crucial for the antifungal effect, was significantly increased. The Trachypus species under study possess PPGs that are very similar to the PPG of P. triangulum with regard to morphology, ultrastructure and chemistry. Moreover, we provide clear evidence that T. elongatus females embalm their prey, presumably as a means of prey preservation. The observed differences among Trachypus and Philanthus in gland size and prey

  6. Morphology, Chemistry and Function of the Postpharyngeal Gland in the South American Digger Wasps Trachypus boharti and Trachypus elongatus

    Science.gov (United States)

    Herzner, Gudrun; Kaltenpoth, Martin; Poettinger, Theodor; Weiss, Katharina; Koedam, Dirk; Kroiss, Johannes; Strohm, Erhard

    2013-01-01

    Microbes pose severe threats to animals as competitors or pathogens and strongly affect the evolution of life history traits like parental care. Females of the European beewolf Philanthus triangulum, a solitary digger wasp, provision their offspring with paralyzed honeybees and embalm them with the secretion from large postpharyngeal glands (PPG) that contain mainly unsaturated hydrocarbons. This coating changes the physico-chemical properties of the prey surface, causes a reduction of water condensation and retards growth of mold fungi. Here we examined the closely related South American genus Trachypus, which shows a life-history similar to Philanthus. We investigated whether Trachypus spp. also possess PPGs and embalm larval provisions. Using histological methods and 3D reconstructions we show that Trachypus boharti and T. elongatus possess PPGs that are similar to P. triangulum but somewhat smaller. The ultrastructure of the gland epithelium suggests that the gland content is at least partly sequestered from the hemolymph. Chemical analyses using gas chromatography / mass spectrometry revealed that both the cuticle and PPGs of Trachypus contain mainly unsaturated long-chain hydrocarbons. The gland of T. boharti additionally contains long-chain ketones. The hydrocarbons from the PPG of T. elongatus occurred on prey bees excavated from nests in the field but not on conspecific control bees. While the embalming only slightly elevated the amount of hydrocarbons on prey bees, the proportion of unsaturated hydrocarbons, which is crucial for the antifungal effect, was significantly increased. The Trachypus species under study possess PPGs that are very similar to the PPG of P. triangulum with regard to morphology, ultrastructure and chemistry. Moreover, we provide clear evidence that T. elongatus females embalm their prey, presumably as a means of prey preservation. The observed differences among Trachypus and Philanthus in gland size and prey embalming may have

  7. CRISPR interference (CRISPRi) for gene regulation and succinate production in cyanobacterium S. elongatus PCC 7942.

    Science.gov (United States)

    Huang, Chun-Hung; Shen, Claire R; Li, Hung; Sung, Li-Yu; Wu, Meng-Ying; Hu, Yu-Chen

    2016-11-15

    Cyanobacterium Synechococcus elongatus PCC 7942 holds promise for biochemical conversion, but gene deletion in PCC 7942 is time-consuming and may be lethal to cells. CRISPR interference (CRISPRi) is an emerging technology that exploits the catalytically inactive Cas9 (dCas9) and single guide RNA (sgRNA) to repress sequence-specific genes without the need of gene knockout, and is repurposed to rewire metabolic networks in various procaryotic cells. To employ CRISPRi for the manipulation of gene network in PCC 7942, we integrated the cassettes expressing enhanced yellow fluorescent protein (EYFP), dCas9 and sgRNA targeting different regions on eyfp into the PCC 7942 chromosome. Co-expression of dCas9 and sgRNA conferred effective and stable suppression of EYFP production at efficiencies exceeding 99%, without impairing cell growth. We next integrated the dCas9 and sgRNA targeting endogenous genes essential for glycogen accumulation (glgc) and succinate conversion to fumarate (sdhA and sdhB). Transcription levels of glgc, sdhA and sdhB were effectively suppressed with efficiencies depending on the sgRNA binding site. Targeted suppression of glgc reduced the expression to 6.2%, attenuated the glycogen accumulation to 4.8% and significantly enhanced the succinate titer. Targeting sdhA or sdhB also effectively downregulated the gene expression and enhanced the succinate titer ≈12.5-fold to ≈0.58-0.63 mg/L. These data demonstrated that CRISPRi-mediated gene suppression allowed for re-directing the cellular carbon flow, thus paving a new avenue to rationally fine-tune the metabolic pathways in PCC 7942 for the production of biotechnological products.

  8. The potential of Synechococcus elongatus UTEX 2973 for sugar feedstock production.

    Science.gov (United States)

    Song, Kuo; Tan, Xiaoming; Liang, Yajing; Lu, Xuefeng

    2016-09-01

    It is important to obtain abundant sugar feedstocks economically and sustainably for bio-fermentation industry, especially for producing cheap biofuels and biochemicals. Besides plant biomass, photosynthetic cyanobacteria have also been considered to be potential microbe candidates for sustainable production of carbohydrate feedstocks. As the fastest growing cyanobacterium reported so far, Synechococcus elongatus UTEX 2973 (Syn2973) might have huge potential for bioproduction. In this study, we explored the potentials of this strain as photo-bioreactors for sucrose and glycogen production. Under nitrogen-replete condition, Syn2973 could accumulate glycogen with a rate of 0.75 g L(-1) day(-1) at the exponential phase and reach a glycogen content as high as 51 % of the dry cell weight (DCW) at the stationary phase. By introducing a sucrose transporter CscB, Syn2973 was endowed with an ability to secrete over 94 % sucrose out of cells under salt stress condition. The highest extracellular sucrose productivity reached 35.5 mg L(-1) h(-1) for the Syn2973 strain expressing cscB, which contained the similar amounts of intracellular glycogen with the wild type. Potassium chloride was firstly proved to induce sucrose accumulation as well as sodium chloride in Syn2973. By semi-continuous culturing, 8.7 g L(-1) sucrose was produced by the cscB-expressing strain of Syn2973 in 21 days. These results support that Syn2973 is a promising candidate with great potential for production of sugars.

  9. Rad9, Rad17, TopBP1 and claspin play essential roles in heat-induced activation of ATR kinase and heat tolerance.

    Directory of Open Access Journals (Sweden)

    Munkhbold Tuul

    Full Text Available Hyperthermia is widely used to treat patients with cancer, especially in combination with other treatments such as radiation therapy. Heat treatment per se activates DNA damage responses mediated by the ATR-Chk1 and ATM-Chk2 pathways but it is not fully understood how these DNA damage responses are activated and affect heat tolerance. By performing a genetic analysis of human HeLa cells and chicken B lymphoma DT40 cells, we found that heat-induced Chk1 Ser345 phosphorylation by ATR was largely dependent on Rad9, Rad17, TopBP1 and Claspin. Activation of the ATR-Chk1 pathway by heat, however, was not associated with FancD2 monoubiquitination or RPA32 phosphorylation, which are known as downstream events of ATR kinase activation when replication forks are stalled. Downregulation of ATR, Rad9, Rad17, TopBP1 or Claspin drastically reduced clonogenic cell viability upon hyperthermia, while gene knockout or inhibition of ATM kinase reduced clonogenic viability only modestly. Suppression of the ATR-Chk1 pathway activation enhanced heat-induced phosphorylation of Chk2 Thr68 and simultaneous inhibition of ATR and ATM kinases rendered severe heat cytotoxicity. These data indicate that essential factors for activation of the ATR-Chk1 pathway at stalled replication forks are also required for heat-induced activation of ATR kinase, which predominantly contributes to heat tolerance in a non-overlapping manner with ATM kinase.

  10. Efficacy of the Combination of a PARP Inhibitor and UVC on Cancer Cells as Imaged by Focus Formation by the DNA Repair-related Protein 53BP1 Linked to Green Fluorescent Protein.

    Science.gov (United States)

    Tome, Yasunori; Uehara, Fuminari; Miwa, Shinji; Yano, Shuya; Mii, Sumiyuki; Efimova, Elena V; Bouvet, Michael; Kimura, Hiroaki; Tsuchiya, Hiroyuki; Kanaya, Fuminori; Hoffman, Robert M

    2016-08-01

    The ability to image DNA repair in cancer cells after irradiation, as well as its inhibition by potential therapeutic agents, is important for the further development of effective cancer therapy. 53BP1 is a DNA repair protein that is overexpressed and forms foci when double-stranded DNA breaks occur in DNA. The re-localization of green fluorescent protein (GFP) fused to the chromatin-binding domain of 53BP1 to form foci was imaged after UVC irradiation of breast and pancreatic cancer cells expressing 53BP1-GFP using confocal microscopy. During live-cell imaging, 53BP1-GFP focus formation was observed within 10 minutes after UVC irradiation. Most 53BP1 foci resolved by 100 minutes. To block UVC-induced double-strand break repair in cancer cells, poly(ADP-ribose) polymerase (PARP) was targeted with ABT-888 (veliparib). PARP inhibition markedly enhanced UVC-irradiation-induced persistence of 53BP1-foci, even beyond 100 minutes after UVC irradiation, and reduced proliferation of breast and pancreatic cancer cells. Confocal microscopy of 53BP1-GFP is a powerful method for imaging UVC-induced DNA damage and repair, as well as inhibition of repair. Copyright© 2016 International Institute of Anticancer Research (Dr. John G. Delinassios), All rights reserved.

  11. Species-specific differences of the spectroscopic properties of P700 - Analysis of the influence of non-conserved amino acid residues by site-directed mutagenesis of photosystem I from Chlamydomonas reinhardtii

    NARCIS (Netherlands)

    Witt, H.; Bordignon, E.; Carbonera, D.; Dekker, J.P.; Karapetyan, N.; Teutloff, C.; Webber, A.; Lubitz, W.; Schlodder, E.

    2003-01-01

    We applied optical spectroscopy, magnetic resonance techniques, and redox titrations to investigate the properties of the primary electron donor P700 in photosystem I (PS I) core complexes from cyanobacteria (Thermosynechococcus elongatus, Spirulina platensis, and Synechocystis sp. PCC 6803), algae

  12. Loss of PINK1 attenuates HIF-1α induction by preventing 4E-BP1-dependent switch in protein translation under hypoxia.

    Science.gov (United States)

    Lin, William; Wadlington, Natasha L; Chen, Linan; Zhuang, Xiaoxi; Brorson, James R; Kang, Un Jung

    2014-02-19

    Parkinson's disease (PD) has multiple proposed etiologies with implication of abnormalities in cellular homeostasis ranging from proteostasis to mitochondrial dynamics to energy metabolism. PINK1 mutations are associated with familial PD and here we discover a novel PINK1 mechanism in cellular stress response. Using hypoxia as a physiological trigger of oxidative stress and disruption in energy metabolism, we demonstrate that PINK1(-/-) mouse cells exhibited significantly reduced induction of HIF-1α protein, HIF-1α transcriptional activity, and hypoxia-responsive gene upregulation. Loss of PINK1 impairs both hypoxia-induced 4E-BP1 dephosphorylation and increase in the ratio of internal ribosomal entry site (IRES)-dependent to cap-dependent translation. These data suggest that PINK1 mediates adaptive responses by activating IRES-dependent translation, and the impairments in translation and the HIF-1α pathway may contribute to PINK1-associated PD pathogenesis that manifests under cellular stress.

  13. Characterization of Ribeye subunits in zebrafish hair cells reveals that exogenous Ribeye B-domain and CtBP1 localize to the basal ends of synaptic ribbons.

    Directory of Open Access Journals (Sweden)

    Lavinia Sheets

    Full Text Available Synaptic ribbons are presynaptic structures formed by the self-association of RIBEYE-the main structural component of ribbon synapses. RIBEYE consists of two domains: a unique N-terminal A-domain and a C-terminal B-domain that is identical to the transcription co-repressor C-terminal binding protein 2 (CtBP2. Previous studies in cell lines have shown that RIBEYE A-domain alone is sufficient to form ribbon-like aggregates and that both A- and B- domains form homo-and heterotypic interactions. As these interactions are likely the basis for synaptic-ribbon assembly and structural plasticity, we wanted to examine how zebrafish Ribeye A- and B- domains interact with synaptic ribbons in vivo. To that end, we characterized the localization of exogenously expressed Ribeye A- and B- domains and the closely related protein, CtBP1, in the hair cells of transgenic zebrafish larvae. Unexpectedly, exogenously expressed Ribeye A-domain showed variable patterns of localization in hair cells; one zebrafish paralog of A-domain failed to self-associate or localize to synaptic ribbons, while the other self-assembled but sometimes failed to localize to synaptic ribbons. By contrast, Ribeye B-domain/CtBP2 was robustly localized to synaptic ribbons. Moreover, both exogenously expressed B-domain/CtBP2 and CtBP1 were preferentially localized to the basal end of ribbons adjacent to the postsynaptic density. Overexpression of B-domain/CtBP2 also appeared to affect synaptic-ribbon composition; endogenous levels of ribbon-localized Ribeye were significantly reduced as hair cells matured in B-domain/CtBP2 transgenic larvae compared to wild-type. These results reveal how exogenously expressed Ribeye domains interact with synaptic ribbons, and suggest a potential organization of elements within the ribbon body.

  14. Characterization of Ribeye subunits in zebrafish hair cells reveals that exogenous Ribeye B-domain and CtBP1 localize to the basal ends of synaptic ribbons.

    Science.gov (United States)

    Sheets, Lavinia; Hagen, Matthew W; Nicolson, Teresa

    2014-01-01

    Synaptic ribbons are presynaptic structures formed by the self-association of RIBEYE-the main structural component of ribbon synapses. RIBEYE consists of two domains: a unique N-terminal A-domain and a C-terminal B-domain that is identical to the transcription co-repressor C-terminal binding protein 2 (CtBP2). Previous studies in cell lines have shown that RIBEYE A-domain alone is sufficient to form ribbon-like aggregates and that both A- and B- domains form homo-and heterotypic interactions. As these interactions are likely the basis for synaptic-ribbon assembly and structural plasticity, we wanted to examine how zebrafish Ribeye A- and B- domains interact with synaptic ribbons in vivo. To that end, we characterized the localization of exogenously expressed Ribeye A- and B- domains and the closely related protein, CtBP1, in the hair cells of transgenic zebrafish larvae. Unexpectedly, exogenously expressed Ribeye A-domain showed variable patterns of localization in hair cells; one zebrafish paralog of A-domain failed to self-associate or localize to synaptic ribbons, while the other self-assembled but sometimes failed to localize to synaptic ribbons. By contrast, Ribeye B-domain/CtBP2 was robustly localized to synaptic ribbons. Moreover, both exogenously expressed B-domain/CtBP2 and CtBP1 were preferentially localized to the basal end of ribbons adjacent to the postsynaptic density. Overexpression of B-domain/CtBP2 also appeared to affect synaptic-ribbon composition; endogenous levels of ribbon-localized Ribeye were significantly reduced as hair cells matured in B-domain/CtBP2 transgenic larvae compared to wild-type. These results reveal how exogenously expressed Ribeye domains interact with synaptic ribbons, and suggest a potential organization of elements within the ribbon body.

  15. Targeting mTOR/p70S6K/glycolysis signaling pathway restores glucocorticoid sensitivity to 4E-BP1 null Burkitt Lymphoma

    International Nuclear Information System (INIS)

    Gu, Ling; Xie, Liping; Zuo, Chuan; Ma, Zhigui; Zhang, Yanle; Zhu, Yiping; Gao, Ju

    2015-01-01

    Increasing evidence indicates that rapamycin could be used as a potential glucocorticoid (GC) sensitizer in lymphoblastic malignancies via genetic prevention of 4E-BP1 phosphorylation. Interestingly, we found that combined rapamycin with dexamethasone can effectively reverse GC resistance in 4E-BP1 null lymphoma cells. In this study, we investigated the potential link between mTOR/p70S6K signaling pathway, glycolysis, autophagy and GC resistance. Antitumor effects of the combination of rapamycin and dexamethasone were evaluated on cell viability by MTT assay and in vivo studies, on cell cycle and apoptosis by flow cytometry, on autophagy by western blot, MDC staining and transmission electron microscopy and on cell signaling by western blot. Moreover, to test whether inhibiting glycolysis is the core mechanism in rapamycin restoring GC sensitivity, we took glycolysis inhibitor 2-deoxyglucose to replace rapamycin and then evaluated the antitumor effects in vitro. Raji cells are resistant to rapamycin (IC 50 > 1000 nM) or dexamethasone (IC 50 > 100 μM) treatment alone. The combination of rapamycin and dexamethasone synergistically inhibited the viability of Raji cells in vitro and in vivo by inducing caspase-dependent and -independent cell death and G 0 /G 1 cell cycle arrest. These effects were achieved by the inhibition of mTOR/p70S6K signaling pathway, which led to the inhibition of glycolysis and the induction of autophagy. Pretreatment with pan-caspase inhibitor z-VAD-fmk or autophagy inhibitor 3-MA failed to protect the cells from combined treatment-induced death. Glycolysis inhibitor combined with dexamethasone produced a similar antitumor effects in vitro. Inhibition of mTOR/p70S6K/glycolysis signaling pathway is the key point of therapy in reversing GC resistant in Burkitt lymphoma patients. The online version of this article (doi:10.1186/s12885-015-1535-z) contains supplementary material, which is available to authorized users

  16. eRF3b, a biomarker for hepatocellular carcinoma, influences cell cycle and phosphoralation status of 4E-BP1.

    Directory of Open Access Journals (Sweden)

    Man Li

    Full Text Available BACKGROUND: Hepatitis B virus (HBV infection and its sequelae are now recognized as serious problems globally. Our aime is to screen hepatocellular carcinoma (HCC from chronic hepatitis B (CHB and identify the characteristics of proteins involved. METHODOLOGY/PRINCIPAL FINDINGS: We affinity-purified sample serum with weak cation-exchange (WCX magnetic beads and matrix-assisted laser desorption/ionization time of flight mass spectrometry (MALDI-TOF MS analysis to search for potential markers. The 4210 Da protein, which differed substantially between HCC and CHB isolates, was later identified to be eukaryotic peptide chain release factor GTP-binding subunit eRF3b. Further research showed that eRF3b/GSPT2 was positively expressed in liver tissues. GSPT2 mRNA was, however differentially expressed in blood. Compared with normal controls, the relative expression of GSPT2/18s rRNA was higher in CHB patients than in patients with either LC or HCC (P = 0.035 for CHB vs. LC; P = 0.020 for CHB vs. HCC. The data of further research showed that eRF3b/GSPT2 promoted the entrance of the HepG2 cells into the S-phase and that one of the substrates of the mTOR kinase, 4E-BP1, was hyperphosphorylated in eRF3b-overexpressing HepG2 cells. CONCLUSIONS: Overall, the differentially expressed protein eRF3b, which was discovered as a biomarker for HCC, could change the cell cycle and influence the phosphorylation status of 4E-BP1 on Ser65 in HepG2.

  17. A numerical investigation of phytoplankton and Pseudocalanus elongatus dynamics in the spring bloom time in the Gdańsk Gulf

    Science.gov (United States)

    Dzierzbicka-Głowacka, Lidia

    2005-01-01

    A nutrient-phytoplankton-zooplankton-detritus (1D-NPZD) `phytoplankton {Phyt} and Pseudocalanus elongatus {Zoop} dynamics in the spring bloom time in the Gdańsk Gulf. The 1D-NPZD model consists of three coupled, partial second-order differential equations of the diffusion type for phytoplankton {Phyt}, zooplankton {Zoop}, nutrients {Nutr} and one ordinary first-order differential equation for benthic detritus pool {Detr}, together with initial and boundary conditions. In this model, the {Zoop} is presented by only one species of copepod ( P. elongatus) and {Zoop} is composed of six cohorts of copepods with weights ( Wi) and numbers ( Zi); where Zoop= limit∑i=16W iZ i. The calculations were made for 90 days (March, April, May) for two stations at Gdańsk Gulf with a vertical space step of 0.5m and a time step of 900 s. The flow field and water temperature used as the inputs in the biological model 1D-NPZD were reproduced by the prognostic numerical simulation technique using hydrographic climatological data. The results of the numerical investigations described here were compared with the mean observed values of surface chlorophyll- a and depth integrated P. elongatus biomass for 10 years, 1980-1990. The slight differences between the calculated and mean observed values of surface chlorophyll- a and zooplankton biomass are ca. 10-60 mg C m -3 and ca. 5-23 mg C m -2, respectively, depending on the location of the hydrographic station. The 1D-NPZD model with a high-resolution zooplankton module for P. elongatus can be used to describe the temporal patterns for phytoplankton biomass and P. elongatus in the centre of the Gdańsk Gulf.

  18. Effect of the ration processing on the apparent digestibility values of nutrients for the piau (Leporinus elongatus Efeito do tipo de ração sobre a digestibilidade aparente dos nutrientes para piau (Leporinus elongatus

    Directory of Open Access Journals (Sweden)

    Priscila Vieira Rosa Logato

    2009-06-01

    Full Text Available The experiment carried out at National Center for Research in Tropical Fish Pirassununga, SP, aiming to determine the effect of the ration processing on the apparent digestibility coefficients of the ingredients for the piau (L. elongatus. A total of 600 males of piau were utilized, allotted into six ponds of 300L. The applied treatments were: grinder processed ration, pelleting ration and extruded ration, utilizing rations with 32% crude protein and 3400 Kcal DE.Kg-1. The experiment was in a randomized blocks design with three treatments, three blocks and two replicates. The data were submitted to variance analysis by the SAEG computational package and the means of the treatments compared by SNK test (5% of significance. The results showed that there were significant differences among the digestibility coefficients of both protein and energy for the pelleted and extrused rations (P0.05.O experimento foi realizado no Centro Nacional de Pesquisa de Peixes Tropicais de Pirassununga, SP, objetivando-se determinar o efeito do processamento da ração sobre os coeficientes de digestibilidade aparente dos ingredientes para o piau (L. elongatus. Foram utilizados 600 machos de piau, distribuídos em seis tanques de 300 L. Os tratamentos aplicados foram: ração farelada, ração peletizada e ração extrusada, formuladas com 32% de PB e 3400 Kcal ED/Kg. O delineamento experimental foi em blocos casualizados, com três tratamentos, três blocos e duas repetições por tratamento. As análises estatísticas foram realizadas pelo SAEG, com as médias comparadas pelo teste SNK (5%. Houve diferenças entre os coeficientes de digestibilidade da proteína bruta e energia para as rações peletizada e extusada (P0,05.

  19. Análise do gene TAX1BP1 em pacientes com câncer de cabeça e pescoço Analysis of the TAX1BP1 gene in head and neck cancer patients

    Directory of Open Access Journals (Sweden)

    Mariangela Torreglosa Ruiz

    2010-04-01

    Full Text Available No Brasil foram estimados 14.160 casos novos de câncer e cabeça e pescoço para o ano de 2008. O tabagismo e o etilismo são os principais fatores de riscos estabelecidos na etiologia dessa doença. OBJETIVO: Avaliar o polimorfismo T → A do gene TAX1BP1 (leu306ile em pacientes com câncer de cabeça e pescoço e em uma população controle. CASUÍSTICA E MÉTODOS: Estudo retrospectivo onde foram avaliados o sexo, idade, tabagismo e etilismo de 191 pacientes com câncer de cabeça e pescoço e de 200 indivíduos sem história de neoplasia. A análise molecular foi realizada após extração de DNA genômico pela técnica de PCR-RFLP. RESULTADOS: Há predominância de pacientes do sexo masculino (84,82%, tabagistas (91,1% e etilistas (77,49%. A avaliação molecular não mostrou diferença estatisticamente significante entre os dois grupos (p =0,32. A análise dos parâmetros clínicos e polimorfismos mostrou uma associação com câncer na cavidade oral (OR:2,38; IC 95%: 1,18-4,78; p = 0,01, os demais parâmetros não mostraram associação com o polimorfismo. CONCLUSÃO: Há evidências de associação entre o polimorfismo do gene TAX1BP1 e câncer de cavidade oral. Para os demais parâmetros analisados os resultados não sugerem uma associação com o polimorfismo do gene TAX1BP1.In Brazil, there were 14,160 new estimated cases of head and neck cancer for the year of 2008. Smoking and drinking are the main risk factors established in the etiology of this disease. AIM: to assess the T → A polymorphism in gene TAX1BP1 (leu306ile in patients with head and neck cancer and a control population. SERIES AND METHODS: a retrospective study in which we assessed the gender, age, smoking and drinking habits of 191 patients with head and neck cancer and 200 individuals without history of neoplasia. The molecular analysis was carried out after genomic DNA extraction by the PCR-RFLP method. RESULTS: there is a predominance of males (84.82%, smokers (91

  20. Isolation of cyanophycin from tobacco and potato plants with constitutive plastidic cphATe gene expression.

    Science.gov (United States)

    Neubauer, Katja; Hühns, Maja; Hausmann, Tina; Klemke, Friederike; Lockau, Wolfgang; Kahmann, Uwe; Pistorius, Elfriede K; Kragl, Udo; Broer, Inge

    2012-03-31

    A chimeric cyanophycin synthetase gene composed of the cphATe coding region from the cyanobacterium Thermosynechococcus elongatus BP-1, the constitutive 35S promoter and the plastid targeting sequence of the integral photosystem II protein PsbY was transferred to the tobacco variety Petit Havanna SRI and the commercial potato starch production variety Albatros. The resulting constitutive expression of cyanophycin synthetase leads to polymer contents in potato leaf chloroplasts of up to 35 mg/g dry weight and in tuber amyloplasts of up to 9 mg/g dry weight. Both transgenic tobacco and potato were used for the development of isolation methods applicable for large-scale extraction of the polymer. Two different procedures were developed which yielded polymer samples of 80 and 90% purity, respectively. Copyright © 2011 Elsevier B.V. All rights reserved.

  1. Live Dynamics of 53BP1 Foci Following Simultaneous Induction of Clustered and Dispersed DNA Damage in U2OS Cells

    Directory of Open Access Journals (Sweden)

    Alice Sollazzo

    2018-02-01

    Full Text Available Cells react differently to clustered and dispersed DNA double strand breaks (DSB. Little is known about the initial reaction to simultaneous induction of DSBs with different complexities. Here, we used live cell microscopy to analyse the behaviour of 53BP1-GFP (green fluorescence protein foci formation at DSBs induced in U2OS cells by alpha particles, X-rays or mixed beams over a 75 min period post irradiation. X-ray-induced foci rapidly increased and declined over the observation interval. After an initial increase, mixed beam-induced foci remained at a constant level over the observation interval, similarly as alpha-induced foci. The average areas of radiation-induced foci were similar for mixed beams and X-rays, being significantly smaller than those induced by alpha particles. Pixel intensities were highest for mixed beam-induced foci and showed the lowest level of variability over time as compared to foci induced by alphas and X-rays alone. Finally, mixed beam-exposed foci showed the lowest level of mobility as compared to alpha and X-ray exposure. The results suggest paralysation of chromatin around foci containing clustered DNA damage.

  2. γH2AX/53BP1 foci as a potential pre-treatment marker of HNSCC tumors radiosensitivity - preliminary methodological study and discussion

    Science.gov (United States)

    Falk, Martin; Horakova, Zuzana; Svobodova, Marketa; Masarik, Michal; Kopecna, Olga; Gumulec, Jaromir; Raudenska, Martina; Depes, Daniel; Bacikova, Alena; Falkova, Iva; Binkova, Hana

    2017-09-01

    In order to improve patients' post-treatment quality of life, a shift from surgery to non-surgical (chemo)radio-treatment is recognized in head and neck oncology. However, about half of HNSCC tumors are resistant to irradiation and an efficient marker of individual tumor radiosensitivity is still missing. We analyzed whether various parameters of DNA double strand break (DSB) repair determined in vitro can predict, prior to clinical treatment initiation, the radiosensitivity of tumors. We compared formation and decrease of γH2AX/53BP1 foci in 48 h after irradiating tumor cell primocultures with 2 Gy of γ-rays. To better understand complex tumor behavior, three different cell type primocultures - CD90-, CD90+, and a mixed culture of these cells - were isolated from 1 clinically radioresistant, 2 radiosensitive, and 4 undetermined HPV-HNSCC tumors and followed separately. While DSB repair was delayed and the number of persisting DSBs increased in the radiosensitive tumors, the results for the radioresistant tumor were similar to cultured normal human skin fibroblasts. Hence, DSB repair kinetics/efficiency may correlate with clinical response to radiotherapy for a subset of HNSCC tumors but the size (and therefore practical relevance) of this subset remains to be determined. The same is true for contribution of different cell type primocultures to tumor radioresistance.

  3. Identification of small droplets of photosynthetic squalene in engineered Synechococcus elongatus PCC 7942 using TEM and selective fluorescent Nile red analysis.

    Science.gov (United States)

    Choi, Sun Young; Sim, Sang Jun; Choi, Jong-Il; Woo, Han Min

    2018-03-12

    To identify microbial squalene that has been widely used in various industrial applications, intracellular formation of photosynthetic squalene was investigated using the previously engineered Synechococcus elongatus PCC 7942 strain. Unlike the proposed localization of squalene in the membrane bilayer, small droplets were identified in the cytoplasm of S. elongatus PCC 7942 as squalene using transmission electron microscopy analysis. Determination of the diameters of the squalene droplets with manual examination of 1,016 droplets in different squalene-producing strains indicated larger squalene droplets in larger cells. Based on the observation of a sole droplet of squalene in a cyanobacterium, fluorescent Nile red was used for the selective staining of squalene. The fluorescent intensities were correlated with squalene contents determined using gas chromatography-mass spectrometry. Photosynthetic squalene was identified as a small droplet in S. elongatus PCC 7942 and this non-invasive quantitative method could be useful to promote high-throughput strain development for squalene production. This article is protected by copyright. All rights reserved. This article is protected by copyright. All rights reserved.

  4. Sensitivity of global translation to mTOR inhibition in REN cells depends on the equilibrium between eIF4E and 4E-BP1.

    Directory of Open Access Journals (Sweden)

    Stefano Grosso

    Full Text Available Initiation is the rate-limiting phase of protein synthesis, controlled by signaling pathways regulating the phosphorylation of translation factors. Initiation has three steps, 43S, 48S and 80S formation. 43S formation is repressed by eIF2α phosphorylation. The subsequent steps, 48S and 80S formation are enabled by growth factors. 48S relies on eIF4E-mediated assembly of eIF4F complex; 4E-BPs competitively displace eIF4E from eIF4F. Two pathways control eIF4F: 1 mTORc1 phosphorylates and inactivates 4E-BPs, leading to eIF4F formation; 2 the Ras-Mnk cascade phosphorylates eIF4E. We show that REN and NCI-H28 mesothelioma cells have constitutive activation of both pathways and maximal translation rate, in the absence of exogenous growth factors. Translation is rapidly abrogated by phosphorylation of eIF2α. Surprisingly, pharmacological inhibition of mTORc1 leads to the complete dephosphorylation of downstream targets, without changes in methionine incorporation. In addition, the combined administration of mTORc1 and MAPK/Mnk inhibitors has no additive effect. The inhibition of both mTORc1 and mTORc2 does not affect the metabolic rate. In spite of this, mTORc1 inhibition reduces eIF4F complex formation, and depresses translocation of TOP mRNAs on polysomes. Downregulation of eIF4E and overexpression of 4E-BP1 induce rapamycin sensitivity, suggesting that disruption of eIF4F complex, due to eIF4E modulation, competes with its recycling to ribosomes. These data suggest the existence of a dynamic equilibrium in which eIF4F is not essential for all mRNAs and is not displaced from translated mRNAs, before recycling to the next.

  5. Temporal changes in ERK phosphorylation are harmonious with 4E-BP1, but not p70S6K, during clenbuterol-induced hypertrophy in the rat gastrocnemius.

    Science.gov (United States)

    Sumi, Koichiro; Higashi, Seiichiro; Natsume, Midori; Kawahata, Keiko; Nakazato, Koichi

    2014-08-01

    Extracellular signal-regulated kinase (ERK) is required for clenbuterol (CB)-dependent fast-type myofibril enlargement; however, its contribution to translation control is unclear. ERK mediates translational regulation through mammalian target of rapamycin complex 1 (mTORC1) activation and (or) mTORC1-independent pathways. In this study, we aimed to investigate the role of ERK in translational control during CB-induced muscular hypertrophy by measuring time-dependent changes in the phosphorylation statuses of ERK, p70 ribosomal S6 kinase (p70S6K; an indicator of mTORC1 activity), 4E-binding protein 1 (4E-BP1), eukaryotic elongation factor 2 (eEF2), and other related signaling molecules in rat gastrocnemius muscles. Five-day administration of CB induced phenotypes associated with muscular hypertrophy (significant increases in wet weight and isometric ankle flexion torque in the gastrocnemius muscle), but was not accompanied by elevated ERK or p70S6K phosphorylation. One-day administration of CB caused significant increases in the phosphorylation of ERK, p70S6K, and 4E-BP1. In contrast, 3-day administration of CB caused significant increases in the phosphorylation of ERK and 4E-BP1, but not p70S6K. In addition, positive correlations were observed between ERK and 4E-BP1 on days 1 and 3, whereas a correlation between ERK and p70S6K was only observed on day 1. eEF2 phosphorylation was unchanged on both days 1 and 3. These findings suggest that ERK accelerates the initiation of translation, but does not support the involvement of ERK in translational elongation. Furthermore, ERK may play a major role in promoting translational initiation by mediating the phosphorylation of 4E-BP1, and may contribute to the initial activation of mTORC1 during CB administration.

  6. In vivo features of signal transduction by the essential response regulator RpaB from Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Moronta-Barrios, Félix; Espinosa, Javier; Contreras, Asunción

    2012-05-01

    The NblS-RpaB signalling pathway, the most conserved two-component system in cyanobacteria, regulates photosynthesis and acclimatization to a variety of environmental conditions and is involved in negative regulation of high-light-induced genes. However, relevant regulatory details of the NblS-RpaB signalling pathway remain to be elucidated. We recently showed that the response regulator RpaB is regulated by specific (de)phosphorylation from the histidine kinase NblS and that RpaB and its phosphorylatable residue Asp56 are both required for viability of Synechococcus elongatus PCC 7942. We show here that the phosphorylated form of RpaB is present in cells growing under standard laboratory conditions and that high light stress affected the ratio of phosphorylated to non-phosphorylated RpaB. It also decreased the amount of rpaB transcripts without appreciably changing the total levels of RpaB. Quantitative Western blotting and confocal microscopy analyses were consistent with RpaB being a very abundant regulator, with nucleoid localization. A genetically engineered RpaB-GFP (green fluorescent protein) fusion protein rescued lethality of the rpaB null mutant, indicating that it was functional. This is, to our knowledge, the first study demonstrating in a cyanobacterium, and for a two-component response regulator, that the in vivo ratio of phosphorylated to non-phosphorylated protein changes in response to environmental conditions.

  7. ppGpp Controls Global Gene Expression in Light and in Darkness in S. elongatus

    Directory of Open Access Journals (Sweden)

    Anna M. Puszynska

    2017-12-01

    Full Text Available The bacterial and plant stringent response involves production of the signaling molecules guanosine tetraphosphate and guanosine pentaphosphate ((pppGpp, leading to global reorganization of gene expression. The function of the stringent response has been well characterized in stress conditions, but its regulatory role during unstressed growth is less studied. Here, we demonstrate that (pppGpp-deficient strains of S. elongatus have globally deregulated biosynthetic capacity, with increased transcription rate, translation rate, and cell size in unstressed conditions in light and impaired viability in darkness. Synthetic restoration of basal guanosine tetraphosphate (ppGpp levels is sufficient to recover transcriptional balance and appropriate cell size in light and to rescue viability in light/dark conditions, but it is insufficient to enable efficient dark-induced transcriptional shutdown. Our work underscores the importance of basal ppGpp signaling for regulation of cyanobacterial physiology in the absence of stress and for viability in energy-limiting conditions, highlighting that basal (pppGpp level is essential in cyanobacteria in the environmental light/dark cycle.

  8. Delignification and detoxification of peanut shell bio-waste using an extremely halophilic laccase from an Aquisalibacillus elongatus isolate.

    Science.gov (United States)

    Rezaie, Rezvan; Rezaei, Shahla; Jafari, Nasrin; Forootanfar, Hamid; Khoshayand, Mohammad Reza; Faramarzi, Mohammad Ali

    2017-11-01

    Lignocellulose bioconversion is a harsh process requiring the use of surfactants and organic solvents. Consequently, the incorporation of laccases in this bioconversion requires the bioprospecting of enzymes that can remain stable under extreme conditions. An extracellular, highly stable laccase was produced by the halophilic isolate Aquisalibacillus elongatus in submerged liquid culture fermentation. Statistical and non-statistical strategies gave the highest enzymatic activity (8.02 U mL -1 ) following addition of glucose (1.7 g L -1 ), copper sulfate (0.8 g L -1 ), urea (15 g L -1 ), and CaCl 2 (0.8 g L -1 ). The enzyme, after purification using a synthetic affinity support, delignified a peanut shell substrate by 45%. A pH of 8.0 and a temperature of 35 °C were optimal for delignification of this bio-waste material. Addition of [Bmim][PF 6 ], 1,4-dioxane, acetone, and HBT promoted this bio-waste delignification. Bio-treatment in the presence of 50% [Bmim][PF 6 ] gave a maximal lignin removal of 87%. The surfactants tested had no significant effects on the delignification yield. The laccase also detoxified the toxic phenols found in peanut shell waste. The high catalytic efficiency of this enzyme against a lignocellulosic sample under extreme conditions suggests the suitability of this laccase for industrial applications.

  9. Ultrastructural analysis of the shells of Anodontites trapesialis (Lamarck and Anodontites elongatus (Swaison (Mollusca, Bivalvia, Etherioidea from the Mato Grosso Pantanal Region, Brazil Análise da ultraestrutura das conchas de Anodontites trapesialis (Lamarck e Anodontites elongatus (Swaison (Mollusca, Bivalvia, Etherioidea do Pantanal do Mato Grosso, Brasil

    Directory of Open Access Journals (Sweden)

    Claudia T. Callil

    2005-09-01

    Full Text Available Based on optical and SEM microscopic observations, the projections of the outer surface of the periostracum and inner micro-structures of the shell are described and redefined. The outer surface of the periostracum is practically smooth in both species. Considering a mesoscopic view of the periostracum, A. trapesialis (Lamarck, 1819 presents regular corrugations in the form of radial sequences of arches on the disk region, isolated rays or horizontal sequences of rays on the anterior lower region. A. elongatus presents corrugations formed by series of oblique arches on the disc and oblique rays on the carina. Under SEM, micro ridges were more evident in A. elongatus, but a wide diversity of shapes and patterns of micro fringes were observed in A. trapesialis, especially in young individuals. Considering the profile of the shell layers, the periostracum is relatively thin and apparently simple in A. trapesialis and thinner in A. elongatus. The prismatic layer is thick in both species, consisting of a single series of elongated prisms and wedge-shaped prisms close to the outer surface. The nacreous layer consists of very fine lamellae without pattern or with a slight staircase-like; in A. elongatus this layer is divided by a laminar inclusion of conchiolin. The fringes are abundant and diversified in A. trapesialis, a species less resistant to desiccation due to the presence of a wide intervalvar gap. The existence of a greater density of micro fringes and spikes in juveniles may be related to the orientation of the animal in order to search for an ideal site for development or for escape from regions subject to seasonal droughts, like Pantanal.Projeções da superfície externa do perióstraco e micro estruturas da concha foram redefinidas com base na microscopia óptica e eletrônica de varredura. A superfície do perióstraco é praticamente lisa em ambas espécies. Sob vista mesoscópica, A. trapesialis (Lamarck, 1819 apresenta corruga

  10. Analysis of the role of the gene coding the Amyloid-Precursor Protein Binding Protein 1 (APP-BP1) in the radio-sensitivity of epidermoid carcinomas of the upper aero-digestive tract infected by the human papillomavirus

    International Nuclear Information System (INIS)

    Guihard, S.; Altmeyer, A.; Ramolu, L.; Macabre, C.; Abecassis, J.; Noel, G.; Jung, A.C.

    2010-01-01

    As the human papillomavirus (HPV) is at the origin of 25% of upper aero-digestive tract cancers, and as these tumours present an increased radio-sensitivity compared to other tumours, probably due to a greater transcriptional activity of p53, the authors report the study on the influence of a decrease of the expression of the APP-BP1 in these tumours which could favour a radio-induced apoptosis. By using a reverse transcriptase polymerase chain reaction (RT-PCR), they assessed the APP-BP1 expression levels as well as expression levels of transcriptions coding onco-proteins known to be over-expressed in HPV+ tumours. They compared the radio-sensitivities of HPV+ and HPV- cells, the first one appearing to be greater than the second one. Short communication

  11. Metabolic engineering of Synechococcus elongatus PCC 7942 for improvement of 1,3-propanediol and glycerol production based on in silico simulation of metabolic flux distribution.

    Science.gov (United States)

    Hirokawa, Yasutaka; Matsuo, Shingo; Hamada, Hiroyuki; Matsuda, Fumio; Hanai, Taizo

    2017-11-25

    Production directly from carbon dioxide by engineered cyanobacteria is one of the promising technologies for sustainable future. Previously, we have successfully achieved 1,3-propanediol (1,3-PDO) production using Synechococcus elongatus PCC 7942 with a synthetic metabolic pathway. The strain into which the synthetic metabolic pathway was introduced produced 3.48 mM (0.265 g/L) 1,3-PDO and 14.3 mM (1.32 g/L) glycerol during 20 days of incubation. In this study, the productivities of 1,3-PDO were improved by gene disruption selected by screening with in silico simulation. First, a stoichiometric metabolic model was applied to prediction of cellular metabolic flux distribution in a 1,3-PDO-producing strain of S. elongatus PCC 7942. A genome-scale model of S. elongatus PCC 7942 constructed by Knoop was modified by the addition of a synthetic metabolic pathway for 1,3-PDO production. Next, the metabolic flux distribution predicted by metabolic flux balance analysis (FBA) was used for in silico simulation of gene disruption. As a result of gene disruption simulation, NADPH dehydrogenase 1 (NDH-1) complexes were found by screening to be the most promising candidates for disruption to improve 1,3-PDO production. The effect of disruption of the gene encoding a subunit of the NDH-1 complex was evaluated in the 1,3-PDO-producing strain. During 20 days of incubation, the ndhF1-null 1,3-PDO-producing strain showed the highest titers: 4.44 mM (0.338 g/L) 1,3-PDO and 30.3 mM (2.79 g/L) glycerol. In this study, we successfully improved 1,3-PDO productivity on the basis of in silico simulation of gene disruption.

  12. Construction of a novel d-lactate producing pathway from dihydroxyacetone phosphate of the Calvin cycle in cyanobacterium, Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Hirokawa, Yasutaka; Goto, Ryota; Umetani, Yoshitaka; Hanai, Taizo

    2017-07-01

    Using engineered cyanobacteria to produce various chemicals from carbon dioxide is a promising technology for a sustainable future. Lactate is a valuable commodity that can be used for the biodegradable plastic, polylactic acid. Typically, lactate production using engineered cyanobacteria was via the conversion of pyruvate in glycolysis by lactate dehydrogenase. In cyanobacteria, the metabolic flux in the Calvin cycle is higher than that in glycolysis under photoautotrophic conditions. The construction of a novel lactate producing pathway that uses metabolites from the Calvin cycle could potentially increase lactate productivity in cyanobacteria. In order to develop such a novel lactate production pathway, we engineered a cyanobacterium Synechococcus elongatus PCC 7942 strain that produced lactate directly from carbon dioxide using dihydroxyacetone phosphate (DHAP) via methylglyoxal. We confirmed that wild-type strain of S. elongatus PCC 7942 could produce lactate using exogenous methylglyoxal. A methylglyoxal synthase gene, mgsA, from Escherichia coli was introduced into Synechococcus elongates PCC 7942 for conversion of DHAP to methylglyoxal. This engineered strain produced lactate directly from carbon dioxide. Genes encoding intrinsic putative glyoxalase I, II (Synpcc7942_0638, 1403) and the lactate/H + symporter from E. coli (lldP) were additionally introduced to enhance the production. For higher lactate production, it was important to maintain elevated extracellular pH due to the characteristics of lactate exporting system. In this study, the highest lactate titer of 13.7 mM (1.23 g/l) was achieved during a 24-day incubation with the engineered S. elongatus PCC 7942 strain possessing the novel lactate producing pathway. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  13. Structural basis and target-specific modulation of ADP sensing by the Synechococcus elongatus PII signaling protein.

    Science.gov (United States)

    Zeth, Kornelius; Fokina, Oleksandra; Forchhammer, Karl

    2014-03-28

    PII signaling proteins comprise one of the most versatile signaling devices in nature and have a highly conserved structure. In cyanobacteria, PipX and N-acetyl-L-glutamate kinase are receptors of PII signaling, and these interactions are modulated by ADP, ATP, and 2-oxoglutarate. These effector molecules bind interdependently to three anti-cooperative binding sites on the trimeric PII protein and thereby affect its structure. Here we used the PII protein from Synechococcus elongatus PCC 7942 to reveal the structural basis of anti-cooperative ADP binding. Furthermore, we clarified the mutual influence of PII-receptor interaction and sensing of the ATP/ADP ratio. The crystal structures of two forms of trimeric PII, one with one ADP bound and the other with all three ADP-binding sites occupied, revealed significant differences in the ADP binding mode: at one site (S1) ADP is tightly bound through side-chain and main-chain interactions, whereas at the other two sites (S2 and S3) the ADP molecules are only bound by main-chain interactions. In the presence of the PII-receptor PipX, the affinity of ADP to the first binding site S1 strongly increases, whereas the affinity for ATP decreases due to PipX favoring the S1 conformation of PII-ADP. In consequence, the PII-PipX interaction is highly sensitive to subtle fluctuations in the ATP/ADP ratio. By contrast, the PII-N-acetyl-L-glutamate kinase interaction, which is negatively affected by ADP, is insensitive to these fluctuations. Modulation of the metabolite-sensing properties of PII by its receptors allows PII to differentially perceive signals in a target-specific manner and to perform multitasking signal transduction.

  14. Persistence of gamma-H2AX and 53BP1 foci in proliferating and nonproliferating human mammary epithelial cells after exposure to gamma-rays or iron ions

    Energy Technology Data Exchange (ETDEWEB)

    Groesser, Torsten; Chang, Hang; Fontenay, Gerald; Chen, James; Costes, Sylvain V.; Barcellos-Hoff, Mary Helen; Parvin, Bahram; Rydberg, Bjorn

    2010-12-22

    To investigate {gamma}-H2AX (phosphorylated histone H2AX) and 53BP1 (tumour protein 53 binding protein No. 1) foci formation and removal in proliferating and non-proliferating human mammary epithelial cells (HMEC) after exposure to sparsely and densely ionizing radiation under different cell culture conditions. HMEC cells were grown either as monolayers (2D) or in extracellular matrix to allow the formation of acinar structures in vitro (3D). Foci numbers were quantified by image analysis at various time points after exposure. Our results reveal that in non-proliferating cells under 2D and 3D cell culture conditions, iron-ion induced {gamma}-H2AX foci were still present at 72 h after exposure, although 53BP1 foci returned to control levels at 48 h. In contrast in proliferating HMEC, both {gamma}-H2AX and 53BP1 foci decreased to control levels during the 24-48 h time interval after irradiation under 2D conditions. Foci numbers decreased faster after {gamma}-ray irradiation and returned to control levels by 12 h regardless of marker, cell proliferation status, and cell culture condition. Conclusions: The disappearance of radiation induced {gamma}-H2AX and 53BP1 foci in HMEC have different dynamics that depend on radiation quality and proliferation status. Notably, the general patterns do not depend on the cell culture condition (2D versus 3D). We speculate that the persistent {gamma}-H2AX foci in iron-ion irradiated non-proliferating cells could be due to limited availability of double strand break (DSB) repair pathways in G0/G1-phase, or that repair of complex DSB requires replication or chromatin remodeling.

  15. Rapamycin-insensitive mTORC1 activity controls eIF4E:4E-BP1 binding [v1; ref status: indexed, http://f1000r.es/NM6hpo

    Directory of Open Access Journals (Sweden)

    Mark Livingstone

    2012-07-01

    Full Text Available The recent development of mammalian target of rapamycin (mTOR kinase domain inhibitors and genetic dissection of rapamycin-sensitive and -insensitive mTOR protein complexes (mTORC1 and mTORC2 have revealed that phosphorylation of the mTOR substrate 4E-BP1 on amino acids Thr37 and/or Thr46 represents a rapamycin-insensitive activity of mTORC1. Despite numerous previous reports utilizing serine (Ser-to-alanine (Ala and threonine (Thr-to-Ala phosphorylation site mutants of 4E-BP1 to assess which post-translational modification(s directly regulate binding to eIF4E, an ambiguous understanding persists. This manuscript demonstrates that the initial, rapamycin-insensitive phosphorylation event at Thr46 is sufficient to prevent eIF4E:4E-BP1 binding. This finding is relevant, particularly as mTOR kinase domain inhibitors continue to be assessed for clinical efficacy, since it clarifies a difference between the action of these second-generation mTOR inhibitors and those of rapamycin analogues.

  16. Adjustments to Photosystem Stoichiometry and Electron Transfer Proteins Are Key to the Remarkably Fast Growth of the Cyanobacterium Synechococcus elongatus UTEX 2973

    Directory of Open Access Journals (Sweden)

    Justin Ungerer

    2018-02-01

    Full Text Available At the genome level, Synechococcus elongatus UTEX 2973 (Synechococcus 2973 is nearly identical to the model cyanobacterium Synechococcus elongatus PCC 7942 (Synechococcus 7942 with only 55 single nucleotide differences separating the two strains. Despite the high similarity between the two strains, Synechococcus 2973 grows three times faster, accumulates significantly more glycogen, is tolerant to extremely high light intensities, and displays higher photosynthetic rates. The high homology between the two strains provides a unique opportunity to examine the factors that lead to increased photosynthetic rates. We compared the photophysiology of the two strains and determined the differences in Synechococcus 2973 that lead to increased photosynthetic rates and the concomitant increase in biomass production. In this study, we identified inefficiencies in the electron transport chain of Synechococcus 7942 that have been alleviated in Synechococcus 2973. Photosystem II (PSII capacity is the same in both strains. However, Synechococcus 2973 exhibits a 1.6-fold increase in PSI content, a 1.5-fold increase in cytochrome b6f content, and a 2.4-fold increase in plastocyanin content on a per cell basis. The increased content of electron carriers allows a higher flux of electrons through the photosynthetic electron transport chain, while the increased PSI content provides more oxidizing power to maintain upstream carriers ready to accept electrons. These changes serve to increase the photosynthetic efficiency of Synechococcus 2973, the fastest growing cyanobacterium known.

  17. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes.

    Science.gov (United States)

    Danchin, Etienne G J; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Da Rocha, Martine; Bajew, Simon; Neilson, Roy; Guzeeva, Elena Sokolova; Da Silva, Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Johannes; Jones, John T; den Akker, Sebastian Eves-van

    2017-10-23

    Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq) to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus , representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus , respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

  18. The study of desiccation-tolerance in drying leaves of the desiccation-tolerant grass Sporobolus elongatus and the desiccation-sensitive grass Sporobolus pyramidalis.

    Science.gov (United States)

    Ghasempour, Hamid Reza; Kianian, Jahanbakheshe

    2007-03-01

    Hydrated leaves of the resurrection grass Sporobolus elongatus are not desiccation tolerant (DT), but moderate to severe drought stress can induce their DT with the leaves remain attach to drying intact plants. In vivo protein synthesis was studied with SDS-page of extracts of leaves of intact drying plants of S. elongatus (a desiccation-Tolerant grass (DT)) and S. pyramidalis (a desiccation-sensitive species (DS)). Free proline increased in drying leaves. Soluble sugar contents also increased with drying but were less than fully hydrated leaves at 8% RWC. Total protein also showed an increase with an exception at 8% RWC which showed a decrease. SDS-page of extracts of drying leaves of both DT and DS plants were studied as relative water contents (RWC) decreased. In first phase, DT species at 58% RWC (80-51% RWC range), two proteins increased in contents. In the second phase, at 8% (35-4% RWC range) two new bands increased and two bands decreased. In leaves of DS species some bands decreased as drying progressed. Also, as drying advanced free proline increased in DT species. Total protein increased as drying increased but at 8% RWC decreased. All data of results are consistent with current views about studied factors and their roles during drying and induction of desiccation tolerance in DT plants.

  19. Evidence supporting a role for TopBP1 and Brd4 in the initiation but not continuation of human papillomavirus 16 E1/E2-mediated DNA replication.

    Science.gov (United States)

    Gauson, Elaine J; Donaldson, Mary M; Dornan, Edward S; Wang, Xu; Bristol, Molly; Bodily, Jason M; Morgan, Iain M

    2015-05-01

    To replicate the double-stranded human papillomavirus 16 (HPV16) DNA genome, viral proteins E1 and E2 associate with the viral origin of replication, and E2 can also regulate transcription from adjacent promoters. E2 interacts with host proteins in order to regulate both transcription and replication; TopBP1 and Brd4 are cellular proteins that interact with HPV16 E2. Previous work with E2 mutants demonstrated the Brd4 requirement for the transactivation properties of E2, while TopBP1 is required for DNA replication induced by E2 from the viral origin of replication in association with E1. More-recent studies have also implicated Brd4 in the regulation of DNA replication by E2 and E1. Here, we demonstrate that both TopBP1 and Brd4 are present at the viral origin of replication and that interaction with E2 is required for optimal initiation of DNA replication. Both cellular proteins are present in E1-E2-containing nuclear foci, and the viral origin of replication is required for the efficient formation of these foci. Short hairpin RNA (shRNA) against either TopBP1 or Brd4 destroys the E1-E2 nuclear bodies but has no effect on E1-E2-mediated levels of DNA replication. An E2 mutation in the context of the complete HPV16 genome that compromises Brd4 interaction fails to efficiently establish episomes in primary human keratinocytes. Overall, the results suggest that interactions between TopBP1 and E2 and between Brd4 and E2 are required to correctly initiate DNA replication but are not required for continuing DNA replication, which may be mediated by alternative processes such as rolling circle amplification and/or homologous recombination. Human papillomavirus 16 (HPV16) is causative in many human cancers, including cervical and head and neck cancers, and is responsible for the annual deaths of hundreds of thousands of people worldwide. The current vaccine will save lives in future generations, but antivirals targeting HPV16 are required for the alleviation of disease

  20. Effects of Reduced and Enhanced Glycogen Pools on Salt-Induced Sucrose Production in a Sucrose-Secreting Strain of Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Qiao, Cuncun; Duan, Yangkai; Zhang, Mingyi; Hagemann, Martin; Luo, Quan; Lu, Xuefeng

    2018-01-15

    Sucrose and glycogen syntheses in cyanobacteria share the common precursor glucose-1-phosphate. It is generally assumed that lowering glycogen synthesis could drive more carbon toward sucrose synthesis that can be induced by salt stress among cyanobacteria. By using a theophylline-dependent riboswitch system, the expression of glgC , a key gene in glycogen synthesis, was downregulated in a quantitative manner in a sucrose-secreting strain of Synechococcus elongatus PCC 7942. We observed that the stepwise suppression of glycogen synthesis limited rather than stimulated sucrose production in the salt-stressed cells, suggesting that glycogen could serve as a carbon pool for the synthesis of sucrose. Accordingly, we generated glycogen-overproducing strains, but the increased glycogen pool alone did not stimulate sucrose production, indicating that alternative steps limit the carbon flux toward the synthesis of sucrose. Consistent with previous studies that showed that sucrose-phosphate synthase (SPS) catalyzes the rate-limiting step in sucrose synthesis, the combination of glycogen overproduction and sps overexpression resulted in increased sucrose production. Our results indicate that the glycogen and sucrose pools are closely linked in Synechococcus elongatus PCC 7942, and we propose that enhancing the glycogen pool could be a promising strategy for the improvement of sucrose production by cyanobacteria in the presence of a strong sucrose synthesis sink. IMPORTANCE Many cyanobacteria naturally synthesize and accumulate sucrose when stressed by NaCl, which provides novel possibilities for obtaining sugar feedstock by engineering of cyanobacteria. It has been assumed that glycogen synthesis competes with sucrose synthesis for the carbon flux. However, our results showed that the suppression of glycogen synthesis decreased rather than stimulated sucrose production in a sucrose-secreting strain of Synechococcus elongatus PCC 7942. This result suggests that glycogen could

  1. Seasonal changes in food quantity and quality of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus: a bioassay approach

    DEFF Research Database (Denmark)

    Koski, Marja; Dutz, Jörg; Klein Breteler, W.

    2010-01-01

    We evaluated the food quantity and quality over a seasonal cycle for the development and egg production of the common North Sea copepods Temora longicornis and Pseudocalanus elongatus, using a bioassay approach. Seston was sampled from December to October from a well-mixed water column...... of the Marsdiep (Dutch Wadden Sea) and fed to cultured copepods at a constant temperature of 15 degrees C, thus excluding seasonal effects of temperature, body size, age, and maternal nutrition. Copepod response was evaluated by measuring egg production and juvenile development, while the seston quantity...... and quality were measured as the concentrations of chl a, specific phytoplankton pigments, particulate organic carbon (POC), particulate organic nitrogen (PON), fatty acids, and sterols. The egg production of both copepods was low when feeding on seston collected in winter, but increased to peak values...

  2. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

    Directory of Open Access Journals (Sweden)

    Etienne G.J. Danchin

    2017-10-01

    Full Text Available Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been implicated in the evolution of plant parasitism. We have used ribonucleic acid sequencing (RNAseq to generate reference transcriptomes for two economically important nematode species, Xiphinema index and Longidorus elongatus, representative of two genera within the early-branching Clade 2 of the phylum Nematoda. We used a transcriptome-wide analysis to identify putative horizontal gene transfer events. This represents the first in-depth transcriptome analysis from any plant-parasitic nematode of this clade. For each species, we assembled ~30 million Illumina reads into a reference transcriptome. We identified 62 and 104 transcripts, from X. index and L. elongatus, respectively, that were putatively acquired via horizontal gene transfer. By cross-referencing horizontal gene transfer prediction with a phylum-wide analysis of Pfam domains, we identified Clade 2-specific events. Of these, a GH12 cellulase from X. index was analysed phylogenetically and biochemically, revealing a likely bacterial origin and canonical enzymatic function. Horizontal gene transfer was previously shown to be a phenomenon that has contributed to the evolution of plant parasitism among nematodes. Our findings underline the importance and the extensiveness of this phenomenon in the evolution of plant-parasitic life styles in this speciose and widespread animal phylum.

  3. Distribución geográfica, prevalencia e intensidad de las infecciones de Gregarina ronderosi (Eugregarinorida: Gregarinidae en Dichroplus elongatus (Orthoptera: Acrididae

    Directory of Open Access Journals (Sweden)

    Christian Bardi

    2016-01-01

    Full Text Available regarina ronderosi es un parásito obligado del tracto digestivo del acrídido plaga Dichroplus elongatus y una de las únicas dos eugregarinas de acrídidos argentinos descriptas con su ciclo de vida completo. Dada la falta de conocimiento acerca de aspectos epizootiológicos fundamentales de las infecci- ones causadas por eugregarinas en acrídidos de Argentina, el objetivo de esta contribución es iniciar el registro de la distribución geográfica de G. ronderosi en la región Pampeana, su prevalencia natural y la intensidad de las infecciones en condiciones naturales. Para ello, se colectaron ejemplares de D. elongatus (2008 – 2012 en distintos puntos de la región Pampeana. Se obtuvieron y analizaron un total de 4084 ejemplares provenientes de cuarenta y dos localidades. La prevalen- cia promedio de G. ronderosi para el total de localidades con presencia (diecisiete localidades fue de 29,7 ± EE 6,6% (n = 1071. El total de individuos infectados (n = 396 fue categorizado respecto de la intensidad de las infecciones: tres (0,8% presentaron infecciones muy fuertes, ochenta (20% fuerte, doscientos diez (53% moderadas y ciento tres (26% infecciones leves. Se ha ampliado la distribución ge- ográfica conocida, se han registrado prevalencias elevadas que sugieren la ocur - rencia de epizootias y se han registrado por primera vez en condiciones naturales infecciones de G. ronderosi categorizadas como Fuertes y Muy Fuertes.

