WorldWideScience

Sample records for thermococcus onnurineus na1

  1. Catalytic Intermediate Crystal Structures of Cysteine Desulfurase from the Archaeon Thermococcus onnurineus NA1

    Directory of Open Access Journals (Sweden)

    Thien-Hoang Ho

    2017-01-01

    Full Text Available Thermococcus onnurineus NA1 is an anaerobic archaeon usually found in a deep-sea hydrothermal vent area, which can use elemental sulfur (S0 as a terminal electron acceptor for energy. Sulfur, essential to many biomolecules such as sulfur-containing amino acids and cofactors including iron-sulfur cluster, is usually mobilized from cysteine by the pyridoxal 5′-phosphate- (PLP- dependent enzyme of cysteine desulfurase (CDS. We determined the crystal structures of CDS from Thermococcus onnurineus NA1 (ToCDS, which include native internal aldimine (NAT, gem-diamine (GD with alanine, internal aldimine structure with existing alanine (IAA, and internal aldimine with persulfide-bound Cys356 (PSF structures. The catalytic intermediate structures showed the dihedral angle rotation of Schiff-base linkage relative to the PLP pyridine ring. The ToCDS structures were compared with bacterial CDS structures, which will help us to understand the role and catalytic mechanism of ToCDS in the archaeon Thermococcus onnurineus NA1.

  2. The structure of TON1937 from archaeon Thermococcus onnurineus NA1 reveals a eukaryotic HEAT-like architecture.

    Science.gov (United States)

    Jeong, Jae-Hee; Kim, Yi-Seul; Rojviriya, Catleya; Cha, Hyung Jin; Ha, Sung-Chul; Kim, Yeon-Gil

    2013-10-01

    The members of the ARM/HEAT repeat-containing protein superfamily in eukaryotes have been known to mediate protein-protein interactions by using their concave surface. However, little is known about the ARM/HEAT repeat proteins in prokaryotes. Here we report the crystal structure of TON1937, a hypothetical protein from the hyperthermophilic archaeon Thermococcus onnurineus NA1. The structure reveals a crescent-shaped molecule composed of a double layer of α-helices with seven anti-parallel α-helical repeats. A structure-based sequence alignment of the α-helical repeats identified a conserved pattern of hydrophobic or aliphatic residues reminiscent of the consensus sequence of eukaryotic HEAT repeats. The individual repeats of TON1937 also share high structural similarity with the canonical eukaryotic HEAT repeats. In addition, the concave surface of TON1937 is proposed to be its potential binding interface based on this structural comparison and its surface properties. These observations lead us to speculate that the archaeal HEAT-like repeats of TON1937 have evolved to engage in protein-protein interactions in the same manner as eukaryotic HEAT repeats. Copyright © 2013 Elsevier B.V. All rights reserved.

  3. Structure of the hypothetical protein Ton1535 from Thermococcus onnurineus NA1 reveals unique structural properties by a left-handed helical turn in normal α-solenoid protein.

    Science.gov (United States)

    Jeong, Jae-Hee; Kim, Yi-Seul; Rojvirija, Catleya; Cha, Hyung Jin; Kim, Yeon-Gil; Ha, Sung Chul

    2014-06-01

    The crystal structure of Ton1535, a hypothetical protein from Thermococcus onnurineus NA1, was determined at 2.3 Å resolution. With two antiparallel α-helices in a helix-turn-helix motif as a repeating unit, Ton1535 consists of right-handed coiled N- and C-terminal regions that are stacked together using helix bundles containing a left-handed helical turn. One left-handed helical turn in the right-handed coiled structure produces two unique structural properties. One is the presence of separated concave grooves rather than one continuous concave groove, and the other is the contribution of α-helices on the convex surfaces of the N-terminal region to the extended surface of the concave groove of the C-terminal region and vice versa. © 2013 Wiley Periodicals, Inc.

  4. Identification of a glycolytic regulon in the Archaea Pyrococcus and Thermococcus

    NARCIS (Netherlands)

    Werken, van de H.J.G.; Verhees, C.H.; Akerboom, A.P.; Vos, de W.M.; Oost, van der J.

    2006-01-01

    The glycolytic pathway of the hyperthermophilic archaea that belong to the order Thermococcales (Pyrococcus, Thermococcus and Palaeococcus) differs significantly from the canonical Embden-Meyerhof pathway in bacteria and eukarya. This archaeal glycolysis variant consists of several novel enzymes,

  5. Formate hydrogenlyase in the hyperthermophilic archaeon, Thermococcus litoralis

    Directory of Open Access Journals (Sweden)

    Rákhely Gábor

    2008-06-01

    Full Text Available Abstract Background Thermococcus litoralis is a heterotrophic facultative sulfur dependent hyperthermophilic Archaeon, which was isolated from a shallow submarine thermal spring. It has been successfully used in a two-stage fermentation system, where various keratinaceous wastes of animal origin were converted to biohydrogen. In this system T. litoralis performed better than its close relative, P. furiosus. Therefore, new alternative enzymes involved in peptide and hydrogen metabolism were assumed in T. litoralis. Results An about 10.5 kb long genomic region was isolated and sequenced from Thermococcus litoralis. In silico analysis revealed that the region contained a putative operon consisting of eight genes: the fdhAB genes coding for a formate dehydrogenase and the mhyCDEFGH genes encoding a [NiFe] hydrogenase belonging to the group of the H2-evolving, energy-conserving, membrane-bound hydrogenases. Reverse transcription linked quantitative Real-Time PCR and Western blotting experiments showed that the expression of the fdh-mhy operon was up-regulated during fermentative growth on peptides and down-regulated in cells cultivated in the presence of sulfur. Immunoblotting and protein separation experiments performed on cell fractions indicated that the formate dehydrogenase part of the complex is associated to the membrane-bound [NiFe] hydrogenase. Conclusion The formate dehydrogenase together with the membrane-bound [NiFe] hydrogenase formed a formate hydrogenlyase (formate dehydrogenase coupled hydrogenase, FDH-MHY complex. The expression data suggested that its physiological role is linked to the removal of formate likely generated during anaerobic peptide fermentation.

  6. Alpha-amylase from the Hyperthermophilic Archaeon Thermococcus thioreducens

    Science.gov (United States)

    Bernhardsdotter, E. C. M. J.; Pusey, M. L.; Ng, M. L.; Garriott, O. K.

    2003-01-01

    Extremophiles are microorganisms that thrive in, from an anthropocentric view, extreme environments such as hot springs. The ability of survival at extreme conditions has rendered enzymes from extremophiles to be of interest in industrial applications. One approach to producing these extremozymes entails the expression of the enzyme-encoding gene in a mesophilic host such as E.coli. This method has been employed in the effort to produce an alpha-amylase from a hyperthermophile (an organism that displays optimal growth above 80 C) isolated from a hydrothermal vent at the Rainbow vent site in the Atlantic Ocean. alpha-amylases catalyze the hydrolysis of starch to produce smaller sugars and constitute a class of industrial enzymes having approximately 25% of the enzyme market. One application for thermostable alpha-amylases is the starch liquefaction process in which starch is converted into fructose and glucose syrups. The a-amylase encoding gene from the hyperthermophile Thermococcus thioreducens was cloned and sequenced, revealing high similarity with other archaeal hyperthermophilic a-amylases. The gene encoding the mature protein was expressed in E.coli. Initial characterization of this enzyme has revealed an optimal amylolytic activity between 85-90 C and around pH 5.3-6.0.

  7. The chromosome copy number of the hyperthermophilic archaeon Thermococcus kodakarensis KOD1

    NARCIS (Netherlands)

    Spaans, S.K.; Oost, van der J.; Kengen, S.W.M.

    2015-01-01

    The euryarchaeon Thermococcus kodakarensis is a well-characterized anaerobic hyperthermophilic heterotroph and due to the availability of genetic engineering systems it has become one of the model organisms for studying Archaea. Despite this prominent role among the Euryarchaeota, no data about the

  8. Extreme Tolerance to Elevated Pressure in a Thermococcus isolate from the Mid-Cayman Rise

    Science.gov (United States)

    Narasingarao, P.; Huber, J. A.; Schrenk, M. O.; Bartlett, D.

    2013-12-01

    Hydrothermal systems are windows into the deep biosphere. Venting fluids with temperatures up to 400°C containing gases such as H2, CO2, H2S and CH4 provide an oasis of life in the deep ocean primarily based on chemosynthesis. The Mid-Cayman Rise (MCR) includes the deepest hydrothermal vent system known thus far, and is characterized by two venting sites Piccard (4950m) and Von Damm (2350m). Here we demonstrate the remarkable high pressure tolerance limits of a Thermococcus sp. designated strain 175, isolated from samples collected from Piccard during an expedition in 2012. Diffuse venting fluids collected at the site resulted in the isolation of several Thermococcus strains capable of growth in basal salts medium supplemented with H2/CO2 and yeast extract, along with sulfur as an electron acceptor. Given the importance of pressure as an environmental parameter influencing evolution and adaptation of deep-sea life, the pressure tolerance of Thermococcus strain 175 was tested. High pressure incubations were originally conducted in serum vials filled completely with growth medium and therefore lacking all headspace gas. To test for growth with H2/CO2 , modified hungate tubes with a piston mechanism were used (Bowles et al. 2011) . The results indicate that strain 175 can grow at 90°C up to 120 megapascal (MPa). Growth rates are comparable when the strain is grown at atmospheric pressure or at 120 MPa pressure. Morphologically, the strain is irregular cocci and does not show any changes in its cellular structure when switched between atmospheric pressure and elevated pressure. This wide range of pressure tolerance has not been previously observed in other microorganisms, including Pyrococcus yayanosii CH1 (Zeng et al., 2009) which is also capable of growth at 120MPa but does not grow below 15 MPa. Thermococcus strain 175 represents an excellent model system to study high pressure adaptation due to its high growth rate and broad range of growth pressures. The

  9. Europlanet-2020 NA1 Exchange Program

    Science.gov (United States)

    Genzer, M.; Szego, K.; Haukka, H.; Harri, A.-M.

    2017-09-01

    The task of Exchange Program of NA1 is to support the activities of EPN2020 with experts and scientific exchange whenever it is needed. Short visits (up to 1 week) with the goal of improving infrastructure facilities and services offered to the scientific community are supported from this task. Since the start of the EPN2020 in September 2015 we have received and approved 14 applications for exchange program travel. More general and specifically targeted calls are planned for the future. The calls are announced on Europlanet-2020 NA1 web site.

  10. Cloning and Characterization of an Alpha-amylase Gene from the Hyperthermophilic Archaeon Thermococcus Thioreducens

    Science.gov (United States)

    Bernhardsdotter, Eva C. M. J.; Pusey, Marc L.; Ng, Joseph D.; Garriott, Owen K.

    2004-01-01

    The gene encoding an extracellular a-amylase, TTA, from the hyperthermophilic archaeon Thermococcus thioreducens was cloned and expressed in Escherichia coli. Primary structural analysis revealed high similarity with other a-amylases from the Thermococcus and Pyrococcus genera, as well as the four highly conserved regions typical for a-amylases. The 1374 bp gene encodes a protein of 457 amino acids, of which 435 constitute the mature protein preceded by a 22 amino acid signal peptide. The molecular weight of the purified recombinant enzyme was estimated to be 43 kDa by denaturing gel electrophoresis. Maximal enzymatic activity of recombinant TTA was observed at 90 C and pH 5.5 in the absence of exogenous Ca(2+), and the enzyme was considerably stable even after incubation at 90 C for 2 hours. The thermostability at 90 and 102 C was enhanced in the presence of 5 mM Ca(2+). The extraordinarily high specific activity (about 7.4 x 10(exp 3) U/mg protein at 90 C, pH 5.5 with soluble starch as substrate) together with its low pH optimum makes this enzyme an interesting candidate for starch processing applications.

  11. Characterization of family D DNA polymerase from Thermococcus sp. 9°N.

    Science.gov (United States)

    Greenough, Lucia; Menin, Julie F; Desai, Nirav S; Kelman, Zvi; Gardner, Andrew F

    2014-07-01

    Accurate DNA replication is essential for maintenance of every genome. All archaeal genomes except Crenarchaea, encode for a member of Family B (polB) and Family D (polD) DNA polymerases. Gene deletion studies in Thermococcus kodakaraensis and Methanococcus maripaludis show that polD is the only essential DNA polymerase in these organisms. Thus, polD may be the primary replicative DNA polymerase for both leading and lagging strand synthesis. To understand this unique archaeal enzyme, we report the biochemical characterization of a heterodimeric polD from Thermococcus. PolD contains both DNA polymerase and proofreading 3'-5' exonuclease activities to ensure efficient and accurate genome duplication. The polD incorporation fidelity was determined for the first time. Despite containing 3'-5' exonuclease proofreading activity, polD has a relatively high error rate (95 × 10(-5)) compared to polB (19 × 10(-5)) and at least 10-fold higher than the polB DNA polymerases from yeast (polε and polδ) or Escherichia coli DNA polIII holoenzyme. The implications of polD fidelity and biochemical properties in leading and lagging strand synthesis are discussed.

  12. Complete Genome Sequence of the Hyperthermophilic and Piezophilic Archaeon Thermococcus barophilus Ch5, Capable of Growth at the Expense of Hydrogenogenesis from Carbon Monoxide and Formate.

    Science.gov (United States)

    Oger, Philippe; Sokolova, Tatyana G; Kozhevnikova, Darya A; Taranov, Evgeny A; Vannier, Pauline; Lee, Hyun Sook; Kwon, Kae Kyoung; Kang, Sung Gyun; Lee, Jung-Hyun; Bonch-Osmolovskaya, Elizaveta A; Lebedinsky, Alexander V

    2016-01-14

    We report here the complete sequence and fully manually curated annotation of the genome of strain Ch5, a new member of the piezophilic hyperthermophilic species Thermococcus barophilus. Copyright © 2016 Oger et al.

  13. The Roles of Family B and D DNA Polymerases in Thermococcus Species 9°N Okazaki Fragment Maturation*

    Science.gov (United States)

    Greenough, Lucia; Kelman, Zvi; Gardner, Andrew F.

    2015-01-01

    During replication, Okazaki fragment maturation is a fundamental process that joins discontinuously synthesized DNA fragments into a contiguous lagging strand. Efficient maturation prevents repeat sequence expansions, small duplications, and generation of double-stranded DNA breaks. To address the components required for the process in Thermococcus, Okazaki fragment maturation was reconstituted in vitro using purified proteins from Thermococcus species 9°N or cell extracts. A dual color fluorescence assay was developed to monitor reaction substrates, intermediates, and products. DNA polymerase D (polD) was proposed to function as the replicative polymerase in Thermococcus replicating both the leading and the lagging strands. It is shown here, however, that it stops before the previous Okazaki fragments, failing to rapidly process them. Instead, Family B DNA polymerase (polB) was observed to rapidly fill the gaps left by polD and displaces the downstream Okazaki fragment to create a flap structure. This flap structure was cleaved by flap endonuclease 1 (Fen1) and the resultant nick was ligated by DNA ligase to form a mature lagging strand. The similarities to both bacterial and eukaryotic systems and evolutionary implications of archaeal Okazaki fragment maturation are discussed. PMID:25814667

  14. The roles of family B and D DNA polymerases in Thermococcus species 9°N Okazaki fragment maturation.

    Science.gov (United States)

    Greenough, Lucia; Kelman, Zvi; Gardner, Andrew F

    2015-05-15

    During replication, Okazaki fragment maturation is a fundamental process that joins discontinuously synthesized DNA fragments into a contiguous lagging strand. Efficient maturation prevents repeat sequence expansions, small duplications, and generation of double-stranded DNA breaks. To address the components required for the process in Thermococcus, Okazaki fragment maturation was reconstituted in vitro using purified proteins from Thermococcus species 9°N or cell extracts. A dual color fluorescence assay was developed to monitor reaction substrates, intermediates, and products. DNA polymerase D (polD) was proposed to function as the replicative polymerase in Thermococcus replicating both the leading and the lagging strands. It is shown here, however, that it stops before the previous Okazaki fragments, failing to rapidly process them. Instead, Family B DNA polymerase (polB) was observed to rapidly fill the gaps left by polD and displaces the downstream Okazaki fragment to create a flap structure. This flap structure was cleaved by flap endonuclease 1 (Fen1) and the resultant nick was ligated by DNA ligase to form a mature lagging strand. The similarities to both bacterial and eukaryotic systems and evolutionary implications of archaeal Okazaki fragment maturation are discussed. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  15. Proteome Profiling of Heat, Oxidative, and Salt Stress Responses in Thermococcus kodakarensis KOD1

    Directory of Open Access Journals (Sweden)

    Baolei eJia

    2015-06-01

    Full Text Available The thermophilic species, Thermococcus kodakarensis KOD1, a model microorganism for studying hyperthermophiles, has adapted to optimal growth under conditions of high temperature and salinity. However, the environmental conditions for the strain are not always stable, and this strain might face different stresses. In the present study, we compared the proteome response of T. kodakarensis to heat, oxidative, and salt stresses using two-dimensional electrophoresis, and protein spots were identified through MALDI-TOF/MS. Fifty-nine, forty-two, and twenty-nine spots were induced under heat, oxidative, and salt stresses, respectively. Among the up-regulated proteins, four proteins (a hypothetical protein, pyridoxal biosynthesis lyase, peroxiredoxin, and protein disulphide oxidoreductase were associated with all three stresses. Gene ontology analysis showed that these proteins were primarily involved metabolic and cellular processes. The KEGG pathway analysis suggested that the main metabolic pathways involving these enzymes were related to carbohydrate metabolism, secondary metabolite synthesis, and amino acid biosynthesis. These data might enhance our understanding of the functions and molecular mechanisms of thermophilic Archaea for survival and adaptation in extreme environments.