  4. Proximate composition, mineral content and fatty acid profile of two marine fishes from Cameroonian coast: Pseudotolithus typus (Bleeker, 1863 and Pseudotolithus elongatus (Bowdich, 1825

    Directory of Open Access Journals (Sweden)

    J.M. Njinkoue

    2016-10-01

    Full Text Available Background: Knowledge of chemical composition of fish from Cameroon is poor. The genera Pseudotolithus are nutritionally and economically important in Cameroon. Thus the knowledge on their chemical composition could help in functional food elaboration. Purpose: In this study, Proximate composition, fatty acid profiles and mineral composition were determined in two fish species, Pseudotolithus typus and Pseudotolithus elongatus from Cameroonian coasts. Basic procedure: AOAC standard method was used. Fatty acids were identified by GC/MS as N-acylpyrolidides. Mineral compositions were determined by atomic absorption spectrophotometry for Ca, Na, K, Mg, Fe, Zn, Cu, Mn, and by UV spectrophotometry for phosphorus (P. Main finding: Results indicated that chemical composition was not similar in the two fish species. Results also showed that water is the main constituent in the edible parts and in the bones with 76.17% to 78.24% and 51.21% to 55.28% respectively. Pseudotolithus typus and Pseudotolithus elongatus were good sources of proteins with 16.17% and 13.4% respectively. All the fish analyzed for fat were lean with fat contents less than 0.5%. These species of fish were poor in ω6PUFA and were rich in ω3PUFA with about one third of total fatty acids. The main ω3 fatty acids were eicosapentaenoic acid (EPA and docosahexaenoic acid (DHA. The most abundant main elements were the potassium in the edible parts (1.39% and calcium in the bones (18.26%. The most abundant trace elements were Zn and Fe in the edible parts and in the bones. Principal conclusion: The Na/K ratio values and ω3 fatty acids contents suggest that consumption of these two fish species could be recommended to prevent cardiovascular diseases. Keywords: Proximal composition, Mineral content, Fatty acid profiles, Pseudotolithus typus, Pseudotolithus elongates

  5. Cytogenetic markers as diagnoses in the identification of the hybrid between Piauçu (Leporinus macrocephalus and Piapara (Leporinus elongatus

    Directory of Open Access Journals (Sweden)

    Fábio Porto-Foresti

    2008-01-01

    Full Text Available The genetic monitoring of interspecific hybrids involves the application of methodologies able to provide an easy and indubitable genetic characterization of both parental and hybrid individuals. In the present work, cytogenetic techniques were used to identify a hybrid lineage of "Piaupara" in order to caracterize them in relation to the parental species, Leporinus macrocephalus (piauçu and L. elongatus (piapara. The cytogenetic analysis revealed that L. macrocephalus presented 2n = 54 chromosomes and a nucleolar organizer regions (NOR at the telomere of the long arm of the submetacentric chromosome pair 2. Analysis of constitutive heterochromatin (C-banding revealed a conspicuous block at the pericentromeric region on the long arm of a submetacentric chromosome pair. L. elongatus presented the same diploid number, 2n = 54, and a karyotypic formula similar to that of L. macrocephalus. The NORs were also at the telomere of the long arm of the submetacentric pair 2, which was morphologically different from that of L. macrocephalus. Heterochromatic blocks were observed at both telomeres of a submetacentric chromosome pair. The hybrid "Piaupara" presented the same diploid number (2n = 54 and karyotypic formula as the parental species and there were no visible differences between parental and hybrid individuals. Differently from the Giemsa staining, NOR- and C-banding analysis showed marked differences which allowed the identification of the hybrids by the different morphology and/or size of the chromosomes carrying the NORs and patterns of heterochromatin distribution in their chromosomes. Such genetic studies are important for fish culture since they can provide tools for monitoring natural and artificial hybridization. They are also useful in biological conservation programmes and in the proper management of natural and reared fish stocks.

  6. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... elongatus BP-1] ... Length = 101 ... Query: 1 ... MIPGELIPAEGTIELNAGRPTVTLTVANTGDRPIQVGSHYHFYEV...NPALQFEREQARGMR 60 ... MIPGELIPAEGTIELNAGRPTVTLTVANTGDRPIQVGSHYHFYEVNPALQF...EREQARGMR Sbjct: 1 ... MIPGELIPAEGTIELNAGRPTVTLTVANTGDRPIQVGSHYHFYEVNPALQFEREQARGMR 60 ...

  7. Acquired resistance of phosphatase and tensin homolog-deficient cells to poly(ADP-ribose) polymerase inhibitor and Ara-C mediated by 53BP1 loss and SAMHD1 overexpression.

    Science.gov (United States)

    Wang, Yu-Ting; Yuan, Bo; Chen, Hua-Dong; Xu, Lin; Tian, Yu-Nan; Zhang, Ao; He, Jin-Xue; Miao, Ze-Hong

    2018-03-01

    With increasing uses of poly(ADP-ribose) polymerase (PARP) inhibitors (PARPi) for cancer therapy, understanding their resistance is becoming urgent. However, acquired PARPi resistance in the phosphatase and tensin homolog (PTEN)-deficient background is poorly understood. We generated 3 PARPi-resistant PTEN-deficient glioblastoma U251 variants separately with olaparib (U251/OP), talazoparib (U251/TP) and simmiparib (U251/SP). These variants displayed consistent resistance (2.46-71.78-fold) to all 5 PARPi, including niraparib and rucaparib, and showed higher degrees of resistance to the PARPi to which the parental cells were more sensitive. The resistance was characteristic of fast emergence and high stability. However, the resistance acquirement did not cause an increasingly aggressive phenotype. The resistance was not correlated to various factors, including PTEN mutations. The PARPi-treated variants produced less γH2AX and G2/M arrest. Consistently, loss of 53BP1 occurred in all variants and its compensation enhanced their sensitivity to PARPi by approximately 76%. The variants revealed slightly different cross-resistance profiles to 13 non-PARPi anticancer drugs. All were resistant to Ara-C (6-8-fold) but showed differential resistance to 5-fluorouracil, gemcitabine and paclitaxel. Almost no resistance was observed to the rest drugs, including cisplatin. SAMHD1 was overexpressed in all the variants and its knockout completely restored their sensitivity to Ara-C but did not affect their PARPi sensitivity. The present study demonstrates a consistent resistance profile to PARPi and a unique cross-resistance profile to non-PARPi drugs in different PARPi-resistant U251 cells and reveals 53BP1 loss and SAMHD1 overexpression as the primary mechanisms responsible for their resistance to PARPi and Ara-C, respectively. These effects probably result from heritable gene change(s) caused by persistent PARPi exposure. © 2017 The Authors. Cancer Science published by John

  8. On Dichelyne (Cucullanellus elongatus (Tornquist, 1931 Petter, 1974: South American correlated species (Nematoda, Cucullanidae and some other helminths of micropogonias furnieri (Desmarest, 1823 (Pisces, Sciaenidae Sobre Dichelyne (Cucullanellus elongatus (Tornquist, 1931 Petter, 1974: espécies sul americanas correlatas (Nematoda, Cucullanidae e alguns outros helmintos de Micropogonias furnieri (Desmarest, 1823(Pisces, Sciaenidae

    Directory of Open Access Journals (Sweden)

    J. Júlio Vicente

    1989-09-01

    Full Text Available Dichelyne (Cucullanellus elongatus (Tomquist, 1931 Petter, 1974, from Venezuela, of which D.(C. amaurincai (Freitas, Vicente & Ibáñez, 1969 Petter, 1974 is proposed as a junior synonym, is redescribed and comments on the present status of the remaining species under the group, namely D.(C. dichelyneformes (Szidat, 1950 Petter, 1974, D.(C. rodriguesi (Pinto, Fábio & Noronha, 1970 Petter, 1974 and D.(C. travassosi (Guimarães & Cristofaro, 1974, occuring in South America are made. Dollfusentis chandleri Golvan, 1969 (Acanthocephala, Illiosentidae, Poecilancistrium caryophyllum (Diesing, 1850(Cestoidea, Otobothriidae and Callitetrarhynchus gracilis (Rudolphi, 1819(Cestoidea, Dasyrhynchidae as well as larval forms of Echinocephalus sp. (Nematoda, Gnathostomatidae and Contracaecum sp. (Nematoda, Anisakidae are also reported.Dichelyne (Cucullanellus elongatus (Tornquist, 1931 Petter, 1974, da Venezuela, da qual D.(C. amaurincai (Freitas, Vicente & Ibáñez, 1969 Petter, 1974 é proposta como sinônimo junior, é descrita, e são feitos comentários sobre a atual situação das outras espécies do mesmo grupo, ocorrendo na América do Sul, a saber: D.(C. dichelyneformes (Szidat, 1950 Petter, 1974, D.(C. rodriguesi (Pinto, Fábio & Noronha, 1971 Petter, 1974 e D.(C. travassosi (Guimarães & Cristofaro, 1974. Dollfusentis chandleri Golvan, 1969 (Acantochephala, Illiosentidae, Poecilancistrium cariophyllum (Diesing, 1850 (Cestoidea, Otobothriidae e Callitetrarhynchus gracilis (Rudolphi, 1819 (Cestoidea, Dayrhynchidae bem como formas larvares de Exhinocephalus sp. (Nematoda, Gnathostomatidae e Contracaecum sp. (Nematoda, Anisakidae são também assinaladas.

  9. Efficient delivery of large DNA from Escherichia coli to Synechococcus elongatus PCC7942 by broad-host-range conjugal plasmid pUB307.

    Science.gov (United States)

    Itaya, Mitsuhiro; Kusakabe, Hiroko; Sato, Mitsuru; Tomita, Masaru; Sato, Rintaro

    2018-02-06

    Synechococcus elongatus PCC7942, a cyanobacterium that uses light and carbon dioxide to grow, has a high ability to incorporate DNA by transformation. To assess the effective delivery of large DNA in plasmid form, we cloned the endogenous plasmid pANL (46.4 kbp) into a BAC vector of Escherichia coli. The plasmid p38ANL (54.3 kbp) replaced the native plasmid. To assess the delivery of larger DNA into PCC7942, p38ANL was fused to the broad-host-range conjugal transfer plasmid pUB307IP (53.5 kbp). The resulting plasmid pUB307IP501 (107.9 kbp) was transmitted from E. coli to PCC7942 by simple mixing of donor and recipient cultures. PCC7942 transcipients possessed only pUB307IP501, replacing the preexisting pANL. In contrast, the pUB307IP501 plasmid was unable to transform PCC7942, indicating that natural transformation of DNA may be restricted by size limitations. The ability to deliver large DNA by conjugation may lead to genetic engineering in PCC7942. © The Authors 2018. Published by Oxford University Press on behalf of the Japanese Biochemical Society. All rights reserved.

  10. Isolation, one-step affinity purification, and characterization of a polyextremotolerant laccase from the halophilic bacterium Aquisalibacillus elongatus and its application in the delignification of sugar beet pulp.

    Science.gov (United States)

    Rezaei, Shahla; Shahverdi, Ahmad Reza; Faramarzi, Mohammad Ali

    2017-04-01

    The aim of the present work was to study the ability of a halophilic bacterial laccase to efficient delignification in extreme conditions. Here, a highly stable extracellular laccase showing ligninolytic activity from halophilic Aquisalibacillus elongatus is described. The laccase production was strongly influenced by NaCl and CuSO 4 and under optimal conditions reached 4.8UmL -1 . The monomeric enzyme of 75kDa was purified by a synthetic affinity column with 68.2% yield and 99.8-fold purification. The enzyme showed some valuable features viz. stability against a wide range of organic solvents, salts, metals, inhibitors, and surfactants and specificity to a wide spectrum of substrates diverse in structure and redox potential. It retained more than 50% of the original activity at 25-75°C and pH 5.0-10.0. Furthermore, the enzyme was found to be effective in the delignification of sugar beet pulp in an ionic liquid that makes it useful for industrial applications. Copyright © 2017 Elsevier Ltd. All rights reserved.

  11. Differences in quantification of DNA double-strand breaks assessed by 53BP1/γH2AX focus formation assays and the comet assay in mammalian cells treated with irradiation and N-acetyl-L-cysteine

    International Nuclear Information System (INIS)

    Kurashige, Tomomi; Shimamura, Mika; Nagayama, Yuji

    2016-01-01

    The biological effect of ionizing radiation (IR) on genomic DNA is thought to be either direct or indirect; the latter is mediated by IR induction of free radicals and reactive oxygen species (ROS). This study was designed to evaluate the effect of N-acetyl-L-cysteine (NAC), a well-known ROS-scavenging antioxidant, on IR induction of genotoxicity, cytotoxicity and ROS production in mammalian cells, and aimed to clarify the conflicting data in previous publications. Although we clearly demonstrate the beneficial effect of NAC on IR-induced genotoxicity and cytotoxicity (determined using the micronucleus assay and cell viability/clonogenic assays), the data on NAC's effect on DNA double-strand break (DSB) formation were inconsistent in different assays. Specifically, mitigation of IR-induced DSBs by NAC was readily detected by the neutral comet assay, but not by the γH2AX or 53BP1 focus assays. NAC is a glutathione precursor and exerts its effect after conversion to glutathione, and presumably it has its own biological activity. Assuming that the focus assay reflects the biological responses to DSBs (detection and repair), while the comet assay reflects the physical status of genomic DNA, our results indicate that the comet assay could readily detect the antioxidant effect of NAC on DSB formation. However, NAC's biological effect might affect the detection of DSB repair by the focus assays. Our data illustrate that multiple parameters should be carefully used to analyze DNA damage when studying potential candidates for radioprotective compounds

  12. Isobutanol production as an alternative metabolic sink to rescue the growth deficiency of the glycogen mutant of Synechococcus elongatus PCC 7942

    Energy Technology Data Exchange (ETDEWEB)

    Li, XQ; Shen, CR; Liao, JC

    2014-03-04

    Glycogen synthesis initiated by glucose-1-phosphate adenylyltransferase (glgC) represents a major carbon storage route in cyanobacteria which could divert a significant portion of assimilated carbon. Significant growth retardation in cyanobacteria with glgC knocked out (Delta glgC) has been reported in high light conditions. Here, we knocked out the glgC gene and analyzed its effects on carbon distribution in an isobutanol-producing strain of Synechococcus elongatus PCC7942 and its parental wild-type strain. We showed that isobutanol production was able to partially rescue the growth of Delta glgC mutant where the growth rescue effect positively correlated with the rate of isobutanol production. Using (NaHCO3)-C-14 incorporation analysis, we observed a 28 % loss of total carbon fixation rate in the Delta glgC mutant compared to the wild-type. Upon expression of the isobutanol production pathway in Delta glgC mutant, the total carbon fixation rate was restored to the wild-type level. Furthermore, we showed that 52 % of the total carbon fixed was redirected into isobutanol biosynthesis in the Delta glgC mutant expressing enzymes for isobutanol production, which is 2.5 times higher than that of the wild-type expressing the same enzymes. These results suggest that biosynthesis of non-native product such as isobutanol can serve as a metabolic sink for replacing glycogen to rescue growth and restore carbon fixation rate. The rescue effect may further serve as a platform for cyanobacteria energy and carbon metabolism study.

  13. Development of a high-frequency in vivo transposon mutagenesis system for Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Watabe, Kazuyuki; Mimuro, Mamoru; Tsuchiya, Tohru

    2014-11-01

    Synechocystis sp. PCC 6803 (Synechocystis) is the first sequenced photosynthetic organism and has two advantages: natural transformation and light-activated heterotrophic growth. Such characteristics have mainly promoted reverse genetic analysis in this organism, however, to date approximately 50% of genes are still annotated as 'unknown protein' or 'hypothetical protein'. Therefore, forward genetic analysis is required for the identification of significant genes responsible for photosynthesis and other physiological phenomena among the genes of unknown function. The in vivo transposon mutagenesis system is one of the major methods for random mutagenesis. However, present in vivo transposon mutagenesis systems for cyanobacteria face problems such as relatively low frequency of transposition and repeated transposition in the host cells. In this study, we constructed vectors based on a mini-Tn5-derived vector that was designed to prevent repeated transposition. Our vectors carry a hyperactive transposase and optimized recognition sequence of transposase, which were reported to enhance frequency of transposition. Using the vector, we succeeded in highly frequent transposition (9×10(-3) per recipient cell) in Synechocystis. Transposon insertion sites of 10 randomly selected mutants indicated that the insertion sites spread throughout the genome with low sequence dependency. Furthermore, one of the 10 mutants exhibited the slow-growing phenotype, and the mutant was functionally complemented by using our expression vector. Our system also worked with another model cyanobacterium, Synechococcus elongatus PCC 7942, with high frequency. These results indicate that the developed system can be applied to the forward genetic analysis of a broad range of cyanobacteria. © The Author 2014. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  14. Genetic variability of wild populations of Leporinus elongatus in the São Domingos River - MS Brazil: a preliminary view on the construction of the hydroelectric plant

    Directory of Open Access Journals (Sweden)

    Ricardo Pereira Ribeiro

    2016-09-01

    Full Text Available Most of the electricity used in Brazil comes from hydroelectric plants, mainly due to the great availability of its water resources. However, the construction of these plants denotes serious problems related to migration of native fish and the genetic conservation of stocks. Current study evaluates two wild population of Leporinus elongatus (piapara located downstream (Population A - PopA and upstream (Population B - PopB of the Cachoeira Branca before the construction of the São Domingos hydroelectric plant (HPP in the Mato Grosso do Sul State, Brazil. Thirty samples from caudal fins were collected and analyzed for each population. Eighty-nine fragments, including 72 polymorphic ones (80.9%, were analyzed. Low fragments (less than 0.100 in both populations (PopA = 2 and PopB = 3 were identified. Nine fixed fragments (frequency 1.000 (PopA = 3 and PopB = 6, and four exclusive fragments (PopA = 3 and PopB = 1 were also reported. The genetic variability within populations, calculated by Shannon Index and by percentage of polymorphic fragments, indicated high rates of intrapopulation variability (PopA = 0.309 and 61.80% and PopB = 0.392 and 71.90%, respectively. Genetic distance and identity rates (0.089 and 0.915, respectively were different between populations, whilst AMOVA showed that most variations lie within the populations and not between them. Fst and Nm rates showed moderate genetic differentiation with low numbers of migrants. Results reveal populations with high intra-population genetic variability and genetic differentiation, with low gene flow. The passage ladders of São Domingos HPP should control fish transposition to preserve genetic variability.

  15. Combined SAXS/EM based models of the S. elongatus post-translational circadian oscillator and its interactions with the output His-kinase SasA.

    Directory of Open Access Journals (Sweden)

    Rekha Pattanayek

    Full Text Available The circadian clock in the cyanobacterium Synechococcus elongatus is composed of a post-translational oscillator (PTO that can be reconstituted in vitro from three different proteins in the presence of ATP and a transcription-translation feedback loop (TTFL. The homo-hexameric KaiC kinase, phosphatase and ATPase alternates between hypo- and hyper-phosphorylated states over the 24-h cycle, with KaiA enhancing phosphorylation, and KaiB antagonizing KaiA and promoting KaiC subunit exchange. SasA is a His kinase that relays output signals from the PTO formed by the three Kai proteins to the TTFL. Although the crystal structures for all three Kai proteins are known, atomic resolution structures of Kai and Kai/SasA protein complexes have remained elusive. Here, we present models of the KaiAC and KaiBC complexes derived from solution small angle X-ray scattering (SAXS, which are consistent with previous EM based models. We also present a combined SAXS/EM model of the KaiC/SasA complex, which has two N-terminal SasA sensory domains occupying positions on the C-terminal KaiC ring reminiscent of the orientations adopted by KaiB dimers. Using EM we demonstrate that KaiB and SasA compete for similar binding sites on KaiC. We also propose an EM based model of the ternary KaiABC complex that is consistent with the sequestering of KaiA by KaiB on KaiC during the PTO dephosphorylation phase. This work provides the first 3D-catalogue of protein-protein interactions in the KaiABC PTO and the output pathway mediated by SasA.

  16. Sulfite-stress induced functional and structural changes in the complexes of photosystems I and II in a cyanobacterium, Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Kobayashi, Satomi; Tsuzuki, Mikio; Sato, Norihiro

    2015-08-01

    Excess sulfite is well known to have toxic effects on photosynthetic activities and growth in plants, however, so far, the behavior of the photosynthetic apparatus during sulfite-stress has not been characterized as to the responsible proteins or genes. Here, the effects of sulfite on photosystem complexes were investigated in a cyanobacterium, Synechococcus elongatus PCC 7942, a possible model organism of chloroplasts. Culturing of the cells for 24 h in the presence of 10 mM sulfite retarded cell growth of the wild type, concomitantly with synthesis of Chl and phycobilisome repressed. The excess sulfite simultaneously repressed photosynthesis by more than 90%, owing largely to structural destabilization and resultant inactivation of the PSII complex, which seemed to consequently retard the cell growth. Notably, the PsbO protein, one of the subunits that construct the water-splitting system of PSII, was retained at a considerable level, and disruption of the psbO gene led to higher sensitivity of photosynthesis and growth to sulfite. Meanwhile, the PSI complex showed monomerization of its trimeric configuration with little effect on the activity. The structural alterations of these PS complexes depended on light. Our data provide evidence for quantitative decreases in the photosystem complex(es) including their antenna(e), structural alterations of the PSI and PSII complexes that would modulate their functions, and a crucial role of psbO in PSII protection, in Synechococcus cells during sulfite-stress. We suggest that the reconstruction of the photosystem complexes is beneficial to cell survival. © The Author 2015. Published by Oxford University Press on behalf of Japanese Society of Plant Physiologists. All rights reserved. For permissions, please email: journals.permissions@oup.com.

  17. Macromolecular crowding effects on reactions of TePixD (Tll0078).

    Science.gov (United States)

    Toyooka, Tsuguyoshi; Tanaka, Keisuke; Okajima, Koji; Ikeuchi, Masahiko; Tokutomi, Satoru; Terazima, Masahide

    2011-01-01

    To reveal macromolecular crowding effects on a chemical reaction of a BLUF (sensors of blue light using FAD) protein (PixD from a thermophilic cyanobacterium Thermosynechococcus elongatus BP-1 [TePixD, Tll0078]), the photoreaction was studied at various concentrations of the macromolecule Ficoll-70 by UV/Vis absorption spectroscopy and the pulsed laser-induced transient grating (TG) method. The absorption spectrum did not change with varying concentration of Ficoll-70. The crowding did not affect the quantum yield of the spectral red shift reaction, recovery rate of the product, rate constant of the volume change reaction and the magnitude of the volume change. However, the magnitude of the TG signal representing the diffusion-sensitive conformation change significantly increased on addition of Ficoll-70. This dependence was attributed to the crowding effect on the TePixD decamer-pentamer equilibrium in the solution. This result indicates that the TePixD reaction is more efficient in cellular than in in vitro conditions. © 2010 The Authors. Photochemistry and Photobiology © 2010 The American Society of Photobiology.

  18. Homology modeling of Homo sapiens lipoic acid synthase: Substrate docking and insights on its binding mode.

    Science.gov (United States)

    Krishnamoorthy, Ezhilarasi; Hassan, Sameer; Hanna, Luke Elizabeth; Padmalayam, Indira; Rajaram, Rama; Viswanathan, Vijay

    2017-05-07

    Lipoic acid synthase (LIAS) is an iron-sulfur cluster mitochondrial enzyme which catalyzes the final step in the de novo pathway for the biosynthesis of lipoic acid, a potent antioxidant. Recently there has been significant interest in its role in metabolic diseases and its deficiency in LIAS expression has been linked to conditions such as diabetes, atherosclerosis and neonatal-onset epilepsy, suggesting a strong inverse correlation between LIAS reduction and disease status. In this study we use a bioinformatics approach to predict its structure, which would be helpful to understanding its role. A homology model for LIAS protein was generated using X-ray crystallographic structure of Thermosynechococcus elongatus BP-1 (PDB ID: 4U0P). The predicted structure has 93% of the residues in the most favour region of Ramachandran plot. The active site of LIAS protein was mapped and docked with S-Adenosyl Methionine (SAM) using GOLD software. The LIAS-SAM complex was further refined using molecular dynamics simulation within the subsite 1 and subsite 3 of the active site. To the best of our knowledge, this is the first study to report a reliable homology model of LIAS protein. This study will facilitate a better understanding mode of action of the enzyme-substrate complex for future studies in designing drugs that can target LIAS protein. Copyright © 2017 Elsevier Ltd. All rights reserved.

  19. Diversidade genética de três estoques de piapara (Leporinus elongatus, utilizando RAPD - DOI: 10.4025/actascianimsci.v30i2.4710 Genetic diversity of three stocks of piapara (Leporinus elongatus, using RAPD - DOI: 10.4025/actascianimsci.v30i2.4710

    Directory of Open Access Journals (Sweden)

    Lauro Vargas

    2008-08-01

    Full Text Available Recentemente a produção aquícola brasileira tem apresentado grande progresso. Dentre as espécies nativas cultivadas no Brasil, a piapara (Leporinus elongatus tem sido amplamente preconizada. Com objetivo de avaliar os programas de repovoamento, foram analisadas a variabilidade e a divergência genética de três estoques de piapara com a técnica de RAPD (Random Amplified Polymorphic. O primeiro estoque pertence à Estação de Aquicultura e Hidrologia da Duke Energy International (A; o segundo, à piscicultura de Rolândia (B e o terceiro, ao Programa de Repovoamento dos Rios do Paraná (C. Os dez primers para RAPD utilizados produziram 105 fragmentos polimórficos, conferindo um polimorfismo de 98,1% para os três estoques avaliados. A porcentagem de locos polimórficos e índice de Shannon foi superior para o estoque A. Porém, todos valores foram elevados, indicando alta diversidade intrapopulacional. Os valores de indicam que houve baixa diferenciação genética entre os estoques A x B e moderada diferenciação entre os demais. O Nm foi maior entre os estoques A x B. A distância genética e o dendrograma indicam que os estoques A x B são menos distantes geneticamente.Latelly, aquiculture production in Brazil has made great strides. Among the native species cultivated in Brazil, piapara (Leporinus elogatus has been widely praised. With the objective of evaluating restocking programs, the variability and genetic divergence of three piapara stocks were analyzed using the RAPD (Random Amplified Polymorphic DNA technique. The first stock belongs to the Aquiculture and Hydrology Station of Duke Energy International (A; the second one belongs to a fish farm in the city of Rolândia (B; and the third to the River Restocking Program of Paraná (C. The ten primers used for RAPD produced 105 polymorphic loci, conferring a polymorphism of 98.1% for the three evaluated stocks. Polymorphic loci percentage and Shannon index were higher for stock A

  20. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available occus ... elongatus BP-1] pdb|1S5L|UU Chain u, Architecture Of The ... Photosynthetic Oxygen E...volving Center pdb|1S5L|U Chain ... U, Architecture Of The Photosynthetic Oxygen Evolving ...

  1. ORF Alignment: NC_004369 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available occus ... elongatus BP-1] pdb|1S5L|UU Chain u, Architecture Of The ... Photosynthetic Oxygen E...volving Center pdb|1S5L|U Chain ... U, Architecture Of The Photosynthetic Oxygen Evolving ...

  2. Concentric-flow electrokinetic injector enables serial crystallography of ribosome and photosystem II.

    Science.gov (United States)

    Sierra, Raymond G; Gati, Cornelius; Laksmono, Hartawan; Dao, E Han; Gul, Sheraz; Fuller, Franklin; Kern, Jan; Chatterjee, Ruchira; Ibrahim, Mohamed; Brewster, Aaron S; Young, Iris D; Michels-Clark, Tara; Aquila, Andrew; Liang, Mengning; Hunter, Mark S; Koglin, Jason E; Boutet, Sébastien; Junco, Elia A; Hayes, Brandon; Bogan, Michael J; Hampton, Christina Y; Puglisi, Elisabetta V; Sauter, Nicholas K; Stan, Claudiu A; Zouni, Athina; Yano, Junko; Yachandra, Vittal K; Soltis, S Michael; Puglisi, Joseph D; DeMirci, Hasan

    2016-01-01

    We describe a concentric-flow electrokinetic injector for efficiently delivering microcrystals for serial femtosecond X-ray crystallography analysis that enables studies of challenging biological systems in their unadulterated mother liquor. We used the injector to analyze microcrystals of Geobacillus stearothermophilus thermolysin (2.2-Å structure), Thermosynechococcus elongatus photosystem II (<3-Å diffraction) and Thermus thermophilus small ribosomal subunit bound to the antibiotic paromomycin at ambient temperature (3.4-Å structure).

  3. Concentric-flow electrokinetic injector enables serial crystallography of ribosome and photosystem II

    Energy Technology Data Exchange (ETDEWEB)

    Sierra, Raymond G.; Gati, Cornelius; Laksmono, Hartawan; Dao, E. Han; Gul, Sheraz; Fuller, Franklin; Kern, Jan; Chatterjee, Ruchira; Ibrahim, Mohamed; Brewster, Aaron S.; Young, Iris D.; Michels-Clark, Tara; Aquila, Andrew; Liang, Mengning; Hunter, Mark S.; Koglin, Jason E.; Boutet, Sébastien; Junco, Elia A.; Hayes, Brandon; Bogan, Michael J.; Hampton, Christina Y.; Puglisi, Elisabetta V.; Sauter, Nicholas K.; Stan, Claudiu A.; Zouni, Athina; Yano, Junko; Yachandra, Vittal K.; Soltis, S. Michael; Puglisi, Joseph D.; DeMirci, Hasan

    2015-11-30

    We describe a concentric-flow electrokinetic injector for efficiently delivering microcrystals for serial femtosecond X-ray crystallography analysis that enables studies of challenging biological systems in their unadulterated mother liquor. We used the injector to analyze microcrystals of Geobacillus stearothermophilus thermolysin (2.2-Å structure), Thermosynechococcus elongatus photosystem II (<3-Å diffraction) and Thermus thermophilus small ribosomal subunit bound to the antibiotic paromomycin at ambient temperature (3.4-Å structure).

  4. For Group II Introns, More Heat Means More Mobility

    OpenAIRE

    Mohr, Georg; Ghanem, Eman; Lambowitz, Alan M.

    2010-01-01

    Mobile group II introns, which are found in bacterial and organellar genomes, are site-specific retroelements hypothesized to be evolutionary ancestors of spliceosomal introns and retrotransposons in higher organisms. Most bacteria, however, contain no more than one or a few group II introns, making it unclear how introns could have proliferated to higher copy numbers in eukaryotic genomes. An exception is the thermophilic cyanobacterium Thermosynechococcus elongatus, which contains 28 closel...

  5. O desenvolvimento embrionário da Piapara, Leporinus elongatus (Pisces, Anostomidae, utilizando técnicas de histologia, microscopia eletrônica de varredura e imunológicas empregando marcadores ósseos

    Directory of Open Access Journals (Sweden)

    Erika Z. Sousa

    2014-12-01

    Full Text Available Resumo O desenvolvimento embrionário dos peixes é de grande importância para a piscicultura e na reintrodução de espécies ameaçadas de extinção em seus ambientes, e seu conhecimento constitui uma importante maneira para minimizar doenças e mortalidades dessas espécies. Com o auxílio de técnicas como a Microscopia Eletrônica de Varredura (MEV e a imuno-histoquimica para identificar proteínas ósseas, foi possível avaliar as fases de desenvolvimento com mais riqueza de detalhes, facilitando a compreensão de hábitos e da biologia da espécie. Neste trabalho pudemos observar a ontogenia e osteogênese da Piapara (Leporinus elongatus, desde a fecundação até a fase juvenil, sendo evidenciadas estruturas importantes como o tamanho do vitelo, essencial para a nutrição do embrião; o fechamento do blastóporo, evento principal da embriogênese, que indica as taxas de fertilização; a metamorfose, que indica a formação dos primeiros e principais órgãos do animal e a formação de sua estrutura óssea. As Proteínas Ósseas Morfogenéticas (BMP-2 e BMP-4, moléculas essenciais reguladoras no desenvolvimento embrionário e na formação óssea, foram observadas apenas no estádio larval até o período juvenil, não sendo evidenciadas nos estágios anteriores. Os resultados desse trabalho trouxeram novas informações quanto à biologia do desenvolvimento dessa espécie, que certamente poderão auxiliar no aprimoramento de técnicas reprodutivas visando uma melhora na sua produção seja para fins comerciais ou de repovoamento.

  6. 200-BP-1 Prototype Hanford Barrier Annual Monitoring Report for Fiscal Years 2005 Through 2007

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Andy L.; Link, Steven O.; Strickland, Christopher E.; Draper, Kathryn E.; Clayton, Ray E.

    2008-02-01

    A prototype Hanford barrier was deployed over the 216-B-57 Crib at the Hanford Site in 1994 to prevent percolation through the underlying waste and to minimize spreading of buried contaminants. This barrier is being monitored to evaluate physical and hydrologic performance at the field scale. This report summarizes data collected during the period FY 2005 through FY 2007. In FY 2007, monitoring of the prototype Hanford barrier focused on barrier stability, vegetative cover, evidence of plant and animal intrusion, and the main components of the water balance, including precipitation, runoff, storage, drainage, and deep percolation. Owing to a hiatus in funding in FY 2005 through 2006, data collected were limited to automated measurements of the water-balance components. For the reporting period (October 2004 through September 2007) precipitation amount and distribution were close to normal. The cumulative amount of water received from October 1994 through September 2007 was 3043.45 mm on the northern half of the barrier, which is the formerly irrigated treatment, and 2370.58 mm on the southern, non-irrigated treatments. Water storage continued to show a cyclic pattern, increasing in the winter and declining in the spring and summer to a lower limit of around 100 mm in response to evapotranspiration. The 600-mm design storage has never been exceeded. For the reporting period, the total drainage from the soil-covered plots ranged from near zero amounts under the soil-covered plots to almost 20 mm under the side slopes. Over the 13-yr monitoring period, side slope drainage accounted for about 20 percent of total precipitation while the soil-covered plots account for only 0.12 mm total. Above-asphalt and below-asphalt moisture measurements show no evidence of deep percolation of water. Topographic surveys show the barrier and protective side slopes to be stable. Plant surveys show a relatively high coverage of native plants still persists after the initial revegetation in 1994 although species diversity on the soil cover continues to decrease, from 35 in 1997 to 12 in 2007. The formerly irrigated treatments continue to show greater cover of grasses and litter than the non-irrigated treatments. On the formerly irrigated treatments, the mean cover class was 25 to 50 percent for both grasses and shrubs. On the non-irrigated treatments, the mean cover class was 5 to 25 percent from grasses and 25 to 50 percent for shrubs. The western and northern side slopes of the barrier show less plant cover than the soil surface, but show higher species diversity. This may be due to the influence of windblown soil and seeds from adjacent land, or the lack of shrubs competing for resources. Insects and small mammals continue to use the barrier surface and several holes and mounds were observed during the last year. This suggests that the restored barrier surface is beginning to function like a recovering ecosystem. Small-mammal burrowing on the top and sides of the barrier is most prevalent on the finer-grained and disturbed soils while active ant mounds were observed on the northern and western slopes.

  7. 200-BP-1 Prototype Hanford Barrier Annual Monitoring Report for Fiscal Year 2004

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Andy L.; Linville, Jenifer K.; Keller, Jason M.; Seedahmed, Gamal H.

    2005-01-03

    In FY 2004, monitoring of the prototype Hanford barrier focused on barrier stability, vegetative cover, evidence of plant and animal intrusion, and the main components of the water balance. Monitored water-balance components included precipitation, runoff, storage, drainage, and deep percolation. Precipitation in FY 2004 was 26 percent less than in FY 2003 but was still higher than normal. The seasonal distribution in precipitation was also different from the previous year with a 43 percent reduction in spring precipitation and a 46 percent increase in summer precipitation. The cumulative amount of water received from October 1994, through September 2004, was 2,559.58 mm on the northern half of the barrier, which is the formerly irrigated treatment, and 1,886.71 mm on the southern non-irrigated treatments. Water storage continued to show a cyclic pattern, increasing in the winter and declining in the spring and summer to a lower limit of about 100 mm in response to evapotranspiration. The 600-mm design storage has never been exceeded. Total drainage from the soil-covered plots range from 2.9E-4 mm to 0.22 mm or 0.003 6 0.004 percent of precipitation. Side-slope drainage was much higher at 20.9 6 2.3 percent of precipitation from the gravel and 18.6 6 5.1 percent from the riprap. There was no runoff from the barrier, but runoff from the BY tank farm following a thunderstorm in May eroded a 45-inch-deep channel into the structural fill at the toe of the riprap slope. Above-asphalt and below-asphalt moisture measurements show no evidence of deep percolation of water. Topographic surveys were conducted on the barrier surface, including the two settlement gauges and 12 creep gauges on the riprap slope using aerial photogrammetry (AP) and a global positioning system (GPS). Comparing the aerial photogrammetry (AP) and global positioning system (GPS) surveys with the traditional survey shows the barrier and side slopes to be stable. Both AP and GPS show potential for considerable cost savings without any loss in accuracy. A relatively high coverage of native plants still persists after the initial revegetation in 1994. The formerly irrigated treatments continue to show greater cover of grasses and litter than the non-irrigated treatments. On the formerly irrigated treatments, the mean cover class was 25 to 50 percent for both grasses and shrubs. On the non-irrigated treatments, the mean cover class was 5 to 25 percent from grasses and 25 to 50 percent for shrubs. Species diversity of the vegetative community appears to have stabilized over the past several years. In addition to 12 of 17 species present in 2003 being present in 2004, two additional species were encountered. Sagebrush continues to flourish with shrubs along the perimeter showing higher biomass yield than the interior shrubs. There is evidence of sagebrush seedlings recruitment but not of rabbitbrush; the presence of gray rabbitbrush appears is declining as the barrier surface continues to stabilize. Use of the barrier surface by insects and small mammals is also evident. Small mammal burrowing on the barrier surface has become more prevalent in recent years, suggesting that the restored barrier surface is beginning to function as a recovering ecosystem. Small-mammal burrowing on the top and sides of the barrier is most prevalent on the finer-grained and disturbed soils while active ant mounds were observed on the northern and western slopes.

  8. 200-BP-1 Prototype Hanford Barrier - 15 Years of Performance Monitoring

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Anderson L.; Link, Steven O.; Draper, Kathryn E.; Clayton, Ray E.

    2009-09-01

    Engineered surface barriers are recognized as a remedial alternative to the removal, treatment and disposal of near-surface contaminants at a variety of waste sites within the DOE complex. One issue impacting their acceptance by stakeholders the use of limited data to predict long-term performance. In 1994, a 2-ha multi-component barrier was constructed over an existing waste disposal site at Hanford using natural materials. Monitoring has been almost continuous for the last 15 yrs and has focused on barrier stability, vegetative cover, plant and animal intrusion, and the components of the water balance, including precipitation, runoff, storage, drainage, and percolation. The total precipitation received from October 1994 through August 2008 was 3311 mm on the northern half (formerly irrigated), and 2638 mm on the southern, non-irrigated half. Water storage in the fine-soil layer shows a cyclic pattern, increasing in the winter and decreasing in the spring and summer to a lower limit of around 100 mm, regardless of precipitation, in response to evapotranspiration. Topographic surveys show the barrier and side slopes to be stable and the pea-gravel admix has proven effective in minimizing erosion through the creation of a desert pavement during deflationary periods. Three runoff events have been observed but the 600-mm design storage capacity has never been exceeded. Total percolation ranged from near zero amounts under the soil-covered plots to over 600 mm under the side slopes. The asphaltic concrete prevented any of this water from reaching the buried waste thereby eliminating the driving force for the contaminant remobilization. Plant surveys show a relatively high coverage of native plants still persists after the initial revegetation although the number of species decreased from 35 in 1994 to 10 in 2009. Ample evidence of insect and small mammal use suggests that the barrier is behaving like a recovering ecosystem. In September 2008, the north half of the barrier was burned to remove vegetation and study the effects of fire on barrier performance. The most immediate effects has been on water storage patterns with the bare surface showing a slower accumulation of water, a smaller peak storage and a delayed release relative to the unburned side due to evaporation . Nonetheless the residual storage at the end of the year was similar for the burned and unburned sides.

  9. Isolation and characterization of transducing bacteriophage BP1 for Bacterium anitratum (Achromobacter sp.).

    Science.gov (United States)

    Twarog, R; Blouse, L E

    1968-07-01

    A small transducing phage has been isolated against a strain of Bacterium anitratum. The particle has a head dimension of 450 A and a tail approximately 200 A long. The latent period is 16 min and the average burst size is 98. The intact particle has an absorption maximum and minimum at 260 and 237 mmu, respectively. The sedimentation coefficient (S(20)) is 460. The phage contains double-stranded DNA with an S degrees (20,w) of 32.8. Molecular weight estimates of the deoxyribonucleic acid ranged from 2.33 x 10(7) to 2.66 x 10(7) based on sedimentation velocity studies. The percentage guanine plus cytosine compositions of the deoxyribonucleic acid, determined by melting temperature and cesium chloride equilibrium centrifugation, were 40.7 and 42.0, respectively.

  10. Loss of 53BP1 causes PARP inhibitor resistance in Brca1-mutated mouse mammary tumors

    NARCIS (Netherlands)

    Jaspers, Janneke E.; Kersbergen, Ariena; Boon, Ute; Sol, Wendy; van Deemter, Liesbeth; Zander, Serge A.; Drost, Rinske; Wientjens, Ellen; Ji, Jiuping; Aly, Amal; Doroshow, James H.; Cranston, Aaron; Martin, Niall M. B.; Lau, Alan; O'Connor, Mark J.; Ganesan, Shridar; Borst, Piet; Jonkers, Jos; Rottenberg, Sven

    2013-01-01

    Inhibition of PARP is a promising therapeutic strategy for homologous recombination-deficient tumors, such as BRCA1-associated cancers. We previously reported that BRCA1-deficient mouse mammary tumors may acquire resistance to the clinical PARP inhibitor (PARPi) olaparib through activation of the

  11. Differential regulation of macropinocytosis by Abi1/Hssh3bp1 isoforms.

    Directory of Open Access Journals (Sweden)

    Patrycja M Dubielecka

    2010-05-01

    Full Text Available Macropinocytosis, which is a constitutive cellular process of fluid and macromolecule uptake, is regulated by actin cytoskeleton rearrangements near the plasma membrane. Activation of Rac1, which is proposed to act upstream of the actin polymerization regulatory Wave 2 complex, has been found to correlate with enhanced macropinocytosis. One of the components of the Wave 2 complex is Abi1. Multiple, alternatively spliced isoforms of Abi1 are expressed in mammalian cells, but the functional significance of the various isoforms is unknown.Here, using flow cytometric assay analysis for Alexa Fluor 647, we demonstrate that Abi1 isoforms 2 and 3 differentially regulate macropinocytosis. LNCaP cells expressing isoform 3 had increased macropinocytic uptake that correlated with enhanced cell spreading and higher Rac1 activation in comparison to cells expressing isoform 2. Isoform 2 expressing cells had decreased macropinocytic uptake, but demonstrated greater sensitivity to Rac1 activation. Moreover, more isoform 2 was localized within the cytoplasm in comparison to isoform 3, which was more associated with the plasma membrane. Activated Rac1 was found to specifically bind to a site in exon 10 of isoform 2 in vitro. Because of alternative mRNA splicing, exon 10 is absent from isoform 3, precluding similar binding of activated Rac1. Both isoforms, however, bound to inactive Rac1 through the same non-exon 10 site. Thus, Abi1 isoform 3-containing Wave 2 complex exhibited a differential binding to activated vs. inactive Rac1, whereas isoform 2-containing Wave 2 complex bound activated or inactive Rac1 comparably.Based on these observations, we postulate that Abi1 isoforms differentially regulate macropinocytosis as a consequence of their different relative affinities for activated Rac1 in Wave 2 complex. These findings also raise the possibility that isoform-specific roles occur in other Abi1 functions.

  12. The Effects of Fire on the Function of the 200-BP-1 Engineered Surface Barrier

    Energy Technology Data Exchange (ETDEWEB)

    Ward, Anderson L.; Link, Steven O.; Hasan, Nazmul; Draper, Kathryn E.

    2009-09-01

    A critical unknown in use of barrier technology for long-term waste isolation is performance after a major disturbance especially when institutional controls are intact, but there are no resources to implement corrective actions. The objective of this study was to quantify the effects of wild fire on alterations the function of an engineered barrier. A controlled burn September 26, 2008 was used to remove all the vegetation from the north side of the barrier. Flame heights exceeded 9 m and temperatures ranged from 250 oC at 1.5 cm below the surface to over 700 oC at 1 m above the surface. Post-fire analysis of soil properties show significant decreases in wettability, hydraulic conductivity, air entry pressure, organic matter, and porosity relative to pre-fire conditions whereas dry bulk density increased. Decreases in hydraulic conductivity and wettabilty immediately after the fire are implicated in a surface runoff event that occurred in January 2009, the first in 13 years. There was a significant increase in macro-nutrients, pH, and electrical conductivity. After one year, hydrophobicity has returned to pre-burn levels with only 16% of samples still showing signs of decreased wettability. Over the same period, hydraulic conductivity and air entry pressure returned to pre-burn levels at one third of the locations but remained identical to values recorded immediately after the fire at the other two thirds. Soil nutrients, pH, and electrical conductivity remain elevated after 1 year. Species composition on the burned surface changed markedly from prior years and relative to the unburned surface and two analog sites. An increase in the proportion of annuals and biennials is characteristic of burned surfaces that have become dominated by ruderal species. Greenhouse seedling emergence tests conducted to assess the seed bank of pre- and post-burn soils and of two analog sites at the McGee Ranch show no difference in the number of species emerging from soils collected before and after the fire. However, there were fewer species emerging from the seed bank on the side slopes and more species emerging from two analog sites. Leaf area index measures confirmed the substantial differences in plant communities after fire. Xylem pressure potential were considerably higher on the burned half of the barrier in September 2009 suggesting that not all the water in the soil profile will be removed before the fall rains begin. The results of this study are expected to contribute to a better understanding of barrier performance after major disturbances in a post-institutional control environment. Such an understanding is needed to enhance stakeholder acceptance regarding the long-term efficacy of engineered barriers. This study will also support improvements in the design of evapotranspiration (ET) and hybrid (ET + capacitive) barriers and the performance monitoring systems.

  13. Analysis of the complete Fischoederius elongatus (Paramphistomidae, Trematoda) mitochondrial genome.

    Science.gov (United States)

    Yang, Xin; Zhao, Yunyang; Wang, Lixia; Feng, Hanli; Tan, Li; Lei, Weiqiang; Zhao, Pengfei; Hu, Min; Fang, Rui

    2015-05-20

    Fischoederius elongates is an important trematode of Paramphistomes in ruminants. Animals infected with F. elongates often don't show obvious symptoms, so it is easy to be ignored. However it can cause severe economic losses to the breeding industry. Knowledge of the mitochondrial genome of F. elongates can be used for phylogenetic and epidemiological studies. The complete mt genome sequence of F. elongates is 14,120 bp in length and contains 12 protein-coding genes, 22 tRNA genes, two rRNA genes and two non-coding regions (LNR and SNR). The gene arrangement of F. elongates is the same as other trematodes, such as Fasciola hepatica and Paramphistomum cervi. Phylogenetic analyses using concatenated amino acid sequences of the 12 protein-coding genes by Maximum-likelihood and Neighbor-joining analysis method showed that F. elongates was closely related to P. cervi. The complete mt genome sequence of F. elongates should provide information for phylogenetic and epidemiological studies for F. elongates and the family Paramphistomidae.

  14. Structural changes of the oxygen-evolving complex in photosystem II during the catalytic cycle.

    Science.gov (United States)

    Glöckner, Carina; Kern, Jan; Broser, Matthias; Zouni, Athina; Yachandra, Vittal; Yano, Junko

    2013-08-02

    The oxygen-evolving complex (OEC) in the membrane-bound protein complex photosystem II (PSII) catalyzes the water oxidation reaction that takes place in oxygenic photosynthetic organisms. We investigated the structural changes of the Mn4CaO5 cluster in the OEC during the S state transitions using x-ray absorption spectroscopy (XAS). Overall structural changes of the Mn4CaO5 cluster, based on the manganese ligand and Mn-Mn distances obtained from this study, were incorporated into the geometry of the Mn4CaO5 cluster in the OEC obtained from a polarized XAS model and the 1.9-Å high resolution crystal structure. Additionally, we compared the S1 state XAS of the dimeric and monomeric form of PSII from Thermosynechococcus elongatus and spinach PSII. Although the basic structures of the OEC are the same for T. elongatus PSII and spinach PSII, minor electronic structural differences that affect the manganese K-edge XAS between T. elongatus PSII and spinach PSII are found and may originate from differences in the second sphere ligand atom geometry.

  15. Photosystem II Water Oxidation: Mechanism, Efficiency and Flux in Diverse Oxygenic Phototrophs

    Energy Technology Data Exchange (ETDEWEB)

    Dismukes, Gerard Charles [Rutgers Univ., Piscataway, NJ (United States); Ananyev, Gennady [Rutgers Univ., Piscataway, NJ (United States); Gates, Colin [Rutgers Univ., Piscataway, NJ (United States)

    2018-01-09

    In one year, we pursued four aims: 1) extend the VZAD model to allow analysis of PSII chlorophyll fluorescence emission as modulated by interaction with the WOC (partial success); 2) compare the solar energy conversion efficiencies of PSII-WOCs from intact cells, isolated thylakoid membranes and PSII core complexes and crystals from cyanobacterium Thermosynechococcus elongatus (collaboration with Lawrence Berkeley National Laboratory; some success after changing collaborator); 3) determine whether PSIIs can store light energy by pumping protons across the thylakoid membrane (PSII-cyclic electron flow) and how it is regulated within the green alga Chlorella ohadii (collaboration with the Hebrew University of Jerusalem; some success); and 4) genetically replace the native PSII-D1 protein subunit from a higher plant with two cyanobacterial D1 isoforms to test whether their functional advantages in growth and photoprotection can be transferred (collaboration with Rutgers University; success).

  16. Mutations in the TP53 gene affected recruitment of 53BP1 protein to DNA lesions, but level of 53BP1 was stable after gamma-irradiation that depleted MDC1 protein in specific TP53 mutants

    Czech Academy of Sciences Publication Activity Database

    Suchánková, Jana; Legartová, Soňa; Růčková, E.; Vojtešek, B.; Kozubek, Stanislav; Bártová, Eva

    2017-01-01

    Roč. 148, č. 3 (2017), s. 239-255 ISSN 0948-6143 R&D Projects: GA ČR GBP302/12/G157; GA MŠk 7F14369 Institutional support: RVO:68081707 Keywords : p53 tumor-suppressor * double- strand breaks * nuclear topography Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 2.553, year: 2016

  17. Hybrid Detectors Improved Time-Lapse Confocal Microscopy of PML and 53BP1 Nuclear Body Colocalization in DNA Lesions

    Czech Academy of Sciences Publication Activity Database

    Foltánková, Veronika; Matula, Pa.; Sorokin, D.; Kozubek, Stanislav; Bártová, Eva

    2013-01-01

    Roč. 19, č. 2 (2013), s. 360-369 ISSN 1431-9276 R&D Projects: GA ČR(CZ) GBP302/12/G157 Institutional research plan: CEZ:AV0Z50040702 Institutional support: RVO:68081707 Keywords : CLASS-SWITCH RECOMBINATION * DAMAGE-RESPONSE * HOMOLOGOUS RECOMBINATION Subject RIV: BO - Biophysics Impact factor: 1.757, year: 2013

  18. Three cyanobacteriochromes work together to form a light color-sensitive input system for c-di-GMP signaling of cell aggregation.

    Science.gov (United States)

    Enomoto, Gen; Ni-Ni-Win; Narikawa, Rei; Ikeuchi, Masahiko

    2015-06-30

    Cyanobacteriochromes (CBCRs) are cyanobacterial photoreceptors that have diverse spectral properties and domain compositions. Although large numbers of CBCR genes exist in cyanobacterial genomes, no studies have assessed whether multiple CBCRs work together. We recently showed that the diguanylate cyclase (DGC) activity of the CBCR SesA from Thermosynechococcus elongatus is activated by blue-light irradiation and that, when irradiated, SesA, via its product cyclic dimeric GMP (c-di-GMP), induces aggregation of Thermosynechococcus vulcanus cells at a temperature that is suboptimum for single-cell viability. For this report, we first characterize the photobiochemical properties of two additional CBCRs, SesB and SesC. Blue/teal light-responsive SesB has only c-di-GMP phosphodiesterase (PDE) activity, which is up-regulated by teal light and GTP. Blue/green light-responsive SesC has DGC and PDE activities. Its DGC activity is enhanced by blue light, whereas its PDE activity is enhanced by green light. A ΔsesB mutant cannot suppress cell aggregation under teal-green light. A ΔsesC mutant shows a less sensitive cell-aggregation response to ambient light. ΔsesA/ΔsesB/ΔsesC shows partial cell aggregation, which is accompanied by the loss of color dependency, implying that a nonphotoresponsive DGC(s) producing c-di-GMP can also induce the aggregation. The results suggest that SesB enhances the light color dependency of cell aggregation by degrading c-di-GMP, is particularly effective under teal light, and, therefore, seems to counteract the induction of cell aggregation by SesA. In addition, SesC seems to improve signaling specificity as an auxiliary backup to SesA/SesB activities. The coordinated action of these three CBCRs highlights why so many different CBCRs exist.

  19. Biodiesel production using blue-green cyanobacterium Synechococcus elongatus PCC 7942

    NARCIS (Netherlands)

    Voshol, Gerben

    2015-01-01

    Due to concerns about global climate change and diminishing supplies of petroleum, there is a need to develop a clean sustainable alternative. The two main alternative fuels are bioethanol and biodiesel. Production of these biofuels using cyanobacteria is a new promising development. I describe the

  20. Cd2+ Effect on Photosynthetic Apparatus in Synechococcus elongatus and Spinach (Spinacia oleracea L.)

    Czech Academy of Sciences Publication Activity Database

    Nováková, Marie; Matějová, E.; Sofrová, D.

    2004-01-01

    Roč. 42, č. 3 (2004), s. 425-430 ISSN 0300-3604 R&D Projects: GA ČR GA525/02/0301 Institutional research plan: CEZ:AV0Z5038910 Keywords : cyanobacteria * heavy metals * photochemical activity Subject RIV: ED - Physiology Impact factor: 0.734, year: 2004

  1. A sneak preview of the daily life of S. elongatus by MS-based proteomics

    NARCIS (Netherlands)

    Leite Guerreiro, A.C.

    2016-01-01

    Circadian rhythms are self-sustained and adjustable cycles, typically entrained with light/dark and/or temperature cycles. These rhythms are present in animals, plants, fungi and several bacteria. The central mechanism behind these ‘pacemakers’ and the connection to the circadian regulated pathways

  2. Critical assessment of the emission spectra of various photosystem II core complexes.

    Science.gov (United States)

    Chen, Jinhai; Kell, Adam; Acharya, Khem; Kupitz, Christopher; Fromme, Petra; Jankowiak, Ryszard

    2015-06-01

    We evaluate low-temperature (low-T) emission spectra of photosystem II core complexes (PSII-cc) previously reported in the literature, which are compared with emission spectra of PSII-cc obtained in this work from spinach and for dissolved PSII crystals from Thermosynechococcus (T.) elongatus. This new spectral dataset is used to interpret data published on membrane PSII (PSII-m) fragments from spinach and Chlamydomonas reinhardtii, as well as PSII-cc from T. vulcanus and intentionally damaged PSII-cc from spinach. This study offers new insight into the assignment of emission spectra reported on PSII-cc from different organisms. Previously reported spectra are also compared with data obtained at different saturation levels of the lowest energy state(s) of spinach and T. elongatus PSII-cc via hole burning in order to provide more insight into emission from bleached and/or photodamaged complexes. We show that typical low-T emission spectra of PSII-cc (with closed RCs), in addition to the 695 nm fluorescence band assigned to the intact CP47 complex (Reppert et al. J Phys Chem B 114:11884-11898, 2010), can be contributed to by several emission bands, depending on sample quality. Possible contributions include (i) a band near 690-691 nm that is largely reversible upon temperature annealing, proving that the band originates from CP47 with a bleached low-energy state near 693 nm (Neupane et al. J Am Chem Soc 132:4214-4229, 2010; Reppert et al. J Phys Chem B 114:11884-11898, 2010); (ii) CP43 emission at 683.3 nm (not at 685 nm, i.e., the F685 band, as reported in the literature) (Dang et al. J Phys Chem B 112:9921-9933, 2008; Reppert et al. J Phys Chem B 112:9934-9947, 2008); (iii) trap emission from destabilized CP47 complexes near 691 nm (FT1) and 685 nm (FT2) (Neupane et al. J Am Chem Soc 132:4214-4229, 2010); and (iv) emission from the RC pigments near 686-687 nm. We suggest that recently reported emission of single PSII-cc complexes from T. elongatus may not represent

  3. gamma H2AX/53BP1 foci as a potential pre-treatment marker of HNSCC tumors radiosensitivity preliminary methodological study and discussion

    Czech Academy of Sciences Publication Activity Database

    Falk, Martin; Hořáková, Z.; Svobodová, M.; Masařík, M.; Kopečná, Olga; Gumulec, J.; Raudenská, M.; Depeš, Daniel; Bačíková, Alena; Falková, Iva; Binkova, H.

    2017-01-01

    Roč. 71, č. 9 (2017), č. článku 241. ISSN 1434-6079 R&D Projects: GA ČR(CZ) GA16-12454S Institutional support: RVO:68081707 Keywords : squamous-cell carcinoma * cancer -associated fibroblasts Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Biochemistry and molecular biology

  4. Instrument evaluation no. 16. Nuclear enterprises portable doserate meter type PDR4 and external probes types BP1/1, BP8 and GP9

    CERN Document Server

    Burgess, P H

    1979-01-01

    The various radiations encountered in radiological protection cover a wide range of energies and radiation measurements have to be carried out under an equally broad spectrum of environmental conditions. This report is one of a series intended to give information on the performance characteristics of radiological protection instruments, to assist in the selection of appropriate instruments for a given purpose, to interpret the results obtained with such instruments, and, in particular, to know the likely sources and magnitude of errors that might be associated with measurements in the field. The radiation, electrical and environmental characteristics of radiation protection instruments are considered together with those aspects of the construction which make an instrument convenient for routine use. To provide consistent criteria for instrument performance, the range of tests performed on any particular class of instrument, the test methods and the criteria of acceptable performance are based broadly on the a...

  5. The strontium inorganic mutant of the water oxidizing center (CaMn4O5) of PSII improves WOC efficiency but slows electron flux through the terminal acceptors.

    Science.gov (United States)

    Gates, Colin; Ananyev, Gennady; Dismukes, G Charles

    2016-09-01

    Herein we extend prior studies of biosynthetic strontium replacement of calcium in PSII-WOC core particles to characterize whole cells. Previous studies of Thermosynechococcus elongatus found a lower rate of light-saturated O2 from isolated PSII-WOC(Sr) cores and 5-8× slower rate of oxygen release. We find similar properties in whole cells, and show it is due to a 20% larger Arrhenius activation barrier for O2 evolution. Cellular adaptation to the sluggish PSII-WOC(Sr) cycle occurs in which flux through the QAQB acceptor gate becomes limiting for turnover rate in vivo. Benzoquinone derivatives that bind to QB site remove this kinetic chokepoint yielding 31% greater O2 quantum yield (QY) of PSII-WOC(Sr) vs. PSII-WOC(Ca). QY and efficiency of the WOC(Sr) catalytic cycle are greatly improved at low light flux, due to fewer misses and backward transitions and 3-fold longer lifetime of the unstable S3 state, attributed to greater thermodynamic stabilization of the WOC(Sr) relative to the photoactive tyrosine YZ. More linear and less cyclic electron flow through PSII occurs per PSII-WOC(Sr). The organismal response to the more active PSII centers in Sr-grown cells at 45°C is to lower the number of active PSII-WOC per Chl, producing comparable oxygen and energy per cell. We conclude that redox and protonic energy fluxes created by PSII are primary determinants for optimal growth rate of T. elongatus. We further conclude that the (Sr-favored) intermediate-spin S=5/2 form of the S2 state is the active form in the catalytic cycle relative to the low-spin S=1/2 form. Copyright © 2016 Elsevier B.V. All rights reserved.

  6. All-atom molecular dynamics simulation of a photosystem i/detergent complex.

    Science.gov (United States)

    Harris, Bradley J; Cheng, Xiaolin; Frymier, Paul

    2014-10-09

    All-atom molecular dynamics (MD) simulation was used to investigate the solution structure and dynamics of the photosynthetic pigment-protein complex photosystem I (PSI) from Thermosynechococcus elongatus embedded in a toroidal belt of n-dodecyl-β-d-maltoside (DDM) detergent. Evaluation of root-mean-square deviations (RMSDs) relative to the known crystal structure show that the protein complex surrounded by DDM molecules is stable during the 200 ns simulation time, and root-mean-square fluctuation (RMSF) analysis indicates that regions of high local mobility correspond to solvent-exposed regions such as turns in the transmembrane α-helices and flexible loops on the stromal and lumenal faces. Comparing the protein-detergent complex to a pure detergent micelle, the detergent surrounding the PSI trimer is found to be less densely packed but with more ordered detergent tails, contrary to what is seen in most lipid bilayer models. We also investigated any functional implications for the observed conformational dynamics and protein-detergent interactions, discovering interesting structural changes in the psaL subunits associated with maintaining the trimeric structure of the protein. Importantly, we find that the docking of soluble electron mediators such as cytochrome c6 and ferredoxin to PSI is not significantly impacted by the solubilization of PSI in detergent.

  7. Structural insights into the light-driven auto-assembly process of the water-oxidizing Mn4CaO5-cluster in photosystem II.

    Science.gov (United States)

    Zhang, Miao; Bommer, Martin; Chatterjee, Ruchira; Hussein, Rana; Yano, Junko; Dau, Holger; Kern, Jan; Dobbek, Holger; Zouni, Athina

    2017-07-18

    In plants, algae and cyanobacteria, Photosystem II (PSII) catalyzes the light-driven splitting of water at a protein-bound Mn 4 CaO 5 -cluster, the water-oxidizing complex (WOC). In the photosynthetic organisms, the light-driven formation of the WOC from dissolved metal ions is a key process because it is essential in both initial activation and continuous repair of PSII. Structural information is required for understanding of this chaperone-free metal-cluster assembly. For the first time, we obtained a structure of PSII from Thermosynechococcus elongatus without the Mn 4 CaO 5 -cluster. Surprisingly, cluster-removal leaves the positions of all coordinating amino acid residues and most nearby water molecules largely unaffected, resulting in a pre-organized ligand shell for kinetically competent and error-free photo-assembly of the Mn 4 CaO 5 -cluster. First experiments initiating (i) partial disassembly and (ii) partial re-assembly after complete depletion of the Mn 4 CaO 5 -cluster agree with a specific bi-manganese cluster, likely a di-µ-oxo bridged pair of Mn(III) ions, as an assembly intermediate.