  16. Genome Replication in Thermococcus kodakarensis Independent of Cdc6 and an Origin of Replication

    Directory of Open Access Journals (Sweden)

    Alexandra M. Gehring

    2017-10-01

    Full Text Available The initiation of DNA replication is typically tightly regulated by proteins that form initiation complexes at specific sequences known as replication origins. In Archaea and Eukaryotes, Cdc6, a near-universally conserved protein binds and facilitates the origin-dependent assembly of the replicative apparatus. TK1901 encodes Cdc6 in Thermococcus kodakarensis but, as we report here, TK1901 and the presumed origin of replication can be deleted from the genome of this hyperthermophilic Archaeon without any detectable effects on growth, genetic competence or the ability to support autonomous plasmid replication. All regions of the genome were equally represented in the sequences generated by whole genome sequencing of DNA isolated from T. kodakarensis strains with or without TK1901, inconsistent with DNA initiation occurring at one or few origins, and instead suggestive of replication initiating at many sites distributed throughout the genome. We were unable to generate strains lacking the recombination factors, RadA or RadB, consistent with T. kodakarensis cells, that are oligoploid (7–19 genomes per cell, employing a recombination-based mechanism of DNA replication. Deletion of the previously presumed origin region reduced the long-term viability of cultures supporting the possibility that retaining an origin-based mechanism of DNA initiation provides a survival mechanism for stationary phase cells with only one genome.

  17. Identification of the glucosamine kinase in the chitinolytic pathway of Thermococcus kodakarensis.

    Science.gov (United States)

    Aslam, Mehwish; Takahashi, Naoya; Matsubara, Kohei; Imanaka, Tadayuki; Kanai, Tamotsu; Atomi, Haruyuki

    2018-03-01

    Although the chitinolytic pathway of the hyperthermophilic archaeon Thermococcus kodakarensis is well-studied, the genome does not contain genes homologous to previously identified glucosamine kinase genes. As some ADP-dependent glucokinases in the order Thermococcales exhibit phosphorylation activities for both glucose and glucosamine in vitro, the homolog in T. kodakarensis, encoded by TK1110, was selected as a candidate for the missing glucosamine kinase gene. The purified, recombinant TK1110 enzyme exhibited phosphorylation activities for not only glucose but also glucosamine and N-acetylglucosamine. Kinetic analysis indicated that activity towards glucosamine was as significant as that towards glucose. In order to determine the physiological role of TK1110 in the chitinolytic pathway of T. kodakarensis, a gene disruption strain of TK1110 was constructed. When grown in chitin-containing medium, the TK1110 disruption resulted in almost complete impairment in chitin degradation, and a complete loss of chitin-dependent H 2 production. As H 2 production is tightly linked to cell growth in T. kodakarensis, the present results strongly suggest that TK1110 functions as the glucosamine kinase responsible for the chitin degradation in T. kodakarensis. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  18. Comparative analyses of the two proliferating cell nuclear antigens from the hyperthermophilic archaeon, Thermococcus kodakarensis.

    Science.gov (United States)

    Kuba, Yumani; Ishino, Sonoko; Yamagami, Takeshi; Tokuhara, Masahiro; Kanai, Tamotsu; Fujikane, Ryosuke; Daiyasu, Hiromi; Atomi, Haruyuki; Ishino, Yoshizumi

    2012-11-01

    The DNA sliding clamp is a multifunctional protein involved in cellular DNA transactions. In Archaea and Eukaryota, proliferating cell nuclear antigen (PCNA) is the sliding clamp. The ring-shaped PCNA encircles double-stranded DNA within its central hole and tethers other proteins on DNA. The majority of Crenarchaeota, a subdomain of Archaea, have multiple PCNA homologues, and they are capable of forming heterotrimeric rings for their functions. In contrast, most organisms in Euryarchaeota, the other major subdomain, have a single PCNA forming a homotrimeric ring structure. Among the Euryarchaeota whose genome is sequenced, Thermococcus kodakarensis is the only species with two genes encoding PCNA homologues on its genome. We cloned the two genes from the T. kodakarensis genome, and the gene products, PCNA1 and PCNA2, were characterized. PCNA1 stimulated the DNA synthesis reactions of the two DNA polymerases, PolB and PolD, from T. kodakarensis in vitro. PCNA2, however, only had an effect on PolB. We were able to disrupt the gene for PCNA2, whereas gene disruption for PCNA1 was not possible, suggesting that PCNA1 is essential for DNA replication. The sensitivities of the Δpcna2 mutant strain to ultraviolet irradiation (UV), methyl methanesulfonate (MMS) and mitomycin C (MMC) were indistinguishable from those of the wild-type strain. © 2012 The Authors Genes to Cells © 2012 by the Molecular Biology Society of Japan and Wiley Publishing Asia Pty Ltd.

  19. Characterization of Recombinant Thermococcus kodakaraensis (KOD) DNA Polymerases Produced Using Silkworm-Baculovirus Expression Vector System

    KAUST Repository

    Yamashita, Mami

    2017-05-08

    The KOD DNA polymerase from Thermococcus kodakarensis (Tkod-Pol) has been preferred for PCR due to its rapid elongation rate, extreme thermostability and outstanding fidelity. Here in this study, we utilized silkworm-baculovirus expression vector system (silkworm-BEVS) to express the recombinant Tkod-Pol (rKOD) with N-terminal (rKOD-N) or C-terminal (rKOD-C) tandem fusion tags. By using BEVS, we produced functional rKODs with satisfactory yields, about 1.1 mg/larva for rKOD-N and 0.25 mg/larva for rKOD-C, respectively. Interestingly, we found that rKOD-C shows higher thermostability at 95 °C than that of rKOD-N, while that rKOD-N is significantly unstable after exposing to long period of heat-shock. We also assessed the polymerase activity as well as the fidelity of purified rKODs under various conditions. Compared with commercially available rKOD, which is expressed in E. coli expression system, rKOD-C exhibited almost the same PCR performance as the commercial rKOD did, while rKOD-N did lower performance. Taken together, our results suggested that silkworm-BEVS can be used to express and purify efficient rKOD in a commercial way.

  20. Variants of sequence family B Thermococcus kodakaraensis DNA polymerase with increased mismatch extension selectivity.

    Directory of Open Access Journals (Sweden)

    Claudia Huber

    Full Text Available Fidelity and selectivity of DNA polymerases are critical determinants for the biology of life, as well as important tools for biotechnological applications. DNA polymerases catalyze the formation of DNA strands by adding deoxynucleotides to a primer, which is complementarily bound to a template. To ensure the integrity of the genome, DNA polymerases select the correct nucleotide and further extend the nascent DNA strand. Thus, DNA polymerase fidelity is pivotal for ensuring that cells can replicate their genome with minimal error. DNA polymerases are, however, further optimized for more specific biotechnological or diagnostic applications. Here we report on the semi-rational design of mutant libraries derived by saturation mutagenesis at single sites of a 3'-5'-exonuclease deficient variant of Thermococcus kodakaraensis DNA polymerase (KOD pol and the discovery for variants with enhanced mismatch extension selectivity by screening. Sites of potential interest for saturation mutagenesis were selected by their proximity to primer or template strands. The resulting libraries were screened via quantitative real-time PCR. We identified three variants with single amino acid exchanges-R501C, R606Q, and R606W-which exhibited increased mismatch extension selectivity. These variants were further characterized towards their potential in mismatch discrimination. Additionally, the identified enzymes were also able to differentiate between cytosine and 5-methylcytosine. Our results demonstrate the potential in characterizing and developing DNA polymerases for specific PCR based applications in DNA biotechnology and diagnostics.

  1. Thermococcus Thioreducens sp. Nov., a Novel Hyperthermophilic, Obligately Sulfur-reducing Archaeon from a Deep-sea Hydrothermal Vent

    Science.gov (United States)

    Pikuta, Elena V.; Marsic, Damien; Itoh, Takashi; Bej, Asim K.; Tang, Jane; Whitman, William B.; Ng, Joseph D.; Garriott, Owen K.; Hoover, Richard B.

    2007-01-01

    A hyperthermophilic, sulfur-reducing, organo-heterotrophic archaeon, strain OGL-20P was isolated from black smoker chimney material from the Rainbow hydrothermal vent site on the Mid-Atlantic Ridge (36.2 N, 33.9 W). The cells of strain OGL-20P(sup T) have an irregular coccoid shape and are motile with a single flagellum. Growth was observed within the pH range 5.0-8.5 (optimum pH 7.0), NaCl concentration range 1-5 % (w/v) (optimum 3%), and temperature range 55-94 C (optimum 83-85 C). The novel isolate is strictly anaerobic and obligately dependent upon elemental sulfur as an electron acceptor, but it does not reduce sulfate, sulfite, thiosulfate, iron (III) or nitrate. Proteolysis products (peptone, bacto-tryptone, casamino-acids, and yeast extract) are utilized as substrates during sulfur-reduction. Strain OGL-20P(sup T) is resistant to ampicillin, chloramphenicol, kanamycin, and gentamycin, but sensitive to tetracycline and rifampicin. The G+C content of DNA is 52.9 mol%. The 16S rRNA gene sequence analysis revealed that strain OGL-20P(sup T) is closely related to Thermococcus coalescens and related species, but no significant homology by DNA-DNA hybridization was observed between those species and the new isolate. On the basis of physiological and molecular properties of the new isolate, we conclude that strain OGL-20P(sup T) represents a new separate species within the genus Thermococcus, and propose the name Thermococcus thioreducens sp. nov. The type strain is OGL-20P(sup T) (= ATCC BAA-394(sup T) = JCM 12859(sup T) = DSM 14981(sup T)).

  2. An Uncharacterized Member of the Ribokinase Family in Thermococcus kodakarensis Exhibits myo-Inositol Kinase Activity*

    Science.gov (United States)

    Sato, Takaaki; Fujihashi, Masahiro; Miyamoto, Yukika; Kuwata, Keiko; Kusaka, Eriko; Fujita, Haruo; Miki, Kunio; Atomi, Haruyuki

    2013-01-01

    Here we performed structural and biochemical analyses on the TK2285 gene product, an uncharacterized protein annotated as a member of the ribokinase family, from the hyperthermophilic archaeon Thermococcus kodakarensis. The three-dimensional structure of the TK2285 protein resembled those of previously characterized members of the ribokinase family including ribokinase, adenosine kinase, and phosphofructokinase. Conserved residues characteristic of this protein family were located in a cleft of the TK2285 protein as in other members whose structures have been determined. We thus examined the kinase activity of the TK2285 protein toward various sugars recognized by well characterized ribokinase family members. Although activity with sugar phosphates and nucleosides was not detected, kinase activity was observed toward d-allose, d-lyxose, d-tagatose, d-talose, d-xylose, and d-xylulose. Kinetic analyses with the six sugar substrates revealed high Km values, suggesting that they were not the true physiological substrates. By examining activity toward amino sugars, sugar alcohols, and disaccharides, we found that the TK2285 protein exhibited prominent kinase activity toward myo-inositol. Kinetic analyses with myo-inositol revealed a greater kcat and much lower Km value than those obtained with the monosaccharides, resulting in over a 2,000-fold increase in kcat/Km values. TK2285 homologs are distributed among members of Thermococcales, and in most species, the gene is positioned close to a myo-inositol monophosphate synthase gene. Our results suggest the presence of a novel subfamily of the ribokinase family whose members are present in Archaea and recognize myo-inositol as a substrate. PMID:23737529

  3. Genetic examination of initial amino acid oxidation and glutamate catabolism in the hyperthermophilic archaeon Thermococcus kodakarensis.

    Science.gov (United States)

    Yokooji, Yuusuke; Sato, Takaaki; Fujiwara, Shinsuke; Imanaka, Tadayuki; Atomi, Haruyuki

    2013-05-01

    Amino acid catabolism in Thermococcales is presumed to proceed via three steps: oxidative deamination of amino acids by glutamate dehydrogenase (GDH) or aminotransferases, oxidative decarboxylation by 2-oxoacid:ferredoxin oxidoreductases (KOR), and hydrolysis of acyl-coenzyme A (CoA) by ADP-forming acyl-CoA synthetases (ACS). Here, we performed a genetic examination of enzymes involved in Glu catabolism in Thermococcus kodakarensis. Examination of amino acid dehydrogenase activities in cell extracts of T. kodakarensis KUW1 (ΔpyrF ΔtrpE) revealed high NADP-dependent GDH activity, along with lower levels of NAD-dependent activity. NADP-dependent activities toward Gln/Ala/Val/Cys and an NAD-dependent threonine dehydrogenase activity were also detected. In KGDH1, a gene disruption strain of T. kodakarensis GDH (Tk-GDH), only threonine dehydrogenase activity was detected, indicating that all other activities were dependent on Tk-GDH. KGDH1 could not grow in a medium in which growth was dependent on amino acid catabolism, implying that Tk-GDH is the only enzyme that can discharge the electrons (to NADP(+)/NAD(+)) released from amino acids in their oxidation to 2-oxoacids. In a medium containing excess pyruvate, KGDH1 displayed normal growth, but higher degrees of amino acid catabolism were observed compared to those for KUW1, suggesting that Tk-GDH functions to suppress amino acid oxidation and plays an anabolic role under this condition. We further constructed disruption strains of 2-oxoglutarate:ferredoxin oxidoreductase and succinyl-CoA synthetase. The two strains displayed growth defects in both media compared to KUW1. Succinate generation was not observed in these strains, indicating that the two enzymes are solely responsible for Glu catabolism among the multiple KOR and ACS enzymes in T. kodakarensis.

  4. Characterization of an archaeal malic enzyme from the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1.

    Science.gov (United States)

    Fukuda, Wakao; Ismail, Yulia Sari; Fukui, Toshiaki; Atomi, Haruyuki; Imanaka, Tadayuki

    2005-05-01

    Although the interconversion between C4 and C3 compounds has an important role in overall metabolism, limited information is available on the properties and regulation of enzymes acting on these metabolites in hyperthermophilic archaea. Malic enzyme is one of the enzymes involved in this interconversion, catalyzing the oxidative decarboxylation of malate to pyruvate as well as the reductive carboxylation coupled with NAD(P)H. This study focused on the enzymatic properties and expression profile of an uncharacterized homolog of malic enzyme identified in the genome of a heterotrophic, hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 (Tk-Mae). The amino acid sequence of Tk-Mae was 52-58% identical to those of malic enzymes from bacteria, whereas the similarities to the eukaryotic homologs were lower. Several catalytically important regions and residues were conserved in the primary structure of Tk-Mae. The recombinant protein, which formed a homodimer, exhibited thermostable malic enzyme activity with strict divalent cation dependency. The enzyme preferred NADP(+) rather than NAD(+), but did not catalyze the decarboxylation of oxaloacetate, unlike the usual NADP-dependent malic enzymes. The apparent Michaelis constant (K(m)) of Tk-Mae for malate (16.9 mM) was much larger than those of known enzymes, leading to no strong preference for the reaction direction. Transcription of the gene encoding Tk-Mae and intracellular malic enzyme activity in T. kodakaraensis were constitutively weak, regardless of the growth substrates. Possible roles of Tk-Mae are discussed based on these results and the metabolic pathways of T. kodakaraensis deduced from the genome sequence.

  5. Multiple components and induction mechanism of the chitinolytic system of the hyperthermophilic archaeon Thermococcus chitonophagus.

    Science.gov (United States)

    Andronopoulou, Evi; Vorgias, Constantinos E

    2004-11-01

    Thermococcus chitonophagus produces several, cellular and extracellular chitinolytic enzymes following induction with various types of chitin and chitin oligomers, as well as cellulose. Factors affecting the anaerobic culture of this archaeon, such as optimal temperature, agitation speed and type of chitin, were investigated. A series of chitinases, co-isolated with the major, cell membrane-associated endochitinase (Chi70), and a periplasmic chitobiase (Chi90) were subsequently isolated. In addition, a distinct chitinolytic activity was detected in the culture supernatant and partially purified. This enzyme exhibited an apparent molecular mass of 50 kDa (Chi50) and was optimally active at 80 degrees C and pH 6.0. Chi50 was classified as an exochitinase based on its ability to release chitobiose as the exclusive hydrolysis product of colloidal chitin. A multi-component enzymatic apparatus, consisting of an extracellular exochitinase (Chi50), a periplasmic chitobiase (Chi90) and at least one cell-membrane-anchored endochitinase (Chi70), seems to be sufficient for effective synergistic in vivo degradation of chitin. Induction with chitin stimulates the coordinated expression of a combination of chitinolytic enzymes exhibiting different specificities for polymeric chitin and its degradation products. Among all investigated potential inducers and nutrient substrates, colloidal chitin was the strongest inducer of chitinase synthesis, whereas the highest growth rate was obtained following the addition of yeast extract and/or peptone to the minimal, mineralic culture medium in the absence of chitin. In rich medium, chitin monomer acted as a repressor of total chitinolytic activity, indicating the presence of a negative feedback regulatory mechanism. Despite the undisputable fact that the multi-component chitinolytic system of this archaeon is strongly induced by chitin, it is clear that, even in the absence of any chitinous substrates, there is low-level, basal

  6. Genome-wide transcriptional response of the archaeon Thermococcus gammatolerans to cadmium.

    Directory of Open Access Journals (Sweden)

    Arnaud Lagorce

    Full Text Available Thermococcus gammatolerans, the most radioresistant archaeon known to date, is an anaerobic and hyperthermophilic sulfur-reducing organism living in deep-sea hydrothermal vents. Knowledge of mechanisms underlying archaeal metal tolerance in such metal-rich ecosystem is still poorly documented. We showed that T. gammatolerans exhibits high resistance to cadmium (Cd, cobalt (Co and zinc (Zn, a weaker tolerance to nickel (Ni, copper (Cu and arsenate (AsO(4 and that cells exposed to 1 mM Cd exhibit a cellular Cd concentration of 67 µM. A time-dependent transcriptomic analysis using microarrays was performed at a non-toxic (100 µM and a toxic (1 mM Cd dose. The reliability of microarray data was strengthened by real time RT-PCR validations. Altogether, 114 Cd responsive genes were revealed and a substantial subset of genes is related to metal homeostasis, drug detoxification, re-oxidization of cofactors and ATP production. This first genome-wide expression profiling study of archaeal cells challenged with Cd showed that T. gammatolerans withstands induced stress through pathways observed in both prokaryotes and eukaryotes but also through new and original strategies. T. gammatolerans cells challenged with 1 mM Cd basically promote: 1 the induction of several transporter/permease encoding genes, probably to detoxify the cell; 2 the upregulation of Fe transporters encoding genes to likely compensate Cd damages in iron-containing proteins; 3 the induction of membrane-bound hydrogenase (Mbh and membrane-bound hydrogenlyase (Mhy2 subunits encoding genes involved in recycling reduced cofactors and/or in proton translocation for energy production. By contrast to other organisms, redox homeostasis genes appear constitutively expressed and only a few genes encoding DNA repair proteins are regulated. We compared the expression of 27 Cd responsive genes in other stress conditions (Zn, Ni, heat shock, γ-rays, and showed that the Cd transcriptional pattern is

  7. Hydrogen production and enzyme activities in the hyperthermophile Thermococcus paralvinellae grown on maltose, tryptone and agricultural waste

    Directory of Open Access Journals (Sweden)

    Sarah A. Hensley

    2016-02-01

    Full Text Available Thermococcus may be an important alternative source of H2 in the hot subseafloor in otherwise low H2 environments such as some hydrothermal vents and oil reservoirs. It may also be useful in industry for rapid agricultural waste treatment and concomitant H2 production. Thermococcus paralvinellae grown at 82°C without sulfur produced up to 5 mmol of H2 L-1 at rates of 5-36 fmol H2 cell-1 h-1 on 0.5% (wt vol-1 maltose, 0.5% (wt vol-1 tryptone, and 0.5% maltose + 0.05% tryptone media. Two potentially inhibiting conditions, the presence of 10 mM acetate and low pH (pH 5 in maltose-only medium, did not significantly affect growth or H2 production. Growth rates, H2 production rates, and cell yields based on H2 production were the same as those for Pyrococcus furiosus grown at 95°C on the same media for comparison. Acetate, butyrate, succinate, isovalerate and formate were also detected as end products. After 100 h, T. paralvinellae produced up to 5 mmol of H2 L-1 of medium when grown on up to 70% (vol vol-1 waste milk from cows undergoing treatment for mastitis with the bacterial antibiotic Ceftiofur and from untreated cows. The amount of H2 produced by T. paralvinellae increased with increasing waste concentrations, but decreased in P. furiosus cultures supplemented with waste milk above 1% concentration. All mesophilic bacteria from the waste milk that grew on Luria Bertani, Sheep’s Blood (selective for Staphylococcus, the typical cause of mastitis, and MacConkey (selective for Gram-negative enteric bacteria agar plates were killed by heat during incubation at 82°C. Ceftiofur, which is heat labile, was below the detection limit following incubation at 82°C. T. paralvinellae also produced up to 6 mmol of H2 L-1 of medium when grown on 0.1-10% (wt vol-1 spent brewery grain while P. furiosus produced < 1 mmol of H2 L-1. Twelve of 13 enzyme activities in T. paralvinellae showed significant (p<0.05 differences across six different growth conditions

  8. Architecture and characterization of a thermostable MoxR family AAA(+) ATPase from Thermococcus kodakarensis KOD1.

    Science.gov (United States)

    Pham, Bang Phuong; Lee, Sangmin; Jia, Baolei; Kwak, Jae Myeong; Cheong, Gang-Won

    2014-05-01

    AAA(+) ATPases are ubiquitous enzymes that can function as molecular chaperones, employing the energy obtained from ATP hydrolysis to remodel macromolecules. In this report, the MoxR enzyme from Thermococcus kodakarensis KOD1 (TkMoxR) was shown to have two native forms: a two-stack hexameric ring and a hexameric structure, under physiological conditions and cold stress, respectively. TkMoxR was altered to a microtubule-like form in the presence of ATP and tightly interacted with dsDNA molecules of various lengths. In addition, the two-stack hexameric protein catalyzed dsDNA decomposition to form and then release ssDNA, whereas the hexamer TkMoxR structure interacted with but did not release dsDNA. These results suggest that TkMoxR has DNA helicase activity involved in gene expression control.

  9. Thermococcus kodakarensis Mutants Deficient in Di-myo-Inositol Phosphate Use Aspartate To Cope with Heat Stress▿§

    Science.gov (United States)

    Borges, Nuno; Matsumi, Rie; Imanaka, Tadayuki; Atomi, Haruyuki; Santos, Helena

    2010-01-01

    Many of the marine microorganisms which are adapted to grow at temperatures above 80°C accumulate di-myo-inositol phosphate (DIP) in response to heat stress. This led to the hypothesis that the solute plays a role in thermoprotection, but there is a lack of definitive experimental evidence. Mutant strains of Thermococcus kodakarensis (formerly Thermococcus kodakaraensis), manipulated in their ability to synthesize DIP, were constructed and used to investigate the involvement of DIP in thermoadaptation of this archaeon. The solute pool of the parental strain comprised DIP, aspartate, and α-glutamate. Under heat stress the level of DIP increased 20-fold compared to optimal conditions, whereas the pool of aspartate increased 4.3-fold in response to osmotic stress. Deleting the gene encoding the key enzyme in DIP synthesis, CTP:inositol-1-phosphate cytidylyltransferase/CDP-inositol:inositol-1-phosphate transferase, abolished DIP synthesis. Conversely, overexpression of the same gene resulted in a mutant with restored ability to synthesize DIP. Despite the absence of DIP in the deletion mutant, this strain exhibited growth parameters similar to those of the parental strain, both at optimal (85°C) and supraoptimal (93.7°C) temperatures for growth. Analysis of the respective solute pools showed that DIP was replaced by aspartate. We conclude that DIP is part of the strategy used by T. kodakarensis to cope with heat stress, and aspartate can be used as an alternative solute of similar efficacy. This is the first study using mutants to demonstrate the involvement of compatible solutes in the thermoadaptation of (hyper)thermophilic organisms. PMID:19880594

  10. Growth Physiology of the Hyperthermophilic Archaeon Thermococcus litoralis: Development of a Sulfur-Free Defined Medium, Characterization of an Exopolysaccharide, and Evidence of Biofilm Formation

    OpenAIRE

    Rinker, K. D.; Kelly, R. M.

    1996-01-01

    Nutritional characteristics of the hyperthermophilic archaeon Thermococcus litoralis have been investigated with emphasis on the development of a sulfur-free, defined growth medium, analysis of an exocellular polysaccharide, and formation of a biofilm. An artificial-seawater-based medium, containing 16 amino acids, adenine, uracil, vitamins, and trace elements, allowed T. litoralis to attain growth rates and cell densities similar to those found with complex media. Four amino acids (alanine, ...

  11. STRUCTURAL CHARACTERIZATION OF LITHIUM DOPED NZP Na1

    African Journals Online (AJOL)

    DR. AMIN

    2011-06-01

    Jun 1, 2011 ... Pet'kov et al, (2003) characterized the structure and thermal properties of the composition Na1-xLixZr2(PO4)3, x=0.0,0.3 and 0.5. In this work we report in detail the structure, lattice ... inside a gas-heated furnace for eight hours at successive .... electrical conductivity of the sample. Fig. 9 is a plot of the ...

  12. Isolation and characterization of the first xylanolytic hyperthermophilic euryarchaeon Thermococcus sp. strain 2319x1 and its unusual multidomain glycosidase

    Directory of Open Access Journals (Sweden)

    Sergey N Gavrilov

    2016-05-01

    Full Text Available Enzymes from (hyperthermophiles Thermozymes offer a great potential for biotechnological applications. Thermophilic adaptation does not only provide stability towards high temperature but is also often accompanied by a higher resistance to other harsh physicochemical conditions, which are also frequently employed in industrial processes, such as the presence of e.g. denaturing agents as well as low or high pH of the medium. In order to find new thermostable, xylan degrading hydrolases with potential for biotechnological application we used an in situ enrichment strategy incubating Hungate tubes with xylan as the energy substrate in a hot vent located in the tidal zone of Kunashir Island (Kuril archipelago. Using this approach a hyperthermophilic euryarchaeon, designated Thermococcus sp. strain 2319x1, growing on xylan as sole energy and carbon source was isolated. The organism grows optimally at 85°C and pH 7.0 on a variety of natural polysaccharides including xylan, carboxymethyl cellulose (CMC, amorphous cellulose (AMC, xyloglucan, and chitin. The protein fraction extracted from the cells surface with Twin 80 exhibited endoxylanase, endoglucanase and xyloglucanase activities. The genome of Thermococcus sp. strain 2319x1 was sequenced and assembled into one circular chromosome. Within the newly sequenced genome, a gene, encoding a novel type of glycosidase (143 kDa with a unique five-domain structure, was identified. It consists of three glycoside hydrolase (GH domains and two carbohydrate-binding modules (CBM with the domain order GH5-12-12-CBM2-2 (N- to C-terminal direction. The full length protein, as well as truncated versions, were heterologously expressed in Escherichia coli and their activity was analyzed. The full length multidomain glycosidase (MDG was able to hydrolyze various polysaccharides, with the highest activity for barley β-glucan (β-1,3/1,4-glucoside, followed by that for carboxymethyl cellulose (β-1,4-glucoside

  13. Thermococcus kodakarensis modulates its polar membrane lipids and elemental composition according to growth stage and phosphate availability

    Directory of Open Access Journals (Sweden)

    Travis B. Meador

    2014-01-01

    Full Text Available We observed significant changes in the elemental and intact polar lipid (IPL composition of the archaeon Thermococcus kodakarensis (KOD1 in response to growth stage and phosphorus supply. Reducing the amount of organic supplements and phosphate in growth media resulted in significant decreases in cell size and cellular quotas of carbon (C, nitrogen (N, and phosphorus (P, which coincided with significant increases in cellular IPL quota and IPLs comprising multiple P atoms and hexose moieties. Relatively more cellular P was stored as IPLs in P-limited cells (2-8% compared to control cells (< 0.8%. We also identified a specific IPL biomarker containing a phosphatidyl-N-acetylhexoseamine headgroup that was relatively enriched during rapid cell division. These observations serve as empirical evidence of IPL adaptations in Archaea that will help to interpret the distribution of these biomarkers in natural systems. The reported cell quotas of C, N, and P represent the first such data for a specific archaeon and suggest that thermophiles are C-rich compared to the cell carbon-to-volume relationship reported for planktonic bacteria.

  14. Prioritizing targets for structural biology through the lens of proteomics: the archaeal protein TGAM_1934 from Thermococcus gammatolerans.

    Science.gov (United States)

    Yang, Yin-Shan; Fernandez, Bernard; Lagorce, Arnaud; Aloin, Valérie; De Guillen, Karine Montet; Boyer, Jean-Baptiste; Dedieu, Alain; Confalonieri, Fabrice; Armengaud, Jean; Roumestand, Christian

    2015-01-01

    ORFans are hypothetical proteins lacking any significant sequence similarity with other proteins. Here, we highlighted by quantitative proteomics the TGAM_1934 ORFan from the hyperradioresistant Thermococcus gammatolerans archaeon as one of the most abundant hypothetical proteins. This protein has been selected as a priority target for structure determination on the basis of its abundance in three cellular conditions. Its solution structure has been determined using multidimensional heteronuclear NMR spectroscopy. TGAM_1934 displays an original fold, although sharing some similarities with the 3D structure of the bacterial ortholog of frataxin, CyaY, a protein conserved in bacteria and eukaryotes and involved in iron-sulfur cluster biogenesis. These results highlight the potential of structural proteomics in prioritizing ORFan targets for structure determination based on quantitative proteomics data. The proteomic data and structure coordinates have been deposited to the ProteomeXchange with identifier PXD000402 (http://proteomecentral.proteomexchange.org/dataset/PXD000402) and Protein Data Bank under the accession number 2mcf, respectively. © 2014 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  15. Compartmentalized self-replication (CSR) selection of Thermococcus litoralis Sh1B DNA polymerase for diminished uracil binding.

    Science.gov (United States)

    Tubeleviciute, Agne; Skirgaila, Remigijus

    2010-08-01

    The thermostable archaeal DNA polymerase Sh1B from Thermococcus litoralis has a typical uracil-binding pocket, which in nature plays an essential role in preventing the accumulation of mutations caused by cytosine deamination to uracil and subsequent G-C base pair transition to A-T during the genomic DNA replication. The uracil-binding pocket recognizes and binds uracil base in a template strand trapping the polymerase. Since DNA replication stops, the repair systems have a chance to correct the promutagenic event. Archaeal family B DNA polymerases are employed in various PCR applications. Contrary to nature, in PCR the uracil-binding property of archaeal polymerases is disadvantageous and results in decreased DNA amplification yields and lowered sensitivity. Furthermore, in diagnostics qPCR, RT-qPCR and end-point PCR are performed using dNTP mixtures, where dTTP is partially or fully replaced by dUTP. Uracil-DNA glycosylase treatment and subsequent heating of the samples is used to degrade the DNA containing uracil and prevent carryover contamination, which is the main concern in diagnostic laboratories. A thermostable archaeal DNA polymerase with the abolished uracil binding would be a highly desirable and commercially interesting product. An attempt to disable uracil binding in DNA polymerase Sh1B from T. litoralis by generating site-specific mutants did not yield satisfactory results. However, a combination of random mutagenesis of the whole polymerase gene and compartmentalized self-replication was successfully used to select variants of thermostable Sh1B polymerase capable of performing PCR with dUTP instead of dTTP.

  16. NMR studies on mechanism of isomerisation of fructose 6-phosphate to glucose 6-phosphate catalysed by phosphoglucose isomerase from Thermococcus kodakarensis.

    Science.gov (United States)

    Abbas, Shahzada Nadeem; Mok, Kenneth Hun; Rashid, Naeem; Xie, Yongjing; Ruether, Manuel; O'Brien, John; Akhtar, Muhammad

    2016-06-01

    The fate of hydrogen atoms at C-2 of glucose 6-phosphate (G6P) and C-1 of fructose 6-phosphate (F6P) was studied in the reaction catalysed by phosphoglucose isomerase from Thermococcus kodakarensis (TkPGI) through 1D and 2D NMR methods. When the reaction was performed in (2)H2O the hydrogen atoms in the aforementioned positions were exchanged with deuterons indicating that the isomerization occurred by a cis-enediol intermediate involving C-1 pro-R hydrogen of F6P. These features are similar to those described for phosphoglucose isomerases from rabbit muscle and Pyrococcus furiosus. Copyright © 2016 Elsevier Inc. All rights reserved.

  17. Expression of Insoluble Influenza Neuraminidase Type 1 (NA1 Protein in Tobacco

    Directory of Open Access Journals (Sweden)

    Teen Lee Pua

    2012-12-01

    Full Text Available The avian influenza virus, particularly H5N1 strain, is highly virulent to poultry and mankind. Several expression systems, like yeast, baculovirus and mammalian cells, have been adopted to produce vaccine candidate for this lethal disease. The present research aimed at developing a recombinant vaccine candidate, neuraminidase type 1 (NA1, for the Malaysia isolate of H5N1 in Nicotiana benthamiana. The NA1 gene was fused directly in-frame in cowpea mosaic virus (CPMV-based pEAQ-HT vector with C-terminal polyhistidine-tag incorporated to ease the subsequent purification step. The expression of the NA1 gene in tobacco was confirmed at RNA and protein levels at 6 days post-infiltration (Dpi. From the insoluble fraction of the protein, a recombinant glycosylated NA1 protein with a molecular weight of ~56 kDa was immunogenically detected by a specific anti-NA polyclonal antibody. We report for the first time the insolubility of the plant-made NA1 protein where a native sequence was used for its expression. This study signifies the necessity of the use of optimised sequences for expression work and provides great opportunity for the exploration of plant-manufactured NA1 protein as vaccine candidate.

  18. Molecular dynamics study of the structural and dynamic characteristics of the polyextremophilic short-chain dehydrogenase from the Thermococcus sibiricus archaeon and its homologues

    Science.gov (United States)

    Popinako, Anna V.; Antonov, Mikhail Yu.; Bezsudnova, Ekaterina Yu.; Prokopiev, Georgiy A.; Popov, Vladimir O.

    2017-11-01

    The study of structural adaptations of proteins from polyextremophilic organisms using computational molecular dynamics method is appealing because the obtained knowledge can be applied to construction of synthetic proteins with high activity and stability in polyextreme media which is useful for many industrial applications. To investigate molecular adaptations to high temperature, we have focused on a superthermostable short-chain dehydrogenase TsAdh319 from the Thermococcus sibiricus polyextremophilic archaeon and its closest structural homologues. Molecular dynamics method is widely used for molecular structure refinement, investigation of biological macromolecules motion, and, consequently, for interpreting the results of certain biophysical experiments. We performed molecular dynamics simulations of the proteins at different temperatures. Comparison of root mean square fluctuations (RMSF) of the atoms in thermophilic alcohol dehydrogenases (ADHs) at 300 K and 358 K revealed the existence of stable residues at 358 K. These residues surround the active site and form a "nucleus of rigidity" in thermophilic ADHs. The results of our studies suggest that the existence of the "nucleus of rigidity" is crucial for the stability of TsAdh319. Absence of the "nucleus of rigidity" in non-thermally stable proteins causes fluctuations throughout the protein, especially on the surface, triggering the process of denaturation at high temperatures.