  8. Photophysiological and photosynthetic complex changes during iron starvation in Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942.

    Science.gov (United States)

    Fraser, Jared M; Tulk, Sarah E; Jeans, Jennifer A; Campbell, Douglas A; Bibby, Thomas S; Cockshutt, Amanda M

    2013-01-01

    Iron is an essential component in many protein complexes involved in photosynthesis, but environmental iron availability is often low as oxidized forms of iron are insoluble in water. To adjust to low environmental iron levels, cyanobacteria undergo numerous changes to balance their iron budget and mitigate the physiological effects of iron depletion. We investigated changes in key protein abundances and photophysiological parameters in the model cyanobacteria Synechococcus PCC 7942 and Synechocystis PCC 6803 over a 120 hour time course of iron deprivation. The iron stress induced protein (IsiA) accumulated to high levels within 48 h of the onset of iron deprivation, reaching a molar ratio of ~42 IsiA : Photosystem I in Synechococcus PCC 7942 and ~12 IsiA : Photosystem I in Synechocystis PCC 6803. Concomitantly the iron-rich complexes Cytochrome b6f and Photosystem I declined in abundance, leading to a decrease in the Photosystem I : Photosystem II ratio. Chlorophyll fluorescence analyses showed a drop in electron transport per Photosystem II in Synechococcus, but not in Synechocystis after iron depletion. We found no evidence that the accumulated IsiA contributes to light capture by Photosystem II complexes.

  9. Integrity and activity of photosystem 2 complexes isolated from the thermophilic cyanobacterium Synechococcus elongatus using various detergents

    Czech Academy of Sciences Publication Activity Database

    Šetlíková, Eva; Sofrová, D.; Prášil, Ondřej; Budáč, Petr; Koblížek, Michal; Šetlík, Ivan

    1999-01-01

    Roč. 37, č. 2 (1999), s. 183-200 ISSN 0300-3604. [Regional Photosynthesis Workshop /2./. Lipno, 31.01.1999-03.02.1999] R&D Projects: GA ČR GA206/96/1266; GA ČR GA206/98/P110; GA MŠk VS96085; GA MŠk ME 138 Grant - others:NATO(EC) LG970388 Subject RIV: ED - Physiology Impact factor: 0.734, year: 1999

  10. Regulation of Traslantion During In Vitro Maturation of Bovine Oocytes: The Role of MAP Kinase, eIF4E (Cap Binding Protein) Phosphorylation, and eIF4E-BP1

    Czech Academy of Sciences Publication Activity Database

    Kubelka, Michal; Tomek, W.; Sterza Melo, F. A.; Wollenhaupt, K.; Torner, H.; Anger, Martin; Kanitz, W.

    2002-01-01

    Roč. 66, - (2002), s. 1274-1282 ISSN 0006-3363 R&D Projects: GA ČR GA301/00/0781; GA AV ČR KSK5052113 Keywords : gamete biology * gene regulation * meiosis Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.689, year: 2002

  11. Suppression of Translation During in vitro Maturation of Pig Oocytes Despite Enhanced Formation of Cap-binding Protein Complex eIF4F and 4E-BP1 hyperphosphorylation.

    Czech Academy of Sciences Publication Activity Database

    Ellederová, Zdeňka; Kovářová, Hana; Melo Sterza, F.; Livingstone, M.; Tomek, W.; Kubelka, Michal

    2006-01-01

    Roč. 73, 1 (2006), s. 68-76 ISSN 1040-452X R&D Projects: GA ČR GA301/00/0781; GA ČR GA524/04/0104 Grant - others:Deutche Forschungsgemeinschaft(DE) 463TSE113/28 Institutional research plan: CEZ:AV0Z50450515 Keywords : meiosis * translation initiation * eIF-4E Subject RIV: ED - Physiology Impact factor: 2.379, year: 2006

  12. Abi1/Hssh3bp1 pY213 links Abl kinase signaling to p85 regulatory subunit of PI-3 kinase in regulation of macropinocytosis in LNCaP cells.

    Science.gov (United States)

    Dubielecka, Patrycja M; Machida, Kazuya; Xiong, Xiaoling; Hossain, Sajjad; Ogiue-Ikeda, Mari; Carrera, Ana C; Mayer, Bruce J; Kotula, Leszek

    2010-08-04

    Macropinocytosis is regulated by Abl kinase via an unknown mechanism. We previously demonstrated that Abl kinase activity is, itself, regulated by Abi1 subsequent to Abl kinase phosphorylation of Abi1 tyrosine 213 (pY213) [1]. Here we show that blocking phosphorylation of Y213 abrogated the ability of Abl to regulate macropinocytosis, implicating Abi1 pY213 as a key regulator of macropinocytosis. Results from screening the human SH2 domain library and mapping the interaction site between Abi1 and the p85 regulatory domain of PI-3 kinase, coupled with data from cells transfected with loss-of-function p85 mutants, support the hypothesis that macropinocytosis is regulated by interactions between Abi1 pY213 and the C-terminal SH2 domain of p85-thereby linking Abl kinase signaling to p85-dependent regulation of macropinocytosis. Copyright (c) 2010 Federation of European Biochemical Societies. All rights reserved.

  13. Down-Regulation of miR-129-5p and the let-7 Family in Neuroendocrine Tumors and Metastases Leads to Up-Regulation of Their Targets Egr1, G3bp1, Hmga2 and Bach1

    DEFF Research Database (Denmark)

    Dossing, Kristina B. V.; Binderup, Tina; Kaczkowski, Bogumil

    2014-01-01

    by miR-129-5p. let-7 overexpression inhibited growth of carcinoid cell lines, and let-7 inhibition increased protein content of the transcription factor BACH1 and its targets MMP1 and HMGA2, all known to promote bone metastases. Immunohistochemistry analysis revealed that let-7 targets are highly...

  14. Depletion of A-type lamins and Lap2α reduces 53BP1 accumulation at UV-induced DNA lesions and Lap2α protein is responsible for compactness of irradiated chromatin

    Czech Academy of Sciences Publication Activity Database

    Bártová, Eva; Legartová, Soňa; Krejčí, Jana; Řezníčková, Petra; Kovaříková, Alena; Suchánková, Jana; Fedr, Radek; Smirnov, E.; Hornáček, M.; Raška, I.

    2018-01-01

    Roč. 2018, č. 2018 (2018) ISSN 0730-2312 R&D Projects: GA ČR GBP302/12/G157; GA MŠk 7F14369 Institutional support: RVO:68081707 Keywords : DAPI * DNA damage response * FLIM Subject RIV: EB - Genetics ; Molecular Biology OBOR OECD: Cell biology Impact factor: 3.085, year: 2016

  15. On the ultrafast kinetics of the energy and electron transfer reactions in photosystem I

    Energy Technology Data Exchange (ETDEWEB)

    Slavov, Chavdar Lyubomirov

    2009-07-09

    The subject of the current work is one of the main participants in the light-dependent phase of oxygenic photosynthesis, Photosystem I (PS I). This complex carries an immense number of cofactors: chlorophylls (Chl), carotenoids, quinones, etc, which together with the protein entity exhibit several exceptional properties. First, PS I has an ultrafast light energy trapping kinetics with a nearly 100% quantum efficiency. Secondly, both of the electron transfer branches in the reaction center are suggested to be active. Thirdly, there are some so called 'red' Chls in the antenna system of PS I, absorbing light with longer wavelengths than the reaction center. These 'red' Chls significantly modify the trapping kinetics of PS I. The purpose of this thesis is to obtain better understanding of the above-mentioned, specific features of PS I. This will not merely cast more light on the mechanisms of energy and electron transfer in the complex, but also will contribute to the future developments of optimized artificial light-harvesting systems. In the current work, a number of PS I complexes isolated from different organisms (Thermosynechococcus elongatus, Chlamydomonas reinhardtii, Arabidopsis thaliana) and possessing distinctive features (different macroorganisation, monomers, trimers, monomers with a semibelt of peripheral antenna attached; presence of 'red' Chls) is investigated. The studies are primarily focused on the electron transfer kinetics in each of the cofactor branches in the PS I reaction center, as well as on the effect of the antenna size and the presence of 'red' Chls on the trapping kinetics of PS I. These aspects are explored with the help of several ultrafast optical spectroscopy methods: (i) time-resolved fluorescence ? single photon counting and synchroscan streak camera; and (ii) ultrafast transient absorption. Physically meaningful information about the molecular mechanisms of the energy trapping in PS I is

  16. Structure of Psb29/Thf1 and its association with the FtsH protease complex involved in photosystem II repair in cyanobacteria.

    Science.gov (United States)

    Bec Ková, Martina; Yu, Jianfeng; Krynická, Vendula; Kozlo, Amanda; Shao, Shengxi; Koník, Peter; Komenda, Josef; Murray, James W; Nixon, Peter J

    2017-09-26

    One strategy for enhancing photosynthesis in crop plants is to improve their ability to repair photosystem II (PSII) in response to irreversible damage by light. Despite the pivotal role of thylakoid-embedded FtsH protease complexes in the selective degradation of PSII subunits during repair, little is known about the factors involved in regulating FtsH expression. Here we show using the cyanobacterium Synechocystis sp. PCC 6803 that the Psb29 subunit, originally identified as a minor component of His-tagged PSII preparations, physically interacts with FtsH complexes in vivo and is required for normal accumulation of the FtsH2/FtsH3 hetero-oligomeric complex involved in PSII repair. We show using X-ray crystallography that Psb29 from Thermosynechococcus elongatus has a unique fold consisting of a helical bundle and an extended C-terminal helix and contains a highly conserved region that might be involved in binding to FtsH. A similar interaction is likely to occur in Arabidopsis chloroplasts between the Psb29 homologue, termed THF1, and the FTSH2/FTSH5 complex. The direct involvement of Psb29/THF1 in FtsH accumulation helps explain why THF1 is a target during the hypersensitive response in plants induced by pathogen infection. Downregulating FtsH function and the PSII repair cycle via THF1 would contribute to the production of reactive oxygen species, the loss of chloroplast function and cell death.This article is part of the themed issue 'Enhancing photosynthesis in crop plants: targets for improvement'. © 2017 The Authors.

  17. Quantum mechanics/molecular mechanics study of the catalytic cycle of water splitting in photosystem II.

    Science.gov (United States)

    Sproviero, Eduardo M; Gascón, José A; McEvoy, James P; Brudvig, Gary W; Batista, Victor S

    2008-03-19

    This paper investigates the mechanism of water splitting in photosystem II (PSII) as described by chemically sensible models of the oxygen-evolving complex (OEC) in the S0-S4 states. The reaction is the paradigm for engineering direct solar fuel production systems since it is driven by solar light and the catalyst involves inexpensive and abundant metals (calcium and manganese). Molecular models of the OEC Mn3CaO4Mn catalytic cluster are constructed by explicitly considering the perturbational influence of the surrounding protein environment according to state-of-the-art quantum mechanics/molecular mechanics (QM/MM) hybrid methods, in conjunction with the X-ray diffraction (XRD) structure of PSII from the cyanobacterium Thermosynechococcus elongatus. The resulting models are validated through direct comparisons with high-resolution extended X-ray absorption fine structure spectroscopic data. Structures of the S3, S4, and S0 states include an additional mu-oxo bridge between Mn(3) and Mn(4), not present in XRD structures, found to be essential for the deprotonation of substrate water molecules. The structures of reaction intermediates suggest a detailed mechanism of dioxygen evolution based on changes in oxidization and protonation states and structural rearrangements of the oxomanganese cluster and surrounding water molecules. The catalytic reaction is consistent with substrate water molecules coordinated as terminal ligands to Mn(4) and calcium and requires the formation of an oxyl radical by deprotonation of the substrate water molecule ligated to Mn(4) and the accumulation of four oxidizing equivalents. The oxyl radical is susceptible to nucleophilic attack by a substrate water molecule initially coordinated to calcium and activated by two basic species, including CP43-R357 and the mu-oxo bridge between Mn(3) and Mn(4). The reaction is concerted with water ligand exchange, swapping the activated water by a water molecule in the second coordination shell of

  18. Structures of the Mycobacterium tuberculosis GlpX protein (class II fructose-1,6-bisphosphatase): implications for the active oligomeric state, catalytic mechanism and citrate inhibition.

    Science.gov (United States)

    Wolf, Nina M; Gutka, Hiten J; Movahedzadeh, Farahnaz; Abad-Zapatero, Celerino

    2018-04-01

    The crystal structures of native class II fructose-1,6-bisphosphatase (FBPaseII) from Mycobacterium tuberculosis at 2.6 Å resolution and two active-site protein variants are presented. The variants were complexed with the reaction product fructose 6-phosphate (F6P). The Thr84Ala mutant is inactive, while the Thr84Ser mutant has a lower catalytic activity. The structures reveal the presence of a 222 tetramer, similar to those described for fructose-1,6/sedoheptulose-1,7-bisphosphatase from Synechocystis (strain 6803) as well as the equivalent enzyme from Thermosynechococcus elongatus. This homotetramer corresponds to a homologous oligomer that is present but not described in the crystal structure of FBPaseII from Escherichia coli and is probably conserved in all FBPaseIIs. The constellation of amino-acid residues in the active site of FBPaseII from M. tuberculosis (MtFBPaseII) is conserved and is analogous to that described previously for the E. coli enzyme. Moreover, the structure of the active site of the partially active (Thr84Ser) variant and the analysis of the kinetics are consistent with the previously proposed catalytic mechanism. The presence of metabolites in the crystallization medium (for example citrate and malonate) and in the corresponding crystal structures of MtFBPaseII, combined with their observed inhibitory effect, could suggest the existence of an uncharacterized inhibition of this class of enzymes besides the allosteric inhibition by adenosine monophosphate observed for the Synechocystis enzyme. The structural and functional insights derived from the structure of MtFBPaseII will provide critical information for the design of lead inhibitors, which will be used to validate this target for future chemical intervention.

  19. Protein (Cyanobacteria): 64998 [PGDBj - Ortholog DB

    Lifescience Database Archive (English)

    Full Text Available syc2491_c Synechococcus elongatus PCC 6301 MRPLTLEPHDQRSVLRLLIGAAWLDGDMQPEERNYLKGLLEKHRLAADPEFQDLMTRTTPISPAVFEQWLTAYLRQHPRREDVEALLEQISSVIYADSLIDAREAAVLCEIEQELEHRPALRLLDRLQTFFHHCLVMS ...

  20. The Transcriptomes of Xiphinema index and Longidorus elongatus Suggest Independent Acquisition of Some Plant Parasitism Genes by Horizontal Gene Transfer in Early-Branching Nematodes

    NARCIS (Netherlands)

    Danchin, Etienne G.J.; Perfus-Barbeoch, Laetitia; Rancurel, Corinne; Thorpe, Peter; Rocha, Da Martine; Bajew, Simon; Neilson, Roy; Sokolova, Elena; Silva, Da Corinne; Guy, Julie; Labadie, Karine; Esmenjaud, Daniel; Helder, Hans; Jones, John T.; Eves-van den Akker, Sebastian

    2017-01-01

    Nematodes have evolved the ability to parasitize plants on at least four independent occasions, with plant parasites present in Clades 1, 2, 10 and 12 of the phylum. In the case of Clades 10 and 12, horizontal gene transfer of plant cell wall degrading enzymes from bacteria and fungi has been

  1. A study of the length – weight relationship and condition factor of ...

    African Journals Online (AJOL)

    1.1145 (March). Pseudotolithus elongatus exhibited an allometric growth. There was a positive correlation between length and weight of both sexes. P. elongatus was also in a good condition. Keywords: Fish, length–weight relationship, condition ...

  2. Effect of Ca2+/Sr2+ substitution on the electronic structure of the oxygen-evolving complex of photosystem II: a combined multifrequency EPR, 55Mn-ENDOR, and DFT study of the S2 state.

    Science.gov (United States)

    Cox, Nicholas; Rapatskiy, Leonid; Su, Ji-Hu; Pantazis, Dimitrios A; Sugiura, Miwa; Kulik, Leonid; Dorlet, Pierre; Rutherford, A William; Neese, Frank; Boussac, Alain; Lubitz, Wolfgang; Messinger, Johannes

    2011-03-16

    The electronic structures of the native Mn(4)O(x)Ca cluster and the biosynthetically substituted Mn(4)O(x)Sr cluster of the oxygen evolving complex (OEC) of photosystem II (PSII) core complexes isolated from Thermosynechococcus elongatus, poised in the S(2) state, were studied by X- and Q-band CW-EPR and by pulsed Q-band (55)Mn-ENDOR spectroscopy. Both wild type and tyrosine D less mutants grown photoautotrophically in either CaCl(2) or SrCl(2) containing media were measured. The obtained CW-EPR spectra of the S(2) state displayed the characteristic, clearly noticeable differences in the hyperfine pattern of the multiline EPR signal [Boussac et al. J. Biol. Chem.2004, 279, 22809-22819]. In sharp contrast, the manganese ((55)Mn) ENDOR spectra of the Ca and Sr forms of the OEC were remarkably similar. Multifrequency simulations of the X- and Q-band CW-EPR and (55)Mn-pulsed ENDOR spectra using the Spin Hamiltonian formalism were performed to investigate this surprising result. It is shown that (i) all four manganese ions contribute to the (55)Mn-ENDOR spectra; (ii) only small changes are seen in the fitted isotropic hyperfine values for the Ca(2+) and Sr(2+) containing OEC, suggesting that there is no change in the overall spin distribution (electronic coupling scheme) upon Ca(2+)/Sr(2+) substitution; (iii) the changes in the CW-EPR hyperfine pattern can be explained by a small decrease in the anisotropy of at least two hyperfine tensors. It is proposed that modifications at the Ca(2+) site may modulate the fine structure tensor of the Mn(III) ion. DFT calculations support the above conclusions. Our data analysis also provides strong support for the notion that in the S(2) state the coordination of the Mn(III) ion is square-pyramidal (5-coordinate) or octahedral (6-coordinate) with tetragonal elongation. In addition, it is shown that only one of the currently published OEC models, the Siegbahn structure [Siegbahn, P. E. M. Acc. Chem. Res.2009, 42, 1871-1880, Pantazis

  3. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ccus ... elongatus PCC 6301] ... Length = 155 ... Query: 2 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDR...AGLLVMFICQHCPFVKHVEEELAA 61 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVM...FICQHCPFVKHVEEELAA Sbjct: 1 ... AKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAA 60 ... Query: 122 DF

  4. ORF Alignment: NC_006576 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Synechococcus elongatus PCC 6301] ... Length = 288 ... Query: 24 ... LVYATYGELNRDRSNAILYPTSYGA...QHSTIDWLIGGDRILDPDRWFIVIVNQFGNGLSSS 83 ... LVYATYGELNRDRSNAILYPTSYGAQHSTID...WLIGGDRILDPDRWFIVIVNQFGNGLSSS Sbjct: 1 ... LVYATYGELNRDRSNAILYPTSYGAQHSTIDWLIGGDRILDPDRWFIVIVNQFGNGLSSS 60 ... Qu

  5. Heavy metals (cadmium and lead) in the estuarine croaker ...

    African Journals Online (AJOL)

    A study to determine the concentrations of cadmium (Cd) and lead (Pb) in the muscles of Pseudotolithus elongatus as well as estimating the condition and growth pattern of the fish was carried out in 2013. Ten samples of the croaker P. elongatus were purchased from the Mile One market, Port Harcourt, Nigeria and their ...

  6. GenBank blastx search result: AK061785 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK061785 001-039-E07 AB121971.1 Thermosynechococcus vulcanus kaiA, kaiB, kaiC genes for circadian clock... protein KaiA, circadian clock protein KaiB, circadian clock protein KaiC, complete and partial cds.|BCT BCT 4e-20 +2 ...

  7. GenBank blastx search result: AK289181 [KOME

    Lifescience Database Archive (English)

    Full Text Available iC genes for circadian clock protein KaiA, circadian clock protein KaiB, circadian clock protein KaiC, complete and partial cds. BCT 2e-19 0 ... ...AK289181 J100029B03 AB121971.1 AB121971 Thermosynechococcus vulcanus kaiA, kaiB, ka

  8. GenBank blastx search result: AK060751 [KOME

    Lifescience Database Archive (English)

    Full Text Available AK060751 001-032-G04 AB121971.1 Thermosynechococcus vulcanus kaiA, kaiB, kaiC genes for circadian clock... protein KaiA, circadian clock protein KaiB, circadian clock protein KaiC, complete and partial cds.|BCT BCT 9e-26 +1 ...

  9. GenBank blastx search result: AK243031 [KOME

    Lifescience Database Archive (English)

    Full Text Available iC genes for circadian clock protein KaiA, circadian clock protein KaiB, circadian clock protein KaiC, complete and partial cds. BCT 1e-19 1 ... ...AK243031 J100004F15 AB121971.1 AB121971 Thermosynechococcus vulcanus kaiA, kaiB, ka

  10. Description d’un Gyrinide nouveau

    NARCIS (Netherlands)

    Régimbart, M.

    1887-01-01

    Oralis, sat elongatus, valde convexus, corpore subtus pedibusque pallide testaceis, supra subtilissime reticulatus, niger, anguste flavolimbatus, in capite et pronoto viridi-aenescens, elytris nigris vix metallicis, in regionibus punctatis brunneotomentosis, costa discoïdali sat lata, ante apicem

  11. Coléoptères nouveaux ou peu connus du Musée de Leyde

    NARCIS (Netherlands)

    Fairmaire, L.

    1887-01-01

    Long. 13 millim. — Elongatus, modice convexus, rufus, modice nitidus, capite infuscato, fulvo-pubescens, subtus cum pedibus dilute rufescens, tarsis obscuris; capite summo fortiter punctato, antice transversim late impresso et subtilius sed densius punctato, labro rufescente, late sinuato; antennis

  12. Mobile acoustic telemetry data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

  13. Tag effect data - Lingcod Stock Enhancement: ecological interactions, fishery contributions, and life history

    Data.gov (United States)

    National Oceanic and Atmospheric Administration, Department of Commerce — Lingcod (Ophiodon elongatus) populations along the West Coast of North America have recovered from overfishing, but the status of genetically distinct lingcod in...

  14. Description of a new genus and species of the Coleopterous family Colydidae

    NARCIS (Netherlands)

    Reitter, E.

    1882-01-01

    Corpus valde elongatum, convexum. Antennae 11-articulatae, sub frontis margine ante oculos insertae, apicem versus sensim incrassatae, articulo ultimo rotundato. Fronte tateribus elevata. Oculi antice emarginati. Prothorax elongatus, carinatus. Scutellum minutum. Elytra punctatostriata, interstitiis

  15. Effect of light wavelength on hot spring microbial mat biodiversity.

    Science.gov (United States)

    Nishida, Akifumi; Thiel, Vera; Nakagawa, Mayuko; Ayukawa, Shotaro; Yamamura, Masayuki

    2018-01-01

    Hot spring associated phototrophic microbial mats are purely microbial communities, in which phototrophic bacteria function as primary producers and thus shape the community. The microbial mats at Nakabusa hot springs in Japan harbor diverse photosynthetic bacteria, mainly Thermosynechococcus, Chloroflexus, and Roseiflexus, which use light of different wavelength for energy conversion. The aim of this study was to investigate the effect of the phototrophs on biodiversity and community composition in hot spring microbial mats. For this, we specifically activated the different phototrophs by irradiating the mats with different wavelengths in situ. We used 625, 730, and 890 nm wavelength LEDs alone or in combination and confirmed the hypothesized increase in relative abundance of different phototrophs by 16S rRNA gene sequencing. In addition to the increase of the targeted phototrophs, we studied the effect of the different treatments on chemotrophic members. The specific activation of Thermosynechococcus led to increased abundance of several other bacteria, whereas wavelengths specific to Chloroflexus and Roseiflexus induced a decrease in >50% of the community members as compared to the dark conditions. This suggests that the growth of Thermosynechococcus at the surface layer benefits many community members, whereas less benefit is obtained from an increase in filamentous anoxygenic phototrophs Chloroflexus and Roseiflexus. The increases in relative abundance of chemotrophs under different light conditions suggest a relationship between the two groups. Aerobic chemoheterotrophs such as Thermus sp. and Meiothermus sp. are thought to benefit from aerobic conditions and organic carbon in the form of photosynthates by Thermosynechococcus, while the oxidation of sulfide and production of elemental sulfur by filamentous anoxygenic phototrophs benefit the sulfur-disproportionating Caldimicrobium thiodismutans. In this study, we used an experimental approach under controlled

  16. HCLK2 is required for activity of the DNA damage response kinase ATR

    DEFF Research Database (Denmark)

    Rendtlew Danielsen, Jannie M; Larsen, Dorthe Helena; Schou, Kenneth Bødtker

    2008-01-01

    of ATR kinase activity. We show that HCLK2 forms a complex with ATR-ATRIP and the ATR activator TopBP1. We demonstrate that HCLK2-induced ATR kinase activity toward substrates requires TopBP1 and vice versa and provides evidence that HCLK2 facilitates efficient ATR-TopBP1 association. Consistent with its...... in the same pathway as TopBP1 but that the two proteins regulate different steps in ATR activation....

  17. A revised geographical range for Liolaemus elongates Koslowsky, 1896 (Squamata: Liolaemini in Argentina: review of reported and new-data based distribution with new localities

    Directory of Open Access Journals (Sweden)

    Ignacio Minoli

    2013-12-01

    Full Text Available Estimating the effective geographical ranges of species is central to species-oriented conservation and management. In this paper, we review the geographical distribution of Liolaemus elongatus Koslowsky, 1896 with three new records for northern Chubut and southern Río Negro provinces, Argentina. Based on detailed locality records pooled from multiple data sources, including new records obtained for this study, we revise the range of L. elongatus sensu stricto and provide geographical distribution maps comparing the previously recognized range to that proposed herein. Our results show that L. elongatus possesses a much more limited geographic distribution than previously thought, being restricted to areas south of 38°S latitude; the newly proposed range is merely half the species formerly recognized geographical distribution.

  18. NMSBA: Aken Technologies Final Report: Toxicity Testing of Liquidoff

    Energy Technology Data Exchange (ETDEWEB)

    Ruffing, Anne [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Jensen, Travis [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States); Strickland, Lucas [Sandia National Lab. (SNL-NM), Albuquerque, NM (United States)

    2015-02-01

    To determine the effect of Liquidoff on bacteria, three bacterial strains were tested: Escherichia coli DH5α, Synechococcus sp. PCC 7002, and Synechococcus elongatus PCC 7942. E. coli DH5α is a Gram-negative, aerobic bacterium that is often found in normal gut flora and is commonly used the laboratory due to its fast growth rate. Synechococcus sp. PCC 7002 and S. elongatus PCC 7942 are Gram-negative, aquatic, autophototrophic cyanobacteria. Synechococcus sp. PCC 7002 is a marine cyanobacterium isolated from ‘fish pens’ on Magueyes Island, Puerto Rico in 1962, while S. elongatus PCC 7942 is a freshwater cyanobacterium. It should be noted that no Gram-positive bacterium was tested in this study.

  19. The heavy metals in the muscle of some imported frozen fish in ...

    African Journals Online (AJOL)

    The heavy metal levels in the edible muscles of eight species of imported frozen fishes in four major markets in Ibadan were examined. The species examined were Ethmalosa harengus, Micromesistius poutassou, Sardinella eba, Trachurus trachurus, Scomber scombrus, Scomberomorous tritor, Pseudotololithus elongatus ...

  20. Browse Title Index

    African Journals Online (AJOL)

    Items 851 - 900 of 1255 ... Vol 10, No 4 (2004), Occurrence of Parasites in Pseudotolithus elongatus and Cynoglossus seneglensis in Cross River Estuary, Nigeria, Abstract PDF. JT Abraham, PA ... P C Chikezie. Vol 9, No 1 (2003), Parasitic contamination of leafy vegetables: a function of the leaf area index (lai), Abstract PDF.

  1. Description d’une nouvelle espèce de Gyrinide du Musée de Leyde

    NARCIS (Netherlands)

    Regimbart, M.

    1884-01-01

    Long. 6 3/4 mm. (ano excepto). — Oblongo-ovalis, elongatus, mediocriter convexus; supra in regionibus glabris purpureocupreus, nitidus, subtilissime reticulatus, in regionibus punctato-tomentosis obscure cœruleus et subopacus, anguste pallide testaceo limbatus; infra pallide testaceus, pedibus

  2. Deux espèces nouvelles de Dytiscides du Musée de Leyde

    NARCIS (Netherlands)

    Régimbart, M.

    1893-01-01

    Long. 2 mill. — Oblongo-ovalis, elongatus, subparallelus; capite et pronoto rufis, hoc ad basin late transversim nigricante, sat tenuiter in disco et fortius apud basin punctato; elytris nigris, margine laterali ad apicem dilatato, macula elongata minuta post medium ad latera, fasciaque post basali

  3. Two new Liolaemus lizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae)

    Science.gov (United States)

    Troncoso-Palacios, Jaime; Diaz, Hugo A.; Puas, German I.; Riveros-Riffo, Edvin; Elorza, Alvaro A.

    2016-01-01

    Abstract Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus (sensu stricto) and Eulaemus, distributed mainly in Chile and Argentina. The Liolaemus elongatus-kriegi complex is the most diverse group within Liolaemus (sensu stricto), especially the species closely related to Liolaemus elongatus, which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the Liolaemus elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus (sensu stricto) is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis. Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs) of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that Liolaemus lonquimayensis is a synonym of Liolaemus elongatus. PMID:27920609

  4. The Holarctic species of the subgenus Allodorus Foerster s.s. of the genus Eubazus Nees (Hymenoptera: Braconidae)ae)

    NARCIS (Netherlands)

    Achterberg, van C.; Kenis, M.

    2000-01-01

    Four new species of the subgenus Allodorus Foerster s.s. (= Eubazus semirugosus (Nees)-group s.s.; Braconidae: Helconinae) are described and illustrated: E. abieticola spec. nov. from France, Austria, Switzerland and Germany, E. elongatus spec. nov., E. ochyrus spec. nov., and E. heothinus spec.

  5. A synthetic, light-driven consortium of cyanobacteria and heterotrophic bacteria enables stable polyhydroxybutyrate production.

    Science.gov (United States)

    Weiss, Taylor L; Young, Eric J; Ducat, Daniel C

    2017-11-01

    We previously reported that Synechococcus elongatus PCC 7942, engineered with the sucrose transporter CscB, can export up to 85% of its photosynthetically-fixed carbon as sucrose and shows considerable promise as an alternative carbohydrate source. One approach to effectively utilize this cyanobacterium is to generate synthetic, light-driven consortia in which sucrose-metabolizing heterotrophs catalyze the conversion of the low-value carbohydrate into higher-value compounds in co-culture. Here, we report an improved synthetic photoautotroph/chemoheterotroph consortial design in which sucrose secreted by S. elongatus CscB directly supports the bacterium Halomonas boliviensis, a natural producer of the bioplastic precursor, PHB. We show that alginate encapsulation of S. elongatus CscB enhances sucrose-export rates ~2-fold within 66h, to ~290mg sucrose L -1 d -1 OD 750 -1 and enhances the co-culture stability. Consortial H. boliviensis accumulate up to 31% of their dry-weight as PHB, reaching productivities up to 28.3mg PHB L -1 d -1 . This light-driven, alginate-partitioned co-culture platform achieves PHB productivities that match or exceed those of traditionally engineered cyanobacterial monocultures. Importantly, S. elongatus CscB/H. boliviensis co-cultures were continuously productive for over 5 months and resisted invasive microbial species without the application of antibiotics or other chemical selection agents. Copyright © 2017 International Metabolic Engineering Society. Published by Elsevier Inc. All rights reserved.

  6. Scandinavian Oncophorus (Bryopsida, Oncophoraceae: species, cryptic species, and intraspecific variation

    Directory of Open Access Journals (Sweden)

    Lars Hedenäs

    2017-05-01

    Full Text Available Scandinavian members of the acrocarpous moss genus Oncophorus were revised after field observations had suggested unrecognized diversity. Based on molecular (nuclear: internal transcribed spacers 1 and 2, ITS; plastid: trnGUCC G2 intron, trnG, rps4 gene + trnS-rps4 spacer, rps4 and morphological evidence, four morphologically distinguishable species are recognized, Oncophorus elongatus (I.Hagen Hedenäs, O. integerrimus Hedenäs sp. nov. (syn. O. virens var. elongatus Limpr., O. virens (Hedw. Brid., and O. wahlenbergii Brid. (O. sardous Herzog, syn. nov.. Oncophorus elongatus was earlier recognized, but much of its variation was hidden within O. wahlenbergii. Its circumscription is here expanded to include plants with long leaves having mostly denticulate or sharply denticulate upper margins and with long and narrow marginal cells in the basal portion of the sheathing leaf lamina. The new species O. integerrimus sp. nov. differs from O. virens in having more loosely incurved leaves and entire or almost entire upper leaf margins. Besides these characters, the species in the respective pairs differ in quantitative features of the leaf lamina cells. Several cryptic entities were found, in several cases as molecularly distinct as some of the morphologically recognizable species, and phylogeographic structure is present within O. elongatus and O. virens.

  7. Two newLiolaemuslizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae).

    Science.gov (United States)

    Troncoso-Palacios, Jaime; Diaz, Hugo A; Puas, German I; Riveros-Riffo, Edvin; Elorza, Alvaro A

    2016-01-01

    Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus ( sensu stricto ) and Eulaemus , distributed mainly in Chile and Argentina. The Liolaemus elongatus-kriegi complex is the most diverse group within Liolaemus ( sensu stricto ), especially the species closely related to Liolaemus elongatus , which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the Liolaemus elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus ( sensu stricto ) is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis . Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs) of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that Liolaemus lonquimayensis is a synonym of Liolaemus elongatus .

  8. Two new Liolaemus lizards from the Andean highlands of Southern Chile (Squamata, Iguania, Liolaemidae

    Directory of Open Access Journals (Sweden)

    Jaime Troncoso-Palacios

    2016-11-01

    Full Text Available Liolaemus is a diverse genus of lizards, subdivided into two subgenera: Liolaemus (sensu stricto and Eulaemus, distributed mainly in Chile and Argentina. The L. elongatus-kriegi complex is the most diverse group within Liolaemus (sensu stricto, especially the species closely related to L. elongatus, which form a clade currently comprising nine species. Several Chilean species of this group have been recently described, mainly from volcanoes and poorly explored mountains. Here molecular and morphological evidence are provided for a new species of the L. elongatus clade, which is characterized by its small size and lack of dorsal pattern, unusual features for the species of this group of lizards. Additionally, the lack of precloacal pores in males of Liolaemus (sensu stricto is a trait found in few species, which do not constitute a monophyletic group. A second new southern Chilean species is also described, without precloacal pores and supported by molecular phylogenetics to be related to Liolaemus villaricensis. Both new species were found in the same locality, near a lake located in a pre-Andean zone with Araucaria and Nothofagus forest. The two species are dedicated to prominent Lonkos (tribal chiefs of the Mapuche and Pehuenche people: Janequeo and Leftraru. Additionally, the phylogenetic results suggest that L. lonquimayensis is a synonym of L. elongatus.

  9. Annual and spatial variability in endo- and ectoparasite infections of North Sea cod (Gadus morhua Linnaeus, 1758) larvae, post-larvae and juveniles

    DEFF Research Database (Denmark)

    Mehrdana, Foojan; Bahlool, Qusay Z. M.; Skovgaard, Alf

    2014-01-01

    A parasitological investigation was performed on a total of 5380 Atlantic cod larvae, post-larvae and small juveniles sampled from the North Sea during a period of five years. The copepod Caligus elongatus (Von Nordmann, 1832) and the nematode Hysterothylacium aduncum (Rudolphi, 1802) were found ...

  10. Coléoptères nouveaux de l’Afrique du Musée de Leyde

    NARCIS (Netherlands)

    Fairmaire, L.

    1888-01-01

    Long. 22 à 25 mill. — Elongatus, convexus, fuscus aut brunneo-castaneus, modice nitidus, fulvo-pubescens; capite dense punctato, inter oculos sat late impresso, antice declivi, margine obtuse rotundato; antennis fuscis, medium corporis attingentibus, articulo 1° punctato, 2° minuto, 3° vix majore,

  11. Species composition, length-weight relationship and condition factor ...

    African Journals Online (AJOL)

    Chrysichthys nigrodigitatus (b=3.75), Mugil cephalus (b=3.02) and Atherina formis (b=3.46) exhibited positive allometry growth while Pseudotolithus elongatus (b=2.55), Eleotris africana (b=2.79), Sardinella maderemsis (b=2.04), Periophthalmus barbarous (b=2.77), Microchirus poscanion had negative allometry growth.

  12. Electric field effects on red chlorophylls, b-carotenes and P700 in cyanobacterial photosystem I complexes.

    NARCIS (Netherlands)

    Frese, R.N.; Palacios, M.A.; Azzizi, A.; van Stokkum, I.H.M.; Kruip, J.; Rögner, M.; Karapetyan, N.V.; Schlodder, E.; van Grondelle, R.; Dekker, J.P.

    2002-01-01

    We have probed the absorption changes due to an externally applied electric field (Stark effect) of Photosystem I (PSI) core complexes from the cyanobacteria Synechocystis sp. PCC 6803, Synechococcus elongatus and Spirulina platensis. The results reveal that the so-called C719 chlorophylls in S.

  13. Author Details

    African Journals Online (AJOL)

    Abraham, JT. Vol 5, No 1 (2006) - Articles Abundance of Pseudotolithus elongatus in the Niger Delta area - a case study in the Cross River estuary. Abstract PDF · Vol 14, No 1 (2015) - Articles Parasites of crayfish (P. clarki) and lobsters (Macrobrachium vollenhovenic) as indicators of metallic pollution in great, Kwa river, ...

  14. DOE final report 100608.doc

    Energy Technology Data Exchange (ETDEWEB)

    Golden, Susan S

    2008-10-16

    The aim of this project was to inactivate each locus of the genome of the cyanobacterium Synechococcus elongatus PCC 7942 and screen resulting mutants for altered circadian phenotypes. The immediate goal was to identify all open reading frames (ORFs) that contribute to circadian timing. An additional result was to create a complete archived set of mutagenesis templates, of great utility for the wider research community, that will allow inactivation of any given locus in the genome of S. elongatus. Clones that carry segments of the S. elongatus genome were saturated with transposon insertions in vitro. We completed saturation mutagenesis of the chromosome (~2800 ORFs). The positions of insertions were sequenced for 17,767 mutagenized clones. Each individual insertion into the S. elongatus DNA in a cosmid or plasmid is a substrate for mutagenesis of the genome via homologous recombination. Because the complete insertion mutation clone set is 5-7 fold redundant, we produced a streamlined set of clones that contains one insertion mutation per locus in the genome, a unigene set. All clones are archived as Escherichia coli stocks frozen in glycerol in 96-well plates at -85ºC and as replicas of these plates on Whatman CloneSaver cards. Each of the mutagenesis substrates from the unigene set has been recombined into the chromosome of wild-type S. elongatus and these cyanobacterial mutants have been archived at -85ºC as well. S. elongatus insertion mutants defective for than 1400 independent genes have screened in luciferase reporter gene backgrounds to evaluate the effect of each mutation on circadian rhythms of gene expression. For the first 700 genes tested, mutagenesis of 71 different ORFs resulted in circadian phenotypes. The mutagenesis project also created insertion mutations in the endogenous large plasmid of S. elongatus, pANL. The sequence of pANL revealed two potential addiction cassettes that appear to account for selection for plasmid persistence. Genetic

  15. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ongatus ... BP-1] ... Length = 279 ... Query: 25 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDLX 84 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPE...AVDL ... Sbjct: 1 ... RVAVIGASEKEGSVGRTLLWNLIQSPFGGTVFPVNPRRSSVLGIKAYASVTAIPEAVDLA 60 ... Query: 145 CLGVMCPPTGLNA

  16. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ongatus ... BP-1] ... Length = 155 ... Query: 45 ... MQGGDPYVRALMRTISASEANDANPYTLLYGGEHVQDLSQHPDRCIP...IRRGANPHLCTTA 104 ... MQGGDPYVRALMRTISASEANDANPYTLLYGGEHVQDLSQHPDRCIPIRRGA...NPHLCTTA Sbjct: 1 ... MQGGDPYVRALMRTISASEANDANPYTLLYGGEHVQDLSQHPDRCIPIRRGANPHLCTTA 60 ... Query: 165 EGRVQEVFALLS

  17. ORF Alignment: NC_004113 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ngatus ... BP-1] ... Length = 113 ... Query: 9 ... WRHLLVIQDREGRHTIHLEASTYTIGRHPSNRIVLKSPMISRQHAVLL...RMLDPGSGNFFF 68 ... WRHLLVIQDREGRHTIHLEASTYTIGRHPSNRIVLKSPMISRQHAVLLRMLDPG...SGNFFF Sbjct: 1 ... WRHLLVIQDREGRHTIHLEASTYTIGRHPSNRIVLKSPMISRQHAVLLRMLDPGSGNFFF 60 ...

  18. Influence of weather variables and plant communities on grasshopper density in the Southern Pampas, Argentina.

    Science.gov (United States)

    de Wysiecki, María Laura; Arturi, Marcelo; Torrusio, Sandra; Cigliano, María Marta

    2011-01-01

    A study was conducted to evaluate the influence of weather (precipitation and temperature) and plant communities on grasshopper density over a 14-year period (1996-2009) in Benito Juárez County, Southern Pampas, Argentina. Total density strongly varied among plant communities. Highest values were registered in 2001 and 2003 in highly disturbed pastures and in 2002 and 2009 in halophilous grasslands. Native grasslands had the lowest density values. Seasonal precipitation and temperature had no significant effect on total grasshopper density. Dichroplus elongatus (Giglio-Tos) (Orthoptera: Acridoidea), Covasacris pallidinota (Bruner), Dichroplus pratensis Bruner, Scotussa lemniscata Stål, Borellia bruneri (Rehn) and Dichroplus maculipennis (Blanchard) comprised, on average, 64% of the grasshopper assemblages during low density years and 79% during high density years. Dichroplus elongatus, S. lemniscata and C. pallidinota were the most abundant species in 2001, 2002 and 2003, while D. elongatus, B. brunneri and C. pallidinota in 2009. Dichroplus elongatus and D. pratensis, mixed feeders species, were positively affected by summer rainfall. This suggests that the increase in summer precipitation had a positive effect on the quantity and quality forage production, affecting these grasshopper populations. Scotussa lemniscata and C. pallidinota were negatively affected by winter and fall temperature, possibly affecting the embryonic development before diapause and hatching. Dichroplus elongatus and D. pratensis were associated with highly disturbed pastures, S. lemniscata with pastures and B. bruneri and D. maculipennis with halophilous grasslands. Covasacris pallidinota was closely associated with halophilous grasslands and moderately disturbed pastures. Weather conditions changed over the years, with 2001, 2002 and 2003 having excessive rainfall while 2008 and 2009 were the driest years since the study started. We suggest that although seasonal precipitation and

  19. Benzophenone-1 stimulated the growth of BG-1 ovarian cancer cells by cell cycle regulation via an estrogen receptor alpha-mediated signaling pathway in cellular and xenograft mouse models

    International Nuclear Information System (INIS)

    Park, Min-Ah; Hwang, Kyung-A; Lee, Hye-Rim; Yi, Bo-Rim; Jeung, Eui-Bae; Choi, Kyung-Chul

    2013-01-01

    Highlights: ► BP-1 induced cell growth was reversed by an ER antagonist in BG-1 cells. ► BP-1 up-regulated the mRNA expression of cyclin D1. ► Up-regulation of cyclin D1 by BP-1 was reversed by an ER antagonist. ► BP-1 is a potential endocrine disruptor that exerts estrogenic effects. - Abstract: 2,4-Dihydroxybenzophenone (benzophenone-1; BP-1) is an UV stabilizer primarily used to prevent polymer degradation and deterioration in quality due to UV irradiation. Recently, BP-1 has been reported to bioaccumulate in human bodies by absorption through the skin and has the potential to induce health problems including endocrine disruption. In the present study, we examined the xenoestrogenic effect of BP-1 on BG-1 human ovarian cancer cells expressing estrogen receptors (ERs) and relevant xenografted animal models in comparison with 17-β estradiol (E2). In in vitro cell viability assay, BP-1 (10 −8 –10 −5 M) significantly increased BG-1 cell growth the way E2 did. The mechanism underlying the BG-1 cell proliferation was proved to be related with the up-regulation of cyclin D1, a cell cycle progressor, by E2 or BP-1. Both BP-1 and E2 induced cell growth and up-regulation of cyclin D1 were reversed by co-treatment with ICI 182,780, an ER antagonist, suggesting that BP-1 may mediate the cancer cell proliferation via an ER-dependent pathway like E2. On the other hand, the expression of p21, a regulator of cell cycle progression at G 1 phase, was not altered by BP-1 though it was down-regulated by E2. In xenograft mouse models transplanted with BG-1 cells, BP-1 or E2 treatment significantly increased the tumor mass formation compared to a vehicle (corn oil) within 8 weeks. In histopathological analysis, the tumor sections of E2 or BP-1 group displayed extensive cell formations with high density and disordered arrangement, which were supported by the increased number of BrdUrd positive nuclei and the over-expression of cyclin D1 protein. Taken together, these

  20. Effect of rootstock on 'Forelle' pear ( Pyrus communis L.) growth and ...

    African Journals Online (AJOL)

    PD), 'Old Home' × 'Farmingdale' (OHxF) 217, BU2/33, BP3, OHxF40 and BP1 averaged >100.0 cm2, with the smallest trees on Quince C51 (QC51). Trees on PD, OHxF217, BP1 and OHxF40 yielded >30.0 kg tree−1, whereas trees on Quince A ...

  1. Removal of triazine herbicides from freshwater systems using photosynthetic microorganisms

    International Nuclear Information System (INIS)

    Gonzalez-Barreiro, O.; Rioboo, C.; Herrero, C.; Cid, A.

    2006-01-01

    The uptake of the triazine herbicides, atrazine and terbutryn, was determined for two freshwater photosynthetic microorganisms, the green microalga Chlorella vulgaris and the cyanobacterium Synechococcus elongatus. An extremely rapid uptake of both pesticides was recorded, although uptake rate was lower for the cyanobacterium, mainly for atrazine. Other parameters related to the herbicide bioconcentration capacity of these microorganisms were also studied. Growth rate, biomass, and cell viability in cultures containing herbicide were clearly affected by herbicide uptake. Herbicide toxicity and microalgae sensitivity were used to determine the effectiveness of the bioconcentration process and the stability of herbicide removal. C. vulgaris showed higher bioconcentration capability for these two triazine herbicides than S. elongatus, especially with regard to terbutryn. This study supports the usefulness of such microorganisms, as a bioremediation technique in freshwater systems polluted with triazine herbicides

  2. Toward solar biodiesel production from CO2 using engineered cyanobacteria.

    Science.gov (United States)

    Woo, Han Min; Lee, Hyun Jeong

    2017-05-01

    Metabolic engineering of cyanobacteria has received attention as a sustainable strategy to convert carbon dioxide to various biochemicals including fatty acid-derived biodiesel. Recently, Synechococcus elongatus PCC 7942, a model cyanobacterium, has been engineered to convert CO2 to fatty acid ethyl esters (FAEEs) as biodiesel. Modular pathway has been constructed for FAEE production. Several metabolic engineering strategies were discussed to improve the production levels of FAEEs, including host engineering by improving CO2 fixation rate and photosynthetic efficiency. In addition, protein engineering of key enzyme in S. elongatus PCC 7942 was implemented to address issues on FAEE secretions toward sustainable FAEE production from CO2. Finally, advanced metabolic engineering will promote developing biosolar cell factories to convert CO2 to feasible amount of FAEEs toward solar biodiesel. © FEMS 2017. All rights reserved. For permissions, please e-mail: journals.permissions@oup.com.

  3. Genome Engineering of the 2,3-Butanediol Biosynthetic Pathway for Tight Regulation in Cyanobacteria.

    Science.gov (United States)

    Nozzi, Nicole E; Atsumi, Shota

    2015-11-20

    Cyanobacteria have gained popularity among the metabolic engineering community as a tractable photosynthetic host for renewable chemical production. However, though a number of successfully engineered production systems have been reported, long-term genetic stability remains an issue for cyanobacterial systems. The genetic engineering toolbox for cyanobacteria is largely lacking inducible systems for expression control. The characterization of tight regulation systems for use in cyanobacteria may help to alleviate this problem. In this work we explore the function of the IPTG inducible promoter P(L)lacO1 in the model cyanobacterium Synechococcus elongatus PCC 7942 as well as the effect of gene order within an operon on pathway expression. According to our experiments, P(L)lacO1 functions well as an inducible promoter in S. elongatus. Additionally, we found that gene order within an operon can strongly influence control of expression of each gene.

  4. Las especies del género Gyropus Nitzsch, 1818 (Phthiraptera: Gyropidae parásitas de Octodontidae (Mammalia: Rodentia The species of the genus Gyropus Nitzch, 1818 (Phthiraptera: Gyropidae parasitic on the Octodontidae (Mammalia: Rodentia

    Directory of Open Access Journals (Sweden)

    DOLORES DEL CARMEN CASTRO

    2002-06-01

    Full Text Available Este trabajo tiene por finalidad otorgar status específico pleno a la subespecie Gyropus parvus elongatus Castro, Cicchino & Torres-Mura, 1987, describir la nueva especie Gyropus distinctus a partir de materiales recolectados sobre Octodon degus (Molina, 1782 y Octodon lunatus Osgood, 1943 procedentes del centro de Chile y, finalmente, ofrecer un análisis de las posibles razones de la distribución geográfica y del rango de hospedadores conocidos para estas tres especiesThe purpose of this paper is to give full specific status to the subspecies Gyropus parvus elongatus Castro, Cicchino & Torres-Mura, 1987, to describe the new species Gyropus distinctus collected in Octodon degus and O. lunatus from central Chile, along with an analysis of the possible causes than could explain their geographic and host range distributions known to date for these three species

  5. Study on the Tribe Ochyromerini (Coleoptera, Curculionidae) from East Asia I, Descriptions of New Species of the Genera Endaeus and Endaenidius

    OpenAIRE

    Kojima, Hiroaki; Morimoto, Katsura

    1995-01-01

    This is the first part of our systematic study on the tribe Ochyromerini (=Endaeini) from East Asia with descriptions of 28 new species of the weevils in the genera Endaeus Schoenherr and Endaenidius Morimoto as follows: Endaeus albolineatus sp. nov. (E. Malaysia), Endaeus niger sp. nov. (E. Malaysia), Endaeus zonatus sp. nov. (E. Malaysia), Endaeus robustus sp. nov. (Thailand), Endaeus longipes sp. nov. (E. Malaysia), Endaeus formosanus sp. nov. (Taiwan), Endaeus elongatus sp. nov. (Taiwan),...

  6. Toward the crystallization of photosystem II core complex from Pisum sativum L

    Czech Academy of Sciences Publication Activity Database

    Prudnikova, T.; Gavira, J. A.; Řezáčová, Pavlína; Molina, E.P.; Hunalová, Ivana; Sviridova, E.; Schmidt, V.; Kohoutová, J.; Kutý, Michal; Kaftan, D.; Vácha, F.; Garcia-Ruiz, J. M.; Kutá-Smatanová, Ivana

    2010-01-01

    Roč. 10, č. 8 (2010), s. 3391-3396 ISSN 1528-7483 R&D Projects: GA MŠk(CZ) LC06010 Institutional research plan: CEZ:AV0Z50520514; CEZ:AV0Z50510513; CEZ:AV0Z60870520; CEZ:AV0Z40550506 Keywords : crystal-structure * cyanobacterial * elongatus Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 4.390, year: 2010

  7. A new species of Parichoronyssus (Acari: Dermanyssoidea: Macronyssidae) from bats of the genus Phyllostomus (Chiroptera: Phyllostomidae) in Peru and Venezuela, with keys to the species of Parichoronyssus.

    Science.gov (United States)

    Morales-Malacara, Juan B; Guerrero, Ricardo

    2007-01-01

    Parichoronyssus bakeri new species was found on two phyllostomid bats species, the greater spear-nosed bat, Phyllostomus hastatus (Pallas), and the lesser spear-nosed bat, Phyllostomus elongatus (E. Geoffroy), in Pakitza, National Park Manu, Madre de Dios, Peru, including additional material examined from Venezuela. The female, male, deutonymph, and protonymph are described and illustrated. A key to the seven species of Parichoronyssus is provided.

  8. Real-time fluorescence imaging of the DNA damage repair response during mitosis.

    Science.gov (United States)

    Miwa, Shinji; Yano, Shuya; Yamamoto, Mako; Matsumoto, Yasunori; Uehara, Fuminari; Hiroshima, Yukihiko; Toneri, Makoto; Murakami, Takashi; Kimura, Hiroaki; Hayashi, Katsuhiro; Yamamoto, Norio; Efimova, Elena V; Tsuchiya, Hiroyuki; Hoffman, Robert M

    2015-04-01

    The response to DNA damage during mitosis was visualized using real-time fluorescence imaging of focus formation by the DNA-damage repair (DDR) response protein 53BP1 linked to green fluorescent protein (GFP) (53BP1-GFP) in the MiaPaCa-2(Tet-On) pancreatic cancer cell line. To observe 53BP1-GFP foci during mitosis, MiaPaCa-2(Tet-On) 53BP1-GFP cells were imaged every 30 min by confocal microscopy. Time-lapse imaging demonstrated that 11.4 ± 2.1% of the mitotic MiaPaCa-2(Tet-On) 53BP1-GFP cells had increased focus formation over time. Non-mitotic cells did not have an increase in 53BP1-GFP focus formation over time. Some of the mitotic MiaPaCa-2(Tet-On) 53BP1-GFP cells with focus formation became apoptotic. The results of the present report suggest that DNA strand breaks occur during mitosis and undergo repair, which may cause some of the mitotic cells to enter apoptosis in a phenomenon possibly related to mitotic catastrophe. © 2014 Wiley Periodicals, Inc.

  9. Polo-like kinase 1 inhibits DNA damage response during mitosis.

    Science.gov (United States)

    Benada, Jan; Burdová, Kamila; Lidak, Tomáš; von Morgen, Patrick; Macurek, Libor

    2015-01-01

    In response to genotoxic stress, cells protect their genome integrity by activation of a conserved DNA damage response (DDR) pathway that coordinates DNA repair and progression through the cell cycle. Extensive modification of the chromatin flanking the DNA lesion by ATM kinase and RNF8/RNF168 ubiquitin ligases enables recruitment of various repair factors. Among them BRCA1 and 53BP1 are required for homologous recombination and non-homologous end joining, respectively. Whereas mechanisms of DDR are relatively well understood in interphase cells, comparatively less is known about organization of DDR during mitosis. Although ATM can be activated in mitotic cells, 53BP1 is not recruited to the chromatin until cells exit mitosis. Here we report mitotic phosphorylation of 53BP1 by Plk1 and Cdk1 that impairs the ability of 53BP1 to bind the ubiquitinated H2A and to properly localize to the sites of DNA damage. Phosphorylation of 53BP1 at S1618 occurs at kinetochores and in cytosol and is restricted to mitotic cells. Interaction between 53BP1 and Plk1 depends on the activity of Cdk1. We propose that activity of Cdk1 and Plk1 allows spatiotemporally controlled suppression of 53BP1 function during mitosis.

  10. Benzophenone 1 induced photogenotoxicity and apoptosis via release of cytochrome c and Smac/DIABLO at environmental UV radiation.

    Science.gov (United States)

    Amar, Saroj Kumar; Goyal, Shruti; Dubey, Divya; Srivastav, Ajeet K; Chopra, Deepti; Singh, Jyoti; Shankar, Jai; Chaturvedi, Rajnish K; Ray, Ratan Singh

    2015-12-15

    Solar UV radiation is main factor of photocarcinogenesis, photoageing, and phototoxicity; thus, protection from UV radiation is major concern. Sunscreens containing UV filters are suggested as sun safe practices, but safety of UV filters remains in controversies. Benzophenone-1 (BP1) is commonly used in sunscreens as UV blocker. We assessed the photogenotoxicity and apoptotic parameters in human keratinocytes (HaCaT cells) by western blot, immunocytochemistry, flowcytometry, comet assay and TEM imaging. Our results exposed that BP1 photosensitized and generated intracellular ROS (2.02 folds) under sunlight/UVR. Decrease in cell viability was recorded as 80.06%, 60.98% and 56.24% under sunlight, UVA and UVB, respectively. Genotoxic potential of BP1 was confirmed through photomicronuclei and CPDs formation. BP1 enhanced lipid peroxidation and leakage of LDH enzyme (61.7%). Apoptotic cells were detected by AnnexinV/PI staining and sub G1 population of cell cycle. BP1 induced up regulation of apoptotic proteins Bax/Bcl2 ratio, Apaf-1, cytochrome c, Smac/DIABLO and cleaved caspase 3 was noticed. Down regulation of pro caspase 3 was inhibited by Z-VAD-fmk (inhibitor of caspase). Thus, study established the involvement of BP1 in photogenotoxicity and apoptosis via release of cytochrome c and Smac/DIABLO. These findings suggest sunscreen user to avoid BP1 in cosmetics preparation for its topical application. Copyright © 2015 Elsevier Ireland Ltd. All rights reserved.

  11. Biochemical analysis of three putative KaiC clock proteins from Synechocystis sp. PCC 6803 suggests their functional divergence.

    Science.gov (United States)

    Wiegard, Anika; Dörrich, Anja K; Deinzer, Hans-Tobias; Beck, Christian; Wilde, Annegret; Holtzendorff, Julia; Axmann, Ilka M

    2013-05-01

    Cyanobacteria have been shown to have a circadian clock system that consists mainly of three protein components: KaiA, KaiB and KaiC. This system is well understood in the cyanobacterium Synechococcus elongatus PCC 7942, for which robust circadian oscillations have been shown. Like many other cyanobacteria, the chromosome of the model cyanobacterium Synechocystis sp. PCC 6803 contains additional kaiC and kaiB gene copies besides the standard kaiABC gene cluster. The respective gene products differ significantly in their amino acid sequences, especially in their C-terminal regions, suggesting different functional characteristics. Here, phosphorylation assays of the three Synechocystis sp. PCC 6803 KaiC proteins revealed that KaiC1 phosphorylation depends on KaiA, as is well documented for the Synechococcus elongatus PCC 7942 KaiC protein, whereas KaiC2 and KaiC3 autophosphorylate independently of KaiA. This was confirmed by in vivo protein-protein interaction studies, which demonstrate that only KaiC1 interacts with KaiA. Furthermore, we demonstrate that the three different Kai proteins form only homomeric complexes in vivo. As only KaiC1 phosphorylation depends on KaiA, a prerequisite for robust oscillations, we suggest that the kaiAB1C1 gene cluster in Synechocystis sp. PCC 6803 controls circadian timing in a manner similar to the clock described in Synechococcus elongatus PCC 7942.

  12. Investigating the Role of the Arabidopsis Homologue of the Human G3BP in RNA Metabolism, Cellular Stress Responses and Innate Immunity

    KAUST Repository

    Abulfaraj, Aala A.

    2018-04-01

    Mitogen-activated protein kinases (MAPKs) belong to the most conserved signaling pathways and are found in all eukaryotes, including humans where they play important roles in various diseases and cancer. Stimulation of this signal transduction pathway by microbe-associated molecular patterns (MAMP) results in a multitude of events to regulate innate immune responses in Arabidopsis thaliana stimulating large-scale changes in gene expression. Starting from a phosphoproteomic screen in Arabidopsis thaliana wild type and mpk3, mpk4 and mpk6 mutants following microbe-associated molecular pattern (MAMP) treatment, several novel chromatin-associated proteins were identified that are differentially phosphorylated by stress-induced protein kinases. Arabidopsis Ras GTPase-activating protein SH3-domain-binding protein (AtG3BP-1) is a downstream putative substrate of the MAMP-stimulated MAPK pathway that is phosphorylated by MPK3, 4 and 6 in in vitro kinase assays. AtG3BP1 belongs to a highly conserved family of RNA-binding proteins in eukaryotes that link kinase receptormediated signaling to RNA metabolism. Here, we report the characterization of the Arabidopsis homolog of human G3BP1 in plant innate immunity. AtG3BP1 negatively regulates plant immunity and defense immune responses. Atg3bp1 mutant lines show constitutive stomata closure, expression of a number of key defense marker genes, and accumulate salicylic acid but not jasmonic acid. Furthermore, Atg3bp1 plants exhibit enhanced resistance to the biotrophic pathogen Pseudomonas syringae pv. tomato. Pathogen resistance was mediated by stomatal and apoplastic immunity in Atg3bp1. More generally, our data reinforce that AtG3BP1 is a key mediator of plant defense responses and transient expression of AtG3BP1 delivered striking disease resistance in the absence of yield penalty, highlighting a potential application of this gene in crop protection.

  13. 2011 NASA Lunabotics Mining Competition for Universities: Results and Lessons Learned

    Science.gov (United States)

    Mueller, Robert P.; Murphy, Gloria A.

    2011-01-01

    Overview: Design, build & compete remote controlled robot (Lunabot). Excavate Black Point 1 (BP-1) Lunar Simulant. Deposit minimum of 10 kg of BP-1 within 15 minutes $5000, $2500, $1000 Scholarships for most BP-1 excavated. May 23-28, 2011. Kennedy Space Center, FL. International Teams Allowed for the First Time. What is a Lunabot? a) Robot Controlled Remotely or Autonomously. b) Visual and Auditory Isolation from Operator. c) Excavates Black Point 1 (BP-l) Simulant. d) Weight Limit - 80 kg. e)Dimension Limits -1.5m width x .75m length x 2m height. f) Designed, Built and Tested by University Student Teams.