  19. Growth Physiology of the Hyperthermophilic Archaeon Thermococcus litoralis: Development of a Sulfur-Free Defined Medium, Characterization of an Exopolysaccharide, and Evidence of Biofilm Formation.

    Science.gov (United States)

    Rinker, K D; Kelly, R M

    1996-12-01

    Nutritional characteristics of the hyperthermophilic archaeon Thermococcus litoralis have been investigated with emphasis on the development of a sulfur-free, defined growth medium, analysis of an exocellular polysaccharide, and formation of a biofilm. An artificial-seawater-based medium, containing 16 amino acids, adenine, uracil, vitamins, and trace elements, allowed T. litoralis to attain growth rates and cell densities similar to those found with complex media. Four amino acids (alanine, asparagine, glutamine, and glutamate) were not included due to their lack of effect on growth rates and cell yields. In this medium, cultures reached densities of 10(sup8) cells per ml, with doubling times of 55 min (without maltose) or 43 min (with maltose). Neither the addition of elemental sulfur nor the presence of H(inf2) significantly affected cell growth. A sparingly soluble exopolysaccharide was produced by T. litoralis grown in either defined or complex media. Analysis of the acid-hydrolyzed exopolysaccharide yielded mannose as the only monosaccharidic constituent. This exopolysaccharide is apparently involved in the formation of a biofilm on polycarbonate filters and glass slides, which is inhabited by high levels of T. litoralis. Biofilm formation by hyperthermophilic microorganisms in geothermal environments has not been examined to any extent, but further work in this area may provide information related to the interactions among high-temperature organisms.

  20. Transcription factor IID in the Archaea: sequences in the Thermococcus celer genome would encode a product closely related to the TATA-binding protein of eukaryotes

    Science.gov (United States)

    Marsh, T. L.; Reich, C. I.; Whitelock, R. B.; Olsen, G. J.; Woese, C. R. (Principal Investigator)

    1994-01-01

    The first step in transcription initiation in eukaryotes is mediated by the TATA-binding protein, a subunit of the transcription factor IID complex. We have cloned and sequenced the gene for a presumptive homolog of this eukaryotic protein from Thermococcus celer, a member of the Archaea (formerly archaebacteria). The protein encoded by the archaeal gene is a tandem repeat of a conserved domain, corresponding to the repeated domain in its eukaryotic counterparts. Molecular phylogenetic analyses of the two halves of the repeat are consistent with the duplication occurring before the divergence of the archael and eukaryotic domains. In conjunction with previous observations of similarity in RNA polymerase subunit composition and sequences and the finding of a transcription factor IIB-like sequence in Pyrococcus woesei (a relative of T. celer) it appears that major features of the eukaryotic transcription apparatus were well-established before the origin of eukaryotic cellular organization. The divergence between the two halves of the archael protein is less than that between the halves of the individual eukaryotic sequences, indicating that the average rate of sequence change in the archael protein has been less than in its eukaryotic counterparts. To the extent that this lower rate applies to the genome as a whole, a clearer picture of the early genes (and gene families) that gave rise to present-day genomes is more apt to emerge from the study of sequences from the Archaea than from the corresponding sequences from eukaryotes.

  1. Heterologous Expression of the Cotton NBS-LRR Gene GbaNA1 Enhances Verticillium Wilt Resistance in Arabidopsis

    Directory of Open Access Journals (Sweden)

    Nan-Yang Li

    2018-02-01

    Full Text Available Verticillium wilt caused by Verticillium dahliae results in severe losses in cotton, and is economically the most destructive disease of this crop. Improving genetic resistance is the cleanest and least expensive option to manage Verticillium wilt. Previously, we identified the island cotton NBS-LRR-encoding gene GbaNA1 that confers resistance to the highly virulent V. dahliae isolate Vd991. In this study, we expressed cotton GbaNA1 in the heterologous system of Arabidopsis thaliana and investigated the defense response mediated by GbaNA1 following inoculations with V. dahliae. Heterologous expression of GbaNA1 conferred Verticillium wilt resistance in A. thaliana. Moreover, overexpression of GbaNA1 enabled recovery of the resistance phenotype of A. thaliana mutants that had lost the function of GbaNA1 ortholog gene. Investigations of the defense response in A. thaliana showed that the reactive oxygen species (ROS production and the expression of genes associated with the ethylene signaling pathway were enhanced significantly following overexpression of GbaNA1. Intriguingly, overexpression of the GbaNA1 ortholog from Gossypium hirsutum (GhNA1 in A. thaliana did not induce the defense response of ROS production due to the premature termination of GhNA1, which lacks the encoded NB-ARC and LRR motifs. GbaNA1 therefore confers Verticillium wilt resistance in A. thaliana by the activation of ROS production and ethylene signaling. These results demonstrate the functional conservation of the NBS-LRR-encoding GbaNA1 in a heterologous system, and the mechanism of this resistance, both of which may prove valuable in incorporating GbaNA1-mediated resistance into other plant species.

  2. Construction and performance of two multicell Cherenkov counters used in FRAMM-NA1 spectrometer

    International Nuclear Information System (INIS)

    Amendolia, S.R.; Batignani, G.; Bedeschi, F.; Bertolucci, E.; Bettoni, D.; Bosisio, L.; Bottigli, U.; Bradaschia, C.; Budinich, M.; Dell'Orso, M.; Fidecaro, F.; Foa, L.; Focardi, E.; Giazotto, A.; Giorgi, M.A.; Liello, F.; Marrocchesi, P.S.; Mensa, A.; Menzione, A.; Ristori, L.; Rolandi, L.; Scribano, A.; Stanga, R.; Stefanini, A.; Tonelli, G.

    1983-01-01

    Two small dimension multicell Cherenkov counters have been built for FRAMM-NA1 multiparticle spectrometer to identify pions and kaons in the momentum range between 5 and 22 GeV/c. The performances achieved and the construction details are reported. (orig.)

  3. β-Glucosidase from the hyperthermophilic archaeon Thermococcus sp. is a salt-tolerant enzyme that is stabilized by its reaction product glucose.

    Science.gov (United States)

    Sinha, Sushant K; Datta, Supratim

    2016-10-01

    β-Glucosidase (BG) is widely applied in the biofuel's industry, as part of a cellulase cocktail to catalyze the hydrolysis of the β-1,4 linkages that join two glucose molecules in a cellulose polymer. The hydrolysis step is generally recognized as the major limiting step in the development of efficient enzyme-based technologies for the conversion of lignocellulosic biomass to sugars and the production of biofuels due to the accumulation of the reaction product, glucose. Relieving this glucose inhibition of BG is therefore a major challenge. In this study, O08324, a putative BG gene encoded in the hyperthermophilic archaeon Thermococcus sp., was cloned and overexpressed in Escherichia coli. O08324 showed maximum activity between pH 5-6.8 and at 78 °C and was thermostable with a half-life of 860 min at 78 °C in the presence of 1.5 M glucose. O08324 was not inhibited by glucose up to the highest assayable concentration of 4 M and also shows no decrease in activity in the presence of up to 4 M of sodium chloride or potassium chloride. O08324 supplementation of Trichoderma viride cellulase enhanced glucose production by more than 50 % compared to a commercially available BG, when Avicel (10 %, w/v) was used as a substrate at 37 °C. Multiple sequence alignments across previously reported glucose-tolerant BGs shows that many conserved residues previously implicated in glucose tolerance are not conserved in this BG suggesting a need for a relook at understanding the molecular basis of glucose tolerance.

  4. DNA polymerase hybrids derived from the family-B enzymes of Pyrococcus furiosus and Thermococcus kodakarensis: improving performance in the polymerase chain reaction.

    Science.gov (United States)

    Elshawadfy, Ashraf M; Keith, Brian J; Ee Ooi, H'Ng; Kinsman, Thomas; Heslop, Pauline; Connolly, Bernard A

    2014-01-01

    The polymerase chain reaction (PCR) is widely applied across the biosciences, with archaeal Family-B DNA polymerases being preferred, due to their high thermostability and fidelity. The enzyme from Pyrococcus furiosus (Pfu-Pol) is more frequently used than the similar protein from Thermococcus kodakarensis (Tkod-Pol), despite the latter having better PCR performance. Here the two polymerases have been comprehensively compared, confirming that Tkod-Pol: (1) extends primer-templates more rapidly; (2) has higher processivity; (3) demonstrates superior performance in normal and real time PCR. However, Tkod-Pol is less thermostable than Pfu-Pol and both enzymes have equal fidelities. To understand the favorable properties of Tkod-Pol, hybrid proteins have been prepared. Single, double and triple mutations were used to site arginines, present at the "forked-point" (the junction of the exonuclease and polymerase channels) of Tkod-Pol, at the corresponding locations in Pfu-Pol, slightly improving PCR performance. The Pfu-Pol thumb domain, responsible for double-stranded DNA binding, has been entirely replaced with that from Tkod-Pol, again giving better PCR properties. Combining the "forked-point" and thumb swap mutations resulted in a marked increase in PCR capability, maintenance of high fidelity and retention of the superior thermostability associated with Pfu-Pol. However, even the arginine/thumb swap mutant falls short of Tkod-Pol in PCR, suggesting further improvement within the Pfu-Pol framework is attainable. The significance of this work is the observation that improvements in PCR performance are easily attainable by blending elements from closely related archaeal polymerases, an approach that may, in future, be extended by using more polymerases from these organisms.

  5. Characterization of an exo-beta-D-glucosaminidase involved in a novel chitinolytic pathway from the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1.

    Science.gov (United States)

    Tanaka, Takeshi; Fukui, Toshiaki; Atomi, Haruyuki; Imanaka, Tadayuki

    2003-09-01

    We previously clarified that the chitinase from the hyperthermophilic archaeon Thermococcus kodakaraensis KOD1 produces diacetylchitobiose (GlcNAc(2)) as an end product from chitin. Here we sought to identify enzymes in T. kodakaraensis that were involved in the further degradation of GlcNAc(2). Through a search of the T. kodakaraensis genome, one candidate gene identified as a putative beta-glycosyl hydrolase was found in the near vicinity of the chitinase gene. The primary structure of the candidate protein was homologous to the beta-galactosidases in family 35 of glycosyl hydrolases at the N-terminal region, whereas the central region was homologous to beta-galactosidases in family 42. The purified protein from recombinant Escherichia coli clearly showed an exo-beta-D-glucosaminidase (GlcNase) activity but not beta-galactosidase activity. This GlcNase (GlmA(Tk)), a homodimer of 90-kDa subunits, exhibited highest activity toward reduced chitobiose at pH 6.0 and 80 degrees C and specifically cleaved the nonreducing terminal glycosidic bond of chitooligosaccharides. The GlcNase activity was also detected in T. kodakaraensis cells, and the expression of GlmA(Tk) was induced by GlcNAc(2) and chitin, strongly suggesting that GlmA(Tk) is involved in chitin catabolism in T. kodakaraensis. These results suggest that T. kodakaraensis, unlike other organisms, possesses a novel chitinolytic pathway where GlcNAc(2) from chitin is first deacetylated and successively hydrolyzed to glucosamine. This is the first report that reveals the primary structure of GlcNase not only from an archaeon but also from any organism.

  6. Properties and stabilization of an extracellular alpha-glucosidase from the extremely thermophilic archaebacteria Thermococcus strain AN1: enzyme activity at 130 degrees C.

    Science.gov (United States)

    Piller, K; Daniel, R M; Petach, H H

    1996-01-04

    An extracellular alpha-glucosidase from the thermophilic archaebacterium Thermococcus strain AN1 was purified 875-fold in five steps (Hiload Q-Sepharose, phenyl Sepharose, HPHT-hydroxyapatite, gel filtration and Mono Q chromatography) with a yield of 4%. It is a monomer with a molecular mass of about 60 kDa and a pI around 5. At 98 degrees C, the purified enzyme in buffer has a half-life around 35 min, which is increased to around 215 min in presence of 1% (w/v) dithiothreitol and 1% (w/v) BSA. Dithiothreitol (1%, w/v) and BSA (0.4%, w/v) also substantially increase the enzyme activity. The Km at 75 degrees C is 0.41 mM with pNP-alpha-D-glucopyranoside as substrate. The substrate preference of the enzyme is: pNP-alpha-D-glucoside > nigerose > panose > palatinose > isomaltose > maltose and turanose. No activity was found against starch, pullulan, amylose, maltotriose, maltotetraose, isomaltotriose, cellobiose and beta-gentiobiose. A variety of techniques including immobolization (e.g., on epoxy and glass beads), chemical modification (cross- and cocross-linking) and the use of additives (including polyhydroxylic molecules, BSA, salts, etc.) were applied to enhance stability at temperatures above 100 degrees C. The half-life could be increased from about 4 min at 100 degrees C to 30-60 min at 130 degrees C in presence of 90% (w/v) sorbitol, 1% (w/v) dithiothreitol and 1% (w/v) BSA, and by cross-linking with BSA in the presence of 90% (w/v) sorbitol. The stabilized enzyme showed good activity at 130 degrees C.

  7. Pre-steady-state Kinetic Analysis of a Family D DNA Polymerase from Thermococcus sp. 9°N Reveals Mechanisms for Archaeal Genomic Replication and Maintenance.

    Science.gov (United States)

    Schermerhorn, Kelly M; Gardner, Andrew F

    2015-09-04

    Family D DNA polymerases (polDs) have been implicated as the major replicative polymerase in archaea, excluding the Crenarchaeota branch, and bear little sequence homology to other DNA polymerase families. Here we report a detailed kinetic analysis of nucleotide incorporation and exonuclease activity for a Family D DNA polymerase from Thermococcus sp. 9°N. Pre-steady-state single-turnover nucleotide incorporation assays were performed to obtain the kinetic parameters, kpol and Kd, for correct nucleotide incorporation, incorrect nucleotide incorporation, and ribonucleotide incorporation by exonuclease-deficient polD. Correct nucleotide incorporation kinetics revealed a relatively slow maximal rate of polymerization (kpol ∼ 2.5 s(-1)) and especially tight nucleotide binding (Kd (dNTP) ∼ 1.7 μm), compared with DNA polymerases from Families A, B, C, X, and Y. Furthermore, pre-steady-state nucleotide incorporation assays revealed that polD prevents the incorporation of incorrect nucleotides and ribonucleotides primarily through reduced nucleotide binding affinity. Pre-steady-state single-turnover assays on wild-type 9°N polD were used to examine 3'-5' exonuclease hydrolysis activity in the presence of Mg(2+) and Mn(2+). Interestingly, substituting Mn(2+) for Mg(2+) accelerated hydrolysis rates > 40-fold (kexo ≥ 110 s(-1) versus ≥ 2.5 s(-1)). Preference for Mn(2+) over Mg(2+) in exonuclease hydrolysis activity is a property unique to the polD family. The kinetic assays performed in this work provide critical insight into the mechanisms that polD employs to accurately and efficiently replicate the archaeal genome. Furthermore, despite the unique properties of polD, this work suggests that a conserved polymerase kinetic pathway is present in all known DNA polymerase families. © 2015 by The American Society for Biochemistry and Molecular Biology, Inc.

  8. Pre-steady-state Kinetic Analysis of a Family D DNA Polymerase from Thermococcus sp. 9°N Reveals Mechanisms for Archaeal Genomic Replication and Maintenance*

    Science.gov (United States)

    Schermerhorn, Kelly M.; Gardner, Andrew F.

    2015-01-01

    Family D DNA polymerases (polDs) have been implicated as the major replicative polymerase in archaea, excluding the Crenarchaeota branch, and bear little sequence homology to other DNA polymerase families. Here we report a detailed kinetic analysis of nucleotide incorporation and exonuclease activity for a Family D DNA polymerase from Thermococcus sp. 9°N. Pre-steady-state single-turnover nucleotide incorporation assays were performed to obtain the kinetic parameters, kpol and Kd, for correct nucleotide incorporation, incorrect nucleotide incorporation, and ribonucleotide incorporation by exonuclease-deficient polD. Correct nucleotide incorporation kinetics revealed a relatively slow maximal rate of polymerization (kpol ∼2.5 s−1) and especially tight nucleotide binding (Kd(dNTP) ∼1.7 μm), compared with DNA polymerases from Families A, B, C, X, and Y. Furthermore, pre-steady-state nucleotide incorporation assays revealed that polD prevents the incorporation of incorrect nucleotides and ribonucleotides primarily through reduced nucleotide binding affinity. Pre-steady-state single-turnover assays on wild-type 9°N polD were used to examine 3′-5′ exonuclease hydrolysis activity in the presence of Mg2+ and Mn2+. Interestingly, substituting Mn2+ for Mg2+ accelerated hydrolysis rates >40-fold (kexo ≥110 s−1 versus ≥2.5 s−1). Preference for Mn2+ over Mg2+ in exonuclease hydrolysis activity is a property unique to the polD family. The kinetic assays performed in this work provide critical insight into the mechanisms that polD employs to accurately and efficiently replicate the archaeal genome. Furthermore, despite the unique properties of polD, this work suggests that a conserved polymerase kinetic pathway is present in all known DNA polymerase families. PMID:26160179

  9. Dielectric properties of Na1–xKxNbO3 in orthorhombic phase

    Indian Academy of Sciences (India)

    Unknown

    σ = ε0ωK tan δ, where ε0 is the permittivity of free space, tan δ the loss tangent, and ω = 2πf, f the applied frequency. 5. Results and discussion. Observed frequency dependence of dielectric constant and dielectric loss, at room temperature, for different x values in Na1–xKxNbO3 samples has been shown in fig- ures 3 and 4, ...

  10. Energy conservation by oxidation of formate to carbon dioxide and hydrogen via a sodium ion current in a hyperthermophilic archaeon.

    Science.gov (United States)

    Lim, Jae Kyu; Mayer, Florian; Kang, Sung Gyun; Müller, Volker

    2014-08-05

    Thermococcus onnurineus NA1 is known to grow by the anaerobic oxidation of formate to CO2 and H2, a reaction that operates near thermodynamic equilibrium. Here we demonstrate that this reaction is coupled to ATP synthesis by a transmembrane ion current. Formate oxidation leads to H(+) translocation across the cytoplasmic membrane that then drives Na(+) translocation. The ion-translocating electron transfer system is rather simple, consisting of only a formate dehydrogenase module, a membrane-bound hydrogenase module, and a multisubunit Na(+)/H(+) antiporter module. The electrochemical Na(+) gradient established then drives ATP synthesis. These data give a mechanistic explanation for chemiosmotic energy conservation coupled to formate oxidation to CO2 and H2. Because it is discussed that the membrane-bound hydrogenase with the Na(+)/H(+) antiporter module are ancestors of complex I of mitochondrial and bacterial electron transport these data also shed light on the evolution of ion transport in complex I-like electron transport chains.

  11. Synthesis and piezoelectric properties of KxNa1-xNbO3 ceramic by molten salt method

    International Nuclear Information System (INIS)

    Li Yueming; Wang Jinsong; Liao Runhua; Huang Dan; Jiang Xiangping

    2010-01-01

    K x Na 1-x NbO 3 ceramic powder with perovskite structure was synthesized in molten salt with a Na 2 CO 3 /K 2 CO 3 molar ratio of 1:1, under different salt-to-oxide weight ratios of 1:10, 1:5, 1:3, 1:2.5 and 1:2 in the temperatures range of 650-900 o C. It is found that the synthesizing temperature and salt-to-oxide ratios had significant effects on the morphology of K x Na 1-x NbO 3 powder. The X-ray diffraction analysis indicated that a pure perovskite structure of K x Na 1-x NbO 3 powder could be synthesized at 650 o C. The microstructure observation revealed that the crystal morphology of K x Na 1-x NbO 3 powder changed from spheroid to cube, and then became irregular after further increasing temperature. The grain size of the synthesized powder increased by an increment of the molten salt content. The K x Na 1-x NbO 3 ceramics were prepared at x = 0.345 by adding 1.0 mol% ZnO as sintering aid, and the optimized dielectric and piezoelectric properties are obtained as following: d 33 = 120 pC/N, T c = 406 o C, Q m = 126 and k p = 0.302.

  12. Electrical and microstructural properties of CaTiO3-doped K1/2Na1 ...

    Indian Academy of Sciences (India)

    KNN) and CaTiO3- modified K1/2Na1/2NbO3 (CTO-KNN) systems, were investigated. Discs doped with 0 to 0.55% mol of CaTiO3 (CTO) were sintered at 1125°C for 2 h. Although minority phases were found in doped samples, CaTiO3 was not ...

  13. Crystal phase transition in LixNa1-xGdF4 solid solution nanocrystals - Tuning of optical properties

    KAUST Repository

    Bański, Mateusz

    2014-01-01

    The influence of precursor composition on the crystallization of LixNa1-xGdF4 is investigated and discussed. Nanocrystals are prepared from the thermal decomposition of trifluoroacetates in the presence of trioctylphosphine oxide to provide control over particle size. A crystal phase transition from hexagonal to cubic and to tetragonal is observed by increasing lithium trifluoroacetate (Li-TFA) in the solution. Controlling the composition of LixNa1-xGdF4 nanocrystals results in modified crystal field symmetry and emission properties from doped europium (Eu3+) ions. We report that for lithium (Li+) substitution <15%, the hexagonal crystal field is preferred, while the Eu3+ emission is already tuned, whereas at higher Li+ substitution, a phase change takes place and the number of crystalline matrix defects increases which is reflected in the optical properties of Eu3+. From Eu3+ emission properties, the optimum Li+ content is determined to be ∼6.2% in the prepared LixNa1-xGdF4 nanocrystals.

  14. Strain Engineering of Ferroelectric Domains in KxNa1−xNbO3 Epitaxial Layers

    Directory of Open Access Journals (Sweden)

    Jutta Schwarzkopf

    2017-08-01

    Full Text Available The application of lattice strain through epitaxial growth of oxide films on lattice mismatched perovskite-like substrates strongly influences the structural properties of ferroelectric domains and their corresponding piezoelectric behavior. The formation of different ferroelectric phases can be understood by a strain-phase diagram, which is calculated within the framework of the Landau–Ginzburg–Devonshire theory. In this paper, we illustrate the opportunity of ferroelectric domain engineering in the KxNa1−xNbO3 lead-free material system. In particular, the following examples are discussed in detail: (i Different substrates (NdGaO3, SrTiO3, DyScO3, TbScO3, and GdScO3 are used to systematically tune the incorporated epitaxial strain from compressive to tensile. This can be exploited to adjust the NaNbO3 thin film surface orientation and, concomitantly, the vector of electrical polarization, which rotates from mainly vertical to exclusive in-plane orientation. (ii In ferroelectric NaNbO3, thin films grown on rare-earth scandate substrates, highly regular stripe domain patterns are observed. By using different film thicknesses, these can be tailored with regard to domain periodicity and vertical polarization component. (iii A featured potassium concentration of x = 0.9 of KxNa1−xNbO3 thin films grown on (110 NdScO3 substrates favors the coexistence of two equivalent, monoclinic, but differently oriented ferroelectric phases. A complicated herringbone domain pattern is experimentally observed which consists of alternating MC and a1a2 domains. The coexistence of different types of ferroelectric domains leads to polarization discontinuities at the domain walls, potentially enabling high piezoelectric responses. In each of these examples, the experimental results are in excellent agreement with predictions based on the linear elasticity theory.

  15. Octahedral tilt transitions in the relaxor ferroelectric Na1/2Bi1/2TiO3

    International Nuclear Information System (INIS)

    Meyer, Kai-Christian; Gröting, Melanie; Albe, Karsten

    2015-01-01

    The kinetics of octahedral tilt transitions in the lead-free relaxor material sodium bismuth titanate Na 1/2 Bi 1/2 TiO 3 (NBT) is investigated by electronic structure calculations within density functional theory. Energy barriers for transitions between tetragonal, rhombohedral and orthorhombic tilts in cation configurations with [001]- and [111]-order on the A-sites are determined by nudged elastic band calculations. By tilting entire layers of octahedra simultaneously we find that the activation energy is lower for structures with 001-order compared to such with 111-order. The energetic coupling between differently tilted layers is, however, negligibly small. By introducing a single octahedral defect we create local tilt disorder and find that the deformation energy of the neighboring octahedra is less in a rhombohedral than in a tetragonal structure. By successively increasing the size of clusters of orthorhombic defects in a rhombohedral matrix with 001-order, we determine a critical cluster size of about 40 Å . Thus groups of about ten octahedra can be considered as nuclei for polar nanoregions, which are the cause of the experimentally observed relaxor behavior of NBT. - Graphical abstract: Nine orthorhombic oxygen octahedral tilt defects in a rhombohedral tilt configuration. - Highlights: • Chemical order influences energy barriers of octahedral tilt transitions. • The octahedral deformation energy is lower in rhombohedral phases. • Tilt defect clusters are more likely in rhombohedral structures. • Tilt defect clusters can act as nuclei for polar nanoregions

  16. Structure of AgxNa1-xPO3 glasses by neutron diffraction and reverse Monte Carlo modelling

    International Nuclear Information System (INIS)

    Hall, Andreas; Swenson, Jan; Karlsson, Christian; Adams, Stefan; Bowron, Daniel T

    2007-01-01

    We have performed structural studies of mixed mobile ion phosphate glasses Ag x Na 1-x PO 3 using diffraction experiments and reverse Monte Carlo simulations. This glass system is particularly interesting as a model system for investigations of the mixed mobile ion effect, due to its anomalously low magnitude in the system. As for previously studied mixed alkali phosphate glasses, with a much more pronounced mixed mobile ion effect, we find no substantial structural alterations of the phosphorous-oxygen network and the local coordination of the mobile cations. Furthermore, the mobile Ag + and Na + ions are randomly mixed with no detectable preference for either similar or dissimilar pairs of cations. However, in contrast to mixed mobile ion systems with a very pronounced mixed mobile ion effect, the two types of mobile ions have, in this case, very similar local environments. For all the studied glass compositions the average Ag-O and Na-O distances in the first coordination shell are determined to be 2.5 ± 0.1 and 2.5 ± 0.1 A, and the corresponding average coordination numbers are approximately 3.2 and 3.7, respectively. The similar local coordinations of the two types of mobile ions suggests that the energy mismatch for a Na + ion to occupy a site that previously has been occupied by a Ag + ion (and vice versa) is low, and that this low energy mismatch is responsible for the anomalously weak mixed mobile ion effect

  17. Host-induced genome alterations in Phytophthora ramorum, I. NA1 lineage on coast live oak in California, II. EU1 lineage on Chamaecyparis lawsoniana in UK

    Science.gov (United States)

    Takao Kasuga; Mai Bui; Elizabeth Bernhardt; Tedmund Swiecki; Kamyar Aram; Lien Bertier; Jennifer Yuzon; Liliana M. Cano; Joan Webber; Clive Brasier; Caroline Press; Niklaus Grünwald; David Rizzo; Matteo Garbelotto

    2017-01-01

    Rapid phenotypic diversification in clonal invasive populations is often observed, although the underlying genetic mechanisms remain elusive. Lineages of the sudden oak death pathogen Phytophthora ramorum are exclusively clonal, yet isolates of the NA1 lineage from oak (Quercus spp.) frequently exhibit...

  18. Molecular evolution of respiratory syncytial virus subgroup A genotype NA1 and ON1 attachment glycoprotein (G) gene in central Vietnam.

    Science.gov (United States)

    Yoshihara, Keisuke; Le, Minh Nhat; Nagasawa, Koo; Tsukagoshi, Hiroyuki; Nguyen, Hien Anh; Toizumi, Michiko; Moriuchi, Hiroyuki; Hashizume, Masahiro; Ariyoshi, Koya; Dang, Duc Anh; Kimura, Hirokazu; Yoshida, Lay-Myint

    2016-11-01

    We performed molecular evolutionary analyses of the G gene C-terminal 3rd hypervariable region of RSV-A genotypes NA1 and ON1 strains from the paediatric acute respiratory infection patients in central Vietnam during the 2010-2012 study period. Time-scaled phylogenetic analyses were performed using Bayesian Markov Chain Monte Carlo (MCMC) method, and pairwise distances (p-distances) were calculated. Bayesian Skyline Plot (BSP) was constructed to analyze the time-trend relative genetic diversity of central Vietnam RSV-A strains. We also estimated the N-glycosylation sites within G gene hypervariable region. Amino acid substitutions under positive and negative selection pressure were examined using Conservative Single Likelihood Ancestor Counting (SLAC), Fixed Effects Likelihood (FEL), Internal Fixed Effects Likelihood (IFEL) and Mixed Effects Model for Episodic Diversifying Selection (MEME) models. The majority of central Vietnam ON1 strains detected in 2012 were classified into lineage 1 with few positively selected substitutions. As for the Vietnamese NA1 strains, four lineages were circulating during the study period with a few positive selection sites. Shifting patterns of the predominantly circulating NA1 lineage were observed in each year during the investigation period. Median p-distance of central Vietnam NA1 strains was wider (p-distance=0.028) than that of ON1 (p-distance=0.012). The molecular evolutionary rate of central Vietnam ON1 strains was estimated to be 2.55×10 -2 (substitutions/site/year) and was faster than NA1 (7.12×10 -3 (substitutions/site/year)). Interestingly, the evolutionary rates of both genotypes ON1 and NA1 strains from central Vietnam were faster than the global strains respectively. Furthermore, the shifts of N-glycosylation pattern within the G gene 3rd hypervariable region of Vietnamese NA1 strains were observed in each year. BSP analysis indicated the rapid growth of RSV-A effective population size in early 2012. These results

  19. Synthesis and electrochemical properties of Na1.2V3O8/LTX as anodic material in sodium ion batteries

    Directory of Open Access Journals (Sweden)

    Stojković-Simatović Ivana B.

    2016-01-01

    Full Text Available In this paper, the synthesis of composite Na1.2V3O8/LTX by sol-gel method was described. The synthesized powders were characterized by X-ray powder diffraction (XRD and thermogravimetric analysis (TGA while the electrochemical performances were investigated by cycling voltammetry (CV by different scan rate. After thermal treatment, the part of carbon was 7%. The initial discharge capacity was 100.44 mAhg-1. The most capacity fade was after 2nd cycle (14% but capacity fade from 6th to 10th cycle was only 10%. The efficiency of Na1.2V3O8/LTX is around 95%.

  20. Phase and morphology evolution of (Na1-xKxNbO3 powders related to calcinations and K2CO3 content

    Directory of Open Access Journals (Sweden)

    Steven J. Milne

    2007-03-01

    Full Text Available Sodium-potassium niobate ((Na1-xKxNbO3 powders with x = 0.2, 0.4, 0.6 and 0.8 were prepared following the conventional mixed oxide method and characterized by TG-DTA, XRD and SEM techniques.The effects of calcination temperature, dwell time and K2CO3 content on phase formation behavior and morphology of the powders were investigated. The calcination temperature and dwell time were found tohave a pronounced effect on the phase formation of the calcined sodium-potassium niobate powders. It was found that the crystallized phase depended on calcination conditions. The high calcination temperature andlong dwell time clearly favored particle growth and the formation of large and hard agglomerates. All the (Na1-xKxNbO3 powders showed a similar orthorhombic phase structure. The K2CO3 content significantlyaffected the calcination temperature and particle size and shape. Large particle size, cubic shape and a lower calcined condition were observed in (Na1-xKxNbO3 powder with low K2CO3 content (x = 0.2.

  1. Dielectric-Spectroscopic and ac Conductivity Investigations on Manganese Doped Layered Na1.9Li0.1Ti3O7 Ceramics

    International Nuclear Information System (INIS)

    Pal, Dharmendra; Pandey, J. L.; Pal, Shri

    2009-01-01

    The dielectric-spectroscopic and ac conductivity studies firstly carried out on layered manganese doped Sodium Lithium Trititanates (Na 1.9 Li 0.1 Ti 3 O 7 ). The dependence of loss tangent (Tanδ), relative permittivity (ε r ) and ac conductivity (σ ac ) in temperature range 373-723K and frequency range 100Hz-1MHz studied on doped derivatives. Various conduction mechanisms are involved during temperature range of study like electronic hopping conduction in lowest temperature region, for MSLT-1 and MSLT-2. The hindered interlayer ionic conduction exists with electronic hopping conduction for MSLT-3. The associated interlayer ionic conduction exists in mid temperature region for all doped derivatives. In highest temperature region modified interlayer ionic conduction along with the polaronic conduction, exist for MSLT-1, MSLT-2, and only modified interlayer ionic conduction for MSLT-3. The loss tangent (Tanδ) in manganese-doped derivatives of layered Na 1.9 Li 0.1 Ti 3 O 7 ceramic may be due to contribution of electric conduction, dipole orientation, and space charge polarization. The corresponding increase in the values of relative permittivity may be due to increase in number of dipoles in the interlayer space while the corresponding decrease in the values of relative permittivity may be due to the increase in the leakage current due to the higher doping

  2. Study on the reversible electrode reaction of Na(1-x)Ni(0.5)Mn(0.5)O2 for a rechargeable sodium-ion battery.

    Science.gov (United States)

    Komaba, Shinichi; Yabuuchi, Naoaki; Nakayama, Tetsuri; Ogata, Atsushi; Ishikawa, Toru; Nakai, Izumi

    2012-06-04

    Layered NaNi(0.5)Mn(0.5)O(2) (space group: R ̅3m), having an O3-type (α-NaFeO(2) type) structure according to the Delmas' notation, is prepared by a solid-state method. The electrochemical reactivity of NaNi(0.5)Mn(0.5)O(2) is examined in an aprotic sodium cell at room temperature. The NaNi(0.5)Mn(0.5)O(2) electrodes can deliver ca. 105-125 mAh g(-1) at rates of 240-4.8 mA g(-1) in the voltage range of 2.2-3.8 V and show 75% of the initial reversible capacity after 50 charge/discharge cycling tests. In the voltage range of 2.2-4.5 V, a higher reversible capacity of 185 mAh g(-1) is achieved; however, its reversibility is insufficient because of the significant expansion of interslab space by charging to 4.5 V versus sodium. The reversbility is improved by adding fluoroethylene carbonate into the electrolyte solution. The structural transition mechanism of Na(1-x)Ni(0.5)Mn(0.5)O(2) is also examined by an ex situ X-ray diffraction method combined with X-ray absorption spectroscopy (XAS). The staking sequence of the [Ni(0.5)Mn(0.5)]O(2) slabs changes progressively as sodium ions are extracted from the crystal lattice. It is observed that the original O3 phase transforms into the O'3, P3, P'3, and P3" phases during sodium extraction. XAS measurement proves that NaNi(0.5)Mn(0.5)O(2) consists of divalent nickel and tetravalent manganese ions. As sodium ions are extracted from the oxide to form Na(1-x)Ni(0.5)Mn(0.5)O(2), nickel ions are oxidized to the trivalent state, while the manganese ions are electrochemically inactive as the tetravalent state.