  14. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Susan S. Golden

    2005-03-31

    The originally funded project was geared to pursue research on regulation of photosystem II (PSII) in the cyanobacterium Synechococcus elongatus PCC 7942. We characterized a locus, psfR, (psbA stimulating factor) that affects expression of the psbAI gene, which encodes the PSII protein D1. Over-expression of psfR, which encodes a protein with receiver and pseudo-receiver domains, acts at the promoter region to elevate expression of psbAI and a subset of other loci. We reoriented the remainder of the funding to make a greater impact through completion of a functional genomics project that had been initiated with funding from another agency. The goal is inactivation of each gene individually in the S. elongatus genome, and completion of the entire genome sequence. At the end of the project we will have screened all loci for involvement in circadian rhythms of gene expression and assembled an archived set of clones that can be used to create the mutations to screen for any other phenotype. During the project period we: (1) prepared a functional genomics website for S. elongatus PCC 7942 that posts sequences prior to GenBank release, and presents the strategy and progress for the genomics project (http://www.bio.tamu.edu/synecho/); (2) determined the sequence of and annotated the S. elongatus 46 kb plasmid, pANL; (3) submitted assembled sequences with annotation of 8 cosmid inserts to GenBank (313 kb), with sites of transposon insertions indicated; (4) mutagenized approximately an additional 600 kb of the genome (16 cosmids) and identified sequences flanking the mutations; (5) recombined mutagenesis substrates into the S. elongatus genome to produce gene inactivations (at the sites of transposon insertions) for approximately 415 kb of mutagenized sequence (85% of these have already been screened for circadian phenotypes) (6) identified the clpPIIclpX locus as important in determining circadian period; and (7) demonstrated effectiveness of antisense RNA for decreasing

  15. 16S rDNA-based analysis reveals cosmopolitan occurrence but limited diversity of two cyanobacterial lineages with contrasted patterns of intracellular carbonate mineralization

    Directory of Open Access Journals (Sweden)

    Marie eRagon

    2014-07-01

    Full Text Available Cyanobacteria are mainly thought to induce carbonate precipitation extracellularly via their photosynthetic activity combined with the nucleation potential of exopolymeric substances. The discovery in microbialites of the alkaline lake Alchichica (Mexico of Candidatus Gloeomargarita lithophora, a cyanobacterium forming large amounts of intracellular Mg-Ca-Sr-Ba carbonate spherules, showed that intracellular biomineralization in cyanobacteria is also possible. A second cyanobacterium isolated from the same environment, Candidatus Synechococcus calcipolaris G9, has been recently shown to also form intracellular calcium carbonates at the cell poles, a capability shared by all cultured species of the Thermosynechococcus clade, to which it belongs. To explore the diversity of these two distant cyanobacterial lineages representing two different patterns of intracellular calcification, we designed specific primers against their 16S rRNA genes and looked for their occurrence in a wide variety of samples. We identified the presence of members of the Gloeomargarita and Thermosynechococcus/S. calcipolaris lineages in microbialites collected from Lake Alchichica and three other neighboring Mexican lakes. The two clades also occurred in karstic areas and in some thermophilic or hypersaline microbial mats collected in South America and/or Southern Europe. Surprisingly, the within-group diversity in the two clades was low, especially within the S. calcipolaris clade, with all 16S rRNA gene sequences retrieved sharing more than 97% identity. This suggests that these clades are composed of a limited number of species with cosmopolitan distribution. Moreover, scanning electron microscopy coupled with energy dispersive x-ray spectrometry showed the presence of intracellularly calcifying Gloeomargarita-like cyanobacteria in fresh samples where this clade was relatively abundant, suggesting that these cyanobacteria do precipitate carbonates intracellularly under

  16. Activation of the ATR kinase by the RPA-binding protein ETAA1

    DEFF Research Database (Denmark)

    Haahr, Peter; Hoffmann, Saskia; Tollenaere, Maxim A X

    2016-01-01

    Activation of the ATR kinase following perturbations to DNA replication relies on a complex mechanism involving ATR recruitment to RPA-coated single-stranded DNA via its binding partner ATRIP and stimulation of ATR kinase activity by TopBP1. Here, we discovered an independent ATR activation pathway......, this requires a conserved domain in ETAA1 that potently and directly stimulates ATR kinase activity independently of TopBP1. Simultaneous loss of ETAA1 and TopBP1 gives rise to synthetic lethality characterized by massive genome instability and abrogation of ATR-dependent signalling. Our findings demonstrate...... that parallel TopBP1- and ETAA1-mediated pathways underlie ATR activation and that their combined action is essential for coping with replication stress....

  17. Characterization of a Novel Nuclear Hormone Receptor Coactivator, Uba3, and Its Function in Breast Cancer

    National Research Council Canada - National Science Library

    Dennis, Andrew

    2001-01-01

    .... Human Uba3, as well as its hetero-dimeric binding partner, APP-BP 1, were able to enhance ligand- activated ERoc, PR-B, GR, AR, TRBeta, and RARalpha-dependent transcription in HeLa cells, although...

  18. Characterization of a Novel Nuclear Hormone Receptor Coactivator, Uba3, and Its Function in Breast Cancer

    National Research Council Canada - National Science Library

    Dennis, Andrew

    2001-01-01

    .... Interestingly, hUba3 and APP-BP1 appear not to contain appreciable intrinsic activation functions nor demonstrate physical iii vitro associations with PR-B, suggesting these proteins may differ...

  19. Određivanje vrijednosti antigena buloznoga pemfigoida 1 i 2 za procjenu aktivnosti bolesti [Determination of antigen bulous pemphigoid 1 and 2 values for assessment of disease activity

    OpenAIRE

    Štulhofer Buzina, Daška

    2015-01-01

    Bullous pemphigoid (BP) is a subepidermal blistering disease, primarily affecting the elderly. This study aimed to assess the relationship between BP desease activity and serum levels of autoantibodies directed against BP antigen 1 and BP antigen 2 – detected by enzyme-linked immunosorbent assay (ELISA) BP 1 and BP 2 – and the titer of indirect immunofluorescence (IIF). Additionally, we analyzed whether age and gender moderated ELISA BP 1 and BP 2 desease monitoring. This re...

  20. A New Cell-Free System to Study BRCA1 Function

    Science.gov (United States)

    2016-06-01

    are BRCA1-dependent will be functionally characterized. For example, MCM2-7 with the ubiquitylation site(s) mutated to arginine will be expressed in...any) are functional for DNA replication. Once a functional MCM2-7 complex is obtained, we will mutate key lysine residues to identify those whose...resection by antagonizing 53BP1. More recently, they discovered that loss of 53BP1 does not rescue the ICL sensitivity observed in BRCA1-deficient cells

  1. Effect of dietary black pepper ( Piper nigrum ) on gut ecosystem and ...

    African Journals Online (AJOL)

    Effect of dietary black pepper (BP) on the digseta pH, viscosity, bacteria population, and blood profile of broilers was investigated. 150 Abor-acre day old chicks were used. Five diets (BP1-BP5) containing respectively 0.00, 0.25, 0.50, 0.75 and 1.0% BP were formulated. BP1 was the control containing no BP. Each treatment ...

  2. CDNA cloning, characterization and expression of an endosperm-specific barley peroxidase

    DEFF Research Database (Denmark)

    Rasmussen, Søren Kjærsgård; Welinder, K.G.; Hejgaard, J.

    1991-01-01

    A barley peroxidase (BP 1) of pI ca. 8.5 and M(r) 37000 has been purified from mature barley grains. Using antibodies towards peroxidase BP 1, a cDNA clone (pcR7) was isolated from cDNA expression library. The nucleotide sequence of pcR7 gave a derived amino acid sequence identical to the 158 C...

  3. Minimal tool set for a prokaryotic circadian clock.

    Science.gov (United States)

    Schmelling, Nicolas M; Lehmann, Robert; Chaudhury, Paushali; Beck, Christian; Albers, Sonja-Verena; Axmann, Ilka M; Wiegard, Anika

    2017-07-21

    Circadian clocks are found in organisms of almost all domains including photosynthetic Cyanobacteria, whereby large diversity exists within the protein components involved. In the model cyanobacterium Synechococcus elongatus PCC 7942 circadian rhythms are driven by a unique KaiABC protein clock, which is embedded in a network of input and output factors. Homologous proteins to the KaiABC clock have been observed in Bacteria and Archaea, where evidence for circadian behavior in these domains is accumulating. However, interaction and function of non-cyanobacterial Kai-proteins as well as homologous input and output components remain mainly unclear. Using a universal BLAST analyses, we identified putative KaiC-based timing systems in organisms outside as well as variations within Cyanobacteria. A systematic analyses of publicly available microarray data elucidated interesting variations in circadian gene expression between different cyanobacterial strains, which might be correlated to the diversity of genome encoded clock components. Based on statistical analyses of co-occurrences of the clock components homologous to Synechococcus elongatus PCC 7942, we propose putative networks of reduced and fully functional clock systems. Further, we studied KaiC sequence conservation to determine functionally important regions of diverged KaiC homologs. Biochemical characterization of exemplary cyanobacterial KaiC proteins as well as homologs from two thermophilic Archaea demonstrated that kinase activity is always present. However, a KaiA-mediated phosphorylation is only detectable in KaiC1 orthologs. Our analysis of 11,264 genomes clearly demonstrates that components of the Synechococcus elongatus PCC 7942 circadian clock are present in Bacteria and Archaea. However, all components are less abundant in other organisms than Cyanobacteria and KaiA, Pex, LdpA, and CdpA are only present in the latter. Thus, only reduced KaiBC-based or even simpler, solely KaiC-based timing systems

  4. Heterogeneous detection probabilities for imperiled Missouri River fishes: implications for large-river monitoring programs

    Science.gov (United States)

    Schloesser, J.T.; Paukert, Craig P.; Doyle, W.J.; Hill, Tracy D.; Steffensen, K.D.; Travnichek, Vincent H.

    2012-01-01

    Occupancy modeling was used to determine (1) if detection probabilities (p) for 7 regionally imperiled Missouri River fishes (Scaphirhynchus albus, Scaphirhynchus platorynchus, Cycleptus elongatus, Sander canadensis, Macrhybopsis aestivalis, Macrhybopsis gelida, and Macrhybopsis meeki) differed among gear types (i.e. stationary gill nets, drifted trammel nets, and otter trawls), and (2) how detection probabilities were affected by habitat (i.e. pool, bar, and open water), longitudinal position (five 189 to 367 rkm long segments), sampling year (2003 to 2006), and season (July 1 to October 30 and October 31 to June 30). Adult, large-bodied fishes were best detected with gill nets (p: 0.02–0.74), but most juvenile large-bodied and all small-bodied species were best detected with otter trawls (p: 0.02–0.58). Trammel nets may be a redundant sampling gear for imperiled fishes in the lower Missouri River because most species had greater detection probabilities with gill nets or otter trawls. Detection probabilities varied with river segment for S. platorynchus, C. elongatus, and all small-bodied fishes, suggesting that changes in habitat influenced gear efficiency or abundance changes among river segments. Detection probabilities varied by habitat for adult S. albus and S. canadensis, year for juvenile S. albus, C. elongatus, and S. canadensis, and season for adult S. albus. Concentrating sampling effort on gears with the greatest detection probabilities may increase species detections to better monitor a population's response to environmental change and the effects of management actions on large-river fishes.

  5. Inhibitory activities of microalgal extracts against Epstein-Barr Virus (EBV antigen expression in lymphoblastoid cells

    Directory of Open Access Journals (Sweden)

    Koh Yih Yih

    2014-01-01

    Full Text Available The inhibitory activities of microalgal extracts against the expression of three EBV antigens, latent membrane protein (LMP1, Epstein-Barr nuclear antigen (EBNA1 and Z Epstein-Barr reactivation activator (ZEBRA were assessed by immunocytochemistry. The observation that the methanol extracts and their fractions from Ankistrodesmus convolutus, Synechococcus elongatus and Spirulina platensis exhibited inhibitory activity against EBV proteins in three Burkitt’s lymphoma cell lines at concentrations as low as 20 μg/ml suggests that microalgae could be a potential source of antiviral compounds against EBV.

  6. Culturing photosynthetic bacteria through surface plasmon resonance

    Energy Technology Data Exchange (ETDEWEB)

    Ooms, Matthew D.; Bajin, Lauren; Sinton, David [Department of Mechanical and Industrial Engineering and Centre for Sustainable Energy, University of Toronto, Toronto M5S 3G8 (Canada)

    2012-12-17

    In this work, cultivation of photosynthetic microbes in surface plasmon enhanced evanescent fields is demonstrated. Proliferation of Synechococcus elongatus was obtained on gold surfaces excited with surface plasmons. Excitation over three days resulted in 10 {mu}m thick biofilms with maximum cell volume density of 20% vol/vol (2% more total accumulation than control experiments with direct light). Collectively, these results indicate the ability to (1) excite surface-bound cells using plasmonic light fields, and (2) subsequently grow thick biofilms by coupling light from the surface. Plasmonic light delivery presents opportunities for high-density optofluidic photobioreactors for microalgal analysis and solar fuel production.

  7. Culturing photosynthetic bacteria through surface plasmon resonance

    Science.gov (United States)

    Ooms, Matthew D.; Bajin, Lauren; Sinton, David

    2012-12-01

    In this work, cultivation of photosynthetic microbes in surface plasmon enhanced evanescent fields is demonstrated. Proliferation of Synechococcus elongatus was obtained on gold surfaces excited with surface plasmons. Excitation over three days resulted in 10 μm thick biofilms with maximum cell volume density of 20% vol/vol (2% more total accumulation than control experiments with direct light). Collectively, these results indicate the ability to (1) excite surface-bound cells using plasmonic light fields, and (2) subsequently grow thick biofilms by coupling light from the surface. Plasmonic light delivery presents opportunities for high-density optofluidic photobioreactors for microalgal analysis and solar fuel production.

  8. New case of long-term persistence of Paranosema locustae (Microsporidia) in melanopline grasshoppers (Orthoptera: Acrididae: Melanoplinae) of Argentina.

    Science.gov (United States)

    Lange, Carlos E; Azzaro, Francisco G

    2008-11-01

    We report an additional case of long-term persistence of Paranosema locustae in grasshoppers of Argentina. The pathogen was introduced from North America on rangeland at Loncopué, Neuquén province. Microsporidia were not detected in pre-introduction samples whereas infected grasshoppers were found 11 years after introduction. Affected grasshoppers were the melanoplines Dichroplus elongatus, Dichroplus maculipennis, and Scotussa lemniscata, some of them with high spore loads. The case highlights the ability of P. locustae to recycle in local grasshopper communities by parasitizing susceptible species other than the natural hosts.

  9. Molecular cloning and subcellular localization of Tektin2-binding protein 1 (Ccdc 172) in rat spermatozoa.

    Science.gov (United States)

    Yamaguchi, Airi; Kaneko, Takane; Inai, Tetsuichiro; Iida, Hiroshi

    2014-04-01

    Tektins (TEKTs) are composed of a family of filament-forming proteins localized in cilia and flagella. Five types of mammalian TEKTs have been reported, all of which have been verified to be present in sperm flagella. TEKT2, which is indispensable for sperm structure, mobility, and fertilization, was present at the periphery of the outer dense fiber (ODF) in the sperm flagella. By yeast two-hybrid screening, we intended to isolate flagellar proteins that could interact with TEKT2, which resulted in the isolation of novel two genes from the mouse testis library, referred as a TEKT2-binding protein 1 (TEKT2BP1) and -protein 2 (TEKT2BP2). In this study, we characterized TEKT2BP1, which is registered as a coiled-coil domain-containing protein 172 (Ccdc172) in the latest database. RT-PCR analysis indicated that TEKT2BP1 was predominantly expressed in rat testis and that its expression was increased after 3 weeks of postnatal development. Immunocytochemical studies discovered that TEKT2BP1 localized in the middle piece of rat spermatozoa, predominantly concentrated at the mitochondria sheath of the flagella. We hypothesize that the TEKT2-TEKT2BP1 complex might be involved in the structural linkage between the ODF and mitochondria in the middle piece of the sperm flagella.

  10. Loss of Expression of Human Spectrin Src Homology Domain Binding Protein 1 is Associated with 10p Loss in Human Prostatic Adenocarcinoma

    Directory of Open Access Journals (Sweden)

    Jill A. Macoska

    2001-01-01

    Full Text Available The gene encoding human spectrin Src homology domain binding protein 1, or Hssh3bpl, which is a marker of macropinocytic vesicles and a potential regulator of macropinocytosis, co-localizes to a YAC containing chromosome 10p sequences at loci D10S89 and D10S111 that are frequently deleted in prostate tumors. Expression of Hssh3bp1 was evaluated at the protein level in 17 paired normal and malignant prostate tumor samples using the monoclonal antibody 2G8 to Hssh3bpl. These experiments demonstrated that 4/6 tumors (67% with 10p deletion failed to express Hssh3bp1 protein compared to 5/11 (46% tumors with intact 10p. Thus, loss of Hssh3bp1 expression is concordant with allelic loss of adjacent 10p sequences in human prostate tumors. In addition, two prostate tumor cell lines contain an exon skipping mutation in the Hssh3bp1 gene that leads to the abnormal splicing of the mRNA and loss of a portion of Abl tyrosine kinase SH3 domain binding site in the protein. These data are consistent with a role for Hssh3bp1 as a candidate tumor suppressor gene inactivated during prostate tumorigenesis.

  11. DNA Repair Network Analysis Reveals Shieldin as a Key Regulator of NHEJ and PARP Inhibitor Sensitivity

    DEFF Research Database (Denmark)

    Gupta, Rajat; Somyajit, Kumar; Narita, Takeo

    2018-01-01

    -switch recombination (CSR), and fusion of unprotected telomeres. Shieldin functions as a downstream effector of 53BP1-RIF1 in restraining DNA end resection and in sensitizing BRCA1-deficient cells to PARP inhibitors. These findings have implications for understanding cancer-associated PARPi resistance...... expressed DNA repair factors 53BP1, BRCA1, and MDC1. Our spatially resolved interaction maps reveal rich network intricacies, identify shared and bait-specific interaction modules, and implicate previously concealed regulators in this process. We identified a novel vertebrate-specific protein complex......, shieldin, comprising REV7 plus three previously uncharacterized proteins, RINN1 (CTC-534A2.2), RINN2 (FAM35A), and RINN3 (C20ORF196). Recruitment of shieldin to DSBs, via the ATM-RNF8-RNF168-53BP1-RIF1 axis, promotes NHEJ-dependent repair of intrachromosomal breaks, immunoglobulin class...

  12. International Conference on Nitride Semiconductors (10th) Held in Washington, DC on August 25-30, 2013

    Science.gov (United States)

    2014-08-17

    Vescan 11:45 am-12:00 pm Ye Shao 12:00 pm-12:15 pm Edwin W. Lee 12:15 pm-12:30 pm POSTER SESSION 1 Potomoc C/D AND 1-6 1:00 pm-2:30 pm >» A...Bruckbauer BP1.45 XueWang BP1.46 Danny Sutherland BP1.47 MunsikOh C; OPTICAL DEVICES, UV PAPER # PRESENTER CP1.01 CP1.02 CP1.03 CP1.04 CP1.05...Hu Liang Peter Parbrook Tobias Meisch Danny Sutherland Takumi Hatakeyama Arata Watanabe Takuji Arauchi Juan G. Lozano R. Radhakrishnan

  13. Fragmentation of Pb-Projectiles at SPS Energies

    CERN Multimedia

    2002-01-01

    % EMU17 \\\\ \\\\ We have exposed stacks consisting of solid state nuclear track detectors (CR-39 plastic and BP-1 glass) and different target materials at the SPS to beams of Pb projectiles. Our detectors record tracks of relativistic nuclei with charge numbers of Z~$\\geq$~6 for CR-39 and Z~$\\geq$75 for BP-1. After development of the tracks by etching they are detected and measured using completely automated microscope systems. Thus experiments with high statistics are possible. \\\\ \\\\BP-1 detectors were exposed to measure total charge changing cross sections and elemental production cross sections for heavy projectile fragments. These experiments were performed for different targets CH$ _{2} $, C, Al, Cu, Ag and Pb. Comparison of the results for different targets allows to investigate contributions to charge changing reactions by electromagnetic dissociation. Multifragmentation events in which several intermediate mass fragments are emitted from the heavy Pb projectile are studied using stacks containing CR-39 d...

  14. Improved Free Fatty Acid Production in Cyanobacteria with Synechococcus sp. PCC 7002 as Host.

    Science.gov (United States)

    Ruffing, Anne M

    2014-01-01

    Microbial free fatty acids (FFAs) have been proposed as a potential feedstock for renewable energy. The ability to directly convert carbon dioxide into FFAs makes cyanobacteria ideal hosts for renewable FFA production. Previous metabolic engineering efforts using the cyanobacterial hosts Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942 have demonstrated this direct conversion of carbon dioxide into FFAs; however, FFA yields in these hosts are limited by the negative impact of FFA production on the host cell physiology. This work investigates the use of Synechococcus sp. PCC 7002 as a cyanobacterial host for FFA production. In comparison to S. elongatus PCC 7942, Synechococcus sp. PCC 7002 strains produced and excreted FFAs at similar concentrations but without the detrimental effects on host physiology. The enhanced tolerance to FFA production with Synechococcus sp. PCC 7002 was found to be temperature-dependent, with physiological effects such as reduced photosynthetic yield and decreased photosynthetic pigments observed at higher temperatures. Additional genetic manipulations were targeted for increased FFA production, including thioesterases and ribulose-1,5-bisphosphate carboxylase/oxygenase (RuBisCO). Overexpression of non-native RuBisCO subunits (rbcLS) from a psbAI promoter resulted in more than a threefold increase in FFA production, with excreted FFA concentrations reaching >130 mg/L. This work illustrates the importance of host strain selection for cyanobacterial biofuel production and demonstrates that the FFA tolerance of Synechococcus sp. PCC 7002 can allow for high yields of excreted FFA.

  15. Dispensability of a sulfolipid for photoautotrophic cell growth and photosynthesis in a marine cyanobacterium, Synechococcus sp. PCC 7002.

    Science.gov (United States)

    Sato, Norihiro; Kamimura, Ryohei; Tsuzuki, Mikio

    2016-09-02

    Sulfoquinovosyl diacylglycerol, which mainly comprises thylakoid membranes in oxygenic photosynthetic organisms, plays species-dependent roles in freshwater microbes. In this study, a sulfoquinovosyl-diacylglycerol deficient mutant was generated in a cyanobacterium, Synechococcus sp. PCC 7002, for the first time among marine microbes to gain more insight into its physiological significance. The mutation had little deleterious impact on photoautotrophic cell growth, and functional and structural properties of the photosystem II complex. These findings were similar to previous observations for a freshwater cyanobacterium, Synechococcus elongatus PCC 7942, but were distinct from those for another freshwater cyanobacterium, Synechocystis sp. PCC 6803, and a green alga, Chlamydomonas reinhardtii, both of which require sulfoquinovosyl diacylglycerol for cell growth and/or photosystem II. Therefore, the functionality of PSII to dispense with sulfoquinovosyl diacylglycerol in Synechococcus sp. PCC 7002, similar to that in Synechococcus elongatus PCC 7942, seemed to have been excluded from the evolution of the PSII complex from cyanobacteria to green algal chloroplasts. Meanwhile, sulfoquinovosyl diacylglycerol was found to contribute to photoheterotrophic growth of Synechococcus sp. PCC 7002, which revealed a novel species-dependent strategy for utilizing SQDG in physiological processes. Copyright © 2016 Elsevier Inc. All rights reserved.

  16. FLAVODIIRON2 and FLAVODIIRON4 Proteins Mediate an Oxygen-Dependent Alternative Electron Flow in Synechocystis sp. PCC 6803 under CO2-Limited Conditions1[OPEN

    Science.gov (United States)

    Shimakawa, Ginga; Shaku, Keiichiro; Nishi, Akiko; Hayashi, Ryosuke; Yamamoto, Hiroshi; Sakamoto, Katsuhiko; Makino, Amane; Miyake, Chikahiro

    2015-01-01

    This study aims to elucidate the molecular mechanism of an alternative electron flow (AEF) functioning under suppressed (CO2-limited) photosynthesis in the cyanobacterium Synechocystis sp. PCC 6803. Photosynthetic linear electron flow, evaluated as the quantum yield of photosystem II [Y(II)], reaches a maximum shortly after the onset of actinic illumination. Thereafter, Y(II) transiently decreases concomitantly with a decrease in the photosynthetic oxygen evolution rate and then recovers to a rate that is close to the initial maximum. These results show that CO2 limitation suppresses photosynthesis and induces AEF. In contrast to the wild type, Synechocystis sp. PCC 6803 mutants deficient in the genes encoding FLAVODIIRON2 (FLV2) and FLV4 proteins show no recovery of Y(II) after prolonged illumination. However, Synechocystis sp. PCC 6803 mutants deficient in genes encoding proteins functioning in photorespiration show AEF activity similar to the wild type. In contrast to Synechocystis sp. PCC 6803, the cyanobacterium Synechococcus elongatus PCC 7942 has no FLV proteins with high homology to FLV2 and FLV4 in Synechocystis sp. PCC 6803. This lack of FLV2/4 may explain why AEF is not induced under CO2-limited photosynthesis in S. elongatus PCC 7942. As the glutathione S-transferase fusion protein overexpressed in Escherichia coli exhibits NADH-dependent oxygen reduction to water, we suggest that FLV2 and FLV4 mediate oxygen-dependent AEF in Synechocystis sp. PCC 6803 when electron acceptors such as CO2 are not available. PMID:25540330

  17. ¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez?

    Directory of Open Access Journals (Sweden)

    Daniel SCUFFI

    2012-01-01

    Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.

  18. Towards a synthetic chloroplast.

    Directory of Open Access Journals (Sweden)

    Christina M Agapakis

    2011-04-01

    Full Text Available The evolution of eukaryotic cells is widely agreed to have proceeded through a series of endosymbiotic events between larger cells and proteobacteria or cyanobacteria, leading to the formation of mitochondria or chloroplasts, respectively. Engineered endosymbiotic relationships between different species of cells are a valuable tool for synthetic biology, where engineered pathways based on two species could take advantage of the unique abilities of each mutualistic partner.We explored the possibility of using the photosynthetic bacterium Synechococcus elongatus PCC 7942 as a platform for studying evolutionary dynamics and for designing two-species synthetic biological systems. We observed that the cyanobacteria were relatively harmless to eukaryotic host cells compared to Escherichia coli when injected into the embryos of zebrafish, Danio rerio, or taken up by mammalian macrophages. In addition, when engineered with invasin from Yersinia pestis and listeriolysin O from Listeria monocytogenes, S. elongatus was able to invade cultured mammalian cells and divide inside macrophages.Our results show that it is possible to engineer photosynthetic bacteria to invade the cytoplasm of mammalian cells for further engineering and applications in synthetic biology. Engineered invasive but non-pathogenic or immunogenic photosynthetic bacteria have great potential as synthetic biological devices.

  19. Presence Tendency of Fish Species in Yatsu Paddy Field and Characterization for Indicator Species

    Science.gov (United States)

    Takemura, Takeshi; Koizumi, Noriyuki; Mizutani, Masakazu; Mori, Atsushi; Watabe, Keiji; Nishida, Kazuya

    We analyzed presence tendency of fish species covering the result of surveys which had been performed every month for two years in Yatsu paddy fields, Chiba prefecture. In the result, there were 13 fish species and the number of loach, Misgurnus anguillicaudatus, was about 3/4 of the total number of all species. To analyze tendency of presence of fish species, we applied 3 methods. A few species stood out in the results from all 3 methods. We compared the environmental properties of the canals that these notable species represented with the properties of the other canals, or, the properties of canals in which those species were present with the properties of the other canals. At the result, in our target area, the analysis suggested that presence of many numbers of field gudgeon, Gnathopogon elongatus elongatus, would indicate higher possibility other species would be present and there would be better balanced species composition. And presence of field gudgeon would indicate a more suitable environment for not only field gudgeon but also other species would exist in the reach.

  20. Microchip capillary electrophoresis-based genetic comparison of closely related cyathostomin nematode parasites of horses using randomly amplified polymorphic DNA polymerase chain reaction.

    Science.gov (United States)

    Posedi, Janez; Drögemüller, Michaela; Schnieder, Thomas; Höglund, Johan; Lichtenfels, J Ralph; von Samson-Himmelstjerna, Georg

    2004-03-01

    The microchip-based capillary electrophoresis technology represents a valuable recent development for the analysis of complex DNA banding patterns. We have used this technology for the differentiation of the closely related cyathostomin species Cylicocyclus elongatus and C. insigne from the horse. We found that the Agilent 2100 bioanalyser in combination with the DNA 7500 Lab Chip were suited to perform a phylogenetic DNA fingerprinting analysis of the parasite species studied. The analysis of the electrophoretic data was optimised and it was possible to resolve a phylogenetic tree where all 12 individual worms of the two Cylicocyclus species studied were assigned to their species as determined by microscopic identification based on morphological traits. Thus, our data indicated that the procedure described here provides an additional powerful tool that can be employed for species delineation of closely related strains or species, such as the two taxa of Cylicocyclus investigated in the present study. Furthermore, by determining the second internal transcribed spacer region of three and nine individual worms for C. elongatus and C. insigne, respectively, low intraspecific variations of only up to 0.3% were demonstrated.

  1. Caracterización de las comunidades de acridios (Orthoptera: Acridoidea del partido de Benito Juárez, sudeste de la provincia de Buenos Aires, Argentina Grasshopper (Orthoptera: Acridoidea community structure in Benito Juárez county, in outhern Buenos Aires province, Argentina

    Directory of Open Access Journals (Sweden)

    María Laura de Wysiecki

    2004-12-01

    Full Text Available Se analizó la riqueza, densidad, constancia y distribución de especies de acridios, en distintas comunidades vegetales (1997-2002 en el partido de Benito Juárez, sudeste de la provincia de Buenos Aires. Las comunidades vegetales se categorizaron en pastizales nativos, comunidades halófilas, pasturas sin disturbio, pasturas con moderado disturbio y pasturas con alto disturbio. En total se registraron 23 especies de acridios. Los melanoplinos dominaron en casi todas las comunidades vegetales, excepto en las halófilas que se caracterizaron por la presencia de un acridino, Covasacris pallidinota (Bruner. La riqueza de especies promedio por sitio por año, varió entre 2,10 ± 0,60 especies en las pasturas con moderado disturbio y 6,20 ± 0,58 especies en las comunidades halófilas. La riqueza de especies acumulada fue de 17 en los pastizales nativos, 14 en las comunidades halófilas, 19 en las pasturas sin disturbio, 18 en las pasturas con moderado disturbio y 14 en las pasturas con alto disturbio. La densidad promedio de acridios fue máxima en el 2001 y 2002. Dichroplus pratensis Bruner y Dichroplus elongatus Giglio-Tos dominaron en los pastizales nativos y en las pasturas con alto disturbio, C. pallidinota en las comunidades halófilas, D. elongatus y Scotussa lemniscata (Stål en las pasturas sin disturbio y en las pasturas con moderado disturbio. La estructura taxonómica de las comunidades de acridios fue constante en los pastizales nativos, las comunidades halófilas y las pasturas. Hubo pocas especies de amplia distribución e intermedias y las raras fueron las más numerosas. De las 23 especies registradas en todos los sitios, D. elongatus fue la única de amplia distribución. Históricamente, para la zona de estudio, Dichroplus maculipennis (Blanch fue señalada como la especie dominante. Sin embargo, nuestros resultados sugieren que en la actualidad la especie dominante es D. elongatus. Si bien resulta imposible conocer las causas

  2. Genetic diversity of pacu and piapara broodstocks in restocking programs in the rivers Paraná and Paranapanema (Brazil

    Directory of Open Access Journals (Sweden)

    Nelson Mauricio Lopera-Barrero

    2016-09-01

    Full Text Available The genetic diversity of Piaractus mesopotamicus (pacu and Leporinus elongatus (piapara broodstocks used in restocking programs in the rivers Paraná and Paranapanema is analyzed. One hundred and twenty specimens (two broodstocks of each species from fish ponds in Palotina PR Brazil and in Salto Grande SP Brazil were assessed. Ten primers produced 96 fragments, comprising 68 (70.83% and 94 (97.92% polymorphic fragments for P. mesopotamicus and L. elongatus broodstocks, respectively. Differences (p < 0.05 in the frequency of 15 and 27 fragments were detected for each species, without exclusive fragments. Shannon Index (0.347 - 0.572 and the percentage of polymorphic fragments (57.3% - 94.8% revealed high intra-population genetic variability for all broodstocks. Results of molecular variance analyses (AMOVA showed that most variations do not lie between the broodstocks but within each broodstock (89%. Genetic (0.088 and 0.142 and identity (0.916 and 0.868 distance rates demonstrated similarity between the broodstocks of each species, corroborated by Fst (0.1023 and 010.27 and Nm (4.18 and 4.33 rates, with a slight genetic difference due to genic flux. High intrapopulation genetic variability and similarity between the broodstocks of each species was also detected, proving a common ancestry.

  3. Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae Actividad reproductiva en tres especies simpátricas del género Liolaemus (Reptilia: Sauria: Tropiduridae

    Directory of Open Access Journals (Sweden)

    Ramírez Pinilla Martha Patricia

    1992-09-01

    Full Text Available Sympatric species Liolaemus bibroni (oviparous, Liolaemus elongatus and Liolaemus ruibali (viviparous have partial fall reproductive activity for males and females. Males are reproductively active between fall and spring, females are vitellogenic especially during this season, they are gravid in spring and the oviposition/parturition occur at the end of spring and early summer. Reproductive cycles of males and females have not a long rest phase, and apparently are continuous. The incidence of  environmental and endogenous factors over the partial fall reproductive pattern in Liolaemus species is discussed. Machos y hembras de las especies simpátricas Liolaemus bibroni (ovípara, Liolaemus elongatus y Liolaemus ruibali (vivíparas tienen actividad reproductiva parcial de otoño. Los machos son reproductivos entre otoño y primavera, período en el que las hembras son vitelogénicas; las hembras están grávidas en primavera y el parto/oviposición sucede al final de esta estación y verano temprano. Los ciclos reproductivos de machos y hembras no tienen un período de receso prolongado, y tienden a ser continuos. Se discute la incidencia de factores ambientales y endógenos en el patrón reproductivo parcial de otoño en especies de Liolaemus.

  4. Mechanisms of Resistance to Chemotherapies Targeting BRCA-Mutant Breast Cancer

    Science.gov (United States)

    2016-12-01

    a RING domain E3-ubiquitin ligase or 53BP1 impacted physiological NHEJ, such as immunoglobulin class switch recombination (CSR), versus mutagenic...expression of RNF168 and 53BP1 increases mutagenic but not physiological non-homologous end joining’. Zong D , Callén E, Pegoraro G, Lukas C, Lukas J...S, Day A, Crespo AV, Shen B, Starnes LM, de Ruiter JR, Daniel JA, Konstantinopoulos PA, Cortez D , Cantor SB, Fernandez-Capetillo O, Ge K, Jonkers J

  5. Polymorphism of felodipine co-crystals with 4,4'-bipyridine

    DEFF Research Database (Denmark)

    Surov, Artem Olegovich; Solanko, Katarzyna A.; Bond, Andrew

    2014-01-01

    The calcium-channel blocking agent felodipine (Fel) forms co-crystals with 4,4′-bipyridine (BP) with 1:1 and 2:1 molar ratios. The [Fel + BP] (1:1) co-crystal exists in two polymorphic forms. Differential scanning calorimetry and solution calorimetry show that form I of the [Fel + BP] (1:1) co......-crystal is the most thermodynamically stable phase. The difference in the crystal lattice energies between different polymorphs of the co-crystal is found to be comparable with that between the polymorphic forms of pure felodipine. The enthalpies of formation of the co-crystals are small, which indicates...

  6. The Mechanism of Action of Unique Small Molecules that Inhibit the Pim Protein Kinase Blocking Prostate Cancer Cell Growth

    Science.gov (United States)

    2010-05-01

    Supplementary Meth - ods. Methods for the 7-Methyl-GTP cap binding assay and 35S-methinone incorporation were reported previously (12) and are further...mimicking the effects of growth factorwithdrawal.Mcl-1 levels are also controlled by an interaction with Mule /ARF-BP1 E3 ubiquitin ligase (44) and this...749–60. 44. Zhong Q, Gao W, Du F, Wang X. Mule /ARF-BP1, a BH3-only E3 ubiquitin ligase, catalyzes the polyubiquitination of Mcl-1 and regu- lates

  7. Molecular cloning and preliminary function study of iron responsive element binding protein 1 gene from cypermethrin-resistant Culex pipiens pallens

    Directory of Open Access Journals (Sweden)

    Tan Wenbin

    2011-11-01

    Full Text Available Abstract Background Insecticide resistance jeopardizes the control of mosquito populations and mosquito-borne disease control, which creates a major public health concern. Two-dimensional electrophoresis identified one protein segment with high sequence homology to part of Aedes aegypti iron-responsive element binding protein (IRE-BP. Method RT-PCR and RACE (rapid amplification of cDNA end were used to clone a cDNA encoding full length IRE-BP 1. Real-time quantitative RT-PCR was used to evaluate the transcriptional level changes in the Cr-IRE strain Aedes aegypti compared to the susceptible strain of Cx. pipiens pallens. The expression profile of the gene was established in the mosquito life cycle. Methyl tritiated thymidine (3H-TdR was used to observe the cypermethrin resistance changes in C6/36 cells containing the stably transfected IRE-BP 1 gene of Cx. pipiens pallens. Results The complete sequence of iron responsive element binding protein 1 (IRE-BP 1 has been cloned from the cypermethrin-resistant strain of Culex pipiens pallens (Cr-IRE strain. Quantitative RT-PCR analysis indicated that the IRE-BP 1 transcription level was 6.7 times higher in the Cr-IRE strain than in the susceptible strain of 4th instar larvae. The IRE-BP 1 expression was also found to be consistently higher throughout the life cycle of the Cr-IRE strain. A protein of predicted size 109.4 kDa has been detected by Western blotting in IRE-BP 1-transfected mosquito C6/36 cells. These IRE-BP 1-transfected cells also showed enhanced cypermethrin resistance compared to null-transfected or plasmid vector-transfected cells as determined by 3H-TdR incorporation. Conclusion IRE-BP 1 is expressed at higher levels in the Cr-IRE strain, and may confer some insecticide resistance in Cx. pipiens pallens.

  8. g-Anisotropy of the S2-state manganese cluster in single crystals of cyanobacterial photosystem II studied by W-band electron paramagnetic resonance spectroscopy.

    Science.gov (United States)

    Matsuoka, Hideto; Furukawa, Ko; Kato, Tatsuhisa; Mino, Hiroyuki; Shen, Jian-Ren; Kawamori, Asako

    2006-07-06

    The multiline signal from the S2-state manganese cluster in the oxygen evolving complex of photosystem II (PSII) was observed in single crystals of a thermophilic cyanobacterium Thermosynechococcus vulcanus for the first time by W-band (94 GHz) electron paramagnetic resonance (EPR). At W-band, spectra were characterized by the g-anisotropy, which enabled the precise determination of the tensor. Distinct hyperfine splittings (hfs's) as seen in frozen solutions of PSII at X-band (9.5 GHz) were detected in most of the crystal orientations relative to the magnetic field. In some orientations, however, the hfs's disappeared due to overlapping of a large number of EPR lines from eight crystallographic symmetry-related sites of the manganese cluster within the unit cell of the crystal. Analysis of the orientation-dependent spectral features yielded the following g-tensor components: g(x) = 1.988, g(y) = 1.981, g(z) = 1.965. The principal values suggested an approximate axial symmetry around the Mn(III) ion in the cluster.

  9. Premalignant Genetic and Epigenetic Alterations in Tubal Epithelium from Women with BRCA1 Mutations

    Science.gov (United States)

    2011-10-01

    SUBJECT TERMS 16. SECURITY CLASSIFICATION OF: 17. LIMITATION OF ABSTRACT 18. NUMBER OF PAGES 19a. NAME OF RESPONSIBLE PERSON USAMRMC a...NHLRC1 and IGF2BP1) to search lymphoblastoid cell lines (LCLs) derived from a pedigree from the Center d’Etude du Polymorphisme Humaine (CEPH) for SNPs

  10. Presence of benzophenones commonly used as UV filters and absorbers in paired maternal and fetal samples

    DEFF Research Database (Denmark)

    Krause, M; Frederiksen, H; Sundberg, K

    2018-01-01

    cordocentesis: and cord blood (n=23) obtained at delivery, both with paired maternal samples of serum and urine collected simultaneously, were used. All biological samples were analyzed by TurboFlow-liquid chromatography - tandem mass spectrometry for seven different benzophenones. RESULTS: Benzophenone-1 (BP-1...... of these compounds in order for better assessment of the risk to the developing fetus....

  11. Metabolic Reprogramming Regulates the Proliferative and Inflammatory Phenotype of Adventitial Fibroblasts in Pulmonary Hypertension Through the Transcriptional Corepressor C-Terminal Binding Protein-1

    Czech Academy of Sciences Publication Activity Database

    Li, M.; Riddle, S.; Zhang, H.; D'Alessandro, A.; Flockton, A.; Serkova, N. J.; Hansen, K. C.; Moldvan, R.; McKeon, B. A.; Frid, M.; Kumar, S.; Li, H.; Liu, H.; Canovas, A.; Medrano, J. F.; Thomas, M. G.; Iloska, D.; Plecitá-Hlavatá, Lydie; Ježek, Petr; Pullamsetti, S.; Fini, M. A.; El Kasmi, K. C.; Zhang, Q. H.; Stenmark, K. R.

    2016-01-01

    Roč. 134, č. 15 (2016), s. 1105-1121 ISSN 0009-7322 R&D Projects: GA MŠk(CZ) LH11055; GA MŠk(CZ) LH15071 Institutional support: RVO:67985823 Keywords : arterial fibroblasts * pulmonary hypertension * metabolism * CtBP1 Subject RIV: ED - Physiology Impact factor: 19.309, year: 2016

  12. Antenna coupling study for ICWC plasma characterization in TEXTOR

    Indian Academy of Sciences (India)

    2013-01-06

    Jan 6, 2013 ... factory antenna coupling in the mode conversion scenario along with reproducible generation of. ICRF plasmas .... on the determination of the standing wave pattern in the transmission lines between the. ICRH generator ... and rotating poloidal Bp = 1 mT/1–10 Hz (resultant of vertical and radial oscillating.

  13. Crystal structure of the G3BP2 NTF2-like domain in complex with a canonical FGDF motif peptide

    DEFF Research Database (Denmark)

    Kristensen, Ole

    2015-01-01

    -terminal domains of the G3BP1 and Rasputin proteins. Recently, a subset of G3BP interacting proteins was recognized to share a common sequence motif, FGDF. The most studied binding partners, USP10 and viral nsP3, interfere with essential G3BP functions related to assembly of cellular stress granules. Reported...

  14. The AKT-mTOR signalling pathway in kidney cancer tissues

    Science.gov (United States)

    Spirina, L. V.; Usynin, Y. A.; Kondakova, I. V.; Yurmazov, Z. A.; Slonimskaya, E. M.; Kolegova, E. S.

    2015-11-01

    An increased expression of phospho-AKT, m-TOR, glycogen regulator GSK-3-beta and transcription inhibitor 4E-BP1 was observed in kidney cancer tissues. Tumor size growth was associated with a high level of c-Raf and low content of phospho-m-TOR. Cancer metastasis development led to a decreased PTEN and phospho-AKT expression.

  15. 75 FR 67985 - Government-Owned Inventions; Availability for Licensing

    Science.gov (United States)

    2010-11-04

    ..., additional data suggests a possible role for the alteration in neurological diseases such as autism, [[Page... prognosis of diseases associated with chromosomal disruptions of the ataxin-2 binding protein 1 (A2BP1 or... frequently over-activated in human cancers, including colon, gastric, breast, lung, thyroid and renal...

  16. Effects of 2 weeks lower limb immobilization and two separate rehabilitation regimens on gastrocnemius muscle protein turnover signaling and normalization genes

    DEFF Research Database (Denmark)

    Nedergaard, Anders; Jespersen, Jakob G; Pingel, Jessica

    2012-01-01

    of resistance training and continued protein/carbohydrate supplementation (Study 2). We obtained muscle biopsies from the medial gastrocnemius prior to immobilization (PRE), post-immobilization (IMMO) and post-rehabilitation (REHAB) and measured protein expression and phosphorylation of Akt, mTOR, S6k, 4E-BP1...

  17. La-related protein 1 (LARP1) represses terminal oligopyrimidine (TOP) mRNA translation downstream of mTOR complex 1 (mTORC1)

    DEFF Research Database (Denmark)

    Fonseca, Bruno; Zakaria, Chadi; Jia, J J

    2015-01-01

    The mammalian target of rapamycin complex 1 (mTORC1) is a critical regulator of protein synthesis. The best studied targets of mTORC1 in translation are the eukaryotic initiation factor-binding protein 1 (4E-BP1) and ribosomal protein S6 kinase 1 (S6K1). In this study, we identify the La-related ...

  18. A Common CYFIP1 Variant at the 15q11.2 Disease Locus Is Associated with Structural Variation at the Language-Related Left Supramarginal Gyrus

    NARCIS (Netherlands)

    Woo, Y.J.; Wang, T.; Guadalupe, T.M.; Nebel, R.A.; Vino, A.; Bene, V.A. Del; Molholm, S.; Ross, L.A.; Zwiers, M.P.; Fisher, S.E.; Foxe, J.J.; Abrahams, B.S.

    2016-01-01

    Copy number variants (CNVs) at the Breakpoint 1 to Breakpoint 2 region at 15q11.2 (BP1-2) are associated with language-related difficulties and increased risk for developmental disorders in which language is compromised. Towards underlying mechanisms, we investigated relationships between single

  19. A Role for BLM in Double-Strand Break Repair Pathway Choice: Prevention of CtIP/Mre11-Mediated Alternative Nonhomologous End-Joining

    Directory of Open Access Journals (Sweden)

    Anastazja Grabarz

    2013-10-01

    Full Text Available The choice of the appropriate double-strand break (DSB repair pathway is essential for the maintenance of genomic stability. Here, we show that the Bloom syndrome gene product, BLM, counteracts CtIP/MRE11-dependent long-range deletions (>200 bp generated by alternative end-joining (A-EJ. BLM represses A-EJ in an epistatic manner with 53BP1 and RIF1 and is required for ionizing-radiation-induced 53BP1 focus assembly. Conversely, in the absence of 53BP1 or RIF1, BLM promotes formation of A-EJ long deletions, consistent with a role for BLM in DSB end resection. These data highlight a dual role for BLM that influences the DSB repair pathway choice: (1 protection against CtIP/MRE11 long-range deletions associated with A-EJ and (2 promotion of DNA resection. These antagonist roles can be regulated, according to cell-cycle stage, by interacting partners such as 53BP1 and TopIII, to avoid unscheduled resection that might jeopardize genome integrity.

  20. Polo-like kinase 1 inhibits DNA damage response during mitosis

    Czech Academy of Sciences Publication Activity Database

    Benada, Jan; Burdová, Kamila; Liďák, Tomáš; von Morgen, Patrick; Macůrek, Libor

    2015-01-01

    Roč. 14, č. 2 (2015), s. 219-231 ISSN 1538-4101 R&D Projects: GA ČR GAP305/12/2485; GA MŠk LO1220 Institutional support: RVO:68378050 Keywords : 53BP1 * DNA damage response * Polo like kinase 1 Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 3.952, year: 2015

  1. Behaviour of bipolar membranes at high current density. Water diffusion limitation

    NARCIS (Netherlands)

    Krol, J.J.; Jansink, M.G.J.; Wessling, Matthias; Strathmann, H.

    1998-01-01

    In this paper the behaviour of bipolar membranes at very high current density is discussed. Current–voltage curves are determined, both for the Tokuyama Soda BP-1 and the WSI Technologies bipolar membrane. The current–voltage curves are characterised by an inflection point at which a drastic

  2. Benzophenone-type UV filters in urine and blood from children, adults, and pregnant women in China: Partitioning between blood and urine as well as maternal and fetal cord blood

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Tao; Sun, Hongwen; Qin, Xiaolei [College of Environmental Sciences and Engineering, Ministry of Education Key Laboratory of Pollution Processes and Environmental Criteria, Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Wu, Qian [Wadsworth Center, New York State Department of Health, Albany, NY 12201 (United States); Department of Environmental Health Sciences, School of Public Health, State University of New York at Albany, Albany, NY 12201 (United States); Zhang, Yanfeng [College of Environmental Sciences and Engineering, Ministry of Education Key Laboratory of Pollution Processes and Environmental Criteria, Tianjin Key Laboratory of Environmental Remediation and Pollution Control, Nankai University, Tianjin 300071 (China); Ma, Jing [Applied Radiation Institute, School of Environmental and Chemical Engineering, Shanghai University, 99 Shangda Road, P.O. Box 144, Shanghai 200444 (China); Kannan, Kurunthachalam, E-mail: kkannan@wadsworth.org [Wadsworth Center, New York State Department of Health, Albany, NY 12201 (United States); Department of Environmental Health Sciences, School of Public Health, State University of New York at Albany, Albany, NY 12201 (United States); International Joint Research Center for Persistent Toxic Substances, State Key Laboratory of Urban Water Resource and Environment, Harbin Institute of Technology, Harbin 150090 (China)

    2013-09-01

    Limited information exists on the exposure of benzophenone (BP)-type UV filters (i.e., sunscreen compounds) in children, adults, and pregnant women in China. In this study, we determined the concentrations of five BP derivatives, BP-1, BP-2, BP-3, BP-8, and 4OH-BP in urine (n = 101) as well as paired specimens of blood and urine (n = 24 pairs) collected from adults; in matched maternal and fetal cord blood (n = 20 pairs) collected from pregnant women; and in blood collected from children (n = 10). 4OH-BP, BP-1, and BP-3 were found in 61%, 57%, and 25%, respectively, of the urine samples analyzed. 4OH-BP was found in all blood samples; BP-3 was found more frequently in the blood of adults (83%), followed, in decreasing order, by pregnant women (35%) and children (30%). Among all adults, urinary BP-3 concentrations were significantly (p < 0.001) positively correlated with urinary BP-1 concentrations. Nevertheless, no significant correlations were found between urinary concentrations of BP-3 (or BP-1) and 4OH-BP. Our results suggest that human exposure to BP-3 and BP-1 is related, whereas 4OH-BP originates from a discrete source. Females had higher urinary concentrations of BP-3, BP-1 and 4OH-BP than males. The distribution profiles of BP-1 and its parent compound (i.e., BP-3) in urine decreased with increasing age of donors (p < 0.05). The ratio of concentrations of BP-3 between blood and urine was 0.21 in adults, which was significantly lower than that for 4OH-BP (0.36). The concentration ratio of BPs between cord blood and maternal blood was higher for 4OH-BP (0.61) than that for BP-3 (0.48), which suggested greater trans-placental transfer potential of 4OH-BP. This is the first study to document the occurrence of BPs in paired urine and blood, and in matched maternal and fetal cord blood. Highlights: • Benzophenone (BP) concentrations are determined in paired blood and urine for the first time. • BP-3 and 4OH-BP partition preferentially into urine. • Cord to

  3. Benzophenone-type UV filters in urine and blood from children, adults, and pregnant women in China: Partitioning between blood and urine as well as maternal and fetal cord blood

    International Nuclear Information System (INIS)

    Zhang, Tao; Sun, Hongwen; Qin, Xiaolei; Wu, Qian; Zhang, Yanfeng; Ma, Jing; Kannan, Kurunthachalam

    2013-01-01

    Limited information exists on the exposure of benzophenone (BP)-type UV filters (i.e., sunscreen compounds) in children, adults, and pregnant women in China. In this study, we determined the concentrations of five BP derivatives, BP-1, BP-2, BP-3, BP-8, and 4OH-BP in urine (n = 101) as well as paired specimens of blood and urine (n = 24 pairs) collected from adults; in matched maternal and fetal cord blood (n = 20 pairs) collected from pregnant women; and in blood collected from children (n = 10). 4OH-BP, BP-1, and BP-3 were found in 61%, 57%, and 25%, respectively, of the urine samples analyzed. 4OH-BP was found in all blood samples; BP-3 was found more frequently in the blood of adults (83%), followed, in decreasing order, by pregnant women (35%) and children (30%). Among all adults, urinary BP-3 concentrations were significantly (p < 0.001) positively correlated with urinary BP-1 concentrations. Nevertheless, no significant correlations were found between urinary concentrations of BP-3 (or BP-1) and 4OH-BP. Our results suggest that human exposure to BP-3 and BP-1 is related, whereas 4OH-BP originates from a discrete source. Females had higher urinary concentrations of BP-3, BP-1 and 4OH-BP than males. The distribution profiles of BP-1 and its parent compound (i.e., BP-3) in urine decreased with increasing age of donors (p < 0.05). The ratio of concentrations of BP-3 between blood and urine was 0.21 in adults, which was significantly lower than that for 4OH-BP (0.36). The concentration ratio of BPs between cord blood and maternal blood was higher for 4OH-BP (0.61) than that for BP-3 (0.48), which suggested greater trans-placental transfer potential of 4OH-BP. This is the first study to document the occurrence of BPs in paired urine and blood, and in matched maternal and fetal cord blood. Highlights: • Benzophenone (BP) concentrations are determined in paired blood and urine for the first time. • BP-3 and 4OH-BP partition preferentially into urine. • Cord to

  4. DNA double-strand break response factors influence end-joining features of IgH class switch and general translocation junctions.

    Science.gov (United States)

    Panchakshari, Rohit A; Zhang, Xuefei; Kumar, Vipul; Du, Zhou; Wei, Pei-Chi; Kao, Jennifer; Dong, Junchao; Alt, Frederick W

    2018-01-23

    Ig heavy chain (IgH) class switch recombination (CSR) in B lymphocytes switches IgH constant regions to change antibody functions. CSR is initiated by DNA double-strand breaks (DSBs) within a donor IgH switch (S) region and a downstream acceptor S region. CSR is completed by fusing donor and acceptor S region DSB ends by classical nonhomologous end-joining (C-NHEJ) and, in its absence, by alternative end-joining that is more biased to use longer junctional microhomologies (MHs). Deficiency for DSB response (DSBR) factors, including ataxia telangiectasia-mutated (ATM) and 53BP1, variably impair CSR end-joining, with 53BP1 deficiency having the greatest impact. However, studies of potential impact of DSBR factor deficiencies on MH-mediated CSR end-joining have been technically limited. We now use a robust DSB joining assay to elucidate impacts of deficiencies for DSBR factors on CSR and chromosomal translocation junctions in primary mouse B cells and CH12F3 B-lymphoma cells. Compared with wild-type, CSR and c-myc to S region translocation junctions in the absence of 53BP1, and, to a lesser extent, other DSBR factors, have increased MH utilization; indeed, 53BP1-deficient MH profiles resemble those associated with C-NHEJ deficiency. However, translocation junctions between c-myc DSB and general DSBs genome-wide are not MH-biased in ATM-deficient versus wild-type CH12F3 cells and are less biased in 53BP1- and C-NHEJ-deficient cells than CSR junctions or c-myc to S region translocation junctions. We discuss potential roles of DSBR factors in suppressing increased MH-mediated DSB end-joining and features of S regions that may render their DSBs prone to MH-biased end-joining in the absence of DSBR factors.

  5. Interactions of Human Mismatch Repair Proteins MutSα and MutLα with Proteins of the ATR-Chk1 Pathway*

    Science.gov (United States)

    Liu, Yiyong; Fang, Yanan; Shao, Hongbing; Lindsey-Boltz, Laura; Sancar, Aziz; Modrich, Paul

    2010-01-01

    At clinically relevant doses, chemotherapeutic SN1 DNA methylating agents induce an ATR-mediated checkpoint response in human cells that is dependent on functional MutSα and MutLα. Deficiency of either mismatch repair activity renders cells highly resistant to this class of drug, but the mechanisms linking mismatch repair to checkpoint activation have remained elusive. In this study we have systematically examined the interactions of human MutSα and MutLα with proteins of the ATR-Chk1 pathway using both nuclear extracts and purified proteins. Using nuclear co-immunoprecipitation, we have detected interaction of MutSα with ATR, TopBP1, Claspin, and Chk1 and interaction of MutLα with TopBP1 and Claspin. We were unable to detect interaction of MutSα or MutLα with Rad17, Rad9, or replication protein A in the extract system. Use of purified proteins confirmed direct interaction of MutSα with ATR, TopBP1, and Chk1 and of MutLα with TopBP1. MutSα-Claspin and MutLα-Claspin interactions were not demonstrable with purified proteins, suggesting that extract interactions are indirect or depend on post-translational modification. Use of a modified chromatin immunoprecipitation assay showed that proliferating cell nuclear antigen, ATR, TopBP1, and Chk1 are recruited to chromatin in a MutLα- and MutSα-dependent fashion after N-methyl-N′-nitro-N-nitrosoguanidine treatment. However, chromatin enrichment of replication protein A, Claspin, Rad17-RFC, and Rad9-Rad1-Hus1 was not detected in these experiments. Although our failure to observe enrichment of the latter activities could be due to sensitivity limitations, these observations may indicate a novel mechanism for ATR activation. PMID:20029092

  6. Accumulation of DNA damage-induced chromatin alterations in tissue-specific stem cells: the driving force of aging?

    Directory of Open Access Journals (Sweden)

    Nadine Schuler

    Full Text Available Accumulation of DNA damage leading to stem cell exhaustion has been proposed to be a principal mechanism of aging. Using 53BP1-foci as a marker for DNA double-strand breaks (DSBs, hair follicle stem cells (HFSCs in mouse epidermis were analyzed for age-related DNA damage response (DDR. We observed increasing amounts of 53BP1-foci during the natural aging process independent of telomere shortening and after protracted low-dose radiation, suggesting substantial accumulation of DSBs in HFSCs. Electron microscopy combined with immunogold-labeling showed multiple small 53BP1 clusters diffusely distributed throughout the highly compacted heterochromatin of aged HFSCs, but single large 53BP1 clusters in irradiated HFSCs. These remaining 53BP1 clusters did not colocalize with core components of non-homologous end-joining, but with heterochromatic histone modifications. Based on these results we hypothesize that these lesions were not persistently unrepaired DSBs, but may reflect chromatin rearrangements caused by the repair or misrepair of DSBs. Flow cytometry showed increased activation of repair proteins and damage-induced chromatin modifications, triggering apoptosis and cellular senescence in irradiated, but not in aged HFSCs. These results suggest that accumulation of DNA damage-induced chromatin alterations, whose structural dimensions reflect the complexity of the initial genotoxic insult, may lead to different DDR events, ultimately determining the biological outcome of HFSCs. Collectively, our findings support the hypothesis that aging might be largely the remit of structural changes to chromatin potentially leading to epigenetically induced transcriptional deregulation.

  7. The UV-filter benzophenone-1 inhibits 17beta-hydroxysteroid dehydrogenase type 3: Virtual screening as a strategy to identify potential endocrine disrupting chemicals.

    Science.gov (United States)

    Nashev, Lyubomir G; Schuster, Daniela; Laggner, Christian; Sodha, Seloni; Langer, Thierry; Wolber, Gerhard; Odermatt, Alex

    2010-04-15

    The prevalence of male reproductive disorders and testicular cancer is steadily increasing. Because the exposure to chemicals disrupting natural hormone action has been associated with these diseases, it is important to identify endocrine disrupting chemicals (EDCs) and their targets of action. Here, a 3D-structural database that can be applied for virtual screening approaches to facilitate the identification of EDCs was constructed. The database was screened using pharmacophores of 17beta-hydroxysteroid dehydrogenase type 3 (17beta-HSD3), which catalyzes the last step of testosterone synthesis in testicular Leydig cells and plays an essential role during male sexual development. Among other chemicals, benzophenone (BP) UV-filters were predicted as potential 17beta-HSD3 inhibitors. Biological analyses revealed (2,4-dihydroxyphenyl)-phenylmethanone (also known as benzophenone-1, BP-1) as an inhibitor of human 17beta-HSD3 (IC(50) 1.05microM). BP-1 also efficiently blocked conversion of androstenedione to testosterone by mouse and rat 17beta-HSD3 in whole-organ enzyme assays. Moreover, BP-1 antagonized the testosterone-dependent activation of androgen receptors (IC(50) 5.7microM), suggesting synergistic anti-androgenic effects of BP-1 by preventing testosterone formation and blocking receptor activation. In addition, analyses of several commonly used UV-filters on estrogen- and androgen-metabolizing 17beta-HSD enzymes revealed 3-benzylidene camphor (3-BC) and 4-methylbenzylidene camphor (4-MBC) as low micromolar 17beta-HSD2 inhibitors. In conclusion, screening of virtual chemical structure libraries can facilitate the identification of compounds interfering with hormone action. The potential disruption of 17beta-HSD enzyme function by the UV-filters BP-1, 3-BC and 4-MBC requires further investigation and should be considered for safety assessment of these chemicals. 2009 Elsevier Inc. All rights reserved.

  8. ENDOR and ESEEM of the 15N labelled radical cations of chlorophyll a and the primary donor P 700 in photosystem I

    Science.gov (United States)

    Käβ, H.; Bittersmann-Weidlich, E.; Andréasson, L.-E.; Bönigk, B.; Lubitz, W.