  3. Microstructure and microwave dielectric properties of Na1/2Sm1/2TiO3 filled PTFE, an environmental friendly composites

    Science.gov (United States)

    Luo, Fuchuan; Tang, Bin; Yuan, Ying; Fang, Zixuan; Zhang, Shuren

    2018-04-01

    A study on Na1/2Sm1/2TiO3 filled and glassfiber reinforced polytetrafluoroethylene (PTFE) composites was described. The GF content was a fixed value of 4 wt%, and the NST content in the composite matrix changed from 26 to 66 wt%. The paper consisted of the manufactural process of the composite and the effects of filler content on the properties of the substrate, such as morphology, moisture absorption, density, dielectric properties and temperature coefficient of dielectric constant. As NST filler loading increased from 26 to 66 wt%, the dielectric constant and loss tangent experienced a continuously increase while the development in τε was opposite. X-Ray Diffraction, FTIR and XPS were used to analyze the microstructure of modified ceramic powder. It was proved that the silane coupling agent has been grafted on the NST surface successfully. At last, the NST/GF filled PTFE composites exhibited good dielectric constant (εr = 4.95), low dielectric loss (tan δ = 0.00147), acceptable water absorption (0.036) and temperature coefficient of dielectric constant (τε = -164) at filler loading of 4 wt% GF and 46 wt% NST.

  4. Heterologous Production of an Energy-Conserving Carbon Monoxide Dehydrogenase Complex in the Hyperthermophile Pyrococcus furiosus

    Directory of Open Access Journals (Sweden)

    Gerrit Jan Schut

    2016-01-01

    Full Text Available Carbon monoxide (CO is an important intermediate in anaerobic carbon fixation pathways in acetogenesis and methanogenesis. In addition, some anaerobes can utilize CO as an energy source. In the hyperthermophilic archaeon Thermococcus onnurineus, which grows optimally at 80°C, CO oxidation and energy conservation is accomplished by a respiratory complex encoded by a 16-gene cluster containing a carbon monoxide dehydrogenase, a membrane-bound [NiFe]-hydrogenase and a Na+/H+ antiporter module. This complex oxidizes CO, evolves CO2 and H2, and generates a Na+ motive force that is used to conserve energy by a Na+-dependent ATP synthase. Herein we used a bacterial artificial chromosome to insert the 13.2 kb gene cluster encoding the CO-oxidizing respiratory complex of T. onnurineus into the genome of the heterotrophic archaeon, Pyrococcus furiosus, which grows optimally at 100°C. P. furiosus is normally unable to utilize CO, however, the recombinant strain readily oxidized CO and generated H2 at 80°C. Moreover, CO also served as an energy source and allowed the P. furiosus strain to grow with a limiting concentration of sugar or with peptides as the carbon source. Moreover, CO oxidation by P. furiosus was also coupled to the re-utilization, presumably for biosynthesis, of acetate generated by fermentation. The functional transfer of CO utilization between Thermococcus and Pyrococcus species demonstrated herein is representative of the horizontal gene transfer of an environmentally-relevant metabolic capability. The transfer of CO utilizing, hydrogen-producing genetic modules also has applications for biohydrogen production and a CO-based industrial platform for various thermophilic organisms.

  5. Tetragonal-to-Tetragonal Phase Transition in Lead-Free (KxNa1−xNbO3 (x = 0.11 and 0.17 Crystals

    Directory of Open Access Journals (Sweden)

    Dabin Lin

    2014-06-01

    Full Text Available Lead free piezoelectric crystals of (KxNa1−xNbO3 (x = 0.11 and 0.17 have been grown by the modified Bridgman method. The structure and chemical composition of the obtained crystals were determined by X-ray diffraction (XRD and electron probe microanalysis (EPMA. The domain structure evolution with increasing temperature for (KxNa1−xNbO3 (x = 0.11 and 0.17 crystals was observed using polarized light microscopy (PLM, where distinguished changes of the domain structures were found to occur at 400 °C and 412 °C respectively, corresponding to the tetragonal to tetragonal phase transition temperatures. Dielectric measurements performed on (K0.11Na0.89NbO3 crystals exhibited tetragonal to tetragonal and tetragonal to cubic phase transitions temperatures at 405 °C and 496 °C, respectively.

  6. Systematic study of photoluminescence upon band gap excitation in perovskite-type titanates R 1/2Na1/2TiO3:Pr (R=La, Gd, Lu, and Y)

    International Nuclear Information System (INIS)

    Inaguma, Yoshiyuki; Tsuchiya, Takeshi; Katsumata, Tetsuhiro

    2007-01-01

    Pr 3+ -doped perovskites R 1/2 Na 1/2 TiO 3 :Pr (R=La, Gd, Lu, and Y) were synthesized, and their structures, optical absorption and luminescent properties were investigated, and the relationship between structures and optical properties are discussed. Optical band gap of R 1/2 Na 1/2 TiO 3 increases in the order R=La, Gd, Y, and Lu, which is primarily due to a decrease in band width accompanied by a decrease in Ti-O-Ti bond angle. Intense red emission assigned to f-f transition of Pr 3+ from the excited 1 D 2 level to the ground 3 H 4 state upon the band gap photo-excitation (UV) was observed for all compounds. The wavelength of emission peaks was red-shifted in the order R=La, Gd, Y, and Lu, which originates from the increase in crystal field splitting of Pr 3+ . This is attributed to the decrease in inter-atomic distances of Pr-O together with the inter-atomic distances (R, Na)-O, i.e., increase in covalency between Pr and O. The results indicate that the luminescent properties in R 1/2 Na 1/2 TiO 3 :Pr are governed by the relative energy level between the ground and excited state of 4f 2 for Pr 3+ , and the conduction and valence band, which is primarily dependent on the structure, e.g., the tilt of TiO 6 octahedra and the Pr-Ti inter-atomic distance and the site symmetry of Pr ion. - Graphical abstract: The red intense emission assigned to f-f transition of Pr 3+ from the excited 1 D 2 level to the ground 3 H 4 state upon the band gap photo-excitation (UV) was observed upon the band gap photo-excitation in perovskites R 1/2 Na 1/2 TiO 3 :Pr(R=La, Gd, Lu, and Y). It was found that the systematic changes in their luminescent properties are strongly dependent on the structure

  7. Effect of paramagnetic manganese ions doping on frequency and high temperature dependence dielectric response of layered Na1.9Li0.1Ti3O7 ceramics

    International Nuclear Information System (INIS)

    Pal, Dharmendra; Pandey, J.L.

    2010-01-01

    The manganese doped layered ceramic samples (Na 1.9 Li 0.1 )Ti 3 O 7 : XMn (0.01 ≤ X ≤ 0.1) have been prepared using high temperature solid state reaction. The room temperature electron paramagnetic resonance (EPR) investigations exhibit that at lower percentage of doping the substitution of manganese ions occur as Mn 3+ at Ti 4+ sites, whereas for higher percentage of doping Mn 2+ ions occupy the two different interlayer sodium/lithium sites. In both cases, the charge compensation mechanism should operate to maintain the overall charge neutrality of the lattice. The manganese doped derivatives of layered Na 1.9 Li 0. 1Ti 3 O 7 (SLT) ceramics have been investigated through frequency dependence dielectric spectroscopy in this work. The results indicate that the dielectric losses in these ceramics are the collective contribution of electric conduction, dipole orientation and space charge polarization. Smeared peaks in temperature dependence of permittivity plots suggest diffuse nature of high temperature ferroelectric phase transition. The light manganese doping in SLT enhances the dielectric constant. However, manganese doping decreases dielectric loss due to inhibition of domain wall motion, enhances electron-hopping conduction, and impedes the interlayer ionic conduction as well. Manganese doping also gives rise to contraction of interlayer space. (author)

  8. Evolution of the tetragonal to rhombohedral transition in (1 − x(Bi1/2Na1/2TiO3 − xBaTiO3 (x ≤ 7%

    Directory of Open Access Journals (Sweden)

    Yonggang Yao, Zhimin Sun, Yuanchao Ji, Yaodong Yang, Xiaoli Tan and Xiaobing Ren

    2013-01-01

    Full Text Available (1 − x(Bi1/2Na1/2TiO3 − xBaTiO3 has been the most studied Pb-free piezoelectric material in the last decade; however, puzzles still remain about its phase transitions, especially around the important morphotropic phase boundary (MPB. By introducing the strain glass transition concept from the ferroelastic field, it was found that the phase transition from tetragonal (T, P4bm to rhombohedral (R, R3c was affected by a strain glass transition at higher temperature for x ≥ 4%. In these compositions, the T–R transition was delayed or even totally suppressed and displayed huge thermal hysteresis upon cooling and heating. Also, isothermal phase transitions were predicted and realized successfully in the crossover region, where the interaction between the T–R transition and the strain glass transition was strong. Our results revealed the strain glass nature in compositions around the MPB in this important material, and also provide new clues for understanding the transition complexity in other (Bi1/2Na1/2TiO3-based Pb-free piezoelectric materials.

  9. Studies of the structure of mixed crystals of the system Na1+2xMgxZr2-x(PO4)3 by 31P-MAS-NMR

    International Nuclear Information System (INIS)

    Jaeger, C.; Scheler, G.; Barth, S.; Feltz, A.

    1987-01-01

    It is proved by 31 P-NMR that the mixed crystals of the series Na 1+2x Mg x Zr 2-x (PO 4 ) 3 are composed of five introduced basic structures NaZr 2 (PO 4 ) 3 , Na 2 Mg 0.5 Zr 1.5 (PO 4 ) 3 , Na 3 MgZr(PO 4 ) 3 , Na 4 Mg 1.5 Zr 0.5 (PO 4 ) 3 , and Na 5 Mg 2 (PO 4 ) 3 (x ≤ 1). The Mg 2+ - and Zr 4+ -ions are statistically distributed. No amorphous minor constituents can be found. The region of this series of mixed crystals is already broken up for x > 1, whereas the theoretical limit is c = 1.5. For x > 1 monophosphates are formed partially with Na + and Mg 2+ in the second coordination sphere of phosphorus. (author)

  10. Influencia de las condiciones de procesamiento sobre las propiedades dieléctricas y microestructurales de cerámicos de K1/2Na1/2NbO3

    Directory of Open Access Journals (Sweden)

    Castro, M. S.

    2011-02-01

    Full Text Available The objective of this work was to analyze different processing condition of Na1/2K1/2NbO3 (KNN in order to obtain a material with good properties and without secondary phases. Solid state reaction method was used and the influence of milling time, calcination temperature and time, and sintering temperature was analyzed. It was found that sintering temperatures were limited by the component decomposition. Also, it was observed that samples sintered at 1125 ºC showed the highest density and permittivity with a homogeneous structure. In general, samples calcined at higher temperatures and times showed the best properties.El objetivo de este trabajo es analizar diferentes condiciones de procesamiento del K1/2Na1/2NbO3 (KNN que permitan obtener un material con buenas propiedades y libre de fases secundarias. Se implementó el método de activación mecanoquímica de los precursores y posterior reacción en estado sólido. Se analizaron las principales condiciones de procesamiento (tiempo de molienda, temperaturas de calcinación y sinterizado, y se determinaron las propiedades dieléctricas y microestructurales de cada sistema. Se encontró que las temperaturas máximas de calcinación estuvieron limitadas por la descomposición de los constituyentes. También se observó que las pastillas sinterizadas a 1125ºC registraron mayor densidad, mayor permitividad y una microestructura homogénea. En general, se observó que los sistemas calcinados a mayores temperaturas y por tiempos mayores tuvieron mejores propiedades.

  11. Šikana na 1.stupni ZŠ

    OpenAIRE

    Poláková, Petra

    2015-01-01

    (The thesis has both a theoretical and a research section.) Master thesis' theoretical section examines problems of school bullying, especially defining its term, classification, bullying stages, its effects, the cause of bullying, participants' typology, (victim, aggressor, silent majority) and prevention, etc. The aim of the practical section is to monitor what approaches and strategies are used at the two intentionally chosen school institutions in terms of preventions and solving problems...

  12. Structural and electrical properties of (1-x)(Na1/2Bi1/2)TiO3-xPb(Mg1/3Nb2/3)O3 solid solution

    International Nuclear Information System (INIS)

    Lee, J.-K.; Yi, J.Y.; Hong, K.S.

    2004-01-01

    Structural, dielectric and piezoelectric properties of (1-x)(Na 1/2 Bi 1/2 )TiO 3 -xPb(Mg 1/3 Nb 2/3 )O 3 (NBT-xPMN) solid solution have been investigated. An addition of PMN into NBT transformed the structure of sintered samples from rhombohedral to pseudocubic phase where x is larger than 0.1. In calcined powders, however, the intermediate structure were observed between rhombohedral and cubic phases near x=0.1. The formation of solid solution between NBT and PMN modified the dielectric and piezoelectric properties of NBT to be suitable for high temperature dielectric and piezoelectric material. With increasing the content of PMN, the temperature-stability of ε r (T) increased and the high temperature dielectric loss decreased. In addition, the piezoelectric property of NBT-xPMN was enhanced, for the decrease of coercive field and conductivity promoted the domain reversal under the high electric field of the poling process

  13. Temperature dependent polarization reversal mechanism in 0.94(Bi1/2Na1/2)TiO3-0.06Ba(Zr0.02Ti0.98)O3 relaxor ceramics

    Science.gov (United States)

    Glaum, Julia; Simons, Hugh; Hudspeth, Jessica; Acosta, Matias; Daniels, John E.

    2015-12-01

    The temperature at which the electric field induced long-range ordered ferroelectric state undergoes transition into the short-range ordered relaxor state, TF-R, is commonly defined by the onset of strong dispersion of the dielectric permittivity. However, this combined macroscopic property and structural investigation of the polarization reversal process in the prototypical lead-free relaxor 0.94(Bi1/2Na1/2)TiO3-0.06Ba(Zr0.02Ti0.98)O3 reveals that an applied electric field can trigger depolarization and onset of relaxor-like behavior well below TF-R. The polarization reversal process can as such be described as a combination of (1) ferroelectric domain switching and (2) a reversible phase transition between two polar ferroelectric states mediated by a non-polar relaxor state. Furthermore, the threshold fields of the second, mediated polarization reversal mechanism depend strongly on temperature. These results are concomitant with a continuous ferroelectric to relaxor transition occurring over a broad temperature range, during which mixed behavior is observed. The nature of polarization reversal can be illustrated in electric-field-temperature (E-T) diagrams showing the electric field amplitudes associated with different polarization reversal processes. Such diagrams are useful tools for identifying the best operational temperature regimes for a given composition in actuator applications.

  14. Effect of B-site substitution of complex ions on dielectric and piezoelectric properties in (Bi1/2Na1/2)TiO3 piezoelectric ceramics

    International Nuclear Information System (INIS)

    Zhou Changrong; Liu Xinyu

    2008-01-01

    The effect of B-site substitution of complex ions on dielectric and piezoelectric properties in (Bi 1/2 Na 1/2 )Ti 1-x (Zn 1/3 Nb 2/3 ) x O 3 (BNTZN-100x) lead-free piezoelectric ceramics was investigated. X-ray diffraction analysis shows that the materials are mono-perovskite phase. The morphotropic phase boundary (MPB) of BNTZN-100x ceramics between rhombohedral and tetragonal locates in the range of 0.5% ≤ x ≤ 2.0%. Temperature dependence of dielectric constant shows that these compounds are relaxor ferroelectrics. The compositions near the MPB exhibit relatively high piezoelectric properties. The piezoelectric constant (d 33 ) and the electromechanical coupling factor (k t ) show the maximum values of d 33 = 97 pC N -1 and k t = 0.46 at x = 2.0% and x = 1.0%, respectively. The BNTZN-100x ceramics are good candidate for use as ultrasonic transducer ceramics for high anisotropic with high k t value and low k p value

  15. Crystal structure of a sodium, zinc and iron(III-based non-stoichiometric phosphate with an alluaudite-like structure: Na1.67Zn1.67Fe1.33(PO43

    Directory of Open Access Journals (Sweden)

    Jamal Khmiyas

    2015-06-01

    Full Text Available The new title compound, disodium dizinc iron(III tris(phosphate, Na1.67Zn1.67Fe1.33(PO43, which belongs to the alluaudite family, has been synthesized by solid-state reactions. In this structure, all atoms are in general positions except for four, which are located on special positions of the C2/c space group. This structure is characterized by cation substitutional disorder at two sites, one situated on the special position 4e (2 and the other on the general position 8f. The 4e site is partially occupied by Na+ [0.332 (3], whereas the 8f site is entirely filled by a mixture of Fe and Zn. The full-occupancy sodium and zinc atoms are located at the Wyckoff positions on the inversion center 4a (-1 and on the twofold rotation axis 4e, respectively. Refinement of the occupancy ratios, bond-valence analysis and the electrical neutrality requirement of the structure lead to the given composition for the title compound. The three-dimensional framework of this structure consists of kinked chains of edge-sharing octahedra stacked parallel to [10-1]. The chains are formed by a succession of trimers based on [ZnO6] octahedra and the mixed-cation FeIII/ZnII [(Fe/ZnO6] octahedra [FeIII:ZnIII ratio 0.668 (3/0.332 (3]. Continuous chains are held together by PO4 phosphate groups, forming polyhedral sheets perpendicular to [010]. The stacked sheets delimit two types of tunnels parallel to the c axis in which the sodium cations are located. Each Na+ cation is coordinated by eight O atoms. The disorder of Na in the tunnel might presage ionic mobility for this material.

  16. Piezoelectric and ferroelectric properties of lead-free (1-x)(Na1-yKy)(Nb1-zSbz)O3-xBaTiO3 solid solution

    Science.gov (United States)

    Sasikumar, S.; Saravanan, R.; Aravinth, K.

    2017-05-01

    The solid solutions of lead-free (1-x)(Na1-yKy)(Nb1-zSbz)O3-xBaTiO3 (with x=0.1, 0.2; y=0.03, 0.05; z=0.05, 0.1) (abbreviated as (1-x)NKNS-xBT) ceramics have been synthesized using conventional solid-state reaction method. The results of X-ray diffraction analysis show that all the grown specimens of NKNS display typical perovskite structure. With BaTiO3 (BT) addition, a structural phase transition from tetragonal to cubic structure has been observed. The structural parameters of (1-x)NKNS-xBT powders were determined by profile refinements based on the analysis of X-ray powder diffraction. The charge density distributions of the prepared samples have been investigated by observed structure factors to understand the chemical bonding nature of (1-x)NKNS-xBT powders. The optical absorption of the ceramics has been investigated using UV-visible spectrophotometer. Scanning electron microscopic (SEM) measurements were performed to study the surface morphology of the prepared solid solutions. The elemental compositions of the (1-x)NKNS-xBT samples were analyzed by energy-dispersive X-ray (EDS) spectrometer. The dielectric constant versus temperature plots of the solid solutions exhibit ferroelectric to paraelectric phase transition, which is dependent on the BaTiO3 content. The ferroelectric nature of the samples has been determined through polarization and electric field hysteresis measurements.

  17. Tem analyses of the local crystal and domain structures in (Na(1-x)K(x))0.5Bi(0.5)TiO3 perovskite ceramics.

    Science.gov (United States)

    Otonicar, Mojca; Skapin, Sreco D; Jancar, Bostjan

    2011-09-01

    The local crystal and domain structures of the ((Na(1-x)K(x))(0.5)Bi(0.5)TiO(3) (NBT-KBT) solid solutions were studied because of their influence on the enhanced electromechanical properties of ceramics. Based on X-ray diffraction, the morphotropic phase boundary (MPB) was determined for the composition x = 0.20, in which the rhombohedral and the tetragonal structures were observed to coexist. However, detailed domain-structure analyses using transmission electron microscopy (TEM), performed on the NBT, KBT, and five NBT-KBT solid-solution compositions, revealed some structural changes at/near the MPB. In the samples on the tetragonal side of the MPB, the grains showed a lamellar domain structure with 90° orientations of the individual domains, separated by straight domain boundaries, i.e., (011)/(101) twin planes. The rhombohedral samples on the other side of the MPB showed a typical square-net pattern with needle-like or lamellar ~71°/109° rhombohedral domains with (001) and/or (110) twin planes separating the individual domains. The domain structure at the MPB showed well-defined lamellar domains. Based on the occurrence of the superstructure reflections in the SAED patterns of various crystallographic zones, on the characteristic splitting of the reflections, and on the domain morphology observations, the crystal structure in/near the boundary region was determined to be a tetragonal structure with an in-phase oxygen octahedral tilt system (probably a(0)a(0)c(+)). It is suggested that the tetragonal polar order is partly induced from the rhombohedral structure at the MPB as a result of mechanical loading during TEM sample preparation.

  18. Hydrogen or formate: Alternative key players in methanogenic degradation.

    Science.gov (United States)

    Schink, Bernhard; Montag, Dominik; Keller, Anja; Müller, Nicolai

    2017-06-01

    Hydrogen and formate are important electron carriers in methanogenic degradation in anoxic environments such as sediments, sewage sludge digestors and biogas reactors. Especially in the terminal steps of methanogenesis, they determine the energy budgets of secondary (syntrophically) fermenting bacteria and their methanogenic partners. The literature provides considerable data on hydrogen pool sizes in such habitats, but little data exist for formate concentrations due to technical difficulties in formate determination at low concentration. Recent evidence from biochemical and molecular biological studies indicates that several secondary fermenters can use both hydrogen and formate for electron release, and may do so even simultaneously. Numerous strictly anaerobic bacteria contain enzymes which equilibrate hydrogen and formate pools to energetically equal values, and recent measurements in sewage digestors and biogas reactors indicate that - beyond occasional fluctuations - the pool sizes of hydrogen and formate are indeed energetically nearly equivalent. Nonetheless, a thermophilic archaeon from a submarine hydrothermal vent, Thermococcus onnurineus, can obtain ATP from the conversion of formate to hydrogen plus bicarbonate at 80°C, indicating that at least in this extreme environment the pools of formate and hydrogen are likely to be sufficiently different to support such an unusual type of energy conservation. © 2017 Society for Applied Microbiology and John Wiley & Sons Ltd.

  19. Crystal structures of chitin binding domains of chitinase from Thermococcus kodakarensis KOD1.

    Science.gov (United States)

    Hanazono, Yuya; Takeda, Kazuki; Niwa, Satomi; Hibi, Masahito; Takahashi, Naoya; Kanai, Tamotsu; Atomi, Haruyuki; Miki, Kunio

    2016-01-01

    Chitinase from T. kodakarensis (TkChiA) catalyzes the hydrolysis of chitin. The enzyme consists of two catalytic and three binding domains (ChBD1, ChBD2 and ChBD3). ChBD2 and ChBD3 can bind to not only chitin but also cellulose. In both domains, the intervals of the side chains of the three tryptophan residues, which are located on the molecular surface, correspond to twice the length of the lattice of the chitin. A binding model with crystalline chitin implies that the tryptophan residues and a glutamate residue interact with the hexose ring by CH-π interactions and the amide group by a hydrogen bond, respectively. © 2016 Federation of European Biochemical Societies.

  20. Association of a multi-synthetase complex with translating ribosomes in the archaeon Thermococcus kodakarensis

    DEFF Research Database (Denmark)

    Raina, Medha; Elgamal, Sara; Santangelo, Thomas J

    2012-01-01

    -dependent methyltransferase 144, GTP cyclohydrolase 398, DNA topoisomerase VI subunit A 209, DNA topoisomerase VI subunit B 192, Type A Flavoprotein 911, NAD(P)H:rubredoxin oxidoreductase (Fatty acid metabolism) 120, NAD(P)H:rubredoxin oxidoreductase 120, cofactor-independent phosphoglycerate mutase 909, bis(5'-adenosyl......, transcriptional regulator 364, glutamine synthetase 120, N6-adenine-specific DNA methylase 194, ArsR family transcriptional regulator 113, 5'-methylthioadenosine phosphorylase II 280, DNA repair and recombination protein RadA 323, 30S ribosomal protein S6e 106, pyruvate ferredoxin oxidoreductase subunit beta 282...

  1. Depolarization temperature and piezoelectric properties of Na1/2 ...

    Indian Academy of Sciences (India)

    1/2Bi1/2(Zn1/3Nb2/3)O3, was synthesized using the two-stage calcination method and depolarization temperatures and piezoelectric properties were also investigated. The XRD analysis showed that the ceramics system had a morphotropic ...

  2. The Effects of the Addition of Silica Mol Fraction (x = 1.5; 2; 2.5) as a Solid Electrolyte on Ion Conductivity of NASICON (Na1-xZr2SixP3-xO12) Using Solid-State Method

    Science.gov (United States)

    Pratiwi, V. M.; Purwaningsih, H.; Widyastuti; Fajarin, R.; Setyawan, H.

    2017-05-01

    Energy is a very important in modern life and need innovations to develop it. One innovation is the application of energyfor storage devices, such as batteries, capacitors, fuel cells, etc. For 30 years, the application of the NASICON (Na1+xZr2SixP3-xO12) into the NASICON gas sensor material was successfully prepared by using solid-state method. The raw materials such as SiO2, Na2CO3, ZrO2, and NaH2PO4 with a little methanol were mixed in Ballmill equipment. The silica powder was made by the extraction of bagasse ash by using sol-gel method. The x-ray diffraction patternshowedthat the result of silica extraction was amorphous and the NASICON structure wassynthesizedto bemonoclinic. The scanning electron microscopy results indicated that silica had non-uniform surface morphology and the NASICON had good surface morphology only on the form of Na3Zr2Si2PO12. The ionic conductivty of NASICON wasshown on LCR Nyquist plot of the three compositions. The highest NASICON conductivity was found inthe composition of x = 2.0, i.e. 1.142x10-8 S/m.

  3. Lead-free and lead-based ABO3 perovskite relaxors with mixed-valence A-site and B-site disorder: A comparative neutron scattering structural study of (Na1/2Bi1/2)TiO3 and Pb(Mg1/3Nb2/3)O3

    Energy Technology Data Exchange (ETDEWEB)

    Ge, Wenwei [Virginia Polytechnic Institute and State University; Devreugd, Christopher [Virginia Polytechnic Institute and State University; Phelan, Daniel [National Institute of Standards and Technology (NIST), Gaithersburg, MD; Zhang, Qinjui [Shanghai Institute of Ceramics, Chinese Academy of Sciences (SICCAS); Muhtar, Aheart [Carnegie Institution of Washington; Li, Jiefang [Virginia Polytechnic Institute and State University; Luo, Haosu [Shanghai Institute of Ceramics, Chinese Academy of Sciences (SICCAS); Boatner, Lynn A [ORNL; Viehland, Dwight [Virginia Polytechnic Institute and State University; Gehring, P. M. [National Institute of Standards and Technology (NIST)

    2013-01-01

    We report the results of neutron elastic scattering measurements between -250oC and 620oC on the lead-free relaxor Na1/2Bi1/2TiO3 (NBT). Strong, anisotropic, elastic diffuse scattering intensity decorates the (100), (110), (111), (200), (220), and (210) Bragg peaks at room temperature. The wavevector dependence of this diffuse scattering is compared to that in the lead-based relaxor PbMg1/3Nb2/3O3 (PMN) to determine if any features might be common to relaxors. Prominent ridges in the elastic diffuse scattering intensity contours that extend along <110> are seen that exhibit the same zone dependence as those observed in PMN and other lead-based relaxors. These ridges disappear gradually on heating above the cubic-to-tetragonal phase transition temperature TCT = 523oC, which is also near the temperature at which the dielectric permittivity begins to deviate from Curie-Weiss behavior. We thus identify the <110>-oriented ridges as a relaxor-specific property. The diffuse scattering contours also display narrower ridges oriented along <100> that are consistent with the x-ray results of Kreisel et al. (2003); these vanish below 320oC indicating that they have a different physical origin. The <100>-oriented ridges are not observed in PMN. We observe no equivalent relaxor-specific elastic diffuse scattering from the homovalent relaxor analogues K0.95Li0.05TiO3 (A-site disordered) and KTa0.95Nb0.05O3 (B-site disordered). This suggests that the <110>-oriented diffuse scattering ridges are correlated with the presence of strong random electric fields and invites a reassessment of what defines the relaxor phase. We find that doping NBT with 5.6% BaTiO3, a composition close to the morphotropic phase boundary with enhanced piezoelectric properties, increases the room temperature correlation length along [1 1 0] from 40 to 60 while doubling the associated integrated diffuse scattering. Similar behavior was reported by Matsuura et al. (2006) for compositions of PMN doped with Pb

  4. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available erase [Thermococcus kodakaraensis KOD1] MLNRYRENVKGYLEAIVKPLAKAGVTPNTITFIGLLISLLGAYLFYLQRPRLAAVILLIGSAIDALDG...TLARMTGKTSRFGAFLDSTFDRISDGAVLFGIALGNLADWRLTFLTFMGAYLVSYERCRAELAGSGTLAVGIAERAERLLILMAFSLAGAEYVKWGVYIVGVLAWITVFQRMWAAYQRLKE

  5. Structural Characterization of Lithium Doped Nzp Na 1-x Li x Zr(PO 4 )

    African Journals Online (AJOL)

    0.75) have been synthesized using solid state reaction, with a view to minimizing the ZrO2 second phase normally present .The compositions have been characterized by XRD and SEM for phase composition, lattice parameters and density.

  6. Realizace dopravní výchovy na 1. stupni ZŠ

    OpenAIRE

    Kadavá, Markéta

    2014-01-01

    To follow, the focus of this diploma thesis is how traffic education can be properly incorporated into the first stage of our primary school curriculum and the different possibilities how the whole subject should be taught. Theoretical part deals with traffic education as part of education and also defines the term - traffic education, the meaning and the aim of traffic education area all together with short view into traffic education concept and comparision to abroad. In this part you can a...

  7. Školní hodnocení na 1. stupni ZŠ

    OpenAIRE

    Zemanová, Zuzana

    2007-01-01

    Annotation: The diploma work has theoretic research characteristics. It deals with school assessment in primary school. Key words: assessment - school assessment - pupil - motivation Powered by TCPDF (www.tcpdf.org)

  8. Autismo - Intervenção terapêutica na 1ª infância

    OpenAIRE

    Marques, Cristina

    1998-01-01

    A autora faz uma elaboração acerca da abordagem terapêutica de crianças na faixa etária da 1. infância com o diagnóstico de autismo, colocando particular ênfase nos seguintes pontos: 1) Importância do diagnóstico e início precoce do tratamento; 2) Reconhecimento da existência de défices regulatórios no processamento sensorial, os quais estariam na base das dificuldades de comunicação, em alguns casos; 3) Importância de promover modalidades terapêuticas que tenham em...

  9. Šikana na 1.stupni základní školy

    OpenAIRE

    Machovičová, Michaela

    2006-01-01

    This thesis deals with bullying in elementary schools. The theoretical part describes forms and causes of bullying within a group of pupils. It presents features of aggressors and victims of bullying and also some of the most common attitudes made by teachers, schools and parents and their opinions of this problem. Further, the thesis states specific ways of how bullying could be diagnosed, investigated and treated. It also suggests sanctions and educational precautions for the bullies. The p...

  10. Výuka atletiky na 1. stupni základní školy

    OpenAIRE

    Suchomelová, Anna

    2017-01-01

    Diploma Thesis:Teaching Athletics at the First Grade of Primary School Student:Bc. Anna Suchomelová Supervisor:Mgr. et Mgr. Zdeňka Engelthalerová Goal of Diploma Thesis: The purpose of this study is to investigate attitudes and experiences of teachers towards teaching athletics in primary schools. Methodology: Data was collected in the form of questionnaires adresssed to 72 teachers and 123 pupils of primary schools from Central Bohemian Region. The teachers were questioned about their attitu...

  11. Tijdschriften na 1 januari 2005. Elsevier Science, Wiley, Springer/Kluwer

    NARCIS (Netherlands)

    Klugkist, A.C.; Laarhoven, Peter van

    2004-01-01

    In aflevering 3 van deze jaargang van Pictogram hebben wij de aandacht gericht op de toen komende onderhandelingen met Elsevier Science, Wiley en Springer/Kluwer over de verlenging van de zogenaamde pakketlicenties. Zoals de meesten bekend is, zijn de faculteiten en de UB sinds 2000/2001 geabonneerd

  12. Dielectric properties of Na1–xKxNbO3 in orthorhombic phase

    Indian Academy of Sciences (India)

    Unknown

    methyl alcohol. The mixture was calcined in a platinum crucible, in air, at 950°C for 1 h. The calcined materials were weighed to ensure complete carbonate removal. The calcined ... Observed frequency dependence of dielectric constant and dielectric loss ... Temperature dependence of loss tangent in NaNbO3, at different ...

  13. ORF Alignment: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Thermococcus kodakaraensis KOD1] ... Length = 108 ... Query: 1 ... MELYDVDEFWKFDLRVGLVKRAEKLKRTRKL...ing protein [Thermococcus kodakaraensis KOD1] ... ref|YP_182652.1| putative tRNA-binding protein ... ...IKLDVDFGGEERTVITGIADQYSPEELEG 60 ... MELYDVDEFWKFDLRVGLVKRAEKLKRTRKLIKLDVD...FGGEERTVITGIADQYSPEELEG Sbjct: 1 ... MELYDVDEFWKFDLRVGLVKRAEKLKRTRKLIKLDVDFGGEERTVITGIADQYSPEELEG 60 ...

  14. Electrical and magnetic properties of (BiNa)1/2(FeV)1/2O3

    Indian Academy of Sciences (India)

    BNT) (Hosono et al 2001) is consi- dered to be one of the promising candidates ... at different temperatures. The sintered pellets were polished by a fine emery paper to make both the faces flat and para- llel. For electrical characterization, the flat ...

  15. Natriumgevoeligheid en recirculatie bij Cymbidium. Tussenrapport na 1e teeltjaar : Behoud plantgezondheid en voorkomen groeiremming bij hergebruik drainwater

    NARCIS (Netherlands)

    Kromwijk, J.A.M.; Voogt, W.

    2015-01-01

    In the Netherlands, the government and horticultural industry have agreed to lower the emission of nutrients to the environment. Until recently no drain water was reused in the cultivation of Cymbidium orchids as growers were allowed to discharge the drain water when a sodium level of more than 0

  16. Identification of new polymorphic microsatellite markers in the NA1 and NA2 lineages of Phytophthora ramorum

    Science.gov (United States)

    A. Vercauteren; M. Larsen; E. Goss; N. Grunwald; M. Maes; K. Heungens

    2011-01-01

    Phytophthora ramorum is a recently introduced pathogen in Europe and North America consisting of three clonal lineages. Due to the limited intralineage genetic variation, only a few polymorphic markers are available for use in studies involving the epidemiology and evolution of P. ramorum. A total of 159 primer pairs for...

  17. Diagnostika sociálního klimatu třídy na 1. stupni ZŠ

    OpenAIRE

    SUCHNOVÁ, Martina

    2008-01-01

    The work deals with the diagnostics of social climate of a classroom at Primary School. The theoretical part characterizes basic concepts, which form the social climate of a classroom: school role, environment, classroom climate and atmosphere, peculiarity of a teacher and pupils, positive classroom climate, problems in classroom climate and the methodology of investigation. The practical part contains an empirical research that was realised at one-room Primary School. ``My Class Inventory{\\c...

  18. Electrical and microstructural properties of CaTiO3-doped K1/2Na1 ...

    Indian Academy of Sciences (India)

    suggest that KNN doped with 0·55 mol% of CTO would be a good candidate for ferroelectric devices. Acknowledgements. The authors are grateful to CONICET and ANCyPT. (Argentina) and to CNPq and FAPESP (Brasil) for the financial support provided for this research. References. Alkoy E M and Papila M 2010 Ceram.