    1995-05-01

    The hyperfine couplings of the nitrogen nuclei in the radical cations of both 15N-labelled chlorophyll a and the primary donor P 700 in Photosystem I of Synechococcus elongatus and spinach ( Spinacea oleracea) in frozen solutions were investigated by ENDOR and, for confirmation, by two-dimensional ESEEM techniques. In addition, 1H ENDOR experiments were performed on these compounds. The experimental 15N hyperfine couplings of the chlorophyll a radical cation are compared with theoretical ones obtained by RHF-INDO/SP calculations and with the respective hyperfine couplings in the closely related 15N-bacteriochlorophyll a radical cation. Based on the observed 15N and 1H hyperfine couplings two possible models are discussed for P 700+: (a) the special pair model with a strongly asymmetric spin density distribution over the dimer halves; (b) the model of a strongly perturbed chlorophyll a monomer.

  9. The genus Trematocarpus (Sarcodiaceae, Rhodophyta in southern Africa and the exclusion of Sphaerococcus (Chondrus scutellatus

    Directory of Open Access Journals (Sweden)

    R. H. Simons

    1983-11-01

    Full Text Available Trematocarpus Kützing in southern Africa is found to comprise four taxa in three species: newly described is T.  fragilis (Ag. De Toni var. divaricatus Simons, var. nov. Two of the species, T. flabellatus (J. Ag. De Toni and T.  affinis (J. Ag. De Toni are restored to independent specific rank after being regarded as synonyms of T.  scutellatus (Her. Searles. It is shown that  Sphaerococcus (Chondrus scutellatus Her., the basionym of  T.  scutellatus refers to a species of Gigartina, therefore a new combination Gigartina scutellata (Her. Simons is made for this species which was formerly known as G. fastigiata J. Ag. and G. scabiosa (Kiitz. Papenf. Trematocarpus elongatus Kiitz. is relegated to synonymy under T. fragilis var.  divaricatus.

  10. Angle-resolved light scattering of individual rod-shaped bacteria based on Fourier transform light scattering.

    Science.gov (United States)

    Jo, YoungJu; Jung, JaeHwang; Lee, Jee Woong; Shin, Della; Park, HyunJoo; Nam, Ki Tae; Park, Ji-Ho; Park, YongKeun

    2014-05-28

    Two-dimensional angle-resolved light scattering maps of individual rod-shaped bacteria are measured at the single-cell level. Using quantitative phase imaging and Fourier transform light scattering techniques, the light scattering patterns of individual bacteria in four rod-shaped species (Bacillus subtilis, Lactobacillus casei, Synechococcus elongatus, and Escherichia coli) are measured with unprecedented sensitivity in a broad angular range from -70° to 70°. The measured light scattering patterns are analyzed along the two principal axes of rod-shaped bacteria in order to systematically investigate the species-specific characteristics of anisotropic light scattering. In addition, the cellular dry mass of individual bacteria is calculated and used to demonstrate that the cell-to-cell variations in light scattering within bacterial species is related to the cellular dry mass and growth.

  11. Wavelength-selective plasmonics for enhanced cultivation of microalgae

    Energy Technology Data Exchange (ETDEWEB)

    Ooms, Matthew D.; Jeyaram, Yogesh; Sinton, David, E-mail: sinton@mie.utoronto.ca [Department of Mechanical and Industrial Engineering, and Institute for Sustainable Energy, University of Toronto, Toronto M5S 3G8 (Canada)

    2015-02-09

    Optimal photon management is a key challenge for photobioreactor design, since light gradients and varying spectral sensitivities between organisms result in uneven illumination and unused photons. This paper demonstrates wavelength specific scattering from plasmonic nano-patterned surfaces as a means of addressing the challenge of photon management in photobioreactors. Modular photobioreactors were constructed with different reflective substrates including arrays of plasmonic nanodisks, broadband reflectors, and untreated glass. It was found that the growth rate of cyanobacterium S. elongatus in photobioreactors equipped with a plasmonic substrate (R{sub 623 nm} ∼ 35%) was enhanced by 6.5% compared to photobioreactors equipped with untreated glass. Furthermore, plasmonic reflectors showed a normalized power efficiency improvement of 52% over broadband reflectors. Wavelength-specific reflection from plasmonic reflectors increases the flux of useful light to cultures without sacrificing the full spectrum.

  12. Wavelength-selective plasmonics for enhanced cultivation of microalgae

    Science.gov (United States)

    Ooms, Matthew D.; Jeyaram, Yogesh; Sinton, David

    2015-02-01

    Optimal photon management is a key challenge for photobioreactor design, since light gradients and varying spectral sensitivities between organisms result in uneven illumination and unused photons. This paper demonstrates wavelength specific scattering from plasmonic nano-patterned surfaces as a means of addressing the challenge of photon management in photobioreactors. Modular photobioreactors were constructed with different reflective substrates including arrays of plasmonic nanodisks, broadband reflectors, and untreated glass. It was found that the growth rate of cyanobacterium S. elongatus in photobioreactors equipped with a plasmonic substrate (R623 nm ˜ 35%) was enhanced by 6.5% compared to photobioreactors equipped with untreated glass. Furthermore, plasmonic reflectors showed a normalized power efficiency improvement of 52% over broadband reflectors. Wavelength-specific reflection from plasmonic reflectors increases the flux of useful light to cultures without sacrificing the full spectrum.

  13. Bioaccumulation of heavy metals in commercially important marine fishes from Mumbai Harbor, India.

    Science.gov (United States)

    Velusamy, A; Satheesh Kumar, P; Ram, Anirudh; Chinnadurai, S

    2014-04-15

    Seventeen commercially important marine fish species were caught in Mumbai Harbor using a trawl net and evaluated using Atomic Absorption Spectroscopy and ICP-OES. It was found that certain species of fish contained lower levels of all metals tested. J. elongatus and C. dussumieri had the highest levels of all 8 metals tested. The heavy metal concentrations were significantly varied within and between the studied fishes (pheavy metals was observed. This investigation indicated that various levels of heavy metals exist in the fish species sampled, but those concentrations are within the maximum residual levels recommended by the European Union and FAO/WHO. Therefore, fish caught in Mumbai Harbor can be considered safe for human consumption. Copyright © 2014 Elsevier Ltd. All rights reserved.

  14. Specific Interaction between Redox Phospholipid Polymers and Plastoquinone in Photosynthetic Electron Transport Chain.

    Science.gov (United States)

    Tanaka, Kenya; Kaneko, Masahiro; Ishikawa, Masahito; Kato, Souichiro; Ito, Hidehiro; Kamachi, Toshiaki; Kamiya, Kazuhide; Nakanishi, Shuji

    2017-04-19

    Redox phospholipid polymers added in culture media are known to be capable of extracting electrons from living photosynthetic cells across bacterial cell membranes with high cytocompatibility. In the present study, we identify the intracellular redox species that transfers electrons to the polymers. The open-circuit electrochemical potential of an electrolyte containing the redox polymer and extracted thylakoid membranes shift to positive (or negative) under light irradiation, when an electron transport inhibitor specific to plastoquinone is added upstream (or downstream) in the photosynthetic electron transport chain. The same trend is also observed for a medium containing living photosynthetic cells of Synechococcus elongatus PCC7942. These results clearly indicate that the phospholipid redox polymers extract photosynthetic electrons mainly from plastoquinone. © 2017 Wiley-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Population dynamics of calanoid copepods and the implications of their predation by clupeid fish in the Central Baltic Sea

    DEFF Research Database (Denmark)

    Möllmann, C.; Köster, Fritz

    2002-01-01

    estimates showed a switch by herring from consuming mainly CV/VI of P. elongatus and T. longicornis, to preying on CII of the latter copepod. This switch was potentially due to increased competition with the drastically increased sprat stock since the late 1980s. Further, an increased predation pressure....... Additionally this study investigated the effect of predation by the major planktivorous fish species herring (Clupea harengus) and sprat (Sprattus sprattus) for the period 1977-1996 in the Gotland Basin (Central Baltic Sea). Examination of consumption by these fish species in relation to copepod production...... temperature-driven increase in the T. longicornis stock, as was observed for Acartia spp., which was not significantly consumed...

  16. Role of essential lipids in copepod nutrition: no evidence for trophic upgrading of food quality by a marine ciliate

    DEFF Research Database (Denmark)

    Klein Breteler, W.; Koski, Marja; Rampen, S.

    2004-01-01

    -quality Rhodomonas sp. diet. The specific mass of fatty acids in S. sulcatum was much lower than in the Dunaliella sp. diet, However, the fatty acid composition of the protozoan more or less resembled that of the food, lacking long-chain highly unsaturated fatty acids (HUFAs). Sterols only occurred in Dunaliella sp......The ciliate Strombidium sulcatum was used to feed and grow young stages of the copepods Temora longicornis (Muller) and Pseudocalanus elongatus (Boeck). The ciliate was cultured in the laboratory using either bacteria or the green alga Dunaliella sp. as a food source. Young copepodites of both......., although in low abundance of unuseful Delta7 sterols. Obviously, S. sulcatum did not biochemically enhance bacterial or algal food for subsequent use at higher trophic levels, and only transferred fatty acids without further conversion. The results indicate a deficiency in the ciliate of HUFAs and sterols...

  17. 210Pb: bioaccumulation factor and internal radiation dose to the public due to consumption of seafood from Mumbai harbour bay

    International Nuclear Information System (INIS)

    Bangera, Vasanthi S.; Rudran, Kamala

    1999-01-01

    Marine organisms such as fishes, molluscs and crustaceans are known to accumulate 210 Pb. Distribution of 210 Pb in coastal marine organisms mainly fishes and shell fishes is studied. Concentration of 210 Pb obtained in muscle of common fishes (edible portion) varied from BDL to 9.71 ± 0.92 Bq kq -1 wet muscle. For fishes like Pampus argenteus (pomfret), Cynoglossus elongatus (sole), Rastrelliger kanagurta (mackerel), Harpoden nehereus (Bombay duck), Arius dussumieri (catfish), the concentration factors for 210 Pb in edible portion of fish from sea water works out to 10 1 to 10 3 . Radiation dose to the public has been evaluated on the basis of daily intake of 40 g of fish (15 kg y -1 ). Committed effective dose (CED) to 210 Pb due to consumption of seafood is calculated, CED varied from 2.5 x 10 -3 to 1.27 x 10 -1 mSv y -1 . (author)

  18. Synthetic analogues of the natural compound cryphonectric acid interfere with photosynthetic machinery through two different mechanisms.

    Science.gov (United States)

    Teixeira, Róbson Ricardo; Pereira, Wagner Luiz; Tomaz, Deborah Campos; de Oliveira, Fabrício Marques; Giberti, Samuele; Forlani, Giuseppe

    2013-06-12

    A series of isobenzofuran-1(3H)-ones (phthalides), analogues of the naturally occurring phytotoxin cryphonectric acid, were designed, synthesized, and fully characterized by NMR, IR, and MS analyses. Their synthesis was achieved via condensation, aromatization, and acetylation reactions. The measurement of the electron transport chain in spinach chloroplasts showed that several derivatives are capable of interfering with the photosynthetic apparatus. Few of them were found to inhibit the basal rate, but a significant inhibition was brought about only at concentrations exceeding 50 μM. Some other analogues acted as uncouplers or energy transfer inhibitors, with a remarkably higher effectiveness. Isobenzofuranone addition to the culture medium inhibited the growth of the cyanobacterium Synechococcus elongatus , with patterns consistent with the effects measured in vitro upon isolated chloroplasts. The most active derivatives, being able to completely suppress algal growth at 20 μM, may represent structures to be exploited for the design of new active ingredients for weed control.

  19. Improved Alkane Production in Nitrogen-Fixing and Halotolerant Cyanobacteria via Abiotic Stresses and Genetic Manipulation of Alkane Synthetic Genes.

    Science.gov (United States)

    Kageyama, Hakuto; Waditee-Sirisattha, Rungaroon; Sirisattha, Sophon; Tanaka, Yoshito; Mahakhant, Aparat; Takabe, Teruhiro

    2015-07-01

    Cyanobacteria possess the unique capacity to produce alkane. In this study, effects of nitrogen deficiency and salt stress on biosynthesis of alkanes were investigated in three kinds of cyanobacteria. Intracellular alkane accumulation was increased in nitrogen-fixing cyanobacterium Anabaena sp. PCC7120, but decreased in non-diazotrophic cyanobacterium Synechococcus elongatus PCC7942 and constant in a halotolerant cyanobacterium Aphanothece halophytica under nitrogen-deficient condition. We also found that salt stress increased alkane accumulation in Anabaena sp. PCC7120 and A. halophytica. The expression levels of two alkane synthetic genes were not upregulated significantly under nitrogen deficiency or salt stress in Anabaena sp. PCC7120. The transformant Anabaena sp. PCC7120 cells with additional alkane synthetic gene set from A. halophytica increased intracellular alkane accumulation level compared to control cells. These results provide a prospect to improve bioproduction of alkanes in nitrogen-fixing halotolerant cyanobacteria via abiotic stresses and genetic engineering.

  20. Global metabolic rewiring for improved CO2 fixation and chemical production in cyanobacteria

    Science.gov (United States)

    Kanno, Masahiro; Carroll, Austin L.; Atsumi, Shota

    2017-03-01

    Cyanobacteria have attracted much attention as hosts to recycle CO2 into valuable chemicals. Although cyanobacteria have been engineered to produce various compounds, production efficiencies are too low for commercialization. Here we engineer the carbon metabolism of Synechococcus elongatus PCC 7942 to improve glucose utilization, enhance CO2 fixation and increase chemical production. We introduce modifications in glycolytic pathways and the Calvin Benson cycle to increase carbon flux and redirect it towards carbon fixation. The engineered strain efficiently uses both CO2 and glucose, and produces 12.6 g l-1 of 2,3-butanediol with a rate of 1.1 g l-1 d-1 under continuous light conditions. Removal of native regulation enables carbon fixation and 2,3-butanediol production in the absence of light. This represents a significant step towards industrial viability and an excellent example of carbon metabolism plasticity.

  1. Functional screening of aldehyde decarbonylases for long-chain alkane production by Saccharomyces cerevisiae

    DEFF Research Database (Denmark)

    Kang, Min-Kyoung; Zhou, Yongjin J.; Buijs, Nicolaas A.

    2017-01-01

    performed functional screening to identify efficient ADs that can improve alkane production by S. cerevisiae. Results: A comparative study of ADs originated from a plant, insects, and cyanobacteria were conducted in S. cerevisiae. As a result, expression of aldehyde deformylating oxygenases (ADOs), which......Background: Low catalytic activities of pathway enzymes are often a limitation when using microbial based chemical production. Recent studies indicated that the enzyme activity of aldehyde decarbonylase (AD) is a critical bottleneck for alkane biosynthesis in Saccharomyces cerevisiae. We therefore...... are cyanobacterial ADs, from Synechococcus elongatus and Crocosphaera watsonii converted fatty aldehydes to corresponding Cn-1 alkanes and alkenes. The CwADO showed the highest alkane titer (0.13 mg/L/OD600) and the lowest fatty alcohol production (0.55 mg/L/OD600). However, no measurable alkanes and alkenes were...

  2. Niveles de esporulación experimentales y naturales de Nosema locustae (Microsporidia en especies de tucuras y langostas (Orthoptera: Acridoidea de la Argentina Levels of experimental and natural sporulation of Nosema locustae (Microsporidia in grasshopper and locust species (Orthoptera: Acridoidea of Argentina

    Directory of Open Access Journals (Sweden)

    Carlos E. Lange

    2003-07-01

    Full Text Available Nosema locustae Canning, un patógeno intracelular esporogénico del cuerpo graso de ortópteros utilizado para el control biológico de acridios, se estableció en ciertas comunidades de éstos de la Argentina luego de ser introducido hace poco más de 20 años. En el presente estudio se midieron, siguiendo metodología estandarizada para la estimación del número de esporos por insecto individual afectado, los niveles de esporulación alcanzados por N. locustae en tres especies de acridios naturalmente infectados [ Dichroplus elongatus Giglio-Tos, Dichroplus pratensis Bruner, Baeacris punctulatus (Thunberg] y en seis especies infectadas experimentalmente [ Dichroplus maculipennis Blanchard, Dichroplus schulzi Bruner, D. elongatus, B. punctulatus, Ronderosia bergi Stal, Schistocerca cancellata (Serville]. Los niveles de esporulación fueron importantes en todas las especies de la subfamilia Melanoplinae (el promedio varió entre 2 x 10(8 y 3,2 x 10(9, mientras que la producción de esporos fue rara (9,5 % de los ejemplares infectados y baja (máxima de 9,6 x 10(6 en S. cancellata. No ocurrió desarrollo de infección en el acridio Romaleidae Elaeochlora viridicata (Serville. Los valores de esporulación alcanzados en los melanoplinos concuerdan con el establecimiento de N. locustae en comunidades de acridios de la Argentina, pues una alta disponibilidad de unidades infectivas transmisibles (propágulos es un factor central para la transmisión y persistencia de una enfermedad en una población de insectos susceptibles. Aunque los niveles de esporulación más elevados se alcanzaron en D. maculipennis, R. bergi parece, por la falta de diapausa embrionaria obligatoria en su ciclo y por su comportamiento poco reactivo que facilita el manejo de la colonia, la especie más adecuada de las probadas en este estudio para la producción in vivo de N. locustae.Nosema locustae Canning, an intracellular sporogenic pathogen of the fat body of orthopterans

  3. Different zooplankton structures in the German Bight

    Science.gov (United States)

    Martens, P.; Brockmann, U.

    1993-06-01

    In August 1982, a net of 48 stations with altogether 208 samples was investigated in the eastern German Bight with respect to temperature, salinity, as well as the amount and species composition of the mesozooplankton (>80 μm). The data were arranged into different structures by means of a cluster analysis. Four different clusters were found: (a) a “Wadden sea water” with few holoplankton organisms but a higher amount of spionid larvae; (b) a “German Bight water” with a maximum occurrence of turbellaria ( Alaurina composita) and medium concentrations of copepods; (c) a mixing area between these two water masses with highest amounts of Oikopleura dioica, Temora longicornis, Acartia sp., mussel larvae and larvae of the spionid worms; (d) a “North Sea water” mass with highest concentrations of Pseudocalanus elongatus, Paracalanus parvus und Oithona similis. The differences in the concentrations of the species mentioned between the four clusters were significant on the 0.1%-level.

  4. ¿La práctica de la siembra directa en cultivos de soja favorece las poblaciones de acridios (Orthoptera: Acrididae en el partido de Benito Juárez? Does the direct tillage practice in soybean crops favour grasshopper populations (Orthoptera: Acrididae, in Benito Juárez county?

    Directory of Open Access Journals (Sweden)

    Daniel Scuffi

    2012-12-01

    Full Text Available Considerando el desarrollo del cultivo de soja en siembra directa en el partido de Benito Juárez, y que algunos autores sostienen que esta práctica favorece los acridios, se evaluó la riqueza de especies y la abundancia en soja con siembra directa y convencional. Se registraron siete especies (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner y Scotussa lemniscata (Stål. La riqueza de especies acumulada en los diferentes cultivos fue similar (p> 0,05. En soja de primera con siembra directa, se registraron 2,3 ± 0,19 especies, en soja de primera con siembra convencional 1,45 ± 0,15 especies y en soja de segunda con siembra directa 2,25 ± 0,28 especies. Dichroplus elongatus fue la especie más abundante en todos los cultivos y en todos los momentos. Las restantes presentaron baja abundancia y se registraron en algunos momentos. No existió diferencia (p> 0,05 en la abundancia de tucuras entre los cultivos y en las diferentes fechas de muestreo. La baja riqueza de especies registrada estaría relacionada con la baja diversidad vegetal de los cultivos. Este estudio no mostró diferencias en la abundancia y riqueza de especies de acuerdo a la labranza utilizada.Considering the development of the soybean crops using direct tillage in Benito Juárez county, and taking into account that for some authors this practice favours the grasshopper populations, the abundance and species richness in soybean with direct and conventional tillage were evaluated. Seven species were registered (Aleuas lineatus Stål, Covasacris pallidinota (Bruner, Baeacris pseudopunctulatus (Ronderos, Dichroplus elongatus Giglio-Tos, Dichroplus maculipennis (Blanchard, Dichroplus pratensis Bruner and Scotussa lemniscata (Stål. The accumulated richness was similar (p> 0.05, along the different crops; 2.3 ± 0.19 species were registered in

  5. Fluorescent minerals - A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments

    Science.gov (United States)

    Omairi, Tareq; Wainwright, Milton

    2015-07-01

    We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark.

  6. Single Molecule Spectroscopy on Photosynthetic Pigment-Protein Complexes

    CERN Document Server

    Jelezko, F; Schuler, S; Thews, E; Tietz, C; Wechsler, A; Wrachtrup, J

    2001-01-01

    Single molecule spectroscopy was applied to unravel the energy transfer pathway in photosynthetic pigment-protein complexes. Detailed analysis of excitation and fluorescence emission spectra has been made for peripheral plant antenna LHC II and Photosystem I from cyanobacterium Synechococcus elongatus. Optical transitions of individual pigments were resolved under nonselective excitation of antenna chlorophylls. High-resolution fluorescence spectroscopy of individual plant antenna LHC II indicates that at low temperatures, the excitation energy is localized on the red-most Chl a pool absorbing at 680 nm. More than one pigment molecule is responsible for the fluorescence emission of the LHC II trimer. The spectral lines of single Chl a molecules absorbing at 675 nm are broadened because of the Foerster energy transfer towards the red-most pigments. Low-temperature spectroscopy on single PS I trimers indicates that two subgroups of pigments, which are present in the red antenna pool, differ by the strength of t...

  7. New agnostina (Trilobita from the Llanvirn (Ordovician of Spain

    Directory of Open Access Journals (Sweden)

    Rábano, I.

    1985-12-01

    Full Text Available The agnostids from the Lower Llanvirn shales of the Southern Central-Iberian Zone (Mounts of Toledo, Villuercas and Almadén district are described. Seven localities are new for Ordovician agnostids and two are revised. Three new species, belonging to the genera Geragnostella and Geragnostus, are described: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. and Geragnostus ninhursagae n. sp. The new names Geragnostus pilleti nom. nov. and Geragnostus abdullaevi nom. nov. are proposed to rename, respectively, the species G. howelli PILLET, 1978 and G. elongatus ABDULLAEV, 1972, regarded herein as junior objective homonyms of other previously defined species.

    Se estudian los trilobites agnóstidos procedentes de nueve localidades, siete de ellas nuevas para estas faunas, situadas en las pizarras del Llanvirn inferior de la parte meridional de la Zona Centroibérica (Montes de Toledo, Villuercas y región de Almadén. Se determina la presencia de los géneros Geragnostella y Geragnostus, y se describen tres nuevas especies: Geragnostella gilcidae n. sp., Geragnostus hispanicus n. sp. y Geragnostus ninhursagae n. sp. Se proponen también los nuevos nombres Geragnostus pilleti nom. nov. y Geragnostus abdullaevi nom. nov. para designar, respectivamente, las especies G. howelli PILLET, 1978, y G. elongatus ABDULLAEV, 1972, consideradas ambas homónimos objetivos primarios de otras especies definidas con anterioridad.

  8. Aboriginal Consumption of Estuarine Food Resources and Potential Implications for Health through Trace Metal Exposure; A Study in Gumbaynggirr Country, Australia.

    Directory of Open Access Journals (Sweden)

    Shaina Russell

    Full Text Available Fishing and resource use continues to be an essential aspect of life for many Aboriginal communities throughout Australia. It is important for dietary sustenance, and also retains deep social, cultural and economic significance, playing a fundamental role in maintaining group cohesion, transferring cultural knowledge and affirming Indigenous identities. We surveyed approximately 20% of the Gumbaynggirr Aboriginal community of Nambucca Heads, New South Wales, Australia. This paper explores Gumbaynggirr Connection to Country and engagement in cultural practice. It quantifies fishing efforts and consumption of seafood within the community. We found 95% of the sample group fish, with the highest rate of fishing being 2-3 times a week (27%. Furthermore, 98% of participants eat seafood weekly or more frequently, up to more than once a day (24%. Survey results revealed that Myxus elongatus (Sand mullet and naturally recruited Saccostrea glomerata (Sydney rock oysters continue to be important wild resources to the Gumbaynggirr community. Trace metals were measured in M. elongatus and S. glomerata samples collected by community participants in this study. Maximum levels prescribed in the Australia New Zealand Food Standards Code were not exceeded in the edible tissue for either species, however both species exceeded the generally expected levels for zinc and copper and S. glomerata samples exceeded the generally expected level for selenium. Furthermore the average dietary exposure to trace metals from consuming seafood was calculated for the surveyed population. Trace metal intake was then compared to the provisional tolerable weekly intake prescribed by the Joint Expert Committee on Food Additives. This process revealed that copper and selenium intake were both within the provisional tolerable weekly intake, while there is no guideline for zinc. Furthermore, participants relying heavily on wild resources from the Nambucca River estuary may exceed the

  9. FLAVODIIRON2 and FLAVODIIRON4 proteins mediate an oxygen-dependent alternative electron flow in Synechocystis sp. PCC 6803 under CO2-limited conditions.

    Science.gov (United States)

    Shimakawa, Ginga; Shaku, Keiichiro; Nishi, Akiko; Hayashi, Ryosuke; Yamamoto, Hiroshi; Sakamoto, Katsuhiko; Makino, Amane; Miyake, Chikahiro

    2015-02-01

    This study aims to elucidate the molecular mechanism of an alternative electron flow (AEF) functioning under suppressed (CO2-limited) photosynthesis in the cyanobacterium Synechocystis sp. PCC 6803. Photosynthetic linear electron flow, evaluated as the quantum yield of photosystem II [Y(II)], reaches a maximum shortly after the onset of actinic illumination. Thereafter, Y(II) transiently decreases concomitantly with a decrease in the photosynthetic oxygen evolution rate and then recovers to a rate that is close to the initial maximum. These results show that CO2 limitation suppresses photosynthesis and induces AEF. In contrast to the wild type, Synechocystis sp. PCC 6803 mutants deficient in the genes encoding FLAVODIIRON2 (FLV2) and FLV4 proteins show no recovery of Y(II) after prolonged illumination. However, Synechocystis sp. PCC 6803 mutants deficient in genes encoding proteins functioning in photorespiration show AEF activity similar to the wild type. In contrast to Synechocystis sp. PCC 6803, the cyanobacterium Synechococcus elongatus PCC 7942 has no FLV proteins with high homology to FLV2 and FLV4 in Synechocystis sp. PCC 6803. This lack of FLV2/4 may explain why AEF is not induced under CO2-limited photosynthesis in S. elongatus PCC 7942. As the glutathione S-transferase fusion protein overexpressed in Escherichia coli exhibits NADH-dependent oxygen reduction to water, we suggest that FLV2 and FLV4 mediate oxygen-dependent AEF in Synechocystis sp. PCC 6803 when electron acceptors such as CO2 are not available. © 2015 American Society of Plant Biologists. All Rights Reserved.

  10. Deletion of the Synechocystis sp. PCC 6803 kaiAB1C1 gene cluster causes impaired cell growth under light-dark conditions.

    Science.gov (United States)

    Dörrich, Anja K; Mitschke, Jan; Siadat, Olga; Wilde, Annegret

    2014-11-01

    In contrast to Synechococcus elongatus PCC 7942, few data exist on the timing mechanism of the widely used cyanobacterium Synechocystis sp. PCC 6803. The standard kaiAB1C1 operon present in this organism was shown to encode a functional KaiC protein that interacted with KaiA, similar to the S. elongatus PCC 7942 clock. Inactivation of this operon in Synechocystis sp. PCC 6803 resulted in a mutant with a strong growth defect when grown under light-dark cycles, which was even more pronounced when glucose was added to the growth medium. In addition, mutants showed a bleaching phenotype. No effects were detected in mutant cells grown under constant light. Microarray experiments performed with cells grown for 1 day under a light-dark cycle revealed many differentially regulated genes with known functions in the ΔkaiABC mutant in comparison with the WT. We identified the genes encoding the cyanobacterial phytochrome Cph1 and the light-repressed protein LrtA as well as several hypothetical ORFs with a complete inverse behaviour in the light cycle. These transcripts showed a stronger accumulation in the light but a weaker accumulation in the dark in ΔkaiABC cells in comparison with the WT. In general, we found a considerable overlap with microarray data obtained for hik31 and sigE mutants. These genes are known to be important regulators of cell metabolism in the dark. Strikingly, deletion of the ΔkaiABC operon led to a much stronger phenotype under light-dark cycles in Synechocystis sp. PCC 6803 than in Synechococcus sp. PCC 7942. © 2014 The Authors.

  11. O efeito da floresta alagada na alimentação de três espécies de peixes onívoros em lagos de várzea da Amazônia Central, Brasil Effects of flooded forest in the diet of three fish species in floodplain lakes of Central Amazon, Brazil

    Directory of Open Access Journals (Sweden)

    Luiz Claro-Jr

    2004-01-01

    Full Text Available As enchentes anuais dos rios na Amazônia alagam extensas áreas de floresta conhecidas como várzeas ou igapós. Estas áreas têm papel importante na vida dos peixes da região, pois são fontes de alimento e de abrigo. Acreditamos que o desmatamento destas áreas ocasiona prejuízos à ictiofauna principalmente pela diminuição da quantidade e diversidade de alimento disponível. O estudo da relação entre a quantidade de floresta e a dieta de Parauchenipterus galeatus (Auchenipteridae, Siluriformes, Mylossoma duriventre (Characidae, Characiformese Triportheus elongatus (Characidae, Characiformespermitiu registrar pela primeira vez a influência direta da floresta alagada na ecologia alimentar de peixes na Amazônia Central.The annual flooding of the rivers in the Amazonia extends over large forest areas known as várzeas or igapós. These areas play an important role in the life of the fishes, as a source of food and shelter. We believe that the deforestation of these areas may affect negatively the fish fauna mainly by decreasing the amount of food resources and consequently the diversity of food types available. The study of the relationship between the riparian forest cover and the diet of Parauchenipterus galeatus (Auchenipteridae, Siluriformes, Mylossoma duriventre (Characidae, Characiformes and Triportheus elongatus (Characidae, Characiformes allowed to refer for the first time on the direct influence of the flooded forest in the feeding ecology of fishes in Central Amazonia.

  12. On some new species of Ancorabolidae Sars, 1909 from the Gulf of California: the generaCeratonotusSars, 1909, andDendropsyllusConroy-Dalton, 2003 (Crustacea, Copepoda, Harpacticoida).

    Science.gov (United States)

    Gómez, Samuel; Díaz, Karen

    2017-01-01

    Two new species of two genera of the family Ancorabolidae, Ceratonotus elongatus sp. n. and Dendropsyllus californiensis sp. n. , found at 1642 m and 1759 m depth, respectively, in the Southern Trough of Guaymas Basin, are described. Ceratonotus elongatus sp. n. was attributed to that genus by a series of character states of which the lack of dendroid dorsal processes on the P6-bearing somite and the presence of such processes on the first abdominal somite were definitive. This species was observed to be very close to Ceratonotus thistlei Conroy-Dalton, 2003 from the San Diego Trough, and can be separated by a number of traits of which the elongated sensilla-bearing dorsal tubercles on the second abdominal somite in the new species was definitive. Dendropsyllus californiensis sp. n. has been placed within that genus given the presence of four geniculate setae on P1EXP2 and one seta on P1ENP2, one inner seta on P3EXP3, and lack of inner armature on P4EXP3. Dendropsyllus californiensis sp. n. appears to be more closely related to Dendropsyllus thomasi Conroy-Dalton, 2003 and Dendropsyllus magellanicus (George & Schminke, 1998) on account of the spinulose nature of the basis of the maxilliped, the two-segmented P4ENP, and the fused condition of the P5 baseoendopod and exopod, and seems to be even more closely related to Dendropsyllus thomasi by the degree of development of the lateroventral processes of the cephalothorax. Dendropsyllus californiensis sp. n. can be separated from its congeners by the relative length of the first antennulary segment, relative length of the caudal rami, and by the armature formula of P3ENP2.

  13. On some new species of Ancorabolidae Sars, 1909 from the Gulf of California: the genera Ceratonotus Sars, 1909, and Dendropsyllus Conroy-Dalton, 2003 (Crustacea, Copepoda, Harpacticoida

    Directory of Open Access Journals (Sweden)

    Samuel Gómez

    2017-02-01

    Full Text Available Two new species of two genera of the family Ancorabolidae, Ceratonotus elongatus sp. n. and Dendropsyllus californiensis sp. n., found at 1642 m and 1759 m depth, respectively, in the Southern Trough of Guaymas Basin, are described. Ceratonotus elongatus sp. n. was attributed to that genus by a series of character states of which the lack of dendroid dorsal processes on the P6-bearing somite and the presence of such processes on the first abdominal somite were definitive. This species was observed to be very close to C. thistlei Conroy-Dalton, 2003 from the San Diego Trough, and can be separated by a number of traits of which the elongated sensilla-bearing dorsal tubercles on the second abdominal somite in the new species was definitive. Dendropsyllus californiensis sp. n. has been placed within that genus given the presence of four geniculate setae on P1EXP2 and one seta on P1ENP2, one inner seta on P3EXP3, and lack of inner armature on P4EXP3. Dendropsyllus californiensis sp. n. appears to be more closely related to D. thomasi Conroy-Dalton, 2003 and D. magellanicus (George & Schminke, 1998 on account of the spinulose nature of the basis of the maxilliped, the two-segmented P4ENP, and the fused condition of the P5 baseoendopod and exopod, and seems to be even more closely related to D. thomasi by the degree of development of the lateroventral processes of the cephalothorax. Dendropsyllus californiensis sp. n. can be separated from its congeners by the relative length of the first antennulary segment, relative length of the caudal rami, and by the armature formula of P3ENP2.

  14. Alguns Helmintos de peixes do litoral norte fluminense - II

    Directory of Open Access Journals (Sweden)

    J. Julio Vicente

    1974-01-01

    Full Text Available De 62 autópsias realizadas empeixes, capturados no litoral de Macaé, Estado do Rio de Janeiro, os autores coletaram alguns exemplares de helmintos cujo estudo permitiu a descrição de 2 espécies novas: Cucullanus rougetae e Raphidascaris yamagutii; a redescrição de Pseudopecoelus elongatus (Yamaguti, 1938 em novo hospedeiro, as referências de Procamallanus macaensis Vicente e Santos, 1972, e Catarinatrema verrucosum Freitas & Santos, 1971 e a descrição de 2 larvas de nematódeos e 1 de cestódeo que não puderam ser determinadas até espécie. A excursão emque foram colecionados os helmintos acima relacionados foi realizada em janeiro de 1973 por um de nós (elias dos Santos permitindo a continuação de trabalho anterior sobre helmintos de peixes marinhos daquele município fluminense.Several helminths were recovered, buy one of the authors (Elias dos Santos from fishes obtained in Macaé Coast, Rio de Janeiro State, Brasil, during an excursion in January, 1973. Two new species are described; Cucullanus rougetae and Raphidascaris yamagutii, they redescribe and give new host records for Pseudopecoellus elongatus (Yamaguti, 1938 and Procamallanus macaensis vicente e Santos, 1972; the later is only refered, as well as Catarinatrema verrucosum Freitas e santos, 1971. The describe one cestode and two nematode larvae although they could not be determinated. This is the second publication on the matter.

  15. Evaluation of algal biofilms on indium tin oxide (ITO for use in biophotovoltaic platforms based on photosynthetic performance.

    Directory of Open Access Journals (Sweden)

    Fong-Lee Ng

    Full Text Available In photosynthesis, a very small amount of the solar energy absorbed is transformed into chemical energy, while the rest is wasted as heat and fluorescence. This excess energy can be harvested through biophotovoltaic platforms to generate electrical energy. In this study, algal biofilms formed on ITO anodes were investigated for use in the algal biophotovoltaic platforms. Sixteen algal strains, comprising local isolates and two diatoms obtained from the Culture Collection of Marine Phytoplankton (CCMP, USA, were screened and eight were selected based on the growth rate, biochemical composition and photosynthesis performance using suspension cultures. Differences in biofilm formation between the eight algal strains as well as their rapid light curve (RLC generated using a pulse amplitude modulation (PAM fluorometer, were examined. The RLC provides detailed information on the saturation characteristics of electron transport and overall photosynthetic performance of the algae. Four algal strains, belonging to the Cyanophyta (Cyanobacteria Synechococcus elongatus (UMACC 105, Spirulina platensis. (UMACC 159 and the Chlorophyta Chlorella vulgaris (UMACC 051, and Chlorella sp. (UMACC 313 were finally selected for investigation using biophotovoltaic platforms. Based on power output per Chl-a content, the algae can be ranked as follows: Synechococcus elongatus (UMACC 105 (6.38×10(-5 Wm(-2/µgChl-a>Chlorella vulgaris UMACC 051 (2.24×10(-5 Wm(-2/µgChl-a>Chlorella sp.(UMACC 313 (1.43×10(-5 Wm(-2/µgChl-a>Spirulina platensis (UMACC 159 (4.90×10(-6 Wm(-2/µgChl-a. Our study showed that local algal strains have potential for use in biophotovoltaic platforms due to their high photosynthetic performance, ability to produce biofilm and generation of electrical power.

  16. Vertical distribution, diversity and assemblages of mesopelagic fishes in the western Mediterranean

    Science.gov (United States)

    Olivar, M. P.; Bernal, A.; Molí, B.; Peña, M.; Balbín, R.; Castellón, A.; Miquel, J.; Massutí, E.

    2012-04-01

    The mesopelagic fish community of the western Mediterranean was studied during two cruises carried out in December 2009 and July 2010 in the shelf and slope zones around the Balearic Islands. Much of what was previously known about this deep water group of fishes in the Mediterranean Sea came from studies performed using planktonic and small midwater nets. This study was the first attempt to use large pelagic trawls and small nets combined with information about the main sound scattering layers to analyse mesopelagic fish composition, diversity and species assemblages. This community is characterised by a relatively low diversity compared to other oceanic regions of the world, with Myctophiformes and Stomiiformes being the main contributors. Bathymetry and the level of the water column were the most important factors structuring the investigated fish assemblages, and similar vertical patterns were observed for the different species collected during the two study periods. A shelf assemblage composed of a few species of myctophids, with Notoscopelus elongatus being the main contributor, was distinguished. The slope assemblage included both Myctophiformes and Stomiiformes that showed differences in their day-night main location along the water column. In terms of species behaviour, two important groups were detected. The first was non-migrant or weakly migrant species, with the paradigmatic example being the gonostomatid Cyclothone braueri, which occurred at a depth of 400-600 m; this species is partly responsible for the permanent acoustic (38 kHz) response at this depth. The second group, near-surface migrants at night, was represented by most of the juvenile and adult myctophids, exemplified by Ceratoscopelus maderensis, with the exception of just a few of the largest size classes of some species, such as Lampanyctus crocodilus and N. elongatus that remain near the bottom.

  17. New host records for Anenterotrematidae, Lecithodendriidae and Urotrematidae trematodes in bats from Argentina, with redescription of Anenterotrema liliputianum Nuevos registros de trematodos Anenterotrematidae, Lecitodendriidae y Urotrematidae en murciélagos de Argentina y redescripción de Anenterotrema liliputianum

    Directory of Open Access Journals (Sweden)

    Lía I. Lunaschi

    2010-08-01

    Full Text Available Anenterotrema liliputianum (Travassos, 1928 (Anenterotrematidae is redescribed based on the type specimens fromMolossus molossus (Pallas and Phyllostomus elongatus (Geoffroy from Brazil, and also on new specimens collected from the Dwarf Dog-faced Bat, Molossops temminckii (Burmeister (Molossidae in Argentina. In addition, we report the finding of Gymnoacetabulum talaveraensis (Lunaschi, 2002, Ochoterenatrema labda Caballero, 1943 (Lecithodendriidae, and Urotrema scabridum Braum, 1900 (Urotrematidae parasitizing Vespertilionidae and Molossidae bats from Buenos Aires and Misiones provinces, and measurements, prevalence, and mean intensity for these trematodes are provided. In addition, the host spectrum and distribution for A. liliputianum and O. labda is increased, and U. scabridum is recorded for the first time parasitizing bats in Argentina.Se re-describe Anenterotrema liliputianum (Travassos, 1928 (Anenterotrematidae a partir de ejemplares tipo depositados en el Instituto Oswaldo Cruz recolectados de Molossus molossus (Pallas y Phyllostomus elongatus (Geoffroy de Brasil y de ejemplares hallados parasitando al moloso pigmeo Molossops temminckii (Burmeister (Molossidae en Argentina. Se registra además, el hallazgo de Gymnoacetabulum talaveraensis (Lunaschi, 2002, Ochoterenatrema labda Caballero, 1943 (Lecithodendriidae y Urotrema scabridum Braum, 1900 (Urotrematidae parasitando a murciélagos Vespertilionidae y Molosidae de las provincias de Buenos Aires y Misiones. Se proporcionan las medidas, prevalencia e intensidad media para estos digéneos. Además, se amplía el registro de hospedadores y localidades para A. liliputianum y O. labda y se encuentra por primera vez U. scabridum como parásito de quirópteros en la Argentina.

  18. Proteomic analysis of phosphoproteins sensitive to a phosphatidylinositol 3-kinase inhibitor, ZSTK474, by using SELDI-TOF MS

    Directory of Open Access Journals (Sweden)

    Yamori Takao

    2009-03-01

    Full Text Available Abstract Background Phosphoproteins play important roles in a vast series of biological processes. Recent proteomic technologies offer the comprehensive analyses of phosphoproteins. Recently, we demonstrated that surface-enhanced laser desorption/ionization time of flight mass (SELDI-TOF MS would detect phosphoproteins quantitatively, which was a new application of SELDI-TOF MS. Results We combined immobilized metal affinity chromatography (IMAC with SELDI-TOF MS. After SELDI-TOF MS analysis of IMAC-enrichment phosphoproteins from A549 cancer cells, a series of protein peaks at 12.9, 12.8, 12.7 and 12.6 kDa was obtained in a mass spectrum. The peak intensities of these proteins decreased after a phosphatase treatment and, interestingly, they also decreased when the cells were pre-treated with a novel phosphatidylinositol 3-kinase (PI3K inhibitor, ZSTK474, suggesting that these proteins were ZSTK474-sensitive phosphoproteins. Identity of the phosphoproteins, which were predicted as the multi-phosphorylated forms of 4E-binding protein 1 (4E-BP1 with the aid of TagIdent algorithm, was confirmed by immunoprecipitation and subsequent SELDI-TOF MS analysis. 4E-BP1 is a downstream component of the PI3K/Akt/mTOR pathway and it regulates protein synthesis. We also investigated the effect of ZSTK474 on 4E-BP1 phosphorylation using phospho-specific antibodies. ZSTK474, which have little inhibitory activity for mTOR, inhibited phosphorylation of Ser65, Thr70 and Thr37/46 in 4E-BP1. In contrast, rapamycin, an inhibitor of mTOR, blocked phosphorylation only of Ser65 and Thr70. These results suggest that ZSTK474 and rapamycin inhibited the phosphorylation of 4E-BP1 in a different manner. Conclusion We identified a group of ZSTK474-sensitive phosphoproteins as the multi-phosphorylated form of 4E-BP1 by combining IMAC, SELDI-TOF MS and antibodies.

  19. UV filters analyzed by isotope diluted TurboFlow-LC-MS/MS in urine from Danish children and adolescents

    DEFF Research Database (Denmark)

    Frederiksen, Hanne; Nielsen, Ole; Skakkebaek, Niels E

    2017-01-01

    between first morning and 24h urine levels of BP-3, BP-1 and 4-HBP from the same day was observed. CONCLUSION: Our project on UV filters analyzed by a new robust and sensitive LC-MS/MS method in Danish children and adolescents showed that almost all individuals were exposed to UV filters. Sun protection...... and adolescents (6-21 yrs). All 387 samples were collected during the autumn (Nov. 2007) and were analyzed by a new on-line TurboFlow-LC-MS/MS method developed for simultaneous biomonitoring of these nine UV filters in urine. RESULTS: BP-3 and BP-1 were detected in more than 80% of the 24h samples and were...

  20. Application of pulsed field gel electrophoresis to determine γ-ray-induced double-strand breaks in yeast chromosomal molecules

    International Nuclear Information System (INIS)

    Friedl, A.A.; Hahn, K.; Eckardt-Schupp, F.; Kellerer, A.M.; Beisker, W.

    1993-01-01

    The frequency of DNA double-strand breaks (dsb) was determined in yeast cells exposed to γ-rays under anoxic conditions. Genomic DNA of treated cells was separated by pulsed field gel electrophoresis, and two different approaches for the evaluation of the gels were employed: (1) The DNA mass distribution profile obtained by electrophoresis was compared to computed profiles, and the number of DSB per unit length was then derived in terms of a fitting procedure; (2) hybridization of selected chromosomes was performed, and a comparison of the hybridization signals in treated and untreated samples was then used to derive the frequency of dsb. The two assays gave similar results for the frequency of dsb ((1.07 ± 0.06) x 10 -9 Gy -1 bp -1 and (0.93 ± 0.09) x 10 -9 Gy -1 bp -1 , respectively). The dsb frequency was found to be linearly dependent on dose. (author)

  1. In Vivo Measurement of Drug Efficacy in Breast Cancer

    Science.gov (United States)

    2015-10-01

    HCC1937, HCC38, MCF-7, SKBR3 . Source: ATCC. 1-6 Dr. Giedt 100% Subtask 1b: Development of image processing techniques 3-12 Dr. Giedt 100% Subtask 1c...Growth, estradiol supplement necessary SKBR3 Average Growth, metastasis noted Page 6 MDA-MB-231- FUCCI HCC1395- H2B-Apple MCF-7-53-BP1 Figure 1

  2. Novel and highly potent histamine H3 receptor ligands. Part 3: an alcohol function to improve the pharmacokinetic profile.

    Science.gov (United States)

    Labeeuw, Olivier; Levoin, Nicolas; Poupardin-Olivier, Olivia; Calmels, Thierry; Ligneau, Xavier; Berrebi-Bertrand, Isabelle; Robert, Philippe; Lecomte, Jeanne-Marie; Schwartz, Jean-Charles; Capet, Marc

    2013-05-01

    Synthesis and biological evaluation of potent histamine H3 receptor antagonists incorporating a hydroxyl function are described. Compounds in this series exhibited nanomolar binding affinities for human receptor, illustrating a new possible component for the H3 pharmacophore. As demonstrated with compound BP1.4160 (cyclohexanol 19), the introduction of an alcohol function counter-intuitively allowed to reach high in vivo efficiency and favorable pharmacokinetic profile with reduced half-life. Copyright © 2013 Elsevier Ltd. All rights reserved.

  3. Identification and chromosomal localization of repeat sequences ...

    Indian Academy of Sciences (India)

    Unknown

    generate linkage maps of human and cattle as well as for other mammalian ... through BAC end sequencing and identification in silico. (Larkin et al. ... LINEs. 2,344. 653,391 bp. 19.80. LTR elements. 500. 124,761 bp. 3.78. DNA elements. 267. 46,569 bp. 1.14. Total interspersed repeats. 1,105,666 bp. 33.51. Small RNA. 26.

  4. Bipolar Disorder and the TCI: Higher Self-Transcendence in Bipolar Disorder Compared to Major Depression

    Directory of Open Access Journals (Sweden)

    James A. Harley

    2011-01-01

    With correction for mood state, total harm avoidance (HA was higher than unaffected in both MDD and BP groups, but the mood disorder groups did not differ from each other. However, BP1 individuals had higher self-transcendence (ST than those with MDD and unaffected relatives. HA may reflect a trait marker of mood disorders whereas high ST may be specific to BP. As ST is heritable, genes that affect ST may be of relevance for vulnerability to BP.

  5. Promising mutant varieties of groundnut evolved through gamma irradiation

    International Nuclear Information System (INIS)

    Sinha, P.K.; Rahman, H.

    1980-01-01

    The Chotanagpur plateau region of Bihar is the main potential area for groundnut cultivation in the State. Var. AK 12-24 - an early, bunch type - has been the predominant variety under cultivation. Because of special nature of soil and rainfall pattern of this area, it is desirable to evolve a variety with early to mid-early maturity and bunch habit, but with improved yield potential over the ruling var. AK 12-24. Two bold podded mutants BP 1 and BP 2 were obtained throuo.h gamma irradiation of var 41-C which is a late maturing variety (135-140 days), spreading in habit and with medium kernel and pod size, whereas the mutant varieties have early (110-115 days for BP 1) to mid-early (115-120 days for BP 2) maturity, bunch habit and bold kernel and pods (HKW 55-60 gm for BP 1 and 60-66 gms for BP 2). Both have 20-25% higher yield potential over AK 12-24. The results of 3 years' yield evaluation trials at Kanke and one year minikit trials at different locations in Bihar show that BP 1 and BP 2 have significantly outyielded the check AK 12-24 and were at par with each other. Both varieties -because of their bold seededness - come under HPS type and have good export market. These varieties have now been released by the Rajendra Agricultural University as Sonya Bold 1 and Sonya Bold 2 for cultivation in Bihar. (author)

  6. N-terminal PDZ-like domain of chromatin organizer SATB1 ...

    Indian Academy of Sciences (India)

    as a global repressor via recruitment of CtBP1:HDAC1-containing co-repressors to its binding targets. The. N-terminal PSD95/Dlg-A/ZO-1 (PDZ)-like domain of SATB1 mediates interactions with several chromatin proteins. In the present study, we set out to address whether the PDZ-domain-mediated interactions of SATB1 ...

  7. Exercise in ZDF rats does not attenuate weight gain, but prevents hyperglycemia concurrent with modulation of amino acid metabolism and AKT/mTOR activation in skeletal muscle.

    Science.gov (United States)

    Adegoke, Olasunkanmi A J; Bates, Holly E; Kiraly, Michael A; Vranic, Mladen; Riddell, Michael C; Marliss, Errol B

    2015-08-01

    Protein metabolism is altered in obesity, accompanied by elevated plasma amino acids (AA). Previously, we showed that exercise delayed progression to type 2 diabetes in obese ZDF rats with maintenance of β cell function and reduction in hyperglucocorticoidemia. We hypothesized that exercise would correct the abnormalities we found in circulating AA and other indices of skeletal muscle protein metabolism. Male obese prediabetic ZDF rats (7-10/group) were exercised (swimming) 1 h/day, 5 days/week from ages 6-19 weeks, and compared with age-matched obese sedentary and lean ZDF rats. Food intake and weight gain were unaffected. Protein metabolism was altered in obese rats as evidenced by increased plasma concentrations of essential AA, and increased muscle phosphorylation (ph) of Akt(ser473) (187%), mTOR(ser2448) (140%), eIF4E-binding protein 1 (4E-BP1) (111%), and decreased formation of 4E-BP1*eIF4E complex (75%, 0.01 ≤ p ≤ 0.05 for all measures) in obese relative to lean rats. Exercise attenuated the increase in plasma essential AA concentrations and muscle Akt and mTOR phosphorylation. Exercise did not modify phosphorylation of S6K1, S6, and 4E-BP1, nor the formation of 4E-BP1*eIF4E complex, mRNA levels of ubiquitin or the ubiquitin ligase MAFbx. Positive correlations were observed between ph-Akt and fed circulating branched-chain AA (r = 0.56, p = 0.008), postprandial glucose (r = 0.42, p = 0.04) and glucose AUC during an IPGTT (r = 0.44, p = 0.03). Swimming exercise-induced attenuation of hyperglycemia in ZDF rats is independent of changes in body weight and could result in part from modulation of muscle AKT activation acting via alterations of systemic AA metabolism.

  8. BLM protein mitigates formaldehyde-induced genomic instability.

    Science.gov (United States)

    Kumari, Anuradha; Owen, Nichole; Juarez, Eleonora; McCullough, Amanda K

    2015-04-01

    Formaldehyde is a reactive aldehyde that has been classified as a class I human carcinogen by the International Agency for Cancer Research. There are growing concerns over the possible adverse health effects related to the occupational and environmental human exposures to formaldehyde. Although formaldehyde-induced DNA and protein adducts have been identified, the genomic instability mechanisms and the cellular tolerance pathways associated with formaldehyde exposure are not fully characterized. This study specifically examines the role of a genome stability protein, Bloom (BLM) in limiting formaldehyde-induced cellular and genetic abnormalities. Here, we show that in the absence of BLM protein, formaldehyde-treated cells exhibited increased cellular sensitivity, an immediate cell cycle arrest, and an accumulation of chromosome radial structures. In addition, live-cell imaging experiments demonstrated that formaldehyde-treated cells are dependent on BLM for timely segregation of daughter cells. Both wild-type and BLM-deficient formaldehyde-treated cells showed an accumulation of 53BP1 and γH2AX foci indicative of DNA double-strand breaks (DSBs); however, relative to wild-type cells, the BLM-deficient cells exhibited delayed repair of formaldehyde-induced DSBs. In response to formaldehyde exposure, we observed co-localization of 53BP1 and BLM foci at the DSB repair site, where ATM-dependent accumulation of formaldehyde-induced BLM foci occurred after the recruitment of 53BP1. Together, these findings highlight the significance of functional interactions among ATM, 53BP1, and BLM proteins as responders associated with the repair and tolerance mechanisms induced by formaldehyde. Copyright © 2015 Elsevier B.V. All rights reserved.

  9. New Approaches for Early Detection of Breast Tumor Invasion or Progression

    Science.gov (United States)

    2004-08-01

    messenger RNA level during breast carcinogenesis. Cancer Res 1997, 57:4992-4996 8. Lawrence JA, Merino MJ, Simpson JF, Manrow RE, Page DL, Steeg PS: A high...Kurek R, Wallwiener D, Merino MJ, Petricoin EF, 3rd, Zhao Y, Steeg PS: Proteomics of human breast ductal carcinoma in situ. Cancer Res 2002, 62:6740...JJ, Davenport GJ, Orenstein JM, Gutierrez P, Simmens SJ, Abraham J, Poola I, Stephan DA, Berg PE. Correlation of expression of BP1, a homeobox gene

  10. Intramolecular Binding of the Rad9 C Terminus in the Checkpoint Clamp Rad9-Hus1-Rad1 Is Closely Linked with Its DNA Binding.

    Science.gov (United States)

    Takeishi, Yukimasa; Iwaya-Omi, Rie; Ohashi, Eiji; Tsurimoto, Toshiki

    2015-08-07

    The human checkpoint clamp Rad9-Hus1-Rad1 (9-1-1) is loaded onto chromatin by its loader complex, Rad17-RFC, following DNA damage. The 120-amino acid (aa) stretch of the Rad9 C terminus (C-tail) is unstructured and projects from the core ring structure (CRS). Recent studies showed that 9-1-1 and CRS bind DNA independently of Rad17-RFC. The DNA-binding affinity of mutant 9(ΔC)-1-1, which lacked the Rad9 C-tail, was much higher than that of wild-type 9-1-1, suggesting that 9-1-1 has intrinsic DNA binding activity that manifests in the absence of the C-tail. C-tail added in trans interacted with CRS and prevented it from binding to DNA. We narrowed down the amino acid sequence in the C-tail necessary for CRS binding to a 15-aa stretch harboring two conserved consecutive phenylalanine residues. We prepared 9-1-1 mutants containing the variant C-tail deficient for CRS binding, and we demonstrated that the mutant form restored DNA binding as efficiently as 9(ΔC)-1-1. Furthermore, we mapped the sequence necessary for TopBP1 binding within the same 15-aa stretch, demonstrating that TopBP1 and CRS share the same binding region in the C-tail. Indeed, we observed their competitive binding to the C-tail with purified proteins. The importance of interaction between 9-1-1 and TopBP1 for DNA damage signaling suggests that the competitive interactions of TopBP1 and CRS with the C-tail will be crucial for the activation mechanism. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  11. Simultaneous inhibition of mTOR-containing complex 1 (mTORC1) and MNK induces apoptosis of cutaneous T-cell lymphoma (CTCL) cells

    DEFF Research Database (Denmark)

    Marzec, Michal Tomasz; Liu, Xiaobin; Wysocka, Maria

    2011-01-01

    mTOR kinase forms the mTORC1 complex by associating with raptor and other proteins and affects a number of key cell functions. mTORC1 activates p70S6kinase 1 (p70S6K1) and inhibits 4E-binding protein 1 (4E-BP1). In turn, p70S6K1 phosphorylates a S6 protein of the 40S ribosomal subunit (S6rp) and 4E...

  12. DNA damage follows repair factor depletion and portends genome variation in cancer cells after pore migration

    OpenAIRE

    Irianto, Jerome; Xia, Yuntao; Pfeifer, Charlotte R.; Athirasala, Avathamsa; Ji, Jiazheng; Alvey, Cory; Tewari, Manu; Bennett, Rachel; Harding, Shane M.; Liu, Andrea; Greenberg, Roger A.; Discher, Dennis E.

    2016-01-01

    Migration through micron-size constrictions has been seen to rupture the nucleus, release nuclear-localized GFP, and cause localized accumulations of ectopic 53BP1 – a DNA repair protein. Here, constricted migration of two human cancer cell types and primary mesenchymal stem cells (MSC) increases DNA breaks throughout the nucleoplasm as assessed by endogenous damage markers and by electrophoretic ‘comet’ measurements. Migration also causes multiple DNA repair proteins to segregate away from D...

  13. GSM microwaves and 50 Hz electromagnetic field induce stress response but not apoptosis in human lymphocytes from hypersensitive and healthy persons

    International Nuclear Information System (INIS)

    Belyaev, I.; Hillert, L.; Prototpopova, M.; Selivanova, G.; Harms-Ringdahl, M.

    2003-01-01

    We used specific conditions of exposure to microwaves from a GSM (global system for mobile communication) mobile phone (915 MHz, SAR=0.4 mW/g) and 50 Hz electromagnetic field (EMF, 15 μT amplitude) to investigate the response of lymphocytes from healthy subjects and from persons reporting hypersensitivity to EMF. The groups of hypersensitive and healthy donors were matched by gender and age and the data were analyzed in blind. The changes in chromatin conformation were measured with the method of anomalous viscosity time dependencies (AVTD). 53BP1 protein, which has been shown to co-localize in foci with DNA double strand breaks (DSB), was analyzed by immunostaining in situ. Exposure either to GSM microwaves or EMF/50 Hz resulted in significant condensation of chromatin, which was similar to the effect of heat shock at 41deg C. These effects varied between donors with a trend for prolonged condensation of chromatin in the cells from hypersensitive subjects. Cells from subjects, which were classified as pronounced hypersensitivity, responded to GSM /ELF stronger than cells from matched control subjects, but these differences in responses need to be confirmed in a larger study group. Neither GSM nor ELF exposure induced formation of 53BP1 foci. In contrary, distinct decrease in background level of 53BP1 signaling was observed upon these exposures as well as after heat shock treatments. This decrease correlated with the AVTD data and may indicate decrease in accessibility of 53BP1 to antibodies because of stress-induced chromatin condensation. No apoptosis was induced by exposure to ELF/50 Hz and GSM microwaves. In conclusion, ELF magnetic fields and GSM microwaves under specified conditions of exposure induced stress response in lymphocytes from healthy and hypersensitive donors

  14. Phenotypic variability in Angelman syndrome: comparison among different deletion classes and between deletion and UPD subjects.

    Science.gov (United States)

    Varela, Monica Castro; Kok, Fernando; Otto, Paulo Alberto; Koiffmann, Celia Priszkulnik

    2004-12-01

    Angelman syndrome (AS) can result from either a 15q11-q13 deletion (del), paternal uniparental disomy (UPD), imprinting, or UBE3A mutations. Here, we describe the phenotypic and behavioral variability detected in 49 patients with different classes of deletions and nine patients with UPD. Diagnosis was made by methylation pattern analysis of exon 1 of the SNRPN-SNURF gene and by microsatellite profiling of loci within and outside the 15q11-q13 region. There were no major phenotypic differences between the two main classes (BP1-BP3; BP2-BP3) of AS deletion patients, except for the absence of vocalization, more prevalent in patients with BP1-BP3 deletions, and for the age of sitting without support, which was lower in patients with BP2-BP3 deletions. Our data suggest that gene deletions (NIPA1, NIPA2, CYF1P1, GCP5) mapped to the region between breakpoints BP1 and BP2 may be involved in the severity of speech impairment, since all BP1-BP3 deletion patients showed complete absence of vocalization, while 38.1% of the BP2-BP3 deletion patients were able to pronounce syllabic sounds, with doubtful meaning. Compared to UPD patients, deletion patients presented a higher incidence of swallowing disorders (73.9% del x 22.2% UPD) and hypotonia (73.3% del x 28.57% UPD). In addition, children with UPD showed better physical growth, fewer or no seizures, a lower incidence of microcephaly, less ataxia and higher cognitive skills. As a consequence of their milder or less typical phenotype, AS may remain undiagnosed, leading to an overall underdiagnosis of the disease.

  15. Heterochromatinization associated with cell differentiation as a model to study DNA double strand break induction and repair in the context of higher-order chromatin structure

    Czech Academy of Sciences Publication Activity Database

    Falk, Martin; Lukášová, Emilie; Štefančíková, Lenka; Baranová, E.; Falková, Iva; Ježková, L.; Davídková, Marie; Bačíková, Alena; Vachelová, Jana; Michaelidesová, Anna; Kozubek, Stanislav

    2014-01-01

    Roč. 83, Jan (2014), s. 177-185 ISSN 0969-8043 R&D Projects: GA MŠk(CZ) LD12039 Institutional support: RVO:68081707 ; RVO:61389005 Keywords : DNA double strand break (DSB) repair * Immature and terminally differentiated granulocytes * gamma H2AX/53BP1 repair foci Subject RIV: BO - Biophysics; BO - Biophysics (UJF-V) Impact factor: 1.231, year: 2014

  16. siRNA Screen Identifies Trafficking Host Factors that Modulate Alphavirus Infection

    Science.gov (United States)

    2016-05-20

    of host modulators of virus infection Scott C Weaver, M.S., Ph.D. Professor, Institute for Human Infections and Immunity , The University of Texas...Koyuncu OO, Enquist LW (2011) Subversion of the actin cytoskeleton during 885 viral infection. Nat Rev Microbiol 9: 427-439. 886 40. Sanchez EG...Imelli N, Boucke K, et al. (2008) Subversion of CtBP1-891 controlled macropinocytosis by human adenovirus serotype 3. EMBO J 27: 956-969. 892 43

  17. Visualization of complex DNA damage along accelerated ions tracks

    Science.gov (United States)

    Kulikova, Elena; Boreyko, Alla; Bulanova, Tatiana; Ježková, Lucie; Zadneprianetc, Mariia; Smirnova, Elena

    2018-04-01

    The most deleterious DNA lesions induced by ionizing radiation are clustered DNA double-strand breaks (DSB). Clustered or complex DNA damage is a combination of a few simple lesions (single-strand breaks, base damage etc.) within one or two DNA helix turns. It is known that yield of complex DNA lesions increases with increasing linear energy transfer (LET) of radiation. For investigation of the induction and repair of complex DNA lesions, human fibroblasts were irradiated with high-LET 15N ions (LET = 183.3 keV/μm, E = 13MeV/n) and low-LET 60Co γ-rays (LET ≈ 0.3 keV/μm) radiation. DNA DSBs (γH2AX and 53BP1) and base damage (OGG1) markers were visualized by immunofluorecence staining and high-resolution microscopy. The obtained results showed slower repair kinetics of induced DSBs in cells irradiated with accelerated ions compared to 60Co γ-rays, indicating induction of more complex DNA damage. Confirming previous assumptions, detailed 3D analysis of γH2AX/53BP1 foci in 15N ions tracks revealed more complicated structure of the foci in contrast to γ-rays. It was shown that proteins 53BP1 and OGG1 involved in repair of DNA DSBs and modified bases, respectively, were colocalized in tracks of 15N ions and thus represented clustered DNA DSBs.

  18. Structural and Biochemical Basis for Mannan Utilization by Caldanaerobius polysaccharolyticus Strain ATCC BAA-17*

    Science.gov (United States)

    Chekan, Jonathan R.; Kwon, In Hyuk; Agarwal, Vinayak; Dodd, Dylan; Revindran, Vanessa; Mackie, Roderick I.; Cann, Isaac; Nair, Satish K.

    2014-01-01

    Hemicelluloses, the polysaccharide component of plant cell walls, represent one of the most abundant biopolymers in nature. The most common hemicellulosic constituents of softwoods, such as conifers and cycads, are mannans consisting of a 1,4-linked β-mannopyranosyl main chain with branch decorations. Efforts toward the utilization of hemicellulose for bioconversion into cellulosic biofuels have resulted in the identification of several families of glycoside hydrolases that can degrade mannan. However, effective biofermentation of manno-oligosaccharides is limited by a lack of appropriate uptake route in ethanologenic organisms. Here, we used transcriptome sequencing to gain insights into mannan degradation by the thermophilic anaerobic bacterium Caldanaerobius polysaccharolyticus. The most highly up-regulated genes during mannan fermentation occur in a cluster containing several genes encoding enzymes for efficient mannan hydrolysis as well as a solute-binding protein (CpMnBP1) that exhibits specificity for short mannose polymers but exhibited the flexibility to accommodate branched polysaccharide decorations. Co-crystal structures of CpMnBP1 in complex with mannobiose (1.4-Å resolution) and mannotriose (2.2-Å resolution) revealed the molecular rationale for chain length and oligosaccharide specificity. Calorimetric analysis of several active site variants confirmed the roles of residues critical to the function of CpMnBP1. This work represents the first biochemical characterization of a mannose-specific solute-binding protein and provides a framework for engineering mannan utilization capabilities for microbial fermentation. PMID:25342756

  19. Specific immunologic recognition of the tumor-specific E2A-PBX1 fusion-point antigen in t(1;19)-positive pre-B cells.

    Science.gov (United States)

    Berendes, P; Hoogeveen, A; van Dijk, M; van Denderen, J; van Ewijk, W

    1995-08-01

    The t(1;19) translocation is the most commonly observed chromosomal translocation in childhood acute lymphoblastic leukemia (ALL). Its presence among pre-B cell ALL cases, has been associated with a poor prognosis. Two genes, E2A and PBX1, are involved in this t(1;19) translocation. As a consequence, parts of the E2A and PBX1 genes are fused, resulting in a chimeric E2A-PBX1 gene, encoding chimeric E2A-PBX1 proteins. As such, the amino acid sequence at the fusion site represents a unique tumor-specific determinant. We report on the generation of a polyclonal antiserum, termed BP 1/19, raised against the tumor-specific E2A-PBX1 junction of E2A-PBX1 proteins. The specificity of antiserum BP 1/19 for the E2A-PBX1 fusion-point is demonstrated at the peptide and at the protein level. Furthermore, specific binding of antiserum BP 1/19 to t(1;19) positive cells was shown using immunofluorescence techniques. The study shows that: (1) the tumor-specific fusion-point epitope on E2A-PBX1 proteins is presented in an antigenic fashion, and (2) this particular fusion-point epitope can be used in immunological marker analysis using fluorescence microscopy.

  20. Phosphorylation of ribosomal protein S6 mediates compensatory renal hypertrophy

    Science.gov (United States)

    Xu, Jinxian; Chen, Jianchun; Dong, Zheng; Meyuhas, Oded; Chen, Jian-Kang

    2014-01-01

    The molecular mechanism underlying renal hypertrophy and progressive nephron damage remains poorly understood. Here we generated congenic ribosomal protein S6 (rpS6) knockin mice expressing non-phosphorylatable rpS6 and found that uninephrectomy-induced renal hypertrophy was significantly blunted in these knockin mice. Uninephrectomy-induced increases in cyclin D1 and decreases in cyclin E in the remaining kidney were attenuated in the knockin mice compared to their wild-type littermates. Uninephrectomy induced rpS6 phosphorylation in the wild type mice; however, no rpS6 phosphorylation was detected in uninephrectomized or sham-operated knockin mice. Nonetheless, uninephrectomy stimulated comparable 4E-BP1 phosphorylation in both knockin and wild type mice, indicating that mTORC1 was still activated in the knockin mice. Moreover, the mTORC1 inhibitor rapamycin prevented both rpS6 and 4E-BP1 phosphorylation, significantly blunted uninephrectomy-induced renal hypertrophy in wild type mice, but did not prevent residual renal hypertrophy despite inhibiting 4E-BP1 phosphorylation in uninephrectomized knockin mice. Thus, both genetic and pharmacological approaches unequivocally demonstrate that phosphorylated rpS6 is a downstream effector of the mTORC1-S6K1 signaling pathway mediating renal hypertrophy. Hence, rpS6 phosphorylation facilitates the increase in cyclin D1 and decrease in cyclin E1 that underlie the hypertrophic nature of uninephrectomy-induced kidney growth. PMID:25229342

  1. Antisense expression of an Arabidopsis ran binding protein renders transgenic roots hypersensitive to auxin and alters auxin-induced root growth and development by arresting mitotic progress

    Science.gov (United States)

    Kim, S. H.; Arnold, D.; Lloyd, A.; Roux, S. J.

    2001-01-01

    We cloned a cDNA encoding an Arabidopsis Ran binding protein, AtRanBP1c, and generated transgenic Arabidopsis expressing the antisense strand of the AtRanBP1c gene to understand the in vivo functions of the Ran/RanBP signal pathway. The transgenic plants showed enhanced primary root growth but suppressed growth of lateral roots. Auxin significantly increased lateral root initiation and inhibited primary root growth in the transformants at 10 pM, several orders of magnitude lower than required to induce these responses in wild-type roots. This induction was followed by a blockage of mitosis in both newly emerged lateral roots and in the primary root, ultimately resulting in the selective death of cells in the tips of both lateral and primary roots. Given the established role of Ran binding proteins in the transport of proteins into the nucleus, these findings are consistent with a model in which AtRanBP1c plays a key role in the nuclear delivery of proteins that suppress auxin action and that regulate mitotic progress in root tips.

  2. Depletion of elongation initiation factor 4E binding proteins by CRISPR/Cas9 enhances the antiviral response in porcine cells.

    Science.gov (United States)

    Ramírez-Carvajal, Lisbeth; Singh, Neetu; de los Santos, Teresa; Rodríguez, Luis L; Long, Charles R

    2016-01-01

    Type I interferons (IFNs) are key mediators of the innate antiviral response in mammalian cells. Elongation initiation factor 4E binding proteins (4E-BPs) are translational controllers of interferon regulatory factor 7 (IRF-7), the "master regulator" of IFN transcription. Previous studies have suggested that mouse cells depleted of 4E-BPs are more sensitive to IFNβ treatment and had lower viral loads as compared to wild type (WT) cells. However, such approach has not been tested as an antiviral strategy in livestock species. In this study, we tested the antiviral activity of porcine cells depleted of 4E-BP1 by a Clustered Regularly Interspaced Short Palindromic Repeats (CRISPR)/CRISPR-associated protein-9 nuclease (Cas9) genome engineering system. We found that 4E-BP1 knockout (KO) porcine cells had increased expression of IFNα and β, IFN stimulated genes, and significant reduction in vesicular stomatitis virus titer as compare to WT cells. No phenotypical changes associated with CRISPR/Cas9 manipulation were observed in 4E-BP1 KO cells. This work highlights the use of the CRISPR/Cas9 system to enhance the antiviral response in porcine cells. Copyright © 2015 Elsevier B.V. All rights reserved.

  3. Calcein represses human papillomavirus 16 E1-E2 mediated DNA replication via blocking their binding to the viral origin of replication.

    Science.gov (United States)

    Das, Dipon; Smith, Nathan W; Wang, Xu; Richardson, Stacie L; Hartman, Matthew C T; Morgan, Iain M

    2017-08-01

    Human papillomaviruses are causative agents in several human diseases ranging from genital warts to ano-genital and oropharyngeal cancers. Currently only symptoms of HPV induced disease are treated; there are no antivirals available that directly target the viral life cycle. Previously, we determined that the cellular protein TopBP1 interacts with the HPV16 replication/transcription factor E2. This E2-TopBP1 interaction is essential for optimal E1-E2 DNA replication and for the viral life cycle. The drug calcein disrupts the interaction of TopBP1 with itself and other host proteins to promote cell death. Here we demonstrate that calcein blocks HPV16 E1-E2 DNA replication via blocking the viral replication complex forming at the origin of replication. This occurs at non-toxic levels of calcein and demonstrates specificity as it does not block the ability of E2 to regulate transcription. We propose that calcein or derivatives could be developed as an anti-HPV therapeutic. Copyright © 2017 Elsevier Inc. All rights reserved.

  4. Docking of calcium-binding protein 1 of Entamoeba histolytica using FDA approved drugs

    Directory of Open Access Journals (Sweden)

    Zahid Ahmad

    2017-11-01

    Full Text Available Objective: To find out an alternative potential inhibitor of Entamoeba histolytica calciumbinding protein 1 (EhCaBP1 through in silico studies. Methods: An attempt was made to find a new FDA approved, and cost effective alternative drug for amoebiasis. Sequence of the EhCaBP1 of Entamoeba histolytica was obtained through searching the UniProt database and protein BLAST was performed. The 3D structure of EhCaBP1 was retrieved from Research Collaboratory for Structural Bioinformatics and visualized using Discovery Studio Visualizer® 3.1. A total of 100 drugs were selected and docked using Patchdock and the different sorts of interactions with the target protein were studied using GS viewer, Ligplot and Discovery Studio visualizer. Results: Among the 100 selected drugs, dolutegravir, cefazedone and ergotamine showed large number of interactions with the target protein. Conclusions: The drugs cefazedone and ergotamine showed twenty and nineteen different sorts of interactions respectively with the target protein. These interactions may lead to metabolic changes and can subsequently stop the growth and cause the death of the parasite. Further investigations and experimental analysis are required to unveil the effects of these drugs.

  5. DNA-PK inhibition causes a low level of H2AX phosphorylation and homologous recombination repair in Medaka (Oryzias latipes) cells

    Energy Technology Data Exchange (ETDEWEB)

    Urushihara, Yusuke [Department of Integrated Biosciences, Graduate School of Frontier Sciences, The University of Tokyo, Chiba 277-8562 (Japan); Kobayashi, Junya [Department of Genome Repair Dynamics, Radiation Biology Center, Kyoto University, Kyoto 606-8501 (Japan); Matsumoto, Yoshihisa [Research Laboratory for Nuclear Reactors, Tokyo Institute of Technology, Tokyo 152-8550 (Japan); Komatsu, Kenshi [Department of Genome Repair Dynamics, Radiation Biology Center, Kyoto University, Kyoto 606-8501 (Japan); Oda, Shoji [Department of Integrated Biosciences, Graduate School of Frontier Sciences, The University of Tokyo, Chiba 277-8562 (Japan); Mitani, Hiroshi, E-mail: mitani@k.u-tokyo.ac.jp [Department of Integrated Biosciences, Graduate School of Frontier Sciences, The University of Tokyo, Chiba 277-8562 (Japan)

    2012-12-14

    Highlights: Black-Right-Pointing-Pointer We investigated the effect of DNA-PK inhibition on DSB repair using fish cells. Black-Right-Pointing-Pointer A radiation sensitive mutant RIC1 strain showed a low level of DNA-PK activity. Black-Right-Pointing-Pointer DNA-PK dysfunction leads defects in HR repair and DNA-PKcs autophosphorylation. Black-Right-Pointing-Pointer DNA-PK dysfunction leads a slight increase in the number of 53BP1 foci after DSBs. Black-Right-Pointing-Pointer DNA-PK dysfunction leads an alternative NHEJ that depends on 53BP1. -- Abstract: Nonhomologous end joining (NHEJ) and homologous recombination (HR) are known as DNA double-strand break (DSB) repair pathways. It has been reported that DNA-PK, a member of PI3 kinase family, promotes NHEJ and aberrant DNA-PK causes NHEJ deficiency. However, in this study, we demonstrate that a wild-type cell line treated with DNA-PK inhibitor and a mutant cell line with dysfunctional DNA-PK showed decreased HR efficiency in fish cells (Medaka, Oryzias latipes). Previously, we reported that the radiation-sensitive mutant RIC1 strain has a defect in the Histone H2AX phosphorylation after {gamma}-irradiation. Here, we showed that a DNA-PK inhibitor, NU7026, treatment resulted in significant reduction in the number of {gamma}H2AX foci after {gamma}-irradiation in wild-type cells, but had no significant effect in RIC1 cells. In addition, RIC1 cells showed significantly lower levels of DNA-PK kinase activity compared with wild-type cells. We investigated NHEJ and HR efficiency after induction of DSBs. Wild-type cells treated with NU7026 and RIC1 cells showed decreased HR efficiency. These results indicated that aberrant DNA-PK causes the reduction in the number of {gamma}H2AX foci and HR efficiency in RIC1 cells. We performed phosphorylated DNA-PKcs (Thr2609) and 53BP1 focus assay after {gamma}-irradiation. RIC1 cells showed significant reduction in the number of phosphorylated DNA-PKcs foci and no deference in the

  6. Diet and feeding strategies of mesopelagic fishes in the western Mediterranean

    Science.gov (United States)

    Bernal, Ainhoa; Olivar, M. Pilar; Maynou, Francesc; Fernández de Puelles, M. Luz

    2015-06-01

    Myctophids, gonostomatids and sternoptychids are the most abundant teleosteans worldwide and constitute an important assemblage of the mesopelagic ecosystem, functioning as vehicles of energy and matter through trophic webs. This study concentrates on the trophic ecology of the most abundant mesopelagic fishes of the western Mediterranean (WM) based on stomach content analysis. The myctophids (in this study: Benthosema glaciale, Ceratoscopelus maderensis, Lobianchia dofleini, Myctophum punctatum, Hygophum benoiti, Hygophum hygomii, Lampanyctus crocodilus, Lampanyctus pusillus and Notoscopelus elongatus) perform extensive diel migrations across the water column, between the surface to as deep as 1000 m, interacting with plankton and micronekton at multiple depths, and generally feeding in the epipelagic layers at night. In contrast, the gonostomatids Cyclothone braueri, Cyclothone pygmaea, and the sternoptychid Argyropelecus hemigymnus remain below epipelagic layers, feeding at different times throughout the day and night. The diet composition, trophic niche breadth and prey selectivity of 11 of these fish species were determined for juvenile and adult individuals from two surveys performed in December 2009 and July 2010 in the western Mediterranean Sea. The number of prey items varied among species, e.g. Myctophum punctatum was the species with the highest feeding intensity, reaching ca. 700 prey items in a stomach, whereas the mean number of prey in Cyclothone braueri was low (usually 1 or 2 prey per stomach). A dietary shift towards larger prey was evident from juveniles to the largest and oldest adult individuals, despite trophic niche breadths did not increase with body length for any of these mesopelagic species. The diets of the small gonostomatids, sternoptychid and early juveniles of myctophids were dominated by non-calanoid copepods, ostracods, and other small zooplankton, whereas medium-sized myctophids, e.g. L. dofleini or H. benoiti, preyed mainly on

  7. Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá Estudio Palinológico de los 35 mts. Superiores de la Sección Tarragona, Sabana de Bogotá

    Directory of Open Access Journals (Sweden)

    Dueñas J. Hernando

    1979-12-01

    Full Text Available En el presente trabajo se da a conocer el resulrado del estudio palinológico de los 35 metros superiores de la sección Tarragona, localizada en la Sabana de Bogotá, a 2.560 metros sobre el nivel del mar. Se describen 2 géneros (Spirotremesporites, Striadyadosporites y 5 especies(Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus y Striadyadosporites constrictus de fungi fósil, 14 tipos de polen, 8 tipos de esporas triletes, 4 tipos de Pediastrum y un tipo especial de Chlorococcales. Con base en la relación de polen de elementos de páramo a polen de elementos de bosque (Pp/Pb y a la estrarigrafía, se dividió el diagrama depolen en 8 zonas climáticas (vegetación, con las cuales fue posible correlacionar la sección Tarragona con otras secciones levantadas en la Sabana de Bogotá y regiones aledañas. Utilizando esta correlación y las fechas de edad absoluta que se han obtenido en las diferentes secciones del área, fue posible efectuar una correlacion tentativa con las unidades cronoestratigráficas europeas.  Los 35 metros superiores de la sección Tarragona representan la historia geológica de por lo menos los últimos 500.000 años de la Sabana de Bogotá.In this study it is given the result of the palynological study of the uppermost 35 meters of the Tarragona section, located in the Sabana de Bogotá at an altitude of 2.560 meters above sea level.  It is described: 2 genus (Spirotremesporites, Striadyadosporites and 5 species (Spirotremesporites simplex, Spirotremesporites multiplex, Spirotremesporites ecuatorialis, Striadyadosporites elongatus and Striadyadosporites constrictus of fossil fungi, 14 types of pollen, 8 types of trilete spores, 4 types of Pediastrum and one special type of Chlorococcales.  On the basis of the relation, Pollen of paramo elements to Pollen of forest elements (Pp/Pb and the stratigraphy it was possible to divide the pollen diagram

  8. Seasonal dynamic of the occurrence of the gregarines infection of Harpalus rufipes (Coleoptera, Carabidae in agroecosystem

    Directory of Open Access Journals (Sweden)

    D. Y. Reshetnyak

    2015-08-01

    Full Text Available Relationships in the “parasite-host” system are closely interrelated and occur at all levels from the molecular to behavioral and population ones. There are two models of realization of these relations. The first case is when the parasites are uniformly distributed in the host population. High extensiveness of invasion is accompanied by its low intensity. The second case is when a part of host population is infected with parasites, but the negative impact is manifested to the maximum extent. Invasion of the ground beetle Harpalus rufipes (De Geer, 1774, dwelling in sweet corn agroecosystems located in the vicinity of Dnipropetrovsk near Doslidnoe village, by several gregarines species is investigated in this study. H. rufipes is an abundant, ubiquitous species, living in extremely wide range of terrestrial ecosystems, with especially high populations inhabiting anthropogenically transformed environments. H. rufipes has a wide range of feeding. This species is distributed in the Central and Eastern Europe, and introduced to North America. Gregarines were found in the intestines of 20 individuals of H. rufipes from 190 (10.5%: Gregarina ovata Dufour, 1828, G. steini Berndt, 1902, G. amarae (Hammerschmidt, 1839 Frantzius, 1848, Clitellocephalus ophoni (Tuzet and Ormieres, 1956 Clopton, 2002, Torogregarina sphinx Clopton, 1998, Gigaductus macrospora Filipponi, 1948 and G. elongatus (Moriggi, 1943 Filipponi, 1948. There is high level of infestation of C. ophoni and G. steini. At the same time, not more than three species of the gregarines were localized in the beetle body. Seasonal dynamic of occurrence of the gregarines is as follows. Maximal indices of occurrence are found at the end of August (22.2% and minimal ones at the end of June (4.8%. The highest total number of gregarines (383 ind. is recorded at the end of August, the lowest one is fixed at the beginning of September (33 ind.. Indices of gregarine species dominance are as follows

  9. Perfil de ácidos grasos de diversas especies de pescados consumidos en México

    Directory of Open Access Journals (Sweden)

    María Isabel Castro González

    2013-12-01

    Full Text Available Los factores bióticos y abióticos determinan la composición de ácidos grasos AG en los peces, información relevante por la asociación existente entre su consumo y los beneficios para la salud humana. El objetivo de esta investigación fue identificar la variación en la concentración de AG, según diferentes factores, en diez especies marinas de pescado comestible en México: Euthynnus alletteratus, Sciaenops ocellatus, Bairdiella chrysoura, Sphyraena guachancho, Symphurus elongatus, Istiophorus platypterus, Ophichthus rex, Eugerres plumieri, Eucinostomus entomelas y Oreochromis mossambicus. La determinación de AG se llevó a cabo mediante cromatografía de gases. El contenido de lípidos totales varió entre 0.93 y 1.95g/100g en E. entomelas y O. mossambicus, respectivamente. E. alletteratus, B. chrysoura, S elongatus, I. platypterus, O. rex y E. plumieri presentaron el siguiente orden en la concentración de AG: AG poliinsaturados AGPAG saturados AGSAG monoinsaturados AGM. S. ocellatus, S. guachancho y E. entomelas: AGSAGPAGM; mientras que tan solo O. mossambicus presentó AGSAGMAGP. Este tuvo la mayor concentración de AGS 559.40mg/100g y AGM 422.60mg/100g, mientras que B. chrysoura presentó el mayor contenido mg/100g de AGP 663.03, AGn-3 514.03, EPA+DHA 506.10 y AGn-6 145.80. Factores bióticos y abióticos influyeron significativamente en la concentración de AG. Las especies subtropicales presentaron una concentración 42.1 mayor de EPA+DHA que las tropicales. Los valores presentados pueden cambiar según modificaciones en el ecosistema y en las características de cada especie, sin embargo, el conocimiento aquí generado es útil para mejorar las recomendaciones sobre el consumo de pescado.

  10. Engineering a cyanobacterium as the catalyst for the photosynthetic conversion of CO2 to 1,2-propanediol

    Directory of Open Access Journals (Sweden)

    Li Han

    2013-01-01

    Full Text Available Abstract Background The modern society primarily relies on petroleum and natural gas for the production of fuels and chemicals. One of the major commodity chemicals 1,2-propanediol (1,2-PDO, which has an annual production of more than 0.5 million tons in the United States, is currently produced by chemical processes from petroleum derived propylene oxide, which is energy intensive and not sustainable. In this study, we sought to achieve photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Compared to the previously reported biological 1,2-PDO production processes which used sugar or glycerol as the substrates, direct chemical production from CO2 in photosynthetic organisms recycles the atmospheric CO2 and will not compete with food crops for arable land. Results In this study, we reported photosynthetic production of 1,2-PDO from CO2 using a genetically engineered cyanobacterium Synechococcus elongatus PCC 7942. Introduction of the genes encoding methylglyoxal synthase (mgsA, glycerol dehydrogenase (gldA, and aldehyde reductase (yqhD resulted in the production of ~22mg/L 1,2-PDO from CO2. However, a comparable amount of the pathway intermediate acetol was also produced, especially during the stationary phase. The production of 1,2-PDO requires a robust input of reducing equivalents from cellular metabolism. To take advantage of cyanobacteria’s NADPH pool, the synthetic pathway of 1,2-PDO was engineered to be NADPH-dependent by exploiting the NADPH-specific secondary alcohol dehydrogenases which have not been reported for 1,2-PDO production previously. This optimization strategy resulted in the production of ~150mg/L 1,2-PDO and minimized the accumulation of the incomplete reduction product, acetol. Conclusion This work demonstrated that cyanobacteria can be engineered as a catalyst for the photosynthetic conversion of CO2 to 1,2-PDO. This work also characterized two NADPH

  11. Short-term cold storage of sperm from six neotropical characiformes fishes

    Directory of Open Access Journals (Sweden)

    Simone Marques

    2004-09-01

    Full Text Available Sperm of the following Neotropical Characiformes fish species were tested for cold storage: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus and Prochilodus marggravii. Each sperm sample was split into two aliquots. The first was placed into a plastic bag with air or oxygen and the second, in a plastic tube with air. The samples were maintained at temperatures between 1.7-4.9 ºC. The rate of sperm motility was estimated using a 50 mM NaCl solution as the activating solution. The shortest sperm storage duration (7 h was recorded for L. friderici, when the sperm motility rate reached ~ 30%, whereas the longest duration (20 h was obtained with the sperm of P. lineatus. A fertilisation test using Prochilodus marggravii sperm refrigerated for 8 h yielded 88-90% of viable embryos. The refrigerated storage method could be of practical applications, especially in fish reproductive management at hatchery stations.O sêmen das seguintes espécies de Characiformes neotropicais foi testado para armazenamento em ambiente resfriado: Brycon lundii, Piaractus mesopotamicus, Leporinus elongatus, Leporinus friderici, Prochilodus lineatus e Prochilodus marggravii. Amostras de sêmen, obtidas por massagem da parede celômica, foram armazenadas em saco plástico com ar ou oxigênio ou em tubo plástico com ar, e mantidas resfriadas entre 1,7-4,9º C. A taxa de motilidade espermática foi estimada usando-se NaCl 50 mM como solução ativadora. O sêmen com menor duração de viabilidade (7 h foi o de L. friderici, quando a taxa de motilidade espermática alcançou ~30%, enquanto que o de maior duração (20 h foi o de P. lineatus. A fertilização de ovócitos utilizando sêmen refrigerado por 8 h de Prochilodus marggravii produziu 88-90% de embriões viáveis. O método de armazenamento desenvolvido neste trabalho tem aplicações práticas, especialmente no manejo reprodutivo de peixes em estações de

  12. Computational Studies of Protein Hydration Methods

    Science.gov (United States)

    Morozenko, Aleksandr

    oxidized state and photosystem II from thermophilic cyanobacterium Thermosynechococcus vulcanus, which both are indispensable for sustaining life on Earth. Cytochrome c oxidase (CcO) is the terminal enzyme of the respiratory electron transport chain responsible for biological reduction over ninety percent of atmospheric oxygen by means of pumping protons across the inner mitochondrial or bacterial plasma membrane with the use of energy derived from the reduction of O 2 to H2O. Photosystem II (PSII) is a membrane protein complex located in the thylakoid membranes of oxygenic photosynthetic organisms, and performs a series of light-induced electron transfer reactions leading to the splitting of water into protons and molecular oxygen.

  13. Defining an additivity framework for mixture research in inducible whole-cell biosensors

    DEFF Research Database (Denmark)

    Martin-Betancor, K; Ritz, Christian; Fernández-Piñas, F

    2015-01-01

    A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts for differe......A novel additivity framework for mixture effect modelling in the context of whole cell inducible biosensors has been mathematically developed and implemented in R. The proposed method is a multivariate extension of the effective dose (EDp) concept. Specifically, the extension accounts...... illustrated by studying the response of the cyanobacterial biosensor Synechococcus elongatus PCC 7942 pBG2120 to binary mixtures of Zn, Cu, Cd, Ag, Co and Hg. The novel method allowed by the first time to model complete dose-response profiles of an inducible whole cell biosensor to mixtures. In addition......, the approach also allowed identification and quantification of departures from additivity (interactions) among analytes. The biosensor was found to respond in a near additive way to heavy metal mixtures except when Hg, Co and Ag were present, in which case strong interactions occurred. The method is a useful...

  14. Exploring local borders of distribution in the shrub Daphne laureola: Individual and populations traits

    Science.gov (United States)

    Castilla, Antonio R.; Alonso, Conchita; Herrera, Carlos M.

    2011-05-01

    Biogeographic models predict that marginal populations should be more geographically isolated and smaller than central populations, linked to more stressful conditions and likely also to a reduction in density of individuals, individual growth, survival and reproductive output. This variation in population features could have important consequences for different aspects of plant ecology such as individual reproductive success, population genetic structure or plant-animal interactions. In this study, we analyze if individuals of the evergreen shrub Daphne laureola at disjunt populations in a local border of its distribution area in southern Iberian Peninsula differ in individual size, shoot growth, reproductive output and the pollination environment from central continuous populations within the area. Plants of central continuous populations were larger and produced more flowers and fruits than plants of marginal disjunct populations suggesting more optimal conditions, although they had lower annual shoot growth. In contrast, fruit set was higher in plants at the local border, suggesting a more efficient pollinator service in these populations where the main pollinator in central continuous populations, the pollen beetle Meligethes elongatus, was not present. Our results do not support strong differences in the ecological stress between marginal disjunct and central continuous populations of D. laureola in the south of the Iberian Peninsula but indicate some changes in plant-pollinator interactions that could be relevant for the sexual polymorphism in this gynodioecious species.

  15. Fish diversity of floodplain lakes on the lower stretch of the Solimões River

    Directory of Open Access Journals (Sweden)

    F. K. Siqueira-Souza

    Full Text Available The fish community of the Solimões floodplain lakes was studied by bimonthly samples taken from May 2001 to April 2002. These were carried out at lakes Maracá (03º51'33"S, 62º35'08,6"W, Samaúma (03º50'42,1"S, 61º39'49,3"W, and Sumaúma and Sacambú (03º17'11,6"S and 60º04'31,4"W, located between the town of Coari and the confluence of the Solimões and Negro rivers. Collections were done with 15 gillnets of standardized dimensions with several mesh sizes. We collected 1,313 animals distributed in 77 species, belonging to 55 genera of 20 families and 5 orders. Characiformes was the most abundant Order, with a larger number of representatives in the Serrasalmidae and Curimatidae. The most abundant species in the samplings were Psectrogaster rutiloides (132 individuals, Pigocentrus nattereri (115 individuals, and Serrasalmus elongatus (109 individuals. Lakes Samaúma, Sacambú, and Sumaúma were adjusted to logarithmic and lognormal series. The diversity exhibited an inverse gradient to the river flow, showing the highest diversity at Lake Sumaúma, followed by Samaúma, Sacambú, and Maracá. Species richness estimated through the jackknife technique ranged from 78 to 107 species.

  16. Nematodes (Mermithidae parasitizing grasshoppers (Orthoptera: Acrididae in the Pampean region, Argentina

    Directory of Open Access Journals (Sweden)

    J. M. Rusconi

    Full Text Available Abstract This work provides the results of a survey of entomonematodes parasites of grasshoppers in grasslands of the Pampean Region, Argentina. Nymphs of Staurorhectus longicornis Giglio-Tos, Laplatacris dispar Rhen, 1939, Dichroplus elongatus Giglio-Tos, 1894 and Metaleptea brevicornis (L. (Orthoptera: Acrididae were collected. Mermithidae was the only family registered with seven species: Agamermis decaudata Cobb, Steiner and Christie, 1923, Amphimermis bonaerensis Miralles and Camino, 1983, Amphimermis dichroplusi Camino and Lange, 1997, Amphimermis ronderosi Camino and Lange, 1997, Hexamermis coclhearius Stock and Camino, 1992, Hexamermis ovistriata Stock and Camino, 1992, and Longimermis acridophila Camino and Stock, 1989. The values of parasitism ranged between 1-12%, and intensity not overcome the number of 5.0 nematodes per larva. The nematodes observed showed specificity, not registering the same species of parasite in more than one host species. The Pampean region constituted an area with high diversity of mermithids where new species could be consider as bioregulator agents of this troublesome insect pests in agricultural areas of Argentina.

  17. Circadian Rhythms in Cyanobacteria

    Science.gov (United States)

    Golden, Susan S.

    2015-01-01

    SUMMARY Life on earth is subject to daily and predictable fluctuations in light intensity, temperature, and humidity created by rotation of the earth. Circadian rhythms, generated by a circadian clock, control temporal programs of cellular physiology to facilitate adaptation to daily environmental changes. Circadian rhythms are nearly ubiquitous and are found in both prokaryotic and eukaryotic organisms. Here we introduce the molecular mechanism of the circadian clock in the model cyanobacterium Synechococcus elongatus PCC 7942. We review the current understanding of the cyanobacterial clock, emphasizing recent work that has generated a more comprehensive understanding of how the circadian oscillator becomes synchronized with the external environment and how information from the oscillator is transmitted to generate rhythms of biological activity. These results have changed how we think about the clock, shifting away from a linear model to one in which the clock is viewed as an interactive network of multifunctional components that are integrated into the context of the cell in order to pace and reset the oscillator. We conclude with a discussion of how this basic timekeeping mechanism differs in other cyanobacterial species and how information gleaned from work in cyanobacteria can be translated to understanding rhythmic phenomena in other prokaryotic systems. PMID:26335718

  18. Fluorescent minerals--A potential source of UV protection and visible light for the growth of green algae and cyanobacteria in extreme cosmic environments.

    Science.gov (United States)

    Omairi, Tareq; Wainwright, Milton

    2015-07-01

    We propose that green algae (Chlorella variabilis and Dunaliella tertiolecta) and cyanobacteria (Synechococcus elongatus and Nostoc commune) can grow inside fluorescent rock minerals which convert damaging UV light to visible light, thereby allowing these organisms to survive and thrive in UV-rich environments without (or with limited) visible light, which would otherwise be inimical to them. The four microorganisms were incubated inside fluorescent rocks composed of fluorite, calcite and pyrite. The resultant growth was then measured following exposure to UV radiation, with the use of optical density and measurement of chlorophyll concentration. Results show that the microorganisms were shielded from harmful UV in these semi-transparent rocks, while at the same time benefiting from the fact that the minerals converted UV to visible light; this have been shown by a statistically significant increase in their growth, which although lower than when the cells were incubated in sunlight, was significantly higher than in controls incubated in the dark. Copyright © 2015 The Committee on Space Research (COSPAR). Published by Elsevier Ltd. All rights reserved.

  19. Method of preparing structural components of proteins and polysaccharides labelled with 14C radioisotope by photoautotrophic microorganisms

    International Nuclear Information System (INIS)

    Kleinmann, I.; Dvorakova, J.; Nejedly, Z.; Entlicher, G.; Kolina, J.; Filip, J.; Svoboda, V.

    1987-01-01

    The biomass labelled with radioisotope 14 C (e.g., blue-green Synechococcus elongatus algae) from which lipids and nucleic acids had previously been removed is subjected to enzyme hydrolysis using pronase. Another enzyme hydrolysis using for instance lysozyme and glycoamylase will produce a mixture which contains L-amino acid fractions and sugar compounds, such as D-[U- 14 C]glucose, D-[U- 14 C]glucosamine, etc. The mixture of L-[U- 14 C]amino acids separated using a polystyrene cation exchanger is divided into separate amino acids using the sorbent Ostion LGKS 0803 and a lithium citrate eluent. Desalination of the obtained fractions of L-[U- 14 C]amino acids is implemented in 0.01 to 4 M formic acid or acetic acid which contains 0 to 0.5% of thiodiglycol and 0 to 5% of ethanol. Desalination is implemented on ethyleneglycol methacrylate ion exchangers with phosphate, carboxyl or sulphone exchange groups. The advantage of the procedure is the perfect desalination of amino acids, higher yields of pure L-amino acids and of the protein hydrolysate and higher chemical purity of products. (E.S)

  20. Engineered Photosystem II reaction centers optimize photochemistry versus photoprotection at different solar intensities.

    Science.gov (United States)

    Vinyard, David J; Gimpel, Javier; Ananyev, Gennady M; Mayfield, Stephen P; Dismukes, G Charles

    2014-03-12

    The D1 protein of Photosystem II (PSII) provides most of the ligating amino acid residues for the Mn4CaO5 water-oxidizing complex (WOC) and half of the reaction center cofactors, and it is present as two isoforms in the cyanobacterium Synechococcus elongatus PCC 7942. These isoforms, D1:1 and D1:2, confer functional advantages for photosynthetic growth at low and high light intensities, respectively. D1:1, D1:2, and seven point mutations in the D1:2 background that are native to D1:1 were expressed in the green alga Chlamydomonas reinhardtii. We used these nine strains to show that those strains that confer a higher yield of PSII charge separation under light-limiting conditions (where charge recombination is significant) have less efficient photochemical turnover, measured in terms of both a lower WOC turnover probability and a longer WOC cycle period. Conversely, these same strains under light saturation (where charge recombination does not compete) confer a correspondingly faster O2 evolution rate and greater protection against photoinhibition. Taken together, the data clearly establish that PSII primary charge separation is a trade-off between photochemical productivity (water oxidation and plastoquinone reduction) and charge recombination (photoprotection). These trade-offs add up to a significant growth advantage for the two natural isoforms. These insights provide fundamental design principles for engineering of PSII reaction centers with optimal photochemical efficiencies for growth at low versus high light intensities.

  1. Delineating Substrate Diversity of Disparate Short-Chain Dehydrogenase Reductase from Debaryomyces hansenii.

    Directory of Open Access Journals (Sweden)

    Arindam Ghatak

    Full Text Available Short-chain dehydrogenase reductases (SDRs have been utilized for catalyzing the reduction of many aromatic/aliphatic prochiral ketones to their respective alcohols. However, there is a paucity of data that elucidates their innate biological role and diverse substrate space. In this study, we executed an in-depth biochemical characterization and substrate space mapping (with 278 prochiral ketones of an unannotated SDR (DHK from Debaryomyces hansenii and compared it with structurally and functionally characterized SDR Synechococcus elongatus. PCC 7942 FabG to delineate its industrial significance. It was observed that DHK was significantly more efficient than FabG, reducing a diverse set of ketones albeit at higher conversion rates. Comparison of the FabG structure with a homology model of DHK and a docking of substrate to both structures revealed the presence of additional flexible loops near the substrate binding site of DHK. The comparative elasticity of the cofactor and substrate binding site of FabG and DHK was experimentally substantiated using differential scanning fluorimetry. It is postulated that the loop flexibility may account for the superior catalytic efficiency of DHK although the positioning of the catalytic triad is conserved.

  2. Evanescent cultivation of photosynthetic bacteria on thin waveguides

    Science.gov (United States)

    Pierobon, S. C.; Ooms, M. D.; Sinton, D.

    2014-04-01

    Waveguides with thicknesses similar to biofilms (10-100 µm) provide an opportunity to improve the bioenergy density of biofilm photobioreactors, avoiding the fundamental light- and mass-transport productivity limitations of planktonic photobioreactors. This report investigates the biofilm growth of a mutant of Synechococcus elongatus (PCC 7942) in evanescent light fields that can be scaled over large planar areas. In this study, areas of 7.2 cm2 are illuminated via frustrated total internal reflections on planar waveguides. The resulting photosynthetic biofilm growth showed resilience to surface intensities exceeding photosynthetic limits and a more uniform cell density distribution (1.0 ± 0.3 × 109 mL-1) than predicted from surface light distribution profiles. These results indicate potential for larger area biofilms using the uniform lighting conditions identified. The combination of evanescent illumination with biofilms indicates a modular reactor cell density on the order of 108 mL-1, representing a two orders of magnitude improvement over current facility architectures, with significant potential for further improvement through denser biofilms.

  3. Light dilution via wavelength management for efficient high-density photobioreactors.

    Science.gov (United States)

    Ooms, Matthew D; Graham, Percival J; Nguyen, Brian; Sargent, Edward H; Sinton, David

    2017-06-01

    The spectral distribution of light influences microalgae productivity; however, development of photobioreactors has proceeded largely without regard to spectral optimization. Here, we use monochromatic light to quantify the joint influence of path length, culture density, light intensity, and wavelength on productivity and efficiency in Synechococcus elongatus. The productivity of green light was ∼4× that of red at the highest levels of culture density, depth, and light intensity. This performance is attributed to the combination of increased dilution and penetration of this weakly absorbed wavelength over a larger volume fraction of the reactor. In contrast, red light outperformed other wavelengths in low-density cultures with low light intensities. Low-density cultures also adapted more rapidly to reduce absorption of longer wavelengths, allowing for prolonged cultivation. Taken together, these results indicate that, particularly for artificially lit photobioreactors, wavelength needs to be included as a critical operational parameter to maintain optimal performance. Biotechnol. Bioeng. 2017;114: 1160-1169. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  4. Redescription of Nothobranchius lucius and description of a new species from Mafia Island, eastern Tanzania (Cyprinodontiformes, Aplocheilidae

    Directory of Open Access Journals (Sweden)

    Wilson J.E.M. Costa

    2017-01-01

    Full Text Available Examination of specimens listed in the original description of Nothobranchius lucius revealed that they belong to two species. Nothobranchius lucius is redescribed based on the type series and other specimens collected in the type locality area, the Kibasira Swamp area, Rufiji River basin, Tanzania, at elevations between 250 and 300 m. Nothobranchius insularis sp. n. is described on the basis of specimens collected in the north part of Mafia Island, Tanzania, at about 10–15 m elevation. Nothobranchius lucius and N. insularis are considered closely related species based on the shared presence of long jaws; caudal fin, in males, with a broad dark grey to black band on its posterior margin; black dots over the whole flank, in females; metapterygoid curved, with its middle and dorsal portions separated from the sympletic by a broad interspace; and posterior process of the quadrate shorter than the ventral length of the quadrate without process. Characters useful to distinguish them include premaxillary dentition, caudal fin shape, colour pattern of flank and unpaired fins in females, fin length, and number of neuromasts of the posterior section of the anterior supraorbital series. Both species are members of a group that also includes N. elongatus, N. hengstleri, N. interruptus, N. jubbi, N. krammeri, and N. melanospilus, which are all diagnosed by the presence of two neuromasts in the anterior section of the anterior supraorbital series.

  5. Diversity in photosynthetic electron transport under [CO2]-limitation: the cyanobacterium Synechococcus sp. PCC 7002 and green alga Chlamydomonas reinhardtii drive an O2-dependent alternative electron flow and non-photochemical quenching of chlorophyll fluorescence during CO2-limited photosynthesis.

    Science.gov (United States)

    Shimakawa, Ginga; Akimoto, Seiji; Ueno, Yoshifumi; Wada, Ayumi; Shaku, Keiichiro; Takahashi, Yuichiro; Miyake, Chikahiro

    2016-12-01

    Some cyanobacteria, but not all, experience an induction of alternative electron flow (AEF) during CO 2 -limited photosynthesis. For example, Synechocystis sp. PCC 6803 (S. 6803) exhibits AEF, but Synechococcus elongatus sp. PCC 7942 does not. This difference is due to the presence of flavodiiron 2 and 4 proteins (FLV2/4) in S. 6803, which catalyze electron donation to O 2 . In this study, we observed a low-[CO 2 ] induced AEF in the marine cyanobacterium Synechococcus sp. PCC 7002 that lacks FLV2/4. The AEF shows high affinity for O 2 , compared with AEF mediated by FLV2/4 in S. 6803, and can proceed under extreme low [O 2 ] (about a few µM O 2 ). Further, the transition from CO 2 -saturated to CO 2 -limited photosynthesis leads a preferential excitation of PSI to PSII and increased non-photochemical quenching of chlorophyll fluorescence. We found that the model green alga Chlamydomonas reinhardtii also has an O 2 -dependent AEF showing the same affinity for O 2 as that in S. 7002. These data represent the diverse molecular mechanisms to drive AEF in cyanobacteria and green algae. In this paper, we further discuss the diversity, the evolution, and the physiological function of strategy to CO 2 -limitation in cyanobacterial and green algal photosynthesis.

  6. Distribution and abundance of fish larvae in the northern Ionian Sea (Eastern Mediterranean)

    Science.gov (United States)

    Granata, Antonia; Cubeta, Annaluce; Minutoli, Roberta; Bergamasco, Alessandro; Guglielmo, Letterio

    2011-09-01

    The purpose of this paper was to study the spatial distribution, abundance and composition of fish larvae in the northern Ionian Sea. Samples were collected to the 600 m depth with an electronic multinet BIONESS during the "INTERREG Italia-Grecia" oceanographic cruise carried out in March 2000 off the Apulian Italian coast. A total of 46 species of teleost early stages were collected, belonging to 38 genera and 22 families. Over 52% of the larvae identified were mesopelagic species, almost 27% were demersal and about 21% pelagic. A total of 307 myctophids, 69 clupeids and 61 gadid post-larvae dominated the community. Benthosema glaciale (mean 6.1 mm SL) was the most abundant species (21.6%), the most frequent in the samples (28.8%), and dominant in the whole study area (mean 1.4 ind/100 m3). Particular attention was given to the horizontal and vertical distribution and abundance of the three dominant post-larval species: Benthosema glaciale, Sprattus sprattus sprattus and Notoscopelus elongatus. The Pearson coefficient ( R = 0.734) showed a high correlation between total zooplankton and fish larval assemblages in terms of spatial distribution abundance values. Regarding the vertical distribution of fish larvae, Sorensen's index ( S = 0.69) showed that fish larvae and total zooplankton abundance peaks co-occurred along the water column.

  7. Enhancing the light-driven production of D-lactate by engineering cyanobacterium using a combinational strategy

    Science.gov (United States)

    Li, Chao; Tao, Fei; Ni, Jun; Wang, Yu; Yao, Feng; Xu, Ping

    2015-05-01

    It is increasingly attractive to engineer cyanobacteria for bulk production of chemicals from CO2. However, cofactor bias of cyanobacteria is different from bacteria that prefer NADH, which hampers cyanobacterial strain engineering. In this study, the key enzyme D-lactate dehydrogenase (LdhD) from Lactobacillus bulgaricus ATCC11842 was engineered to reverse its favored cofactor from NADH to NADPH. Then, the engineered enzyme was introduced into Synechococcus elongatus PCC7942 to construct an efficient light-driven system that produces D-lactic acid from CO2. Mutation of LdhD drove a fundamental shift in cofactor preference towards NADPH, and increased D-lactate productivity by over 3.6-fold. We further demonstrated that introduction of a lactic acid transporter and bubbling CO2-enriched air also enhanced D-lactate productivity. Using this combinational strategy, increased D-lactate concentration and productivity were achieved. The present strategy may also be used to engineer cyanobacteria for producing other useful chemicals.

  8. Revealing Hidden Diversity of the Underestimated Neotropical Ichthyofauna: DNA Barcoding in the Recently Described Genus Megaleporinus (Characiformes: Anostomidae

    Directory of Open Access Journals (Sweden)

    Jorge L. Ramirez

    2017-10-01

    Full Text Available Molecular studies have improved our knowledge on the neotropical ichthyofauna. DNA barcoding has successfully been used in fish species identification and in detecting cryptic diversity. Megaleporinus (Anostomidae is a recently described freshwater fish genus within which taxonomic uncertainties remain. Here we assessed all nominal species of this genus using a DNA barcode approach (Cytochrome Oxidase subunit I with a broad sampling to generate a reference library, characterize new molecular lineages, and test the hypothesis that some of the nominal species represent species complexes. The analyses identified 16 (ABGD and BIN to 18 (ABGD, GMYC, and PTP different molecular operational taxonomic units (MOTUs within the 10 studied nominal species, indicating cryptic biodiversity and potential candidate species. Only Megaleporinus brinco, Megaleporinus garmani, and Megaleporinus elongatus showed correspondence between nominal species and MOTUs. Within six nominal species, a subdivision in two MOTUs was found, while Megaleporinus obtusidens was divided in three MOTUs, suggesting that DNA barcode is a very useful approach to identify the molecular lineages of Megaleporinus, even in the case of recent divergence (< 0.5 Ma. Our results thus provided molecular findings that can be used along with morphological traits to better define each species, including candidate new species. This is the most complete analysis of DNA barcode in this recently described genus, and considering its economic value, a precise species identification is quite desirable and fundamental for conservation of the whole biodiversity of this fish.

  9. Change in rank of Megaperidae (Trematoda) to Megaperinae within the Apocreadiidae and description of Haintestinum amplum n. g., n. sp.

    Science.gov (United States)

    Pulis, Eric E; Curran, Stephen S; Andres, Michael J; Overstreet, Robin M

    2014-04-01

    Haintestinum amplum n. g., n. sp. is described from the scrawled cowfish, Acanthostracion quadricornis, collected in the Eastern Gulf of Mexico off Florida, USA. The new species is relatively large and shares characters of the Apocreadiidae and Megaperidae but conforms to the diagnosis of neither. It belongs in a new genus possessing a pharynx with lobed anterior margin and intestine terminating in paired ani, like in megaperids, and, when compared with apocreadiids, it shares important anatomical features, including an I-shaped excretory vesicle, canicular seminal vesicle, eye-spot remnants, and pretesticular uterus and lacks a cirrus and cirrus sac. The H-shaped intestine and large funnel-shaped oral sucker without a U-shaped sphincter encircling half the anterior aperture are the most notable diagnostic characters of the new monotypic genus. Additionally, the phylogenetic position of the Megaperidae is investigated for the first time, using analysis of partial 28S rDNA gene sequences from H. amplum, two species in the Megapera, Thysanopharynx elongatus, and previously published 28S sequences of species from members of the Apocreadiata, Haploporoidae, Lepocreadiata, and Opisthorchiata. The resulting analysis demonstrated a close relationship among the new genus and the three species of megaperids, and the megaperids were most closely allied with Schistorchis zancli of the apocreadiids. Moreover, we now consider Megaperidae as the subfamily Megaperinae within the Apocreadiidae. Copyright © 2013 Elsevier Ireland Ltd. All rights reserved.

  10. An allele of the crm gene blocks cyanobacterial circadian rhythms.

    Science.gov (United States)

    Boyd, Joseph S; Bordowitz, Juliana R; Bree, Anna C; Golden, Susan S

    2013-08-20

    The SasA-RpaA two-component system constitutes a key output pathway of the cyanobacterial Kai circadian oscillator. To date, rhythm of phycobilisome associated (rpaA) is the only gene other than kaiA, kaiB, and kaiC, which encode the oscillator itself, whose mutation causes completely arrhythmic gene expression. Here we report a unique transposon insertion allele in a small ORF located immediately upstream of rpaA in Synechococcus elongatus PCC 7942 termed crm (for circadian rhythmicity modulator), which results in arrhythmic promoter activity but does not affect steady-state levels of RpaA. The crm ORF complements the defect when expressed in trans, but only if it can be translated, suggesting that crm encodes a small protein. The crm1 insertion allele phenotypes are distinct from those of an rpaA null; crm1 mutants are able to grow in a light:dark cycle and have no detectable oscillations of KaiC phosphorylation, whereas low-amplitude KaiC phosphorylation rhythms persist in the absence of RpaA. Levels of phosphorylated RpaA in vivo measured over time are significantly altered compared with WT in the crm1 mutant as well as in the absence of KaiC. Taken together, these results are consistent with the hypothesis that the Crm polypeptide modulates a circadian-specific activity of RpaA.

  11. A New Environmentally Safe Formulation and of Low Cost for Prolonged Release System of Atrazine and Diuron

    Directory of Open Access Journals (Sweden)

    Gracy karla da Rocha Cortes

    2017-07-01

    Full Text Available Diuron and atrazine were incorporated in new formulations developed with the purpose to improve herbicides action through release systems, as well as to reduce the environmental toxicity. A low cost formulation (ALG/ESC was obtained by combining sodium alginate (ALG with fish scales of the Piau fish (ESC from the Leporinus elongatus species. From the crosslinking of ALG/ESC with CaCl2, the formulation ALG/ESC-CaCl2 was obtained. For ALG/ESC-CaCl2, the results are successful, showing a prolonged release of 3.5 and 4.5 days for atrazine and diuron, respectively. Based on parameters of an empirical equation used to fit the herbicide release data, it appears that the release systems of diuron and atrazine from ALG/ESC-CaCl2 are by diffusion processes due to anomalous transport, which did not follow Fick’s laws of diffusion. DOI: http://dx.doi.org/10.17807/orbital.v9i3.994

  12. Sucrose secreted by the engineered cyanobacterium and its fermentability

    Science.gov (United States)

    Duan, Yangkai; Luo, Quan; Liang, Feiyan; Lu, Xuefeng

    2016-10-01

    The unicellular cyanobacterium, Synechococcus elongatus PCC 7942 (Syn7942), synthesizes sucrose as the only compatible solute under salt stress. A series of engineered Syn7942 strains for sucrose production were constructed. The overexpression of the native sps (encoding a natively fused protein of sucrose phosphate synthase SPS and sucrose phosphate phosphatase SPP) in Syn7942 wild type caused a 93% improvement of sucrose productivity. The strain FL130 co-overexpressing sps and cscB (encoding a sucrose transporter) exhibited a 74% higher extracellular sucrose production than that overexpressing cscB only. Both results showed the significant improvement of sucrose productivity by the double functional protein SPS-SPP. Afterwards, FL130 was cultivated under a modified condition, and the cell-free culture medium containing 1.5 g L-1 sucrose was pre-treated with an acid hydrolysis technique. Cultivated with the neutralized hydrolysates as the starting media, two widely used microorganisms, Escherichia coli and Saccharomyces cerevisiae, showed a comparable growth with that in the control media supplemented with glucose. These results clearly demonstrated that the cell-free culture of sucrose-secreting cyanobacteria can be applied as starting media in microbial cultivation.

  13. From PII signaling to metabolite sensing: a novel 2-oxoglutarate sensor that details PII-NAGK complex formation.

    Directory of Open Access Journals (Sweden)

    Jan Lüddecke

    Full Text Available The widespread PII signal transduction proteins are known for integrating signals of nitrogen and energy supply and regulating cellular behavior by interacting with a multitude of target proteins. The PII protein of the cyanobacterium Synechococcus elongatus forms complexes with the controlling enzyme of arginine synthesis, N-acetyl-L-glutamate kinase (NAGK in a 2-oxoglutarate- and ATP/ADP-dependent manner. Fusing NAGK and PII proteins to either CFP or YFP yielded a FRET sensor that specifically responded to 2-oxoglutarate. The impact of the fluorescent tags on PII and NAGK was evaluated by enzyme assays, surface plasmon resonance spectroscopy and isothermal calorimetric experiments. The developed FRET sensor provides real-time data on PII - NAGK interaction and its modulation by the effector molecules ATP, ADP and 2-oxoglutarate in vitro. Additionally to its utility to monitor 2-oxoglutarate levels, the FRET assay provided novel insights into PII - NAGK complex formation: (i It revealed the formation of an encounter-complex between PII and NAGK, which holds the proteins in proximity even in the presence of inhibitors of complex formation; (ii It revealed that the PII T-loop residue Ser49 is neither essential for complex formation with NAGK nor for activation of the enzyme but necessary to form a stable complex and efficiently relieve NAGK from arginine inhibition; (iii It showed that arginine stabilizes the NAGK hexamer and stimulates PII - NAGK interaction.

  14. A barrier to upstream migration in the fish passage of Itaipu Dam (Canal da Piracema, Paraná River basin

    Directory of Open Access Journals (Sweden)

    Hélio Martins Fontes Júnior

    Full Text Available The majority of the fish passages built in the Neotropical region are characterised by low efficiency and high selectivity; in many cases, the benefits to fish populations are uncertain. Studies conducted in the Canal da Piracema at Itaipu dam on the Parana River indicate that the system component designated as the Discharge channel in the Bela Vista River (herein named Canal de deságue no rio Bela Vista or CABV, a 200 m long technical section, was the main barrier to the upstream migration. The aim of this study was to evaluate the degree of restriction imposed by the CABV on upstream movements of Prochilodus lineatus and Leporinus elongatus, Characiformes. Fish were tagged with passive integrated transponders (PIT tags and released both downstream and upstream of this critical section. Individuals of both species released downstream of the CABV took much more time to reach the upper end of the system (43.6 days vs. 15.9 days, and passed in much lower proportions (18% vs. 60.8% than those tagged upstream of this component. Although more work is needed to differentiate between fishway effects and natural variation in migratory motivation, the results clearly demonstrate passage problems at the CABV.

  15. A barrier to upstream migration in the fish passage of Itaipu Dam (Canal da Piracema), Paraná River basin

    Science.gov (United States)

    ,; Fontes Júnior, Hélio Martins; Makrakis, Sergio; Gomes, Luiz Carlos; Latini, João Dirço

    2012-01-01

    The majority of the fish passages built in the Neotropical region are characterised by low efficiency and high selectivity; in many cases, the benefits to fish populations are uncertain. Studies conducted in the Canal da Piracema at Itaipu dam on the Parana River indicate that the system component designated as the Discharge channel in the Bela Vista River (herein named Canal de deságue no rio Bela Vista or CABV), a 200 m long technical section, was the main barrier to the upstream migration. The aim of this study was to evaluate the degree of restriction imposed by the CABV on upstream movements of Prochilodus lineatus and Leporinus elongatus, Characiformes. Fish were tagged with passive integrated transponders (PIT tags) and released both downstream and upstream of this critical section. Individuals of both species released downstream of the CABV took much more time to reach the upper end of the system (43.6 days vs. 15.9 days), and passed in much lower proportions (18% vs. 60.8%) than those tagged upstream of this component. Although more work is needed to differentiate between fishway effects and natural variation in migratory motivation, the results clearly demonstrate passage problems at the CABV.

  16. Preparation and HPLC isolation of L-[U-14C]tryptophan from enzyme hydrolysate labelled with 14C

    International Nuclear Information System (INIS)

    Novak, J.; Tintera, S.; Hromadkova, B.

    1990-01-01

    Tryptophan was obtained from biomass of the blue-green alga Synechococcus elongatus cultivated under 14 CO 2 . After partial purification, the protein fraction was subjected to enzymatic hydrolysis using pronase. Semipreparative isolation of L-[U- 14 C]tryptophan was accomplished on a HPLC column of Separon S Hema 1000 CM, 2% ethanol were added to the eluent, and a precolumn packed with the basic anion exchanger Spheron 1000 DEAE was used. Always after the passage of L-[U- 14 C]tryptophan, the precolumn was decoupled. The substance was collected in 96% ethanol. After removing the solvent by vacuum evaporation, the sample was analyzed on a column packed with Separon SIX C 18 in the eluent of 0.1M-NaH 2 PO 4 , 2% methanol. When the desired radiochemical purity was not attained, the sample was purified on Separon SIX C 18 using 2% methanol. The final radiochemical purity achieved by using this method is 98%. (P.A.). 5 figs., 2 tabs., 4 refs

  17. Rewiring hydrogenase-dependent redox circuits in cyanobacteria

    Science.gov (United States)

    Ducat, Daniel C.; Sachdeva, Gairik; Silver, Pamela A.

    2011-01-01

    Hydrogenases catalyze the reversible reaction 2H+ + 2e-↔H2 with an equilibrium constant that is dependent on the reducing potential of electrons carried by their redox partner. To examine the possibility of increasing the photobiological production of hydrogen within cyanobacterial cultures, we expressed the [FeFe] hydrogenase, HydA, from Clostridium acetobutylicum in the non-nitrogen-fixing cyanobacterium Synechococcus elongatus sp. 7942. We demonstrate that the heterologously expressed hydrogenase is functional in vitro and in vivo, and that the in vivo hydrogenase activity is connected to the light-dependent reactions of the electron transport chain. Under anoxic conditions, HydA activity is capable of supporting light-dependent hydrogen evolution at a rate > 500-fold greater than that supported by the endogenous [NiFe] hydrogenase. Furthermore, HydA can support limited growth solely using H2 and light as the source of reducing equivalents under conditions where Photosystem II is inactivated. Finally, we demonstrate that the addition of exogenous ferredoxins can modulate redox flux in the hydrogenase-expressing strain, allowing for greater hydrogen yields and for dark fermentation of internal energy stores into hydrogen gas. PMID:21368150

  18. Enhanced limonene production in cyanobacteria reveals photosynthesis limitations.

    Science.gov (United States)

    Wang, Xin; Liu, Wei; Xin, Changpeng; Zheng, Yi; Cheng, Yanbing; Sun, Su; Li, Runze; Zhu, Xin-Guang; Dai, Susie Y; Rentzepis, Peter M; Yuan, Joshua S

    2016-12-13

    Terpenes are the major secondary metabolites produced by plants, and have diverse industrial applications as pharmaceuticals, fragrance, solvents, and biofuels. Cyanobacteria are equipped with efficient carbon fixation mechanism, and are ideal cell factories to produce various fuel and chemical products. Past efforts to produce terpenes in photosynthetic organisms have gained only limited success. Here we engineered the cyanobacterium Synechococcus elongatus PCC 7942 to efficiently produce limonene through modeling guided study. Computational modeling of limonene flux in response to photosynthetic output has revealed the downstream terpene synthase as a key metabolic flux-controlling node in the MEP (2-C-methyl-d-erythritol 4-phosphate) pathway-derived terpene biosynthesis. By enhancing the downstream limonene carbon sink, we achieved over 100-fold increase in limonene productivity, in contrast to the marginal increase achieved through stepwise metabolic engineering. The establishment of a strong limonene flux revealed potential synergy between photosynthate output and terpene biosynthesis, leading to enhanced carbon flux into the MEP pathway. Moreover, we show that enhanced limonene flux would lead to NADPH accumulation, and slow down photosynthesis electron flow. Fine-tuning ATP/NADPH toward terpene biosynthesis could be a key parameter to adapt photosynthesis to support biofuel/bioproduct production in cyanobacteria.