  19. Electrical and magnetic properties of (BiNa)1/2(FeV)1/2O3

    Indian Academy of Sciences (India)

    Electrical properties were investigated in a frequency range (1 kHz–1 MHz) by complex impedance spectroscopy (CIS) technique. The material showed negative temperature coefficient of resis- tance (NTCR) reflecting semiconductor behaviour. A.C. conductivity was found to obey Johnscher's law. Conducti- vity mechanism ...

  20. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641467 >gi|57641467|ref|YP_183945.1| SSU ribosomal protein S17P [Thermococcus kodakarae...nsis KOD1] MREIGLRVQPPAEVCNDPKCPWHGNLKIHGRYVEGIVVSDKGKKTVVVERQYYHYLKKYERYELRKSKVHAHNPECINAKVGDKVLIAETRPISKTKSWVVVAVLQRAERAEEV

  1. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640234 >gi|57640234|ref|YP_182712.1| hypothetical protein TK0299 [Thermococcus kodakarae...nsis KOD1] MEGGREKPSVRAGSEELLFEVLKEGLFWAALGRPSEVMPFLRGKLLGNGFSPKAKEELQWLLDQLEKYYSHVAASGRVEERHLRAIKSFYRDIVVVLSVERAEF

  2. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640908 >gi|57640908|ref|YP_183386.1| hypothetical protein TK0973 [Thermococcus kodakarae...nsis KOD1] MAVISVRIPDELKAKMKELDINWSEEIRKFIEERVLRAEKQKKLDEIHRLLSGGTPADEGTARKYVRDDRDSN

  3. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641662 >gi|57641662|ref|YP_184140.1| hypothetical protein TK1727 [Thermococcus kodakarae...nsis KOD1] MGKEERTVIENSPSFQYLLRFASDIGGGLKFISLEKDAYNIRENDIIVCFGDESKKRAEYLKKVLKYPIEIHSILEIIERYETNANGV

  4. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640317 >gi|57640317|ref|YP_182795.1| hypothetical protein TK0382 [Thermococcus kodakarae...nsis KOD1] MSVWGWLLGFLLLGAILSILYDILFRPWKLVREGINDLERQLKLLDGRFARLRSFIIAPWLWGDVERTRTFVSHKLALKRAELELFEKLKGGGE

  5. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57641941 >gi|57641941|ref|YP_184419.1| hypothetical protein TK2006 [Thermococcus kodakarae...nsis KOD1] MSEAVNPKLYSIEKLLEDKDKRLLVSEVVLKLAEALGVTVEDFLGYMEWKENMGKLERAEKEAQIPESIPVEFPTEDAPEGLEEALNEIEEDIQKWQKIERRLKEMGLEL

  6. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640253 >gi|57640253|ref|YP_182731.1| hypothetical protein TK0318 [Thermococcus kodakarae...nsis KOD1] MVEIPEVEELKALLNELGEEGLLERLDAFVRMNGGLESKRGEDFIKVSILGFAEGLLTVLKEKYDEPRVKELYEKIKAKRAELDEQFRKPRIPYLEEEG

  7. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640245 >gi|57640245|ref|YP_182723.1| hypothetical protein TK0310 [Thermococcus kodakarae...nsis KOD1] MLEKSEMVRSYEILDYKEGSDFYFLKIRAELIDGSVLHIREFVSNEEYNYSFQWQRDSELIIRWDNAPHHKDLPTFPHHKHVGSEKNVLPSSEITLEEVLGVISSYIQNP

  8. ORF Sequence: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available NC_006624 gi|57640174 >gi|57640174|ref|YP_182652.1| putative tRNA-binding protein [Thermococcus kodakarae...nsis KOD1] MELYDVDEFWKFDLRVGLVKRAEKLKRTRKLIKLDVDFGGEERTVITGIADQYSPEELEGKKFVFVLNLKPKKLSGVESQGMLIVAETEDGKVYLLPVPEEVPVGTRVW

  9. ORF Alignment: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... [Thermococcus kodakaraensis KOD1] ... Length = 243 ... Query: 5 ... VVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAM...DPSRVVLIDLNLPESIFSKYEVE 64 ... VVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAMDP...SRVVLIDLNLPESIFSKYEVE Sbjct: 1 ... VVFDGAKEFADLIATASNLIDEAAFKFTEEGISMRAMDPSRVVLIDLNLPESIFSKYEVE 60 ... Query: 125

  10. Review of anticancer and antioxidant activities of radioresistant ...

    African Journals Online (AJOL)

    electromagnetic or corpuscular). Chroococcidiopsis sp., Deinococcus radiodurans, Rubrobacter radiotolerans, and Thermococcus gammatolerans are examples of radioresistant microorganisms with the ability to survive and grow under high ...

  11. ORF Alignment: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ... cofactor-binding protein [Thermococcus kodakaraensis ... KOD1] ... Length = 102 ... Query: 3 ... IALPVDEDLGLESPM...SGHFGRARYFAFVDVEDGEIRGVEVVPVPFEEHGPGDLPNFIKEH 62 ... IALPVDEDLGLESPM...SGHFGRARYFAFVDVEDGEIRGVEVVPVPFEEHGPGDLPNFIKEH Sbjct: 1 ... IALPVDEDLGLESPMSGHFGRARYFAFVDVEDGEIRGVEVVPVPFEEHGPGDLPNFIKEH 60 ...

  12. ORF Alignment: NC_006624 [GENIUS II[Archive

    Lifescience Database Archive (English)

    Full Text Available ein L18E [Thermococcus kodakaraensis KOD1] ... ref|YP_183915.1| LSU ribosomal protein L18E ... [Thermococcus kodakarae...nsis KOD1] ... Length = 113 ... Query: 8 ... TDINLRRLIRTLRKKSNEEGVKIWKDIAWRLERPRRQRAE...VNISKINRYTKEGDVVIVPG 67 ... TDINLRRLIRTLRKKSNEEGVKIWKDIAWRLERPRRQRAEVNI...SKINRYTKEGDVVIVPG Sbjct: 1 ... TDINLRRLIRTLRKKSNEEGVKIWKDIAWRLERPRRQRAEVNISKINRYTKEGDVVIVPG 60 ...

  13. CA2+ AND ZN2+ ARE TRANSPORTED BY THE ELECTROGENIC 2NA+/1H+ ANTIPORTER IN ECHINODERM GASTROINTESTINAL EPITHELIUM. (R823068)

    Science.gov (United States)

    The perspectives, information and conclusions conveyed in research project abstracts, progress reports, final reports, journal abstracts and journal publications convey the viewpoints of the principal investigator and may not represent the views and policies of ORD and EPA. Concl...

  14. Multifocal atrial and ventricular premature contractions with an increased risk of dilated cardiomyopathy caused by a Na1.5 gain-of-function mutation (G213D)

    DEFF Research Database (Denmark)

    Calloe, Kirstine; Broendberg, Anders K; Christensen, Alex H

    2018-01-01

    of the Nav1.5 protein, resulting in a glycine to aspartate substitution at position 213 (G213D). The phenotype co-segregated with the missense mutation. Electrophysiological studies of wild type (WT) hNav1.5 and hNav1.5_G213D expressed in CHO-K cells showed that the voltage of half-maximal activation (V...

  15. Projektová výuka na 1. stupni ZŠ v kontextu regionálního muzea Jana Amose Komenského v Komni

    OpenAIRE

    Šašinková, Miroslava

    2014-01-01

    The thesis Project teaching at 1st grade of primary school in the context of regional museum John Amos Comenius, deals with linking subject matter of John Amos Comenius and project teaching, and utilizes the facilities of John Amos Comenius Memorial in Komňa. In the theoretical part are analysed information about the project method, its implementation in the teaching process, the importance and difficulties. The key part is the practical one, which is devoted to the design and realization of ...

  16. Dramatická hra ve výuce výtvarné výchovy na 1.stupni ZŠ

    OpenAIRE

    Málková, Vlasta

    2010-01-01

    Diploma thesis "Dramatic game in the basic school art education" deal the dramatic elements to improve completing the intentions of art education in a middle school. It inqiures into the art and dramatic culture definite and afterwards their cross connection into the art-dramatic concept. It is designated to anybody who would like to use this style of the art education in one's own pedagogical classwork. This thesis contains the artconsecution concept.

  17. Tělesná zdatnost a pohybová aktivita studentů zubního lékařství na 1. LF UK

    OpenAIRE

    Leger, Aleš

    2013-01-01

    This thesis deals with a question of physical fitness and physical regime of first-year dental students at the Charles University in Prague, First Faculty of Medicine. Results of a research on physical fitness and physical regime of first-year students of physical education on Faculty of Education of the Charles University will serve us as a comparision. Furthermore, this thesis analyzes to what extent the dentistry students are acquainted with difficulties of their profession, whether they k...

  18. Podmínky pro utváření klíčových kompetencí žáků na 1. stupni ZŠ

    OpenAIRE

    MUDROVÁ, Lenka

    2009-01-01

    The diploma work deals with formation and development of the key competencies with the pupils in primary schools focusing on communicative competency both in school environment and in extracurricular activities. The theoretical part gives insight into the basic idea of key competencies, a part of its history and its significance from the general point of view. The key competencies are defined and the concept of communicative competence is analyzed in this part. The theoretical part includes o...

  19. Progresso científico em equideocultura na 1ª década do século XXI Scientific progress in equine production at 1st decade of the XXI century

    Directory of Open Access Journals (Sweden)

    Fernando Queiroz de Almeida

    2010-07-01

    Full Text Available No Brasil, como nos demais países, os investimentos em pesquisa com equinos estão relacionados às perspectivas dos segmentos da indústria equina no país. Este trabalho foi conduzido com o objetivo de revisar a literatura corrente com a perspectiva de avaliar o recente desenvolvimento científico e tecnológico na produção de equídeos. As pesquisas estão relacionadas às diversas áreas da equideocultura, como produção e manejo, genética e melhoramento, nutrição e alimentação, reprodução, medicina e cirurgia, doenças, sanidade e defesa sanitária. Há ainda pesquisas em áreas relacionadas ao hipismo, envolvendo fisiologia esportiva, equitação e treinamento de equinos e também, além de estudos sobre o comércio nacional e internacional de equinos. Considerando todas as áreas da equideocultura, o maior número de artigos publicados está relacionado às áreas da medicina e cirurgia e doenças e sanidade. Na área da Zootecnia, predominam as publicações de artigos associados à nutrição e alimentação dos equinos. No entanto, deve-se considerar que os interesses do agronegócio do cavalo, das associações de criadores, dos governos e da sociedade em geral influenciam as pesquisas e, consequentemente, as publicações dos artigos e trabalhos técnicos sobre equídeos.In Brazil, as in other countries, investments in research with horses are related to the objectives of the equine industry in the country. This study aimed to review the current literature with the purpose of assessing the latest scientific and technological development in horse's production. Researchers are related to many areas as in production and management, genetics and breeding, nutrition and feeding, reproduction, medicine and surgery, diseases and health protection. There is still research in areas related to equestrian sports, involving equine exercise physiology, riding and training horses and also studies on national and international equine trade. Considering all areas of interest of horse production the largest number of published articles is related to the medicine and surgery and diseases and health. In Animal Science, the largest number of articles is related to nutrition and feeding of horses. However, must be consider that interests of agribusiness, horse's breeders associations, governments and society in general, influence the research and consequently the publication of papers about horses.

  20. Diagnostika vybraných didaktických pojmů v sémantickém prostoru studentů učitelství a učitelů na 1. stupni ZŠ

    OpenAIRE

    KUBÍČKOVÁ, Eva

    2009-01-01

    This diploma work raises the issues and subsequently the diagnostics of preconcepts for didactic concepts of students of teaching and primary school teachers. The aim of this work was to find out to what extent the perception of some chosen didactic concepts are related comparing students of pedagogical faculty and primary school teachers. The theoretical part aims to the technical definition of the semantic differential research method and definition of the concepts involved in the research....

  1. Postavení atletiky ve školním vzdělávacím programu na 1.stupni základní školy

    OpenAIRE

    Šašková, Veronika

    2014-01-01

    On the basis of the analysis of school educational programmes and as well based on the statements I gained from the teachers I'm trying to find out and verify the representation of athletics in first five years of primary schools. Title of diploma thesis: The position of athletics in the school curricula in the first five years of primary school Student: Veronika Šašková Supervisor: Mgr. Zdeňka Engelthalerová Objective of the work: Determine the position of athletics in first five years of pr...

  2. Vyučování geometrie na 1. stupni základní školy s využitím interaktivní tabule a programu dynamické geometrie - GeoGebra

    OpenAIRE

    MENTLÍKOVÁ, Linda

    2011-01-01

    The diploma thesis consist of three parts. The first part is composed of theory of geometry, sumary basic geometrical concepts in subject-matter for elementary school, situate Math to educate programme and importance teaching with computer today. The second part I wrote as manual referenc book for teacher, who will teach according to my material. Last part describe experiment, which I make in 4. class of basic school. The third part describes pupils work witk programmes SMART Notebook and Geo...

  3. Directed evolution of a thermostable l-aminoacylase biocatalyst

    DEFF Research Database (Denmark)

    Parker, Brenda M.; Taylor, Ian N.; Woodley, John

    2011-01-01

    Enzymes from extreme environments possess highly desirable traits of activity and stability for application under process conditions. One such example is l-aminoacylase (E.C. 3.5.1.14) from Thermococcus litoralis (TliACY), which catalyzes the enantioselective amide hydrolysis of N-protected l-ami...

  4. Gene cloning and characterization of NADH oxidase from ...

    African Journals Online (AJOL)

    The genome search of Thermococcus kodakarensis revealed three open reading frames, Tk0304, Tk1299 and Tk1392 annotated as nicotinamide adenine dinucleotide (NADH) oxidases. This study deals with cloning, and characterization of Tk0304. The gene, composed of 1320 nucleotides, encodes a protein of 439 ...

  5. Integration of biohydrogen fermentation and gas separation processes to recover and enrich hydrogen

    NARCIS (Netherlands)

    Bélafi-Bakó, K.; Búcsú, D.; Pientka, Z.; Bálint, B.; Herbel, Z.; Kovács, K.I.; Wessling, Matthias

    2006-01-01

    An integrated system for biohydrogen production and separation was designed, constructed and operated where biohydrogen was fermented by Thermococcus litoralis, a heterotrophic archaebacterium, and a two-step gas separation process was coupled to recover and concentrate hydrogen. A special liquid

  6. Tvořivě výrazové aktivity ve výuce na 1.st. ZŠ (se zaměřením na výtvarnou výchovu jako integrující disciplínu)

    OpenAIRE

    Picmausová, Daniela

    2013-01-01

    Karlova Univerzita Pedagogická fakulta Katedra výtvarné výchovy ved. práce: PaedDr. Hazuková Helena Vypracovala: Picmausová Daniela, 5 KS Abstrakt v Aj: Thesis should contribute to the development of teaching competence of teachers at elementary school. Specifically, it could be a guide in planning of teaching of art design education in the form of integrated learning units, since it contains methods and activities which are needed to develop a creativity and expression. This thesis uses a po...

  7. Estudo comparativo entre três volumes de Ropivacaína 1mg-mL e Sufentanil 0,25mcg-mL por via epidural em bolus intermitentes e sua relação com a duração da analgesia durante o trabalho de parto

    OpenAIRE

    Pereira, Luciano Duarte Pires

    2013-01-01

    Dissertação de mestrado em Farmacologia Aplicada, apresentada à Faculdade de Farmácia da Universidade de Coimbra. Objectivos: A técnica de bolus epidurais intermitentes programados, como técnica de manutenção mais recente da analgesia epidural no trabalho de parto, reduz a duração do segundo estadio e a administração de anestésicos locais, aumenta a satisfação materna e possivelmente reduz a taxa de parto instrumentalizado. No entanto, os volumes e intervalos de fármacos administrados pode...

  8. Cristallogenèse et caractérisations du diphosphate Na2ZnP2O7 pur et dopé et de la solution solide de type pérovskite Na(1x)BaxNb(1x)TixO3

    OpenAIRE

    Gacem , Lakhdar

    2010-01-01

    Thèse en cotutelle entre L'Université Mohamed KHIDER de Biskra et L'Université de Bordeaux 1; The physical properties of a material are intimately related to its crystalline structure and in the case of doped ions they are dependent on to the sites they occupy. The first part of this work is dedicated to the diphosphate material of sodium and zinc Na2ZnP2O7, glassy and crystallized for doped ions of Co2+, Ni2+, Mn2+ and Eu3+. The crystallized phases were obtained by the Czochralski method whe...

  9. Scientific progress in ruminant production in the 1st decade of the XXI century Avanços científicos na produção de ruminantes na 1ª década do século XXI

    Directory of Open Access Journals (Sweden)

    Geraldo Tadeu dos Santos

    2010-07-01

    Full Text Available Scientific advances in nutrition of dairy cows in the first decade of the XXI century have occurred. This paper will review the most common additives fed to transition cows to decrease the incidence of metabolic disorders, which will be discussed separately with emphasis on their mechanisms of action, utilization and efficiency. Some changes on protein in the 2001 updated version of the Nutrient Requirements of Dairy Cattle to reach better precision of the nitrogen and amino acid requirements of lactating cows also are presented. Many of the advances in nutritional manipulation of milk fat concentration are related to fat supplementation, then the relationship between the action of rumen microbes on biohydrogenation of dietary polyunsaturated fatty acids and milk fatty acid profile are discussed as well as the main factors identified as being responsible for milk fat depression.Avanços científicos em nutrição de vacas leiteiras têm ocorrido na primeira década do século XXI. Desta forma, este artigo abordará os principais aditivos utilizados na alimentação de vacas leiteiras no período de transição, empregados com o objetivo de diminuir