  19. Experimental simulation of evaporation-driven silica sinter formation and microbial silicification in hot spring systems.

    Science.gov (United States)

    Orange, François; Lalonde, Stefan V; Konhauser, Kurt O

    2013-02-01

    Evaporation of silica-rich geothermal waters is one of the main abiotic drivers of the formation of silica sinters around hot springs. An important role in sinter structural development is also played by the indigenous microbial communities, which are fossilized and eventually encased in the silica matrix. The combination of these two factors results in a wide variety of sinter structures and fabrics. Despite this, no previous experimental fossilization studies have focused on evaporative-driven silica precipitation. We present here the results of several experiments aimed at simulating the formation of sinters through evaporation. Silica solutions at different concentrations were repeatedly allowed to evaporate in both the presence and absence of the cyanobacterium Synechococcus elongatus. Without microorganisms, consecutive silica additions led to the formation of well-laminated deposits. By contrast, when microorganisms were present, they acted as reactive surfaces for heterogeneous silica particle nucleation; depending on the initial silica concentration, the deposits were then either porous with a mixture of silicified and unmineralized cells, or they formed a denser structure with a complete entombment of the cells by a thick silica crust. The deposits obtained experimentally showed numerous similarities in terms of their fabric to those previously reported for natural hot springs, demonstrating the complex interplay between abiotic and biotic processes during silica sinter growth.

  20. PSII as an in vivo molecular catalyst for the production of energy rich hydroquinones - A new approach in renewable energy.

    Science.gov (United States)

    Das, Sai; Maiti, Soumen K

    2018-03-01

    One of the pertinent issues in the field of energy science today is the quest for an abundant source of hydrogen or hydrogen equivalents. In this study, phenyl-p-benzoquinone (pPBQ) has been used to generate a molecular store of hydrogen equivalents (phenyl-p-hydroquinone; pPBQH 2 ) from thein vivo splitting of water by photosystem II of the marine cyanobacterium Synechococcus elongatus BDU 70542. Using this technique, 10.8 μmol of pPBQH 2 per mg chlorophyll a can be extracted per minute, an efficiency that is orders of magnitude higher when compared to the techniques present in the current literature. Moreover, the photo-reduction process was stable when tested over longer periods of time. Addition of phenyl-p-benzoquinone on an intermittent basis resulted in the precipitation of phenyl-p-hydroquinone, obviating the need for costly downstream processing units for product recovery. Phenyl-p-hydroquinone so obtained is a molecular store of free energy preserved through the light driven photolysis of water and can be used as a cheap and a renewable source of hydrogen equivalents by employing transition metal catalysts or fuel cells with the concomitant regeneration of phenyl-p-benzoquinone. The cyclic nature of this technique makes it an ideal candidate to be utilized in mankind's transition from fossil fuels to solar fuels. Copyright © 2018 Elsevier B.V. All rights reserved.

  1. Interaction specificity between the chaperone and proteolytic components of the cyanobacterial Clp protease.

    Science.gov (United States)

    Tryggvesson, Anders; Ståhlberg, Frida M; Mogk, Axel; Zeth, Kornelius; Clarke, Adrian K

    2012-09-01

    The Clp protease is conserved among eubacteria and most eukaryotes, and uses ATP to drive protein substrate unfolding and translocation into a chamber of sequestered proteolytic active sites. In plant chloroplasts and cyanobacteria, the essential constitutive Clp protease consists of the Hsp100/ClpC chaperone partnering a proteolytic core of catalytic ClpP and noncatalytic ClpR subunits. In the present study, we have examined putative determinants conferring the highly specific association between ClpC and the ClpP3/R core from the model cyanobacterium Synechococcus elongatus. Two conserved sequences in the N-terminus of ClpR (tyrosine and proline motifs) and one in the N-terminus of ClpP3 (MPIG motif) were identified as being crucial for the ClpC-ClpP3/R association. These N-terminal domains also influence the stability of the ClpP3/R core complex itself. A unique C-terminal sequence was also found in plant and cyanobacterial ClpC orthologues just downstream of the P-loop region previously shown in Escherichia coli to be important for Hsp100 association to ClpP. This R motif in Synechococcus ClpC confers specificity for the ClpP3/R core and prevents association with E. coli ClpP; its removal from ClpC reverses this core specificity.

  2. Internal radiation dose to the public from polonium-210 due to consumption of seafood from Bombay-harbour bay

    International Nuclear Information System (INIS)

    Bangera, V.S.; Rudran, Kamala

    1995-01-01

    Marine organisms such as fishes, molluscs and crustaceans are known to accumulate 210 Po. Distribution of 210 Po in coastal marine organisms mainly fishes and shell fishes is studied. Concentration of 210 Po obtained in muscle of common fishes (edible portion) varied from 2.10 ± 0.11 to 21.90 ± 5.00 Bq kg -1 dry muscle (for fishes like Pampus argenteus (Pomfret), Cynoglossus elongatus (sole), Rastrelliger kanagurta (mackerel), Harpodon nehereus (Bombay duck) etc. Concentration factors for 210 Po in edible portion of fish from sea water works out to 10 3 to 10 4 . Radiation dose to the public has been evaluated on the basis of daily intake of 40 g of fish (15 kg y -1 ). Committed effective dose (CED) to 210 Po due to consumption of sea food is calculated, CED varied from 2.05 x 10 -3 to 4 x 10 -2 mSv y -1 . (author). 7 refs., 3 figs., 3 tabs

  3. The nitrogen interaction network in Synechococcus WH5701, a cyanobacterium with two PipX and two P(II)-like proteins.

    Science.gov (United States)

    Laichoubi, Karim Boumediene; Beez, Sabine; Espinosa, Javier; Forchhammer, Karl; Contreras, Asunción

    2011-04-01

    Nitrogen regulation involves the formation of different types of protein complexes between signal transducers and their transcriptional or metabolic targets. In oxygenic phototrophs, the signal integrator P(II) activates the enzyme N-acetyl-l-glutamate kinase (NAGK) by complex formation. P(II) also interacts with PipX, a protein with a tudor-like domain that mediates contacts with P(II) and with the transcriptional regulator NtcA, to which it binds to increase its activity. Here, we use a combination of in silico, yeast two-hybrid and in vitro approaches to investigate the nitrogen regulation network of Synechococcus WH5701, a marine cyanobacterium with two P(II) (GlnB_A and GlnB_B) and two PipX (PipX_I and PipX_II) proteins. Our results indicate that GlnB_A is functionally equivalent to the canonical P(II) protein from Synechococcus elongatus. GlnB_A interacted with PipX and NAGK proteins and stimulated NAGK activity, counteracting arginine inhibition. GlnB_B had only a slight stimulatory effect on NAGK activity, but its potential to bind effectors and form heterotrimers in Synechococcus WH5701 indicates additional regulatory functions. PipX_II, and less evidently PipX_I, specifically interacted with GlnB_A and NtcA, supporting a role for both Synechococcus WH5701 PipX proteins in partner swapping with GlnB_A and NtcA.

  4. Optimization of isopropanol production by engineered cyanobacteria with a synthetic metabolic pathway.

    Science.gov (United States)

    Hirokawa, Yasutaka; Suzuki, Iwane; Hanai, Taizo

    2015-05-01

    Cyanobacterium is an attractive host for the production of various chemicals and alternative fuels using solar energy and carbon dioxide. In previous study, we succeeded to produce isopropanol using engineered Synechococcus elongatus PCC 7942 under dark and anaerobic conditions (0.43 mM, 26.5 mg/l). In the present study, we report the further optimization of this isopropanol producing condition. We then optimized growth conditions for production of isopropanol by the engineered cyanobacteria, including the use of cells in early stationary phase and buffering of the production medium to neutral pH. We observed that shifting of cultures from dark and anaerobic to light and aerobic conditions during the production phase dramatically increased isopropanol production by conversion to isopropanol from acetate, byproduct under dark and anaerobic condition. Under the optimized production conditions, the titer of isopropanol was elevated 6-fold, to 2.42 mM (146 mg/l). Copyright © 2014 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  5. Cyanobacterial defense mechanisms against foreign DNA transfer and their impact on genetic engineering

    Directory of Open Access Journals (Sweden)

    Karina Stucken

    2013-01-01

    Full Text Available Cyanobacteria display a large diversity of cellular forms ranging from unicellular to complex multicellular filaments or aggregates. Species in the group present a wide range of metabolic characteristics including the fixation of atmospheric nitrogen, resistance to extreme environments, production of hydrogen, secondary metabolites and exopolysaccharides. These characteristics led to the growing interest in cyanobacteria across the fields of ecology, evolution, cell biology and biotechnology. The number of available cyanobacterial genome sequences has increased considerably in recent years, with more than 140 fully sequenced genomes to date. Genetic engineering of cyanobacteria is widely applied to the model unicellular strains Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. However the establishment of transformation protocols in many other cyanobacterial strains is challenging. One obstacle to the development of these novel model organisms is that many species have doubling times of 48 h or more, much longer than the bacterial models E. coli or B. subtilis. Furthermore, cyanobacterial defense mechanisms against foreign DNA pose a physical and biochemical barrier to DNA insertion in most strains. Here we review the various barriers to DNA uptake in the context of lateral gene transfer among microbes and the various mechanisms for DNA acquisition within the prokaryotic domain. Understanding the cyanobacterial defense mechanisms is expected to assist in the development and establishment of novel transformation protocols that are specifically suitable for this group.

  6. Nematodes (Mermithidae) parasitizing grasshoppers (Orthoptera: Acrididae) in the Pampean region, Argentina.

    Science.gov (United States)

    Rusconi, J M; Camino, N B; Achinelly, M F

    2017-03-01

    This work provides the results of a survey of entomonematodes parasites of grasshoppers in grasslands of the Pampean Region, Argentina. Nymphs of Staurorhectus longicornis Giglio-Tos, Laplatacris dispar Rhen, 1939, Dichroplus elongatus Giglio-Tos, 1894 and Metaleptea brevicornis (L.) (Orthoptera: Acrididae) were collected. Mermithidae was the only family registered with seven species: Agamermis decaudata Cobb, Steiner and Christie, 1923, Amphimermis bonaerensis Miralles and Camino, 1983, Amphimermis dichroplusi Camino and Lange, 1997, Amphimermis ronderosi Camino and Lange, 1997, Hexamermis coclhearius Stock and Camino, 1992, Hexamermis ovistriata Stock and Camino, 1992, and Longimermis acridophila Camino and Stock, 1989. The values of parasitism ranged between 1-12%, and intensity not overcome the number of 5.0 nematodes per larva. The nematodes observed showed specificity, not registering the same species of parasite in more than one host species. The Pampean region constituted an area with high diversity of mermithids where new species could be consider as bioregulator agents of this troublesome insect pests in agricultural areas of Argentina.

  7. Biological characteristics of the blue sucker in the James River and the Big Sioux River, South Dakota

    Science.gov (United States)

    Morey, N.M.; Berry, C.R.

    2003-01-01

    Little is known about the relative abundance and biology of the blue sucker (Cycleptus elongatus), a species that may be declining in some parts of its range. We described the age, growth, condition, length distribution, and habitat preference of the blue sucker in two South Dakota rivers. Specimens were collected from the James River (n=74) and Big Sioux River (n=28) during the summer of 2000. Although five macrohabitats were sampled with electrofishing and hoopnets, most individuals were collected from riffle habitats and downstream of rock dams. Total length-weight relationships were log10W=-6.14+3.37(log10L) (r2 = 0.92) for blue suckers from the James River and log10W = -6.52+3.50(log10L) (r2 = 0.97) for fish from the Big Sioux River. Mean condition factors (K = W(105)/L3) of blue suckers were 0.79 (SE = 0.07) for the James River and 0.73 (SE = 0.07) for the Big Sioux River. Blue suckers between 500 and 700 mm dominated length distributions (range = 374-717 mm) of both samples. Ages ranged from two to nine years, but six-year-old fish were captured most frequently. Blue suckers grew rapidly during juvenile stages (< age 5); however, growth slowed afterward.

  8. Habitat preferences of ground beetle (Coleoptera: Carabidae) species in the northern Black Hills of South Dakota.

    Science.gov (United States)

    Bergmann, David J; Brandenburg, Dylan; Petit, Samantha; Gabel, Mark

    2012-10-01

    Ground beetles (Coleoptera: Carabidae) are a major component of terrestrial invertebrate communities and have been used as bioindicators of habitat change and disturbance. The Black Hills of South Dakota is a small area with a high biodiversity, but the ground beetles of this region are little studied. The habitat preferences of ground beetles in the Black Hills are unknown, and baseline data must be collected if these beetles are to be used in the future as bioindicators. Ground beetles (Coleoptera: Carabidae) were collected from pitfall traps at two sites in each of five kinds of habitats (grassland, bur oak-ironwood forests, ponderosa pine-common juniper forests, aspen-pine forests, and a spruce forest) from which habitat structure characteristics and plant abundance data also were collected. In total, 27 species of ground beetles were identified. Although some species, such as Dicaelus sculptilis Say were found in most habitats, other species showed distinct habitat preferences: Poecilus lucublandus (Say) preferred oak forests, Pasimachus elongatus LeConte preferred grasslands, and Calathus ingratus Dejean preferred high-elevation aspen-pine forests. Pterostichus adstrictus Escholtz was found only in woodlands, and Carabus taedatus Say strictly in higher elevation (over 1,500 m) aspen or coniferous woods, and may represent relict populations of boreal species. Elevation, exposure to sunlight, and cover of woody plants strongly influence the structure of carabid communities in the Black Hills.

  9. An evolutionary fitness enhancement conferred by the circadian system in cyanobacteria

    International Nuclear Information System (INIS)

    Ma, Peijun; Woelfle, Mark A.; Johnson, Carl Hirschie

    2013-01-01

    Circadian clocks are found in a wide variety of organisms from cyanobacteria to mammals. Many believe that the circadian clock system evolved as an adaption to the daily cycles in light and temperature driven by the rotation of the earth. Studies on the cyanobacterium, Synechococcus elongatus PCC 7942, have confirmed that the circadian clock in resonance with environmental cycles confers an adaptive advantage to cyanobacterial strains with different clock properties when grown in competition under light–dark cycles. The results thus far suggest that in a cyclic environment, the cyanobacterial strains whose free running periods are closest to the environmental period are the most fit and the strains lacking a functional circadian clock are at a competitive disadvantage relative to strains with a functional clock. In contrast, the circadian system provides little or no advantage to cyanobacteria grown in competition in constant light. To explain the potential mechanism of this clock-mediated enhancement in fitness in cyanobacteria, several models have been proposed; these include the limiting resource model, the diffusible inhibitor model and the cell-to-cell communication model. None of these models have been excluded by the currently available experimental data and the mechanistic basis of clock-mediated fitness enhancement remains elusive

  10. Species-specific roles of sulfolipid metabolism in acclimation of photosynthetic microbes to sulfur-starvation stress.

    Directory of Open Access Journals (Sweden)

    Norihiro Sato

    Full Text Available Photosynthetic organisms utilize sulfate for the synthesis of sulfur-compounds including proteins and a sulfolipid, sulfoquinovosyl diacylglycerol. Upon ambient deficiency in sulfate, cells of a green alga, Chlamydomonas reinhardtii, degrade the chloroplast membrane sulfolipid to ensure an intracellular-sulfur source for necessary protein synthesis. Here, the effects of sulfate-starvation on the sulfolipid stability were investigated in another green alga, Chlorella kessleri, and two cyanobacteria, Synechocystis sp. PCC 6803 and Synechococcus elongatus PCC 7942. The results showed that sulfolipid degradation was induced only in C. kessleri, raising the possibility that this degradation ability was obtained not by cyanobacteria, but by eukaryotic algae during the evolution of photosynthetic organisms. Meanwhile, Synechococcus disruptants concerning sqdB and sqdX genes, which are involved in successive reactions in the sulfolipid synthesis pathway, were respectively characterized in cellular response to sulfate-starvation. Phycobilisome degradation intrinsic to Synechococcus, but not to Synechocystis, and cell growth under sulfate-starved conditions were repressed in the sqdB and sqdX disruptants, respectively, relative to in the wild type. Their distinct phenotypes, despite the common loss of the sulfolipid, inferred specific roles of sqdB and sqdX. This study demonstrated that sulfolipid metabolism might have been developed to enable species- or cyanobacterial-strain dependent processes for acclimation to sulfate-starvation.

  11. Physiological tolerance and stoichiometric potential of cyanobacteria for hydrocarbon fuel production.

    Science.gov (United States)

    Kämäräinen, Jari; Knoop, Henning; Stanford, Natalie J; Guerrero, Fernando; Akhtar, M Kalim; Aro, Eva-Mari; Steuer, Ralf; Jones, Patrik R

    2012-11-30

    Cyanobacteria are capable of directly converting sunlight, carbon dioxide and water into hydrocarbon fuel or precursors thereof. Many biological and non-biological factors will influence the ability of such a production system to become economically sustainable. We evaluated two factors in engineerable cyanobacteria which could potentially limit economic sustainability: (i) tolerance of the host to the intended end-product, and (ii) stoichiometric potential for production. Alcohols, when externally added, inhibited growth the most, followed by aldehydes and acids, whilst alkanes were the least inhibitory. The growth inhibition became progressively greater with increasing chain-length for alcohols, whilst the intermediate C6 alkane caused more inhibition than both C3 and C11 alkane. Synechocystis sp. PCC 6803 was more tolerant to some of the tested chemicals than Synechococcus elongatus PCC 7942, particularly ethanol and undecane. Stoichiometric evaluation of the potential yields suggested that there is no difference in the potential productivity of harvestable energy between any of the studied fuels, with the exception of ethylene, for which maximal stoichiometric yield is considerably lower. In summary, it was concluded that alkanes would constitute the best choice metabolic end-product for fuel production using cyanobacteria if high-yielding strains can be developed. Copyright © 2012 Elsevier B.V. All rights reserved.

  12. Transgenic tobacco plants with improved cyanobacterial Rubisco expression but no extra assembly factors grow at near wild-type rates if provided with elevated CO2.

    Science.gov (United States)

    Occhialini, Alessandro; Lin, Myat T; Andralojc, P John; Hanson, Maureen R; Parry, Martin A J

    2016-01-01

    Introducing a carbon-concentrating mechanism and a faster Rubisco enzyme from cyanobacteria into higher plant chloroplasts may improve photosynthetic performance by increasing the rate of CO2 fixation while decreasing losses caused by photorespiration. We previously demonstrated that tobacco plants grow photoautotrophically using Rubisco from Synechococcus elongatus, although the plants exhibited considerably slower growth than wild-type and required supplementary CO2 . Because of concerns that vascular plant assembly factors may not be adequate for assembly of a cyanobacterial Rubisco, prior transgenic plants included the cyanobacterial chaperone RbcX or the carboxysomal protein CcmM35. Here we show that neither RbcX nor CcmM35 is needed for assembly of active cyanobacterial Rubisco. Furthermore, by altering the gene regulatory sequences on the Rubisco transgenes, cyanobacterial Rubisco expression was enhanced and the transgenic plants grew at near wild-type growth rates, although still requiring elevated CO2 . We performed detailed kinetic characterization of the enzymes produced with and without the RbcX and CcmM35 cyanobacterial proteins. These transgenic plants exhibit photosynthetic characteristics that confirm the predicted benefits of introduction of non-native forms of Rubisco with higher carboxylation rate constants in vascular plants and the potential nitrogen-use efficiency that may be achieved provided that adequate CO2 is available near the enzyme. © 2015 The Authors The Plant Journal © 2015 John Wiley & Sons Ltd.

  13. Genetic variability of broodstocks of restocking programs in Brazil

    Directory of Open Access Journals (Sweden)

    Nelson Lopera-Barrero

    2015-09-01

    Full Text Available Objective. The aim of this study was evaluate the genetic diversity of the following broodstocks: piapara (Leporinus elongatus, dourado (Salminus brasiliensis, jundiá (Rhamdia quelen and cachara (Pseudoplatystoma fasciatum already useful for restocking programs in the Paranapanema, Iguaçu and Paraná Brazilian Rivers. Materials and methods. Samples from the caudal fin of 122 fish were analyzed. DNA was extracted by NaCl protocol. PCR products were separated by a horizontal agarose gel electrophoresis. The fragments were visualized by staining with ethidium bromide. Results. The amplification of 25 primers generated different fragments in studied species that allowed characterizing 440 fragments of 100-2900 bp. High percentage of polymorphic fragments (66.67 to 86.29, Shannon index (0.365 to 0.486 and genetic diversity of Nei (0.248 to 0.331 were detected. Conclusions. The level of genetic variability in the broodstocks was adequate for allowing their use in restocking programs in the studied Rivers. However, periodical monitoring studies of genetic variability in these stocks, the mating system, reproductive system and general management must be made to guarantee the preservation of wild populations.

  14. Redescription of Tripaphylus musteli (van Beneden, 1851) (Copepoda: Sphyriidae) and the relegation of Paeon Wilson, 1919 to synonymy with Tripaphylus Richiardi in Anonymous, 1878.

    Science.gov (United States)

    Benz, George W; Boxshall, Geoffrey A

    2017-07-01

    Tripaphylus musteli (van Beneden, 1851) (Copepoda, Siphonostomatoida, Sphyriidae) is redescribed from an adult female collected from the branchial chamber of a starry smooth-hound, Mustelus asterias Cloquet (Carcharhiniformes, Triakidae), captured in the English Channel off Portland, UK. The new account of T. musteli is the first based on a complete adult female and highlighted the lack of a robust distinction separating Tripaphylus Richiardi, in Anonymous, 1878 and Paeon Wilson, 1919 prompting us to relegate Paeon to a junior subjective synonym of Tripaphylus. In the light of this synonymy the eight former species of Paeon are transferred to Tripaphylus as follows: T. ferox (Wilson, 1919) new combination, T. elongatus (Wilson, 1932) new combination, T. vassierei (Delamare Deboutteville & Nuñes-Ruivo, 1954) new combination, T. lobatus (Kirtisinghe, 1964) new combination, T. asymboli (Turner, Kyne & Bennett, 2003) new combination, T. versicolor (Wilson, 1919) new combination, T. australis (Kabata, 1993) new combination, and T. triakis (Castro Romero, 2001) new combination. Comparisons between terminology used in this report and that in the literature indicate that all transformed adult females of Tripaphylus probably possess a full complement of cephalic appendages and maxillipeds. All limbs, with the exception of the maxillae share a general morphological similarity to the corresponding appendages of conspecific males. The maxilla of the transformed adult female of Tripaphylus is a small digitiform protuberance associated with a swelling in some species.

  15. Studies on European species of the water mite family Aturidae Thor (Acari: Hydrachnidia).

    Science.gov (United States)

    Gerecke, Reinhard

    2014-07-24

    Selected water mite species of the family Aturidae are revised. The following synonyms are established: Aturus intermedius serrata K. Viets, 1922 = A. asserculatus Walter, 1906; A. lelgioensis Rensburg, 1971 = A. natangensis Protz, 1900; A. oudemansi Besseling, 1932 = A. intermedius Protz, 1900. The proposal of E. Angelier (1965), to synonymize A. paucisetus Motaş & Tanasachi, 1946 with A. brachypus K. Viets, 1934 is rejected. Aturus elongatus Walter, 1927 (described after females, type material heavily damaged) and Ljania bipapillata subterranea Schwoerbel, 1964 (no type material available, no type locality defined) are considered as species incertae. Ljania macilenta longissima Schwoerbel, 1962 is redescribed and elevated to species rank. Two species of the genus Kongsbergia are described as new to science from interstitial habitats in the Central Mediterranean: K. albanorum sp. nov. from Western Sicily and K. jaentschi sp. nov. from Sicily and Sardinia. Woolastookia basilicalabrica sp. nov. is described from mountain streams in Southern Italy. Numerous new records are given, extending noteworthy the known distribution area of several species in Southern Europe. Aturus rotundus Romijn, 1921, Kongsbergia dentata Walter, 1947 and K. simillima K. Viets, 1949 are recorded for the first time from Italy, K. pectinigera Motaş & Tanasachi, 1946 from France and Italy; first records from Corsica are given for Aturus intermedius and A. spatulifer Piersig, 1904. Lectotypes are designated for Aturus asserculatus Walter, 1906; A. asserculatus serratus K. Viets, 1922; A. oudemansi Besseling, 1932.

  16. Silica ecosystem for synergistic biotransformation

    Science.gov (United States)

    Mutlu, Baris R.; Sakkos, Jonathan K.; Yeom, Sujin; Wackett, Lawrence P.; Aksan, Alptekin

    2016-06-01

    Synergistical bacterial species can perform more varied and complex transformations of chemical substances than either species alone, but this is rarely used commercially because of technical difficulties in maintaining mixed cultures. Typical problems with mixed cultures on scale are unrestrained growth of one bacterium, which leads to suboptimal population ratios, and lack of control over bacterial spatial distribution, which leads to inefficient substrate transport. To address these issues, we designed and produced a synthetic ecosystem by co-encapsulation in a silica gel matrix, which enabled precise control of the microbial populations and their microenvironment. As a case study, two greatly different microorganisms: Pseudomonas sp. NCIB 9816 and Synechococcus elongatus PCC 7942 were encapsulated. NCIB 9816 can aerobically biotransform over 100 aromatic hydrocarbons, a feat useful for synthesis of higher value commodity chemicals or environmental remediation. In our system, NCIB 9816 was used for biotransformation of naphthalene (a model substrate) into CO2 and the cyanobacterium PCC 7942 was used to provide the necessary oxygen for the biotransformation reactions via photosynthesis. A mathematical model was constructed to determine the critical cell density parameter to maximize oxygen production, and was then used to maximize the biotransformation rate of the system.

  17. Condition factor variations over time and trophic position among four species of Characidae from Amazonian floodplain lakes: effects of an anomalous drought.

    Science.gov (United States)

    Tribuzy-Neto, I A; Conceição, K G; Siqueira-Souza, F K; Hurd, L E; Freitas, C E C

    2017-08-17

    The effects of extreme droughts on freshwater fish remain unknown worldwide. In this paper, we estimated the condition factor, a measure of relative fitness based on the relationship of body weight to length, in four fish species representing two trophic levels (omnivores and piscivores) from Amazonian floodplain lakes for three consecutive years: 2004, 2005 (an anomalous drought year), and 2006. The two omnivores, Colossoma macropomum and Mylossoma duriventre, exhibited trends consistent with their life cycles in 2004 and 2006: high values during the hydrologic seasons of high water, receding water, and low water, with a drop following reproduction following the onset of rising water. However during the drought year of 2005 the condition factor was much lower than normal during receding and low water seasons, probably as a result of an abnormal reduction in resource availability in a reduced habitat. The two piscivorous piranhas, Serrasalmus spilopleura and S. elongatus, maintained relatively stable values of condition factor over the hydrologic cycles of all three years, with no apparent effect of the drought, probably because the reduction in habitat is counterbalanced by the resulting increase in relative prey density. We suggest that if predictions of increasing drought in the Amazon are correct, predatory species may benefit, at least in the short run, while omnivores may be negatively affected.

  18. Blocking rpS6 Phosphorylation Exacerbates Tsc1 Deletion–Induced Kidney Growth

    Science.gov (United States)

    Wu, Huijuan; Chen, Jianchun; Xu, Jinxian; Dong, Zheng; Meyuhas, Oded

    2016-01-01

    The molecular mechanisms underlying renal growth and renal growth–induced nephron damage remain poorly understood. Here, we report that in murine models, deletion of the tuberous sclerosis complex protein 1 (Tsc1) in renal proximal tubules induced strikingly enlarged kidneys, with minimal cystogenesis and occasional microscopic tumorigenesis. Signaling studies revealed hyperphosphorylation of eukaryotic translation initiation factor 4E-binding protein 1 (4E-BP1) and increased phosphorylation of ribosomal protein S6 (rpS6) in activated renal tubules. Notably, knockin of a nonphosphorylatable rpS6 in these Tsc1-mutant mice exacerbated cystogenesis and caused drastic nephron damage and renal fibrosis, leading to kidney failure and a premature death rate of 67% by 9 weeks of age. In contrast, Tsc1 single-mutant mice were all alive and had far fewer renal cysts at this age. Mechanistic studies revealed persistent activation of mammalian target of rapamycin complex 1 (mTORC1) signaling causing hyperphosphorylation and consequent accumulation of 4E-BP1, along with greater cell proliferation, in the renal tubules of Tsc1 and rpS6 double-mutant mice. Furthermore, pharmacologic treatment of Tsc1 single-mutant mice with rapamycin reduced hyperphosphorylation and accumulation of 4E-BP1 but also inhibited phosphorylation of rpS6. Rapamycin also exacerbated cystic and fibrotic lesions and impaired kidney function in these mice, consequently leading to a premature death rate of 40% within 2 weeks of treatment, despite destroying tumors and decreasing kidney size. These findings indicate that Tsc1 prevents aberrant renal growth and tumorigenesis by inhibiting mTORC1 signaling, whereas phosphorylated rpS6 suppresses cystogenesis and fibrosis in Tsc1-deleted kidneys. PMID:26296742

  19. Structural and biochemical basis for mannan utilization by Caldanaerobius polysaccharolyticus strain ATCC BAA-17.

    Science.gov (United States)

    Chekan, Jonathan R; Kwon, In Hyuk; Agarwal, Vinayak; Dodd, Dylan; Revindran, Vanessa; Mackie, Roderick I; Cann, Isaac; Nair, Satish K

    2014-12-12

    Hemicelluloses, the polysaccharide component of plant cell walls, represent one of the most abundant biopolymers in nature. The most common hemicellulosic constituents of softwoods, such as conifers and cycads, are mannans consisting of a 1,4-linked β-mannopyranosyl main chain with branch decorations. Efforts toward the utilization of hemicellulose for bioconversion into cellulosic biofuels have resulted in the identification of several families of glycoside hydrolases that can degrade mannan. However, effective biofermentation of manno-oligosaccharides is limited by a lack of appropriate uptake route in ethanologenic organisms. Here, we used transcriptome sequencing to gain insights into mannan degradation by the thermophilic anaerobic bacterium Caldanaerobius polysaccharolyticus. The most highly up-regulated genes during mannan fermentation occur in a cluster containing several genes encoding enzymes for efficient mannan hydrolysis as well as a solute-binding protein (CpMnBP1) that exhibits specificity for short mannose polymers but exhibited the flexibility to accommodate branched polysaccharide decorations. Co-crystal structures of CpMnBP1 in complex with mannobiose (1.4-Å resolution) and mannotriose (2.2-Å resolution) revealed the molecular rationale for chain length and oligosaccharide specificity. Calorimetric analysis of several active site variants confirmed the roles of residues critical to the function of CpMnBP1. This work represents the first biochemical characterization of a mannose-specific solute-binding protein and provides a framework for engineering mannan utilization capabilities for microbial fermentation. © 2014 by The American Society for Biochemistry and Molecular Biology, Inc.

  20. Profiling of benzophenone derivatives using fish and human estrogen receptor-specific in vitro bioassays

    International Nuclear Information System (INIS)

    Molina-Molina, Jose-Manuel; Escande, Aurelie; Pillon, Arnaud; Gomez, Elena; Pakdel, Farzad; Cavailles, Vincent; Olea, Nicolas; Ait-Aissa, Selim; Balaguer, Patrick

    2008-01-01

    Benzophenone (BP) derivatives, BP1 (2,4-dihydroxybenzophenone), BP2 (2,2',4,4'-tetrahydroxybenzophenone), BP3 (2-hydroxy-4-methoxybenzophenone), and THB (2,4,4'-trihydroxybenzophenone) are UV-absorbing chemicals widely used in pharmaceutical, cosmetics, and industrial applications, such as topical sunscreens in lotions and hair sprays to protect skin and hair from UV irradiation. Studies on their endocrine disrupting properties have mostly focused on their interaction with human estrogen receptor alpha (hERα), and there has been no comprehensive analysis of their potency in a system allowing comparison between hERα and hERβ activities. The objective of this study was to provide a comprehensive ER activation profile of BP derivatives using ER from human and fish origin in a battery of in vitro tests, i.e., competitive binding, reporter gene based assays, vitellogenin (Vtg) induction in isolated rainbow trout hepatocytes, and proliferation based assays. The ability to induce human androgen receptor (hAR)-mediated reporter gene expression was also examined. All BP derivatives tested except BP3 were full hERα and hERβ agonists (BP2 > THB > BP1) and displayed a stronger activation of hERβ compared with hERα, the opposite effect to that of estradiol (E 2 ). Unlike E 2 , BPs were more active in rainbow trout ERα (rtERα) than in hERα assay. All four BP derivatives showed anti-androgenic activity (THB > BP2 > BP1 > BP3). Overall, the observed anti-androgenic potencies of BP derivatives, together with their proposed greater effect on ERβ versus ERα activation, support further investigation of their role as endocrine disrupters in humans and wildlife

  1. Phenotypically Dormant and Immature Leukaemia Cells Display Increased Ribosomal Protein S6 Phosphorylation.

    Directory of Open Access Journals (Sweden)

    Monica Pallis

    Full Text Available Mechanistic/mammalian target of rapamycin (mTOR activity drives a number of key metabolic processes including growth and protein synthesis. Inhibition of the mTOR pathway promotes cellular dormancy. Since cells from patients with acute myeloid leukaemia (AML can be phenotypically dormant (quiescent, we examined biomarkers of their mTOR pathway activity concurrently with Ki-67 and CD71 (indicators of cycling cells by quantitative flow cytometry. Using antibodies to phosphorylated epitopes of mTOR (S2448 and its downstream targets ribosomal protein S6 (rpS6, S235/236 and 4E-BP1 (T36/45, we documented that these phosphorylations were negligible in lymphocytes, but evident in dormant as well as proliferating subsets of both mobilised normal stem cell harvest CD34+ cells and AML blasts. Although mTOR phosphorylation in AML blasts was lower than that of the normal CD34+ cells, p-4E-BP1 was 2.6-fold higher and p-rpS6 was 22-fold higher. Moreover, in contrast to 4E-BP1, rpS6 phosphorylation was higher in dormant than proliferating AML blasts, and was also higher in the immature CD34+CD38- blast subset. Data from the Cancer Genome Atlas show that rpS6 expression is associated with that of respiratory chain enzymes in AML. We conclude that phenotypic quiescence markers do not necessarily predict metabolic dormancy and that elevated rpS6 ser235/236 phosphorylation is characteristic of AML.

  2. Plastid Proteomic Analysis in Tomato Fruit Development.

    Science.gov (United States)

    Suzuki, Miho; Takahashi, Sachiko; Kondo, Takanori; Dohra, Hideo; Ito, Yumihiko; Kiriiwa, Yoshikazu; Hayashi, Marina; Kamiya, Shiori; Kato, Masaya; Fujiwara, Masayuki; Fukao, Yoichiro; Kobayashi, Megumi; Nagata, Noriko; Motohashi, Reiko

    2015-01-01

    To better understand the mechanism of plastid differentiation from chloroplast to chromoplast, we examined proteome and plastid changes over four distinct developmental stages of 'Micro-Tom' fruit. Additionally, to discover more about the relationship between fruit color and plastid differentiation, we also analyzed and compared 'Micro-Tom' results with those from two other varieties, 'Black' and 'White Beauty'. We confirmed that proteins related to photosynthesis remain through the orange maturity stage of 'Micro-Tom', and also learned that thylakoids no longer exist at this stage. These results suggest that at a minimum there are changes in plastid morphology occurring before all related proteins change. We also compared 'Micro-Tom' fruits with 'Black' and 'White Beauty' using two-dimensional gel electrophoresis. We found a decrease of CHRC (plastid-lipid-associated protein) and HrBP1 (harpin binding protein-1) in the 'Black' and 'White Beauty' varieties. CHRC is involved in carotenoid accumulation and stabilization. HrBP1 in Arabidopsis has a sequence similar to proteins in the PAP/fibrillin family. These proteins have characteristics and functions similar to lipocalin, an example of which is the transport of hydrophobic molecules. We detected spots of TIL (temperature-induced lipocalin) in 2D-PAGE results, however the number of spots and their isoelectric points differed between 'Micro-Tom' and 'Black'/'White Beauty'. Lipocalin has various functions including those related to environmental stress response, apoptosis induction, membrane formation and fixation, regulation of immune response, cell growth, and metabolism adjustment. Lipocalin related proteins such as TIL and HrBP1 could be related to the accumulation of carotenoids, fruit color and the differentiation of chromoplast.

  3. Plastid Proteomic Analysis in Tomato Fruit Development.

    Directory of Open Access Journals (Sweden)

    Miho Suzuki

    Full Text Available To better understand the mechanism of plastid differentiation from chloroplast to chromoplast, we examined proteome and plastid changes over four distinct developmental stages of 'Micro-Tom' fruit. Additionally, to discover more about the relationship between fruit color and plastid differentiation, we also analyzed and compared 'Micro-Tom' results with those from two other varieties, 'Black' and 'White Beauty'. We confirmed that proteins related to photosynthesis remain through the orange maturity stage of 'Micro-Tom', and also learned that thylakoids no longer exist at this stage. These results suggest that at a minimum there are changes in plastid morphology occurring before all related proteins change. We also compared 'Micro-Tom' fruits with 'Black' and 'White Beauty' using two-dimensional gel electrophoresis. We found a decrease of CHRC (plastid-lipid-associated protein and HrBP1 (harpin binding protein-1 in the 'Black' and 'White Beauty' varieties. CHRC is involved in carotenoid accumulation and stabilization. HrBP1 in Arabidopsis has a sequence similar to proteins in the PAP/fibrillin family. These proteins have characteristics and functions similar to lipocalin, an example of which is the transport of hydrophobic molecules. We detected spots of TIL (temperature-induced lipocalin in 2D-PAGE results, however the number of spots and their isoelectric points differed between 'Micro-Tom' and 'Black'/'White Beauty'. Lipocalin has various functions including those related to environmental stress response, apoptosis induction, membrane formation and fixation, regulation of immune response, cell growth, and metabolism adjustment. Lipocalin related proteins such as TIL and HrBP1 could be related to the accumulation of carotenoids, fruit color and the differentiation of chromoplast.

  4. Phosphorylation of ribosomal protein S6 mediates compensatory renal hypertrophy.

    Science.gov (United States)

    Xu, Jinxian; Chen, Jianchun; Dong, Zheng; Meyuhas, Oded; Chen, Jian-Kang

    2015-03-01

    The molecular mechanism underlying renal hypertrophy and progressive nephron damage remains poorly understood. Here we generated congenic ribosomal protein S6 (rpS6) knock-in mice expressing nonphosphorylatable rpS6 and found that uninephrectomy-induced renal hypertrophy was significantly blunted in these knock-in mice. Uninephrectomy-induced increases in cyclin D1 and decreases in cyclin E in the remaining kidney were attenuated in the knock-in mice compared with their wild-type littermates. Uninephrectomy induced rpS6 phosphorylation in the wild-type mice; however, no rpS6 phosphorylation was detected in uninephrectomized or sham-operated knock-in mice. Nonetheless, uninephrectomy stimulated comparable 4E-BP1 phosphorylation in both knock-in and wild-type mice, indicating that mTORC1 was still activated in the knock-in mice. Moreover, the mTORC1 inhibitor rapamycin prevented both rpS6 and 4E-BP1 phosphorylation, significantly blunted uninephrectomy-induced renal hypertrophy in wild-type mice, but did not prevent residual renal hypertrophy despite inhibiting 4E-BP1 phosphorylation in uninephrectomized knock-in mice. Thus, both genetic and pharmacological approaches unequivocally demonstrate that phosphorylated rpS6 is a downstream effector of the mTORC1-S6K1 signaling pathway mediating renal hypertrophy. Hence, rpS6 phosphorylation facilitates the increase in cyclin D1 and decrease in cyclin E1 that underlie the hypertrophic nature of uninephrectomy-induced kidney growth.

  5. The relationship between MR images and clinical findings in neuronal migration disorders

    International Nuclear Information System (INIS)

    Onuma, Akira; Kobayashi, Yasuko; Iinuma, Kazuie.

    1997-01-01

    Among the variable manifestating conditions of neuronal migration disorders, mental retardation, motor disturbance and epilepsy are the main features of developmental disabilities. We analyzed the relationship between clinical symptoms and magnetic resonance (MR) images, including surface anatomy scan (SAS). Thirty-nine patients (23 males, 16 females; mean age 6.1 years) with neuronal migration disorders were studied. The diagnoses were cerebral palsy in 23 cases, mental retardation in 4, West syndrome in 4, Fukuyama type congenital muscular dystrophy (FCMD) in 6, Walker-Warburg syndrome in 1 and Dubowitz syndrome in 1. Cortical dysplasias were classified into the following 7 groups, mainly based on the SAS findings: complete agyria (AG 1), mixture of agyria and pachygyria (AG 2), bilateral complete pachygyria (BP 1), diffuse pachygyria with marked widening of the bilateral superior frontal gyrus (BP 2), unilateral pachygyria with hemispheric atrophy or hemimegalencephaly (UP), focal cortical dysplasia (FP) and other findings such as solitary schizencephaly (Others). Most cases of AG 1 and AG 2 showed spastic quadriplegia (6/7) and symptomatic generalized epilepsy (5/7), whereas cases of BP 1 showed spasticity only in 1/8 and epilepsy in 7/8. Hemiplegia was observed in 6/7 of UP, 2/8 of FP and 2/4 of Others. Partial epilepsy was observed in 2/7 of UP and 1/8 of FP. Intellectual level was variable in BP 1, UP, FP and Others, but all cases showed severe mental retardation in AG 1, AG 2 and BP 2. BP 2 was observed in all cases of typical FCMD (5/5). The birth weight was less than 2,500 g in 6/7 of UP. The structural findings well correlated with clinical symptoms and epileptic seizure types. The surface anatomy scan was a very useful technique for detecting cortical dysplasias. (author)

  6. The relationship between MR images and clinical findings in neuronal migration disorders

    Energy Technology Data Exchange (ETDEWEB)

    Onuma, Akira; Kobayashi, Yasuko [Takuto Rehabilitation Center for Disabled Children, Sendai (Japan); Iinuma, Kazuie

    1997-07-01

    Among the variable manifestating conditions of neuronal migration disorders, mental retardation, motor disturbance and epilepsy are the main features of developmental disabilities. We analyzed the relationship between clinical symptoms and magnetic resonance (MR) images, including surface anatomy scan (SAS). Thirty-nine patients (23 males, 16 females; mean age 6.1 years) with neuronal migration disorders were studied. The diagnoses were cerebral palsy in 23 cases, mental retardation in 4, West syndrome in 4, Fukuyama type congenital muscular dystrophy (FCMD) in 6, Walker-Warburg syndrome in 1 and Dubowitz syndrome in 1. Cortical dysplasias were classified into the following 7 groups, mainly based on the SAS findings: complete agyria (AG 1), mixture of agyria and pachygyria (AG 2), bilateral complete pachygyria (BP 1), diffuse pachygyria with marked widening of the bilateral superior frontal gyrus (BP 2), unilateral pachygyria with hemispheric atrophy or hemimegalencephaly (UP), focal cortical dysplasia (FP) and other findings such as solitary schizencephaly (Others). Most cases of AG 1 and AG 2 showed spastic quadriplegia (6/7) and symptomatic generalized epilepsy (5/7), whereas cases of BP 1 showed spasticity only in 1/8 and epilepsy in 7/8. Hemiplegia was observed in 6/7 of UP, 2/8 of FP and 2/4 of Others. Partial epilepsy was observed in 2/7 of UP and 1/8 of FP. Intellectual level was variable in BP 1, UP, FP and Others, but all cases showed severe mental retardation in AG 1, AG 2 and BP 2. BP 2 was observed in all cases of typical FCMD (5/5). The birth weight was less than 2,500 g in 6/7 of UP. The structural findings well correlated with clinical symptoms and epileptic seizure types. The surface anatomy scan was a very useful technique for detecting cortical dysplasias. (author)

  7. Dengue virus inactivation by minipool TnBP/Triton X-45 treatment of plasma and cryoprecipitate.

    Science.gov (United States)

    Burnouf, T; Chou, M-L; Cheng, L-H; Li, Z-R; Wu, Y-W; El-Ekiaby, M; Tsai, K-H

    2013-01-01

    A minipool solvent/detergent (S/D; 1% TnBP/1% Triton X-45; 31°C) process was developed for viral inactivation of plasma and cryoprecipitate used for transfusion. The goal of this study was to determine the rate and extent of inactivation of dengue virus (DENV) during this process. DENV-1 was propagated using C6/36 mosquito cells to an infectivity titre close to 9 log and spiked (10% v/v) into individual plasma and cryoprecipitate samples from two distinct donors. Samples were taken right after spiking and during viral inactivation treatment by 1% TnBP-1% Triton X-45 at 31°C. DENV-1 infectivity was assessed on Vero E6 cells by a focus-forming assay (FFA). Culture medium and complement-inactivated plasma were used as experimental controls. Experiments were done in duplicate. DENV-1 infectivity was 7·5 log in spiked plasma and 7·1 and 7·3 log in spiked cryoprecipitate. There was no loss of DENV-1 infectivity in the spiked materials, nor in the controls not subjected to S/D treatment. No infectivity was found in plasma and cryoprecipitate subjected to S/D treatment at the first time-point evaluated (10 min). DENV-1 was strongly inactivated in plasma and cryoprecipitate, respectively, within 10 min of 1% TnBP/1% Triton X-45 treatment at 31°C. These data provide a reassurance of the safety of such S/D-treated plasma and cryoprecipitate with regard to the risk of transmission of all DENV serotypes and other flaviviruses. © 2012 The Author(s). Vox Sanguinis © 2012 International Society of Blood Transfusion.

  8. Biomechanical and structural changes following the decellularization of bovine pericardial tissues for use as a tissue engineering scaffold.

    Science.gov (United States)

    Pagoulatou, Eirini; Triantaphyllidou, Irene-Eva; Vynios, Demitrios H; Papachristou, Dionysios J; Koletsis, Efstratios; Deligianni, Despina; Mavrilas, Dimosthenis

    2012-06-01

    To achieve natural scaffolds for tissue engineering applications we decellularized bovine pericardial (BP) tissues according to two different protocols: a novel treatment based on Triton(®) X-100 (12 h, 4 °C) (BP1) and a trypsin/EDTA treatment (37 °C, 48 h) (BP2). Results were compared with commercially available acellular xenogeneic biomaterials, Veritas(®) and Collamed(®). Biomechanical characteristics, high (E(h)) and low (E(l)) modulus of elasticity, of the fresh untreated tissue varied with the anatomical direction (apex to base (T) to transverse (L)) (mean ± SDEV): (41.63 ± 14.65-48.12 ± 10.19 MPa and 0.27 ± 0.05-0.30 ± 0.12 MPa respectively). BP1 had no mechanical effect (44.65 ± 19.73-52.67 ± 7.59 MPa and 0.37 ± 0.14-0.37 ± 0.11 MPa, respectively) but BP2 resulted in significant decrease in E(h) and E(l) (20.96 ± 8.17-36.82 ± 3.23 MPa and 0.20 ± 0.06-0.23 ± 0.06 MPa). Hysteresis ratio (h) varied (19-26 % of the loading energy) independently of anatomical direction. Glycosaminoglycans content was unaffected by BP1, while 22 % of chondroitin/dermatan sulphate and 60 % of hyaluronan were removed after BP2 treatment. Endothelial cell adhesion was achieved after 24 h and 3 days cell culture.

  9. Improvements in or relating to catalysts and catalytic burners

    International Nuclear Information System (INIS)

    Cairns, J.A.

    1977-01-01

    A catalyst is described that consists of a fibrous kaolin substrate which supports a sputtered coating of catalytic material in the form of a monatomic layer or atomic dispersion and hence in a highly active form. The kaolin comprises 43 to 47% Al 2 O 3 and 50 to 54% SiO 2 , with traces of Fe 2 O 3 and TiO 2 , and the catalytic material is a Pt group metal or alloy. The method of preparation of such a catalyst is described. An application is for the catalytic oxidation of hydrocarbons. See also BP 1 455248. (U.K.)

  10. Ras-Related Small GTPases RalA and RalB Regulate Cellular Survival After Ionizing Radiation

    International Nuclear Information System (INIS)

    Kidd, Ambrose R.; Snider, Jared L.; Martin, Timothy D.; Graboski, Sarah F.; Der, Channing J.; Cox, Adrienne D.

    2010-01-01

    Purpose: Oncogenic activation of Ras renders cancer cells resistant to ionizing radiation (IR), but the mechanisms have not been fully characterized. The Ras-like small GTPases RalA and RalB are downstream effectors of Ras function and are critical for both tumor growth and survival. The Ral effector RalBP1/RLIP76 mediates survival of mice after whole-body irradiation, but the role of the Ral GTPases themselves in response to IR is unknown. We have investigated the role of RalA and RalB in cellular responses to IR. Methods and Materials: RalA, RalB, and their major effectors RalBP1 and Sec5 were knocked down by stable expression of short hairpin RNAs in the K-Ras-dependent pancreatic cancer-derived cell line MIA PaCa-2. Radiation responses were measured by standard clonogenic survival assays for reproductive survival, γH2AX expression for double-strand DNA breaks (DSBs), and poly(ADP-ribose)polymerase (PARP) cleavage for apoptosis. Results: Knockdown of K-Ras, RalA, or RalB reduced colony-forming ability post-IR, and knockdown of either Ral isoform decreased the rate of DSB repair post-IR. However, knockdown of RalB, but not RalA, increased cell death. Surprisingly, neither RalBP1 nor Sec5 suppression affected colony formation post-IR. Conclusions: Both RalA and RalB contribute to K-Ras-dependent IR resistance of MIA PaCa-2 cells. Sensitization due to suppressed Ral expression is likely due in part to decreased efficiency of DNA repair (RalA and RalB) and increased susceptibility to apoptosis (RalB). Ral-mediated radioresistance does not depend on either the RalBP1 or the exocyst complex, the two best-characterized Ral effectors, and instead may utilize an atypical or novel effector.

  11. Variability and exposure classification of urinary phenol and paraben metabolite concentrations in reproductive-aged women.

    Science.gov (United States)

    Pollack, Anna Z; Perkins, Neil J; Sjaarda, Lindsey; Mumford, Sunni L; Kannan, Kurunthachalam; Philippat, Claire; Wactawski-Wende, Jean; Schisterman, Enrique F

    2016-11-01

    Human exposure to phenols and parabens is widespread. Within-person variability of urinary concentrations in healthy women is not well characterized. To characterize the variability of urinary phenol and paraben concentrations across two months and evaluate the ability of a single spot urine sample to characterize exposure. 143 women provided 509 spot urine samples collected across two months of study (3-5 samples/woman). We measured urinary concentrations of 8 phenols: bisphenol A (BPA), benzophenone-3 (BP-3), benzophenone-1 (BP-1), 2,4-dichlorophenol (2,4-DCP), 2,5-dichlorophenol (2,5-DCP), 2,4,5-trichlorophenol (2,4,5-TCP), 2,4,6-trichlorophenol (2,4,6-TCP), triclosan (TCS); and 8 parabens and their metabolites (benzyl (BzP), butyl (BuP), ethyl (EtP), heptyl (HeP), methyl (MeP), propyl (PrP), 4-hydroxybenzoic acid (4-HB), 3,4-dihydroxybenzoic acid (3,4-DHB)). Biomarker variability was characterized using the intraclass correlation coefficient (ICC) and surrogate category analyses were conducted. ICCs ranged from very low for BPA (0.04) to moderate for BP-3, BP-1, TCS, BzP, and MeP (0.66, 0.58, 0.55, 0.54, and 0.62, respectively). Surrogate analyses suggested that BP-1, BP-3, TCS, 2,4-DCP, BuP, and PrP may be characterized by a single spot sample (sensitivity range 0.76-0.86) but that additional samples were necessary for BPA, HeP, 4-HB, and 3,4-DHB (sensitivity range 0.47-0.61). Urinary phenol and paraben metabolite concentrations were variable across two months in healthy women but the degree of reliability differed by the specific biomarker. A small number of samples may sufficiently characterize typical concentrations for BP-3, BP-1, TCS, BuP, and PrP; but additional biospecimens may be necessary to characterize exposure for other compounds, including BPA. Copyright © 2016 Elsevier Inc. All rights reserved.

  12. Amplified in Breast Cancer Regulates Transcription and Translation in Breast Cancer Cells.

    Science.gov (United States)

    Ochnik, Aleksandra M; Peterson, Mark S; Avdulov, Svetlana V; Oh, Annabell S; Bitterman, Peter B; Yee, Douglas

    2016-02-01

    Control of mRNA translation is fundamentally altered in cancer. Insulin-like growth factor-I (IGF-I) signaling regulates key translation mediators to modulate protein synthesis (e.g. eIF4E, 4E-BP1, mTOR, and S6K1). Importantly the Amplified in Breast Cancer (AIB1) oncogene regulates transcription and is also a downstream mediator of IGF-I signaling. To determine if AIB1 also affects mRNA translation, we conducted gain and loss of AIB1 function experiments in estrogen receptor alpha (ERα)(+) (MCF-7L) and ERα(-) (MDA-MB-231, MDA-MB-435 and LCC6) breast cancer cells. AIB1 positively regulated IGF-I-induced mRNA translation in both ERα(+) and ERα(-) cells. Formation of the eIF4E-4E-BP1 translational complex was altered in the AIB1 ERα(+) and ERα(-) knockdown cells, leading to a reduction in the eIF4E/4E-BP1 and eIF4G/4E-BP1 ratios. In basal and IGF-I stimulated MCF-7 and LCC6 cells, knockdown of AIB1 decreased the integrity of the cap-binding complex, reduced global IGF-I stimulated polyribosomal mRNA recruitment with a concomitant decrease in ten of the thirteen genes tested in polysome-bound mRNAs mapping to proliferation, cell cycle, survival, transcription, translation and ribosome biogenesis ontologies. Specifically, knockdown of AIB1 decreased ribosome-bound mRNA and steady-state protein levels of the transcription factors ERα and E2F1 in addition to reduced ribosome-bound mRNA of the ribosome biogenesis factor BYSL in a cell-line specific manner to regulate mRNA translation. The oncogenic transcription factor AIB1 has a novel role in the regulation of polyribosome recruitment and formation of the translational complex. Combinatorial therapies targeting IGF signaling and mRNA translation in AIB1 expressing breast cancers may have clinical benefit and warrants further investigation. Copyright © 2015 The Authors. Published by Elsevier Inc. All rights reserved.

  13. Hanford prototype-barrier status report FY 1996

    International Nuclear Information System (INIS)

    Gee, G.W.; Ward, A.L.; Gilmore, B.G.; Link, S.O.; Dennis, G.W.; O'Neil, T.K.

    1996-11-01

    A prototype surface barrier is being evaluated as part of a treatability study at the 200-BP-1 Operable Unit in the 200 East Area of the Hanford Site. Tests include the application of irrigation water to the northern half of the barrier and subsequent measurement of water balance, wind and water erosion, subsidence, plant establishment,a nd plant and animal intrusion. The tests are designed to evaluate both irrigated and nonirrigated sideslope and vegetated surfaces over a period of 3 years. This report documents findings from the second year of testing

  14. A Study of Enabling Factors for Rapid Fielding: Combined Practices to Balance Speed and Stability

    Science.gov (United States)

    2013-05-01

    as contributors to the success of Agile projects, such as Scrum status meetings, continuous integration, test-driven development, etc. A second...Management Approach Type Product Size Team Size Sprint length / Prod Release Cycle A-P1 Pre- release Scrum Case management system ᝺M...SLOC 10-20 2 weeks/ TBD B-P1 12 years Scrum Analysis support system ᝺M SLOC 10-20 2 weeks/ 6 months – 1 year C-P1 3 years Scrum Training

  15. REV7/MAD2L2: the multitasking maestro emerges as a barrier to recombination

    Science.gov (United States)

    Sale, Julian E

    2015-01-01

    REV7/MAD2L2 plays important roles in translesion DNA synthesis and mitotic control. Two new papers extend its gamut by revealing its unexpected participation in pathway choice during DNA double-strand break repair. By inhibiting 5′ DNA end resection downstream of 53BP1 and RIF1, REV7/MAD2L2 promotes non-homologous end joining at the expense of homologous recombination. Importantly, loss of REV7/MAD2L2 renders PARP inhibitors ineffective in BRCA1-deficient tumours, suggesting another possible mechanism for the acquisition of resistance to this important new class of drug. PMID:25896508

  16. REV7/MAD2L2: the multitasking maestro emerges as a barrier to recombination

    OpenAIRE

    Sale, Julian E

    2015-01-01

    REV7/MAD2L2 plays important roles in translesion DNA synthesis and mitotic control. Two new papers extend its gamut by revealing its unexpected participation in pathway choice during DNA double-strand break repair. By inhibiting 5′ DNA end resection downstream of 53BP1 and RIF1, REV7/MAD2L2 promotes non-homologous end joining at the expense of homologous recombination. Importantly, loss of REV7/MAD2L2 renders PARP inhibitors ineffective in BRCA1-deficient tumours, suggesting another possible ...

  17. UV filters analyzed by isotope diluted TurboFlow-LC-MS/MS in urine from Danish children and adolescents.

    Science.gov (United States)

    Frederiksen, Hanne; Nielsen, Ole; Skakkebaek, Niels E; Juul, Anders; Andersson, Anna-Maria

    2017-03-01

    Experimental studies indicate that some chemicals with UV blocking properties (known as UV filters) can act as endocrine disruptors. UV filters are used in sunscreens and other cosmetic- and personal care products, as well as in other consumer products such as food packaging, clothing and furniture textiles to protect the products against UV radiation. Here we present the urinary excretion of suspected endocrine active UV filters in Danish children and adolescents recruited from the general population. The content of benzophenone (BP), benzophenone-1 (BP-1), benzophenone-2 (BP-2), benzophenone-3 (BP-3), 5-chloro-2- hydroxybenzophenone (BP-7), 4-hydroxybenzophenone (4-HBP), 4-methyl-benzophenone (4-MBP), 3-(4- methylbenzylidene)-camphor (4-MBC) and 3-benzylidene camphor (3-BC) were monitored in 24h urine and two consecutive first morning samples from 129 healthy Danish children and adolescents (6-21 yrs). All 387 samples were collected during the autumn (Nov. 2007) and were analyzed by a new on-line TurboFlow-LC-MS/MS method developed for simultaneous biomonitoring of these nine UV filters in urine. BP-3 and BP-1 were detected in more than 80% of the 24h samples and were significantly correlated (R 2 =0.815). BP, 4-HBP and BP-2 were found in 43, 15 and 5% of the samples, respectively. The median (range) concentrations of the UV-filters in 24-h urine were as follows: BP-3, 0.92 (LOD-115); BP-1, 0.54 (LOD-44.6); BP,UV filters; BP-7, 4-MBP, 4-MBC or 3-BC were detected in urine. A highly significant correlation between first morning and 24h urine levels of BP-3, BP-1 and 4-HBP from the same day was observed. Our project on UV filters analyzed by a new robust and sensitive LC-MS/MS method in Danish children and adolescents showed that almost all individuals were exposed to UV filters. Sun protection products have been claimed to be a major source of exposure to sunscreens. However since all children in the present study were exposed during autumn where sunscreens are not

  18. Ubiquitin-activating enzyme UBA1 is required for cellular response to DNA damage

    Czech Academy of Sciences Publication Activity Database

    Moudrý, Pavel; Lukas, C.; Macůrek, Libor; Hanzlíková, Hana; Hodný, Zdeněk; Lukas, J.; Bartek, Jiří

    2012-01-01

    Roč. 11, č. 8 (2012), s. 1573-1582 ISSN 1538-4101 R&D Projects: GA ČR GA301/08/0353; GA ČR GAP301/10/1525 Grant - others:7.RP EU(XE) CZ.1.05/2.1.00/01.0030 Institutional research plan: CEZ:AV0Z50520514 Keywords : 53BP1 * DNA damage response * UBA1 * UBA6 * ubiquitylation Subject RIV: EB - Genetics ; Molecular Biology Impact factor: 5.243, year: 2012

  19. Characterizing the DNA Damage Response by Cell Tracking Algorithms and Cell Features Classification Using High-Content Time-Lapse Analysis.

    Directory of Open Access Journals (Sweden)

    Walter Georgescu

    Full Text Available Traditionally, the kinetics of DNA repair have been estimated using immunocytochemistry by labeling proteins involved in the DNA damage response (DDR with fluorescent markers in a fixed cell assay. However, detailed knowledge of DDR dynamics across multiple cell generations cannot be obtained using a limited number of fixed cell time-points. Here we report on the dynamics of 53BP1 radiation induced foci (RIF across multiple cell generations using live cell imaging of non-malignant human mammary epithelial cells (MCF10A expressing histone H2B-GFP and the DNA repair protein 53BP1-mCherry. Using automatic extraction of RIF imaging features and linear programming techniques, we were able to characterize detailed RIF kinetics for 24 hours before and 24 hours after exposure to low and high doses of ionizing radiation. High-content-analysis at the single cell level over hundreds of cells allows us to quantify precisely the dose dependence of 53BP1 protein production, RIF nuclear localization and RIF movement after exposure to X-ray. Using elastic registration techniques based on the nuclear pattern of individual cells, we could describe the motion of individual RIF precisely within the nucleus. We show that DNA repair occurs in a limited number of large domains, within which multiple small RIFs form, merge and/or resolve with random motion following normal diffusion law. Large foci formation is shown to be mainly happening through the merging of smaller RIF rather than through growth of an individual focus. We estimate repair domain sizes of 7.5 to 11 µm2 with a maximum number of ~15 domains per MCF10A cell. This work also highlights DDR which are specific to doses larger than 1 Gy such as rapid 53BP1 protein increase in the nucleus and foci diffusion rates that are significantly faster than for spontaneous foci movement. We hypothesize that RIF merging reflects a "stressed" DNA repair process that has been taken outside physiological conditions when

  20. AcEST: BP919751 [AcEST

    Lifescience Database Archive (English)

    Full Text Available YMU001_000128_G01 537 Adiantum capillus-veneris mRNA. clone: YMU001_000128_G01. BP919751 - Show BP9197...is mRNA. clone: YMU001_000128_G01. Accession BP919751 Tissue type prothallium Developmental stage - Contig I... new generation of protein database search programs, Nucleic Acids Res. 25:3389-3402. Query= BP9197...N=TP53BP1 PE=1 SV=2 Length = 1972 Score = 33.9 bits (76), Expect = 0.51 Identitie...se search programs, Nucleic Acids Res. 25:3389-3402. Query= BP919751|Adiantum capillus-veneris mRNA, clone:

  1. Hanford prototype-barrier status report FY 1996

    Energy Technology Data Exchange (ETDEWEB)

    Gee, G.W.; Ward, A.L.; Gilmore, B.G.; Link, S.O.; Dennis, G.W.; O`Neil, T.K.

    1996-11-01

    A prototype surface barrier is being evaluated as part of a treatability study at the 200-BP-1 Operable Unit in the 200 East Area of the Hanford Site. Tests include the application of irrigation water to the northern half of the barrier and subsequent measurement of water balance, wind and water erosion, subsidence, plant establishment,a nd plant and animal intrusion. The tests are designed to evaluate both irrigated and nonirrigated sideslope and vegetated surfaces over a period of 3 years. This report documents findings from the second year of testing.

  2. DNA damage markers in dermal fibroblasts in vitro reflect chronological donor age

    DEFF Research Database (Denmark)

    Waaijer, Mariëtte E C; Croco, Eleonora; Westendorp, Rudi G J

    2016-01-01

    and presence of cardiovascular diseases. Therefore, numbers of 53BP1 foci, telomere-associated foci (TAF) and micronuclei were measured in cultured dermal fibroblasts obtained from three age groups of donors (mean age 22, 63 and 90 years). Fibroblasts were cultured without a stressor and with 0.6 μM rotenone...... markers and long-lived family membership or cardiovascular disease. Results were comparable when fibroblasts were stressed in vitro with rotenone. In conclusion, we found that DNA damage foci of cultured fibroblasts are significantly associated with the chronological age, but not biological age...

  3. Variability and exposure classification of urinary phenol and paraben metabolite concentrations in reproductive-aged women

    Science.gov (United States)

    Pollack, Anna Z.; Perkins, Neil J.; Sjaarda, Lindsey; Mumford, Sunni L.; Kannan, Kurunthachalam; Philippat, Claire; Wactawski-Wende, Jean; Schisterman, Enrique F.

    2016-01-01

    Background Human exposure to phenols and parabens is widespread. Within-person variability of urinary concentrations in healthy women is not well characterized. Objectives To characterize the variability of urinary phenol and paraben concentrations across two months and evaluate the ability of a single spot urine sample to characterize exposure. Methods 143 women provided 509 spot urine samples collected across two months of study (3–5 samples/woman). We measured urinary concentrations of 8 phenols: bisphenol A (BPA), benzophenone-3 (BP-3), benzophenone-1 (BP-1), 2,4-dichlorophenol (2,4-DCP), 2,5-dichlorophenol (2,5-DCP), 2,4,5-trichlorophenol (2,4,5-TCP), 2,4,6-trichlorophenol (2,4,6-TCP), triclosan (TCS); and 8 parabens and their metabolites (benzyl (BzP), butyl (BuP), ethyl (EtP), heptyl (HeP), methyl (MeP), propyl (PrP), 4-hydro-xybenzoic acid (4-HB), 3,4-dihydroxybenzoic acid (3,4-DHB)). Biomarker variability was characterized using the intraclass correlation coefficient (ICC) and surrogate category analyses were conducted. Results ICCs ranged from very low for BPA (0.04) to moderate for BP-3, BP-1, TCS, BzP, and MeP (0.66, 0.58, 0.55, 0.54, and 0.62, respectively). Surrogate analyses suggested that BP-1, BP-3, TCS, 2,4-DCP, BuP, and PrP may be characterized by a single spot sample (sensitivity range 0.76–0.86) but that additional samples were necessary for BPA, HeP, 4-HB, and 3,4-DHB (sensitivity range 0.47–0.61). Conclusions Urinary phenol and paraben metabolite concentrations were variable across two months in healthy women but the degree of reliability differed by the specific biomarker. A small number of samples may sufficiently characterize typical concentrations for BP-3, BP-1, TCS, BuP, and PrP; but additional biospecimens may be necessary to characterize exposure for other compounds, including BPA. PMID:27567355

  4. Catalysts and conditions for the highly efficient, selective and stable heterogeneous oligomerisation of ethylene

    CSIR Research Space (South Africa)

    Heveling, J

    1998-10-11

    Full Text Available analysis On- and off-line analyses were carried out using Carlo Erba 4200 gas chromatographs equipped with FID detectors and a 60 m SEG OV1 or BP-1 capillary column. Liquid products were condensed with a water-cooled condenser and the volume of gaseous... that the unhydrogenated gasoline fraction, on the other hand, had a RON of 86.2. Further, from 13C ? NMR it can be determined that aromatics are essentially absent from the fuel samples produced under the LT-HP conditions [14]. An estimation of the amount of linear...

  5. Influence of the mycotoxins alpha- and beta-zearalenol (ZOL) on regulators of cap-dependent translation control in pig endometrial cells.

    Science.gov (United States)

    Wollenhaupt, K; Jonas, L; Tiemann, U; Tomek, W

    2004-12-01

    The molecular mechanisms that control the mycotoxin-mediated effects in porcine endometrial cells are far from being completely understood. Recent results show that they could inhibit cell proliferation. Therefore, the present study investigated the effects of the mycotoxins alpha-zearalenol (alpha-ZOL) and beta-zearalenol (beta-ZOL) on a cellular level. Mainly, the abundance and phosphorylation state (activity) of the cell cycle-dependent kinases MAPK and Akt (PKB) and their potential targets eIF4E (eukaryotic initiation factor 4E) and 4E-BP1 (4E binding protein, eIF4E repressor protein) were investigated. The results show that alpha-ZOL has apparently only a slight influence on the phosphorylation state of MAP kinases, Akt and on eIF4E and 4E-BP1. In contrast, their phosphorylation was strongly reduced in beta-ZOL-treated cells in a concentration-dependent manner. Therefore, our results indicate that beta-ZOL potentially not only influences transcription but also effects gene expression on translational level. The effect of alpha- and beta-ZOL on endometrial cell proliferation and their toxicology are discussed.

  6. Comparison of the molecular effects of the mycotoxins beta-zearalenol and deoxynivalenol in porcine endometrial cells--a review.

    Science.gov (United States)

    Wollenhaupt, Karin; Tomek, W; Tiemann, Ute

    2007-03-01

    The mycotoxins beta-zearalenol (beta-ZOL) and deoxynivalenol (DON) produce toxic effects that result in diseases in humans and animals. The molecular mechanisms that control the mycotoxin-mediated effects are far from being completely understood. Various results show that these mycotoxins could inhibit cell proliferation. In the present short communication, the influence of beta-ZOL and DON on the abundance and phosphorylation state of kinases that are included in regulation of the initiation of mRNA translation (which is correlated with cell proliferation) was compared in porcine endometrial cells (PEC). Our results indicate that these mycotoxins modulate the expression and phosphorylation of these factors in a different manner. Whereas beta-ZOL mainly had an impact on the biological activity of the extracellular signal-regulated protein kinases 1 and 2 (ERK1/2), protein kinase B (Akt), eukaryotic initiation factor 4E (eIF4E) and its repressor 4E binding protein 1 (4E-BP1), DON reduced the abundance of p38 MAPk, Akt and specific 4E-BP1 bands. In summary, these results indicate that beta-ZOL influences molecular events that are included in the initiation of mRNA translation in the porcine endometrium but DON does not alter such processes clearly.

  7. A Macrohistone Variant Links Dynamic Chromatin Compaction to BRCA1-Dependent Genome Maintenance

    Directory of Open Access Journals (Sweden)

    Simran Khurana

    2014-08-01

    Full Text Available Appropriate DNA double-strand break (DSB repair factor choice is essential for ensuring accurate repair outcome and genomic integrity. The factors that regulate this process remain poorly understood. Here, we identify two repressive chromatin components, the macrohistone variant macroH2A1 and the H3K9 methyltransferase and tumor suppressor PRDM2, which together direct the choice between the antagonistic DSB repair mediators BRCA1 and 53BP1. The macroH2A1/PRDM2 module mediates an unexpected shift from accessible to condensed chromatin that requires the ataxia telangiectasia mutated (ATM-dependent accumulation of both proteins at DSBs in order to promote DSB-flanking H3K9 dimethylation. Remarkably, loss of macroH2A1 or PRDM2, as well as experimentally induced chromatin decondensation, impairs the retention of BRCA1, but not 53BP1, at DSBs. As a result, macroH2A1 and/or PRDM2 depletion causes epistatic defects in DSB end resection, homology-directed repair, and the resistance to poly(ADP-ribose polymerase (PARP inhibition—all hallmarks of BRCA1-deficient tumors. Together, these findings identify dynamic, DSB-associated chromatin reorganization as a critical modulator of BRCA1-dependent genome maintenance.

  8. Coupling of Human DNA Excision Repair and the DNA Damage Checkpoint in a Defined in Vitro System*

    Science.gov (United States)

    Lindsey-Boltz, Laura A.; Kemp, Michael G.; Reardon, Joyce T.; DeRocco, Vanessa; Iyer, Ravi R.; Modrich, Paul; Sancar, Aziz

    2014-01-01

    DNA repair and DNA damage checkpoints work in concert to help maintain genomic integrity. In vivo data suggest that these two global responses to DNA damage are coupled. It has been proposed that the canonical 30 nucleotide single-stranded DNA gap generated by nucleotide excision repair is the signal that activates the ATR-mediated DNA damage checkpoint response and that the signal is enhanced by gap enlargement by EXO1 (exonuclease 1) 5′ to 3′ exonuclease activity. Here we have used purified core nucleotide excision repair factors (RPA, XPA, XPC, TFIIH, XPG, and XPF-ERCC1), core DNA damage checkpoint proteins (ATR-ATRIP, TopBP1, RPA), and DNA damaged by a UV-mimetic agent to analyze the basic steps of DNA damage checkpoint response in a biochemically defined system. We find that checkpoint signaling as measured by phosphorylation of target proteins by the ATR kinase requires enlargement of the excision gap generated by the excision repair system by the 5′ to 3′ exonuclease activity of EXO1. We conclude that, in addition to damaged DNA, RPA, XPA, XPC, TFIIH, XPG, XPF-ERCC1, ATR-ATRIP, TopBP1, and EXO1 constitute the minimum essential set of factors for ATR-mediated DNA damage checkpoint response. PMID:24403078

  9. Respiratory toxicity of repeated exposure to particles produced by traffic and sugar cane burning.

    Science.gov (United States)

    Mazzoli-Rocha, Flavia; Carvalho, Giovanna M C; Lanzetti, Manuella; Valença, Samuel S; Silva, Luiz F F; Saldiva, Paulo H N; Zin, Walter A; Faffe, Débora S

    2014-01-15

    We compared the toxicity of subchronic exposure to equivalent masses of particles from sugar cane burning and traffic. BALB/c mice received 3 intranasal instillations/week during 1, 2 or 4 weeks of either distilled water (C1, C2, C4) or particles (15μg) from traffic (UP1, UP2, UP4) or biomass burning (BP1, BP2, BP4). Lung mechanics, histology and oxidative stress were analyzed 24h after the last instillation. In all instances UP and BP groups presented worse pulmonary elastance, airway and tissue resistance, alveolar collapse, bronchoconstriction and macrophage influx into the lungs than controls. UP4, BP2 and BP4 presented more alveolar collapse than UP1 and BP1, respectively. UP and BP had worse bronchial and alveolar lesion scores than their controls; BP4 had greater bronchial lesion scores than UP4. Catalase was higher in UP4 and BP4 than in C4. In conclusion, biomass particles were more toxic than those from traffic after repeated exposures. Copyright © 2013 Elsevier B.V. All rights reserved.

  10. Study of Various Processes with 160 A GeV Pb Beam

    CERN Multimedia

    2002-01-01

    % WA101 \\\\ \\\\ Ten modules of BP-1 glass detectors interleaved with various targets ranging from C to Pb were exposed to the 160~A~GeV~Pb beam in the November-December run of 1994 at CERN SPS. The experiment was carried out at normal incidence at a beam density of $\\sim$~600~cm$ ^- ^{2} $. The dimension of each plate of BP-1 glass was 50~mm~x~50~mm~x~1~mm. We etched the glass in 70\\% CH$ _{3} $SO$ _{3} $H at 50 $^{0}$C or in 48\\%~HF at room temperature. The charge threshold is found to be Z$ _{t} _{h} $ $\\sim$ 68 and 70 respectively. Using the automated scanning and measurement system developed at Berkeley, we have demonstrated that the charge resolution for Pb ions is $\\sigma _{Z} $~=~0.14 charge unit from a single measurement within a distance of 30~$\\mu$m. This excellent charge resolution allows us to make the proposed measurements of cross-sections for various processes. \\\\ \\\\We use this detector system to measure cross-sections for various processes in heavy ion collisions of 160~A~GeV~Pb with different t...

  11. S6K1 Is Required for Increasing Skeletal Muscle Force during Hypertrophy.

    Science.gov (United States)

    Marabita, Manuela; Baraldo, Martina; Solagna, Francesca; Ceelen, Judith Johanna Maria; Sartori, Roberta; Nolte, Hendrik; Nemazanyy, Ivan; Pyronnet, Stéphane; Kruger, Marcus; Pende, Mario; Blaauw, Bert

    2016-10-04

    Loss of skeletal muscle mass and force aggravates age-related sarcopenia and numerous pathologies, such as cancer and diabetes. The AKT-mTORC1 pathway plays a major role in stimulating adult muscle growth; however, the functional role of its downstream mediators in vivo is unknown. Here, we show that simultaneous inhibition of mTOR signaling to both S6K1 and 4E-BP1 is sufficient to reduce AKT-induced muscle growth and render it insensitive to the mTORC1-inhibitor rapamycin. Surprisingly, lack of mTOR signaling to 4E-BP1 only, or deletion of S6K1 alone, is not sufficient to reduce muscle hypertrophy or alter its sensitivity to rapamycin. However, we report that, while not required for muscle growth, S6K1 is essential for maintaining muscle structure and force production. Hypertrophy in the absence of S6K1 is characterized by compromised ribosome biogenesis and the formation of p62-positive protein aggregates. These findings identify S6K1 as a crucial player for maintaining muscle function during hypertrophy. Copyright © 2016 The Authors. Published by Elsevier Inc. All rights reserved.

  12. Persistent DNA Damage in Spermatogonial Stem Cells After Fractionated Low-Dose Irradiation of Testicular Tissue

    Energy Technology Data Exchange (ETDEWEB)

    Grewenig, Angelika; Schuler, Nadine; Rübe, Claudia E., E-mail: claudia.ruebe@uks.eu

    2015-08-01

    Purpose: Testicular spermatogenesis is extremely sensitive to radiation-induced damage, and even low scattered doses to testis from radiation therapy may pose reproductive risks with potential treatment-related infertility. Radiation-induced DNA double-strand breaks (DSBs) represent the greatest threat to the genomic integrity of spermatogonial stem cells (SSCs), which are essential to maintain spermatogenesis and prevent reproduction failure. Methods and Materials: During daily low-dose radiation with 100 mGy or 10 mGy, radiation-induced DSBs were monitored in mouse testis by quantifying 53 binding protein 1 (53BP-1) foci in SSCs within their stem cell niche. The accumulation of DSBs was correlated with proliferation, differentiation, and apoptosis of testicular germ cell populations. Results: Even very low doses of ionizing radiation arrested spermatogenesis, primarily by inducing apoptosis in spermatogonia. Eventual recovery of spermatogenesis depended on the survival of SSCs and their functional ability to proliferate and differentiate to provide adequate numbers of differentiating spermatogonia. Importantly, apoptosis-resistant SSCs resulted in increased 53BP-1 foci levels during, and even several months after, fractionated low-dose radiation, suggesting that surviving SSCs have accumulated an increased load of DNA damage. Conclusions: SSCs revealed elevated levels of DSBs for weeks after radiation, and if these DSBs persist through differentiation to spermatozoa, this may have severe consequences for the genomic integrity of the fertilizing sperm.

  13. JMJD1C demethylates MDC1 to regulate the RNF8 and BRCA1-mediated chromatin response to DNA breaks

    DEFF Research Database (Denmark)

    Watanabe, Sugiko; Watanabe, Kenji; Akimov, Vyacheslav

    2013-01-01

    ubiquitylation and recruitment of RAP80-BRCA1 to polyubiquitylated MDC1. Furthermore, JMJD1C restricted formation of RAD51 repair foci, and JMJD1C depletion caused resistance to ionizing radiation and PARP inhibitors, phenotypes relevant to aberrant loss of JMJD1C in subsets of breast carcinomas. These findings......Chromatin ubiquitylation flanking DNA double-strand breaks (DSBs), mediated by RNF8 and RNF168 ubiquitin ligases, orchestrates a two-branch pathway, recruiting repair factors 53BP1 or the RAP80-BRCA1 complex. We report that human demethylase JMJD1C regulates the RAP80-BRCA1 branch of this DNA......-damage response (DDR) pathway. JMJD1C was stabilized by interaction with RNF8, was recruited to DSBs, and was required for local ubiquitylations and recruitment of RAP80-BRCA1 but not 53BP1. JMJD1C bound to RNF8 and MDC1, and demethylated MDC1 at Lys45, thereby promoting MDC1-RNF8 interaction, RNF8-dependent MDC1...

  14. IgD class switching is initiated by microbiota and limited to mucosa-associated lymphoid tissue in mice.

    Science.gov (United States)

    Choi, Jin Huk; Wang, Kuan-Wen; Zhang, Duanwu; Zhan, Xiaowei; Wang, Tao; Bu, Chun-Hui; Behrendt, Cassie L; Zeng, Ming; Wang, Ying; Misawa, Takuma; Li, Xiaohong; Tang, Miao; Zhan, Xiaoming; Scott, Lindsay; Hildebrand, Sara; Murray, Anne R; Moresco, Eva Marie Y; Hooper, Lora V; Beutler, Bruce

    2017-02-14

    Class-switch recombination (CSR) alters the Ig isotype to diversify antibody effector functions. IgD CSR is a rare event, and its regulation is poorly understood. We report that deficiency of 53BP1, a DNA damage-response protein, caused age-dependent overproduction of secreted IgD resulting from increased IgD CSR exclusively within B cells of mucosa-associated lymphoid tissues. IgD overproduction was dependent on activation-induced cytidine deaminase, hematopoietic MyD88 expression, and an intact microbiome, against which circulating IgD, but not IgM, was reactive. IgD CSR occurred via both alternative nonhomologous end-joining and homologous recombination pathways. Microbiota-dependent IgD CSR also was detected in nasal-associated lymphoid tissue of WT mice. These results identify a pathway, present in WT mice and hyperactivated in 53BP1-deficient mice, by which microbiota signal via Toll-like receptors to elicit IgD CSR.

  15. Bowel preparation for CT-colonography: Comparison of two different cleansing protocols

    International Nuclear Information System (INIS)

    Juchems, Markus S.; Hoffmann, Martin H.K.; Schmidt, Stefan A.; Apostel, Anna; Brambs, Hans-Juergen; Aschoff, Andrik J.

    2006-01-01

    Objective: Comparison of cleansing effects and colonic distension observed with two polyethyleneglycol-solution (PEG) containing bowel preparation techniques prior to CT-colonography (CTC). Materials and methods: One hundred and three patients that received CTC in our institution were retrospectively evaluated. Fifty-one patients received preparation 1 (BP1; based on a GoLytely formulation + bisacodyl), 52 preparation 2 (BP2; based on a NuLytely formulation + bisacodyl). On multi-planar-reformatted (MPR) images, fluid residuals and colon distension were assessed in five colonic segments, from the ascending colon to the rectum. Results: On average, significantly (p < 0.001) lower fluid residuals were assesses when using BP2 regardless of the patient position. In prone position, a significantly lower fluid level was observed in the sigmoid using bowel preparation 2. The average maximum diameter measured for the whole colon was 5.2 ± 0.6 cm in prone position and 4.8 ± 0.6 cm in the supine position in BP1 (p < 0.01). In BP2 the average maximum diameter measured for the whole colon was 5.3 ± 0.6 cm in prone position and 4.7 ± 0.5 cm in supine position, respectively (p < 0.001). Conclusion: Overall, lower fluid residuals were scored using BP2. In both preparation groups we achieved better colonic distension in prone position. We were not able to distend the sigmoid better when insufflating air during patient repositioning

  16. CNVs conferring risk of autism or schizophrenia affect cognition in controls.

    Science.gov (United States)

    Stefansson, Hreinn; Meyer-Lindenberg, Andreas; Steinberg, Stacy; Magnusdottir, Brynja; Morgen, Katrin; Arnarsdottir, Sunna; Bjornsdottir, Gyda; Walters, G Bragi; Jonsdottir, Gudrun A; Doyle, Orla M; Tost, Heike; Grimm, Oliver; Kristjansdottir, Solveig; Snorrason, Heimir; Davidsdottir, Solveig R; Gudmundsson, Larus J; Jonsson, Gudbjorn F; Stefansdottir, Berglind; Helgadottir, Isafold; Haraldsson, Magnus; Jonsdottir, Birna; Thygesen, Johan H; Schwarz, Adam J; Didriksen, Michael; Stensbøl, Tine B; Brammer, Michael; Kapur, Shitij; Halldorsson, Jonas G; Hreidarsson, Stefan; Saemundsen, Evald; Sigurdsson, Engilbert; Stefansson, Kari

    2014-01-16

    In a small fraction of patients with schizophrenia or autism, alleles of copy-number variants (CNVs) in their genomes are probably the strongest factors contributing to the pathogenesis of the disease. These CNVs may provide an entry point for investigations into the mechanisms of brain function and dysfunction alike. They are not fully penetrant and offer an opportunity to study their effects separate from that of manifest disease. Here we show in an Icelandic sample that a few of the CNVs clearly alter fecundity (measured as the number of children by age 45). Furthermore, we use various tests of cognitive function to demonstrate that control subjects carrying the CNVs perform at a level that is between that of schizophrenia patients and population controls. The CNVs do not all affect the same cognitive domains, hence the cognitive deficits that drive or accompany the pathogenesis vary from one CNV to another. Controls carrying the chromosome 15q11.2 deletion between breakpoints 1 and 2 (15q11.2(BP1-BP2) deletion) have a history of dyslexia and dyscalculia, even after adjusting for IQ in the analysis, and the CNV only confers modest effects on other cognitive traits. The 15q11.2(BP1-BP2) deletion affects brain structure in a pattern consistent with both that observed during first-episode psychosis in schizophrenia and that of structural correlates in dyslexia.

  17. A revised cranial description of Massospondylus carinatus Owen (Dinosauria: Sauropodomorpha based on computed tomographic scans and a review of cranial characters for basal Sauropodomorpha

    Directory of Open Access Journals (Sweden)

    Kimberley E.J. Chapelle

    2018-01-01

    Full Text Available Massospondylus carinatus is a basal sauropodomorph dinosaur from the early Jurassic Elliot Formation of South Africa. It is one of the best-represented fossil dinosaur taxa, known from hundreds of specimens including at least 13 complete or nearly complete skulls. Surprisingly, the internal cranial anatomy of M. carinatus has never been described using computed tomography (CT methods. Using CT scans and 3D digital representations, we digitally reconstruct the bones of the facial skeleton, braincase, and palate of a complete, undistorted cranium of M. carinatus (BP/1/5241. We describe the anatomical features of the cranial bones, and compare them to other closely related sauropodomorph taxa such as Plateosaurus erlenbergiensis, Lufengosaurus huenei, Sarahsaurus aurifontanalis and Efraasia minor. We identify a suite of character states of the skull and braincase for M. carinatus that sets it apart from other taxa, but these remain tentative due to the lack of comparative sauropodomorph braincase descriptions in the literature. Furthermore, we hypothesize 27 new cranial characters useful for determining relationships in non-sauropodan Sauropodomorpha, delete five pre-existing characters and revise the scores of several existing cranial characters to make more explicit homology statements. All the characters that we hypothesized or revised are illustrated. Using parsimony as an optimality criterion, we then test the relationships of M. carinatus (using BP/1/5241 as a specimen-level exemplar in our revised phylogenetic data matrix.

  18. A new mid-Permian burnetiamorph therapsid from the Main Karoo Basin of South Africa and a phylogenetic review of Burnetiamorpha

    Directory of Open Access Journals (Sweden)

    Michael O. Day

    2016-12-01

    Full Text Available Discoveries of burnetiamorph therapsids in the last decade and a half have increased their known diversity but they remain a minor constituent of middle–late Permian tetrapod faunas. In the Main Karoo Basin of South Africa, from where the clade is traditionally best known, specimens have been reported from all of the Permian biozones except the Eodicynodon and Pristerognathus assemblage zones. Although the addition of new taxa has provided more evidence for burnetiamorph synapomorphies, phylogenetic hypotheses for the clade remain incongruent with their appearances in the stratigraphic column. Here we describe a new burnetiamorph specimen (BP/1/7098 from the Pristerognathus Assemblage Zone and review the phylogeny of the Burnetiamorpha through a comprehensive comparison of known material. Phylogenetic analysis suggests that BP/1/7098 is closely related to the Russian species Niuksenitia sukhonensis. Remarkably, the supposed mid-Permian burnetiids Bullacephalus and Pachydectes are not recovered as burnetiids and in most cases are not burnetiamorphs at all, instead representing an earlier-diverging clade of biarmosuchians that are characterised by their large size, dentigerous transverse process of the pterygoid and exclusion of the jugal from the lateral temporal fenestra. The evolution of pachyostosis therefore appears to have occurred independently in these genera. The resulting biarmosuchian tree is significantly more congruent with the stratigraphic appearance of its constituent taxa than in previous phylogenetic hypotheses and, consequently, does not necessarily constrain the diversification of the Burnetiamorpha to before the Capitanian.

  19. Willowbrook Lodge, Mocklershill, Fethard, Tipperary.

    LENUS (Irish Health Repository)

    Dodson, Helen

    2009-10-01

    The response to DNA damage in vertebrate cells involves successive recruitment of DNA signalling and repair factors. We used light microscopy to monitor the genetic dependencies of such localization to a single, induced DNA double strand break (DSB) in vertebrate cells. We used an inducible version of the rare-cutting I-SceI endonuclease to cut a chromosomally integrated I-SceI site beside a Tet operator array that was visualized by binding a Tet repressor-GFP fusion. Formation of gamma-H2AX foci at a single DSB was independent of ATM or Ku70. ATM-deficient cells showed normal kinetics of 53Bp1 recruitment to DSBs, but Rad51 localization was retarded. 53Bp1 and Rad51 foci formation at a single DSB was greatly reduced in H2AX-null DT40 cells. We also observed decreased inter-sister chromatid distances after DSB induction, suggesting that cohesin loading at DSBs causes elevated sister chromatid cohesion. Loss of ATM reduced DSB-induced cohesion, consistent with cohesin being an ATM target in the DSB response. These data show that the same genetic pathways control how cells respond to single DSBs and to multiple lesions induced by whole-cell DNA damage.

  20. Benzophenone-type UV filters in urine and blood from children, adults, and pregnant women in China: partitioning between blood and urine as well as maternal and fetal cord blood.

    Science.gov (United States)

    Zhang, Tao; Sun, Hongwen; Qin, Xiaolei; Wu, Qian; Zhang, Yanfeng; Ma, Jing; Kannan, Kurunthachalam

    2013-09-01

    Limited information exists on the exposure of benzophenone (BP)-type UV filters (i.e., sunscreen compounds) in children, adults, and pregnant women in China. In this study, we determined the concentrations of five BP derivatives, BP-1, BP-2, BP-3, BP-8, and 4OH-BP in urine (n=101) as well as paired specimens of blood and urine (n=24 pairs) collected from adults; in matched maternal and fetal cord blood (n=20 pairs) collected from pregnant women; and in blood collected from children (n=10). 4OH-BP, BP-1, and BP-3 were found in 61%, 57%, and 25%, respectively, of the urine samples analyzed. 4OH-BP was found in all blood samples; BP-3 was found more frequently in the blood of adults (83%), followed, in decreasing order, by pregnant women (35%) and children (30%). Among all adults, urinary BP-3 concentrations were significantly (pblood and urine was 0.21 in adults, which was significantly lower than that for 4OH-BP (0.36). The concentration ratio of BPs between cord blood and maternal blood was higher for 4OH-BP (0.61) than that for BP-3 (0.48), which suggested greater trans-placental transfer potential of 4OH-BP. This is the first study to document the occurrence of BPs in paired urine and blood, and in matched maternal and fetal cord blood. Copyright © 2013 Elsevier B.V. All rights reserved.

  1. DNA Damage Reduces the Quality, but Not the Quantity of Human Papillomavirus 16 E1 and E2 DNA Replication

    Directory of Open Access Journals (Sweden)

    Molly L. Bristol

    2016-06-01

    Full Text Available Human papillomaviruses (HPVs are causative agents in almost all cervical carcinomas. HPVs are also causative agents in head and neck cancer, the cases of which are increasing rapidly. Viral replication activates the DNA damage response (DDR pathway; associated proteins are recruited to replication foci, and this pathway may serve to allow for viral genome amplification. Likewise, HPV genome double-strand breaks (DSBs could be produced during replication and could lead to linearization and viral integration. Many studies have shown that viral integration into the host genome results in unregulated expression of the viral oncogenes, E6 and E7, promoting HPV-induced carcinogenesis. Previously, we have demonstrated that DNA-damaging agents, such as etoposide, or knocking down viral replication partner proteins, such as topoisomerase II β binding protein I (TopBP1, does not reduce the level of DNA replication. Here, we investigated whether these treatments alter the quality of DNA replication by HPV16 E1 and E2. We confirm that knockdown of TopBP1 or treatment with etoposide does not reduce total levels of E1/E2-mediated DNA replication; however, the quality of replication is significantly reduced. The results demonstrate that E1 and E2 continue to replicate under genomically-stressed conditions and that this replication is mutagenic. This mutagenesis would promote the formation of substrates for integration of the viral genome into that of the host, a hallmark of cervical cancer.

  2. Budget Period 2 Summary Report Part 2: Hywind Maine Project

    Energy Technology Data Exchange (ETDEWEB)

    Driscoll, Frederick; Platt, Andrew; Sirnivas, Senu

    2015-08-15

    This project was performed under the Work for Others—Funds in Agreement FIA-14-1793 between Statoil and the Alliance for Sustainable Energy, manager and operator of the National Renewable Energy Laboratory (NREL). To support the development of a 6-MW spar-mounted offshore wind turbine, Statoil funded NREL to perform tasks in the following three categories: 1. Design and analysis 2. Wake modeling 3. Concept resource assessment. This study expands upon the work conducted in Budget Period 1 (BP1) to investigate the influence of the wake generated from an upstream turbine on a downstream turbine using Computational Fluid Dynamics (CFD) high-fidelity modeling tool. Simulator fOr Wind Farms Application (SOWFA) [1] is an NREL high fidelity modeling tool that couples OpenFOAM [2] CFD and NREL’s Aero-Elastic code Fatigue, Aerodynamics, Structures, and Turbulence (FAST)[3]. In BP1 the configuration was based on Hywind-3MW at 140 m water depth in the Gulf of Maine; however this study for Budget Period 2 (BP2) the configuration investigated is based on Hywind-6MW at 220 m water depth off the coast of Boston. The objectives were to perform two-turbines One-Way Coupling (OWC), three-turbines Two-Way Coupling (TWC), and to investigate wind power plant optimization.

  3. An ImageJ-based algorithm for a semi-automated method for microscopic image enhancement and DNA repair foci counting

    International Nuclear Information System (INIS)

    Klokov, D.; Suppiah, R.

    2015-01-01

    Proper evaluation of the health risks of low-dose ionizing radiation exposure heavily relies on the ability to accurately measure very low levels of DNA damage in cells. One of the most sensitive methods for measuring DNA damage levels is the quantification of DNA repair foci that consist of macromolecular aggregates of DNA repair proteins, such as γH2AX and 53BP1, forming around individual DNA double-strand breaks. They can be quantified using immunofluorescence microscopy and are widely used as markers of DNA double-strand breaks. However this quantification, if performed manually, may be very tedious and prone to inter-individual bias. Low-dose radiation studies are especially sensitive to this potential bias due to a very low magnitude of the effects anticipated. Therefore, we designed and validated an algorithm for the semi-automated processing of microscopic images and quantification of DNA repair foci. The algorithm uses ImageJ, a freely available image analysis software that is customizable to individual cellular properties or experimental conditions. We validated the algorithm using immunolabeled 53BP1 and γH2AX in normal human fibroblast AG01522 cells under both normal and irradiated conditions. This method is easy to learn, can be used by nontrained personnel, and can help avoiding discrepancies in inter-laboratory comparison studies examining the effects of low-dose radiation. (author)

  4. Benzophenone-type UV filters in surface waters: An assessment of profiles and ecological risks in Shanghai, China.

    Science.gov (United States)

    Wu, Ming-Hong; Xie, Deng-Guo; Xu, Gang; Sun, Rui; Xia, Xiao-Yu; Liu, Wen-Long; Tang, Liang

    2017-07-01

    Benzophenone-type UV filters (BP-UV filters) are frequently introduced into aquatic environment from several sources. The occurrence and fate of select BP-UV filters and their metabolites were investigated in this study. All target compounds were detected in water samples, except for 2, 3, 4-trihydroxybenzophenone (2, 3, 4-OH-BP). The concentration reached up 131ngL -1 for 5-benzoyl-4-hydroxy-2-ethoxybenzenesulfonic acid (BP-4), 30.0ngL -1 for 2-hydroxy-4-methoxybenzophenone (BP-3), and mean value of 158ngL -1 for benzophenone (BP). Concentrations of BP-UV filters were not related to recreational waters but with high population frequencies. In addition, five BP-UV filters, namely 2,2',4,4'-tetrahydroxybenzophenone (BP-2), 2,3,4-OH-BP, 2,4-dihydroxybenzophenone (BP-1), 4-hydroxybenzophenone (4-OH-BP) and BP were investigated for probable sources, and found that they originate from BP-3 metabolism. There is a similar source for BP-3, BP-4, BP-1, 4-OH-BP and BP. Environmental risk assessment (ERA) showed that risk quotients (RQs) of BP-4, BP-3 and BP were 2.7, 0.8 and 0.5, respectively. Copyright © 2017 Elsevier Inc. All rights reserved.

  5. The Adaptive Response, Genetic Haplo-Insufficiency and Genomic Instability

    Energy Technology Data Exchange (ETDEWEB)

    Geard, Charles R. [Columbia Univ., New York, NY (United States). Center for Radiological Research

    2014-12-12

    The linear no-threshold (LNT) hypothesis is the driving force in the establishment of radiation protection standards. However, the scientific basis for linearity has been brought into question, particularly due to the concerns about induced radiation resistance as it pertains to oxidative stress. Specifically, we investigated the observation that tumor hypoxia is associated with malignant progression, increased metastases, chemo- and radioresistance and poor prognosis. Experiments were conducted with non-malignant 3T3/NIH cells and normal human lung fibroblasts (NHLF) that were subjected to γ-irradiation under the levels of oxygen resembling those in growing tumors, and related our data to the concentrations of dissolved oxygen (DO), which is a better indicator of the amounts of residual oxygen inside the cells cultured in the hypoxic or anoxic atmosphere. We found that at DO levels about 0.5 mg/L cells subjected to both short-term (17 hours) and prolonged (48-72 hours) hypoxia continued to proliferate, and that apoptotic events were decreased at the early hours of hypoxic treatment. We showed that the short-term hypoxia up-regulated p53-binding protein 1 (53BP1) and resulted in facilitated 53BP1 nuclear foci formation and disappearance, thus indicating the higher efficiency of DNA double strand breaks repair processes. The latter was confirmed by the lower micronuclei incidence in irradiated hypoxic cells.

  6. BBAP monoubiquitylates histone H4 at lysine 91 and selectively modulates the DNA damage response.

    Science.gov (United States)

    Yan, Qingsheng; Dutt, Shilpee; Xu, Rong; Graves, Katherine; Juszczynski, Przemyslaw; Manis, John P; Shipp, Margaret A

    2009-10-09

    Although the BBAP E3 ligase and its binding partner BAL are overexpressed in chemotherapy-resistant lymphomas, the role of these proteins in DNA damage responses remains undefined. Because BAL proteins modulate promoter-coupled transcription and contain structural motifs associated with chromatin remodeling and DNA repair, we reasoned that the BBAP E3 ligase might target nucleosomal proteins. Herein, we demonstrate that BBAP selectively monoubiquitylates histone H4 lysine 91 and protects cells exposed to DNA-damaging agents. Disruption of BBAP-mediated monoubiquitylation of histone H4K91 is associated with the loss of chromatin-associated H4K20 methylase, mono- and dimethyl H4K20, and a delay in the kinetics of 53BP1 foci formation at sites of DNA damage. Because 53BP1 localizes to DNA damage sites, in part, via an interaction with dimethyl H4K20, these data directly implicate BBAP in the monoubiquitylation and additional posttranslational modification of histone H4 and an associated DNA damage response.

  7. BAL1 and its partner E3 ligase, BBAP, link Poly(ADP-ribose) activation, ubiquitylation, and double-strand DNA repair independent of ATM, MDC1, and RNF8.

    Science.gov (United States)

    Yan, Qingsheng; Xu, Rong; Zhu, Liya; Cheng, Xin; Wang, Zhe; Manis, John; Shipp, Margaret A

    2013-02-01

    The BAL1 macrodomain-containing protein and its partner E3 ligase, BBAP, are overexpressed in chemotherapy-resistant lymphomas. BBAP selectively ubiquitylates histone H4 and indirectly promotes early 53BP1 recruitment to DNA damage sites. However, neither BBAP nor BAL1 has been directly associated with a DNA damage response (DDR), and the function of BAL1 remains undefined. Herein, we describe a direct link between rapid and short-lived poly(ADP-ribose) (PAR) polymerase 1 (PARP1) activation and PARylation at DNA damage sites, PAR-dependent recruitment of the BAL1 macrodomain-containing protein and its partner E3 ligase, local BBAP-mediated ubiquitylation, and subsequent recruitment of the checkpoint mediators 53BP1 and BRCA1. The PARP1-dependent localization of BAL1-BBAP functionally limits both early and delayed DNA damage and enhances cellular viability independent of ATM, MDC1, and RNF8. These data establish that BAL1 and BBAP are bona fide members of a DNA damage response pathway and are directly associated with PARP1 activation, BRCA1 recruitment, and double-strand break repair.

  8. Cordyceps militaris (L. Link Fruiting Body Reduces the Growth of a Non-Small Cell Lung Cancer Cell Line by Increasing Cellular Levels of p53 and p21

    Directory of Open Access Journals (Sweden)

    Ana Bizarro

    2015-07-01

    Full Text Available Cordyceps militaris (L. Link, an edible entomopathogenic fungus widely used in traditional Chinese medicine, has numerous potential medicinal properties including antitumor activity. The methanolic extract of C. militaris fruiting body was recently shown to have tumor cell growth inhibitory activity in several human tumor cell lines. Nonetheless, the mechanism of action involved is still not known. This work aimed at further studying the effect of the methanolic extract of C. militaris regarding its antitumor mechanism of action, using the non-small cell lung cancer cell line (NCI-H460 as a model. Results showed that treatment with the extract decreased cellular proliferation, induced cell cycle arrest at G0/G1 and increased apoptosis. In addition, the extract increased the levels of p53 and p21. Moreover, an increase in p-H2A.X and 53BP1 levels, together with an increase in the number of 53BP1 foci/cell (all indicative of DNA damage, were also observed after treatment with the extract. This work suggests that this extract affected NCI-H460 cellular viability through a mechanism involving DNA damage and p53 activation. This further supports the potential of this extract as a source of bioactive compounds, which may be used in anticancer strategies.

  9. Increased sister chromatid cohesion and DNA damage response factor localization at an enzyme-induced DNA double-strand break in vertebrate cells.

    LENUS (Irish Health Repository)

    Dodson, Helen

    2009-10-01

    The response to DNA damage in vertebrate cells involves successive recruitment of DNA signalling and repair factors. We used light microscopy to monitor the genetic dependencies of such localization to a single, induced DNA double strand break (DSB) in vertebrate cells. We used an inducible version of the rare-cutting I-SceI endonuclease to cut a chromosomally integrated I-SceI site beside a Tet operator array that was visualized by binding a Tet repressor-GFP fusion. Formation of gamma-H2AX foci at a single DSB was independent of ATM or Ku70. ATM-deficient cells showed normal kinetics of 53Bp1 recruitment to DSBs, but Rad51 localization was retarded. 53Bp1 and Rad51 foci formation at a single DSB was greatly reduced in H2AX-null DT40 cells. We also observed decreased inter-sister chromatid distances after DSB induction, suggesting that cohesin loading at DSBs causes elevated sister chromatid cohesion. Loss of ATM reduced DSB-induced cohesion, consistent with cohesin being an ATM target in the DSB response. These data show that the same genetic pathways control how cells respond to single DSBs and to multiple lesions induced by whole-cell DNA damage.

  10. RNA-seq profiling reveals defense responses in a tolerant potato cultivar to stem infection by Pectobacterium carotovorum ssp. brasiliense

    Directory of Open Access Journals (Sweden)

    Stanford Kwenda

    2016-12-01

    Full Text Available Pectobacterium carotovorum subsp. brasiliense is a member of the soft rot Enterobacteriaceae (SRE family that causes tuber soft rot and blackleg diseases of stems in potato plants. Currently, there are no effective chemical strategies for the control of members of the SRE. Thus, an understanding of the inducible defense responses in stems of potato plants is important, particularly during colonization of the vascular system. Here, time-course RNA-sequencing analysis was used to compare expressed genes between a susceptible potato cultivar (Solanum tubersoum cv Valor and a tolerant cultivar (S. tuberosum cv BP1 at 0, 6, 12, 24, and 72 h post-inoculation with P. c. brasiliense. In total, we identified 6,139 and 8,214 differentially expressed genes (DEGs in the tolerant and susceptible cultivars, compared to mock-inoculated controls, respectively. Key DEGs distinguishing between tolerance and susceptibility were associated with negative regulation of cell death and plant-type cell wall organization/ biogenesis biological processes in the tolerant and susceptible cultivars, respectively. Among these were DEGs involved in signaling (mainly MAPK cascade and ethylene pathway, defense-related transcription regulation including WRKY transcription factors, and downstream secondary cell biosynthesis. Together, our results suggest that S. tuberosum cv BP1 likely employs quantitative defense response against P.c brasiliense. Overall, our study provides the first transcriptome-wide insight into the molecular basis of tolerance and/or resistance of potato stems to SRE infection.

  11. RNA-seq Profiling Reveals Defense Responses in a Tolerant Potato Cultivar to Stem Infection by Pectobacterium carotovorum ssp. brasiliense.

    Science.gov (United States)

    Kwenda, Stanford; Motlolometsi, Tshepiso V; Birch, Paul R J; Moleleki, Lucy N

    2016-01-01

    Pectobacterium carotovorum subsp. brasiliense is a member of the soft rot Enterobacteriaceae (SRE) family that causes tuber soft rot and blackleg diseases of stems in potato plants. Currently, there are no effective chemical strategies for the control of members of the SRE. Thus, an understanding of the inducible defense responses in stems of potato plants is important, particularly during colonization of the vascular system. Here, time-course RNA-sequencing analysis was used to compare expressed genes between a susceptible potato cultivar ( Solanum tuberosum cv Valor) and a tolerant cultivar ( S. tuberosum cv BP1) at 0, 6, 12, 24, and 72 h post-inoculation with P. c. brasiliense . In total, we identified 6139 and 8214 differentially expressed genes (DEGs) in the tolerant and susceptible cultivars, compared to mock-inoculated controls, respectively. Key DEGs distinguishing between tolerance and susceptibility were associated with negative regulation of cell death and plant-type cell wall organization/biogenesis biological processes in the tolerant and susceptible cultivars, respectively. Among these were DEGs involved in signaling (mainly MAPK cascade and ethylene pathway), defense-related transcription regulation including WRKY transcription factors, and downstream secondary cell biosynthesis. Together, our results suggest that S. tuberosum cv BP1 likely employs quantitative defense response against P. c. brasiliense . Overall, our study provides the first transcriptome-wide insight into the molecular basis of tolerance and/or resistance of potato stems to SRE infection.

  12. Electronic states of thiophene/phenylene co-oligomers: Extreme-ultra violet excited photoelectron spectroscopy observations and density functional theory calculations

    International Nuclear Information System (INIS)

    Kawaguchi, Yoshizo; Sasaki, Fumio; Mochizuki, Hiroyuki; Ishitsuka, Tomoaki; Tomie, Toshihisa; Ootsuka, Teruhisa; Watanabe, Shuji; Shimoi, Yukihiro; Yamao, Takeshi; Hotta, Shu

    2013-01-01

    We have investigated electronic states in the valence electron bands for the thin films of three thiophene/phenylene co-oligomer (TPCO) compounds, 2,5-bis(4-biphenylyl)thiophene (BP1T), 1,4-bis(5-phenylthiophen-2-yl)benzene (AC5), and 1,4-bis{5-[4-(trifluoromethyl)phenyl]thiophen-2-yl}benzene (AC5-CF 3 ), by using extreme-UV excited photoelectron spectroscopy (EUPS). By comparing both EUPS spectra and secondary electron spectra between AC5 and AC5-CF 3 , we confirm that CF 3 substitution to AC5 deepens valence states by 2 eV, and increases the ionization energy by 3 eV. From the cut-off positions of secondary electron spectra, the work functions of AC5, AC5-CF 3 , and BP1T are evaluated to be 3.8 eV, 4.8 eV, and 4.0 eV, respectively. We calculate molecular orbital (MO) energy levels by the density functional theory and compare results of calculations with those of experiments. Densities of states obtained by broadening MO levels well explain the overall features of experimental EUPS spectra of three TPCOs.

  13. Spatially restricted translation of the xCR1 mRNA in Xenopus embryos.

    Science.gov (United States)

    Zhang, Yan; Forinash, Kara D; McGivern, Jered; Fritz, Brian; Dorey, Karel; Sheets, Michael D

    2009-07-01

    The xCR1 protein is a maternal determinant and cofactor for nodal signaling in vertebrate embryos. The xCR1 protein accumulates specifically in the animal cells of Xenopus embryos, but maternal xCR1 mRNA is distributed equally throughout all embryonic cells. Here, we show that vegetal cell-specific translational repression of xCR1 mRNA contributes to this spatially restricted accumulation of the xCR1 protein in Xenopus embryos. xCR1 mRNA was associated with polyribosomes in animal cells but not vegetal cells. A 351-nucleotide region of xCR1 mRNA's 3' untranslated region was sufficient to confer a spatially restricted pattern of translation to a luciferase reporter mRNA by repressing translation in vegetal cells. Repression depended upon the mRNA's 5' cap but not its 3' poly(A) tail. Furthermore, the region of xCR1 mRNA sufficient to confer vegetal cell-specific repression contained both Pumilio binding elements (PBEs) and binding sites for the CUG-BP1 protein. The PBEs and the CUG-BP1 sites were necessary but not sufficient for translation repression. Our studies of xCR1 mRNA document the first example of spatially regulated translation in controlling the asymmetric distribution of a maternal determinant in vertebrates.

  14. Homologous recombination and non-homologous end-joining repair pathways in bovine embryos with different developmental competence

    Energy Technology Data Exchange (ETDEWEB)

    Henrique Barreta, Marcos [Universidade Federal de Santa Catarina, Campus Universitario de Curitibanos, Curitibanos, SC (Brazil); Laboratorio de Biotecnologia e Reproducao Animal-BioRep, Universidade Federal de Santa Maria, Santa Maria, RS (Brazil); Garziera Gasperin, Bernardo; Braga Rissi, Vitor; Cesaro, Matheus Pedrotti de [Laboratorio de Biotecnologia e Reproducao Animal-BioRep, Universidade Federal de Santa Maria, Santa Maria, RS (Brazil); Ferreira, Rogerio [Centro de Educacao Superior do Oeste-Universidade do Estado de Santa Catarina, Chapeco, SC (Brazil); Oliveira, Joao Francisco de; Goncalves, Paulo Bayard Dias [Laboratorio de Biotecnologia e Reproducao Animal-BioRep, Universidade Federal de Santa Maria, Santa Maria, RS (Brazil); Bordignon, Vilceu, E-mail: vilceu.bordignon@mcgill.ca [Department of Animal Science, McGill University, Ste-Anne-De-Bellevue, QC (Canada)

    2012-10-01

    This study investigated the expression of genes controlling homologous recombination (HR), and non-homologous end-joining (NHEJ) DNA-repair pathways in bovine embryos of different developmental potential. It also evaluated whether bovine embryos can respond to DNA double-strand breaks (DSBs) induced with ultraviolet irradiation by regulating expression of genes involved in HR and NHEJ repair pathways. Embryos with high, intermediate or low developmental competence were selected based on the cleavage time after in vitro insemination and were removed from in vitro culture before (36 h), during (72 h) and after (96 h) the expected period of embryonic genome activation. All studied genes were expressed before, during and after the genome activation period regardless the developmental competence of the embryos. Higher mRNA expression of 53BP1 and RAD52 was found before genome activation in embryos with low developmental competence. Expression of 53BP1, RAD51 and KU70 was downregulated at 72 h and upregulated at 168 h post-insemination in response to DSBs induced by ultraviolet irradiation. In conclusion, important genes controlling HR and NHEJ DNA-repair pathways are expressed in bovine embryos, however genes participating in these pathways are only regulated after the period of embryo genome activation in response to ultraviolet-induced DSBs.

  15. Homologous recombination and non-homologous end-joining repair pathways in bovine embryos with different developmental competence

    International Nuclear Information System (INIS)

    Henrique Barreta, Marcos; Garziera Gasperin, Bernardo; Braga Rissi, Vitor; Cesaro, Matheus Pedrotti de; Ferreira, Rogério; Oliveira, João Francisco de; Gonçalves, Paulo Bayard Dias; Bordignon, Vilceu

    2012-01-01

    This study investigated the expression of genes controlling homologous recombination (HR), and non-homologous end-joining (NHEJ) DNA-repair pathways in bovine embryos of different developmental potential. It also evaluated whether bovine embryos can respond to DNA double-strand breaks (DSBs) induced with ultraviolet irradiation by regulating expression of genes involved in HR and NHEJ repair pathways. Embryos with high, intermediate or low developmental competence were selected based on the cleavage time after in vitro insemination and were removed from in vitro culture before (36 h), during (72 h) and after (96 h) the expected period of embryonic genome activation. All studied genes were expressed before, during and after the genome activation period regardless the developmental competence of the embryos. Higher mRNA expression of 53BP1 and RAD52 was found before genome activation in embryos with low developmental competence. Expression of 53BP1, RAD51 and KU70 was downregulated at 72 h and upregulated at 168 h post-insemination in response to DSBs induced by ultraviolet irradiation. In conclusion, important genes controlling HR and NHEJ DNA-repair pathways are expressed in bovine embryos, however genes participating in these pathways are only regulated after the period of embryo genome activation in response to ultraviolet-induced DSBs.

  16. Persistence and dynamics of DNA damage signal amplification determined by microcolony formation and live-cell imaging

    International Nuclear Information System (INIS)

    Oka, Yasuyoshi; Yamauchi, Motohiro; Suzuki, Masatoshi; Yamashita, Shunichi; Suzuki, Keiji

    2011-01-01

    Cell cycle checkpoints are essential cellular process protecting the integrity of the genome from DNA damaging agents. In the present study, we developed a microcolony assay, in which normal human diploid fibroblast-like cells exposed to ionizing radiation, were plated onto coverslips at very low density (3 cells/cm 2 ). Cells were grown for up to 3 days, and phosphorylated ataxia-telangiectasia mutated (ATM) at Ser1981 and 53BP1 foci were analyzed as the markers for an amplified DNA damage signal. We observed a dose-dependent increase in the fraction of non-dividing cells, whose increase was compromised by knocking down p53 expression. While large persistent foci were predominantly formed in non-dividing cells, we observed some growing colonies that contained cells with large foci. As each microcolony was derived from a single cell, it appeared that some cells could proliferate with large foci. A live-imaging analysis using hTERT-immortalized normal human diploid cells transfected with the EGFP-tagged 53BP1 gene revealed that the formation of persistent large foci was highly dynamic. Delayed appearance and disappearance of large foci were frequently observed in exposed cells visualized 12-72 hours after X-irradiation. Thus, our results indicate that amplified DNA damage signal could be ignored, which may be explained in part by the dynamic nature of the amplification process. (author)

  17. Effects of different replicons in conjugative plasmids on transformation efficiency, plasmid stability, gene expression and n-butanol biosynthesis in Clostridium tyrobutyricum

    Energy Technology Data Exchange (ETDEWEB)

    Yu, Mingrui; Du, Yinming; Jiang, Wenyan; Chang, Wei-Lun; Yang, Shang-Tian [Ohio State Univ., Columbus, OH (United States). William G. Lowrie Dept. of Chemical and Biomolecular Engineering; Tang, I-Ching [Bioprocessing Innovative Company, Dublin, OH (United States)

    2012-01-15

    Clostridium tyrobutyricum ATCC 25755 can produce butyric acid, acetic acid, and hydrogen as the main products from various carbon sources. In this study, C. tyrobutyricum was used as a host to produce n-butanol by expressing adhE2 gene under the control of a native thiolase promoter using four different conjugative plasmids (pMTL82151, 83151, 84151, and 85151) each with a different replicon (pBP1 from C. botulinum NCTC2916, pCB102 from C. butyricum, pCD6 from Clostridium difficile, and pIM13 from Bacillus subtilis). The effects of different replicons on transformation efficiency, plasmid stability, adhE2 expression and aldehyde/alcohol dehydrogenase activities, and butanol production by different mutants of C. tyrobutyricum were investigated. Among the four plasmids and replicons studied, pMTL82151 with pBP1 gave the highest transformation efficiency, plasmid stability, gene expression, and butanol biosynthesis. Butanol production from various substrates, including glucose, xylose, mannose, and mannitol were then investigated with the best mutant strain harboring adhE2 in pMTL82151. A high butanol titer of 20.5 g/L with 0.33 g/g yield and 0.32 g/L h productivity was obtained with mannitol as the substrate in batch fermentation with pH controlled at {proportional_to}6.0. (orig.)

  18. Size Effect on the Cytotoxicity of Layered Black Phosphorus and Underlying Mechanisms.

    Science.gov (United States)

    Zhang, Xuejiao; Zhang, Ziming; Zhang, Siyu; Li, Dengyu; Ma, Wei; Ma, ChuanXin; Wu, Fengchang; Zhao, Qing; Yan, Qingfeng; Xing, Baoshan

    2017-08-01

    A systematic cytotoxicity study of layered black phosphorus (BP) is urgently needed before moving forward to its potential biomedical applications. Herein, bulk BP crystals are synthesized and exfoliated into layered BP with different lateral size and thickness. The cytotoxicity of as-exfoliated layered BP is evaluated by a label-free real-time cell analysis technique, displaying a concentration-, size-, and cell type-dependent response. The IC 50 values can vary by 40 and 30 times among the BP sizes and cell types, respectively. BP-1 with the largest lateral size and thickness has the highest cytotoxicity; whereas the smallest BP-3 only shows moderate toxicity. The sensitivity of three tested cell lines follows the sequence of 293T > NIH 3T3 > HCoEpiC. Two possible mechanisms for BP to induce cytotoxicity are proposed and verified: (1) the generation of intracellular reactive oxygen species (ROS) is detected by a ROS sensitive probe using the inverted fluorescence microscopy and flow cytometry; (2) the interaction of layered BP and model cell membrane is examined by quartz crystal microbalance with dissipation, illustrating the disruption of cell membrane integrity especially by the largest BP-1. This systematic study of BP's cytotoxicity will shed light on its future biomedical and environmental applications. © 2017 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  19. Larval fish distribution and their relationship with environmental factors in the southern Tyrrhenian Sea (central Mediterranean during two years of sampling

    Directory of Open Access Journals (Sweden)

    Adriana Profeta

    2014-06-01

    The results of this study could have implications for the management of marine resources, because the investigated area has already been identified as a nursery area for many pelagic and coastal fishes and a natural habitat for many species of high commercial interest. Fig. 1. Results of CCA analysis for larval fish species and sampled stations during June 2006. Two first axes (CCA1 and CCA2 are represented. Species abbreviations in alphabetical order: An_a (Anthias anthias, Ap_i (Apogon imberbis, Ar_k (Arnoglossus kessleri, Ar_h (Argyropelecus hemigymnus, Ar_l (Arnoglossus laterna, Ar_r (Arnoglossus rueppelii, Ar_t (Arnoglossus thori, Be_g (Benthosema glaciale, Bl_o (Blennius ocellaris, Bo_b (Boops boops, Bo_p (Bothus podas, Ca_a (Capros aper, Ca_p (Callyonimus maculatus, Ce_m (Ceratoscopelus maderensis, Ce_m1(Cepola macrophtalma, Ci_l (Citharus linguatula, Co_j (Coris julis, Co_n (Ophidion barbatum, Cy_b (Cyclothone braueri, Cy_p (Cyclothone pygmaea, En_e (Engraulis encrasicolus, Di_a (Diplodus annularis, Di_h (Diaphus holti, Di_r (Diaphus rafinesquei, El_r (Electrona rissoi, Go_n (Gobius niger, He_d (Helicolenus dactylopterus, Hy_b (Hygophum benoiti, Hy_h (Hygophum hygomii, La_c (Lampanyctus crocodilus, La_p (Lampanyctus pusillus, Le_c (Lepidotrigla cavillone, Le_j (Lestidiops jayakari, Lo_d (Lobianchia dofleini, Ma_m (Maurolicus muelleri, Ma_s (Macrorhamphosus scolopax, Me_m (Merluccius merluccius, Mi_p (Micromesistius poutassou, My_p (Myctophum punctatum, Mu_s (Mullus surmuletus, Ne_s (Nemichthys scolopaceus, No_b (Notoscopelus bolini, No_e (Notoscopelus elongatus, No_r (Arctozenus risso, Ob_m (Oblada melanura, Pa_s (Paralepis speciosa. Sc_p (Scorpaena porcus, Sc_s (Scorpaena scrofa, Se_c (Serranus cabrilla, Se_h (Serranushepatus, Sp_f (Spicara maena, Sp_s (Spicara smaris, Sy sp. (Symphurus nigrescens, Sy_v, (Symphurus ligulatus, St_b (Stomias boa boa, Tr_d (Trachinus draco, Tr_me (Trachurus mediterraneus, Tr_t (Trachurus trachurus, Ur_s (Uranoscopus scaber

  20. A RAD-based linkage map and comparative genomics in the gudgeons (genus Gnathopogon, Cyprinidae

    Directory of Open Access Journals (Sweden)

    Kakioka Ryo

    2013-01-01

    Full Text Available Abstract Background The construction of linkage maps is a first step in exploring the genetic basis for adaptive phenotypic divergence in closely related species by quantitative trait locus (QTL analysis. Linkage maps are also useful for comparative genomics in non-model organisms. Advances in genomics technologies make it more feasible than ever to study the genetics of adaptation in natural populations. Restriction-site associated DNA (RAD sequencing in next-generation sequencers facilitates the development of many genetic markers and genotyping. We aimed to construct a linkage map of the gudgeons of the genus Gnathopogon (Cyprinidae for comparative genomics with the zebrafish Danio rerio (a member of the same family as gudgeons and for the future QTL analysis of the genetic architecture underlying adaptive phenotypic evolution of Gnathopogon. Results We constructed the first genetic linkage map of Gnathopogon using a 198 F2 interspecific cross between two closely related species in Japan: river-dwelling Gnathopogon elongatus and lake-dwelling Gnathopogon caerulescens. Based on 1,622 RAD-tag markers, a linkage map spanning 1,390.9 cM with 25 linkage groups and an average marker interval of 0.87 cM was constructed. We also identified a region involving female-specific transmission ratio distortion (TRD. Synteny and collinearity were extensively conserved between Gnathopogon and zebrafish. Conclusions The dense SNP-based linkage map presented here provides a basis for future QTL analysis. It will also be useful for transferring genomic information from a “traditional” model fish species, zebrafish, to screen candidate genes underlying ecologically important traits of the gudgeons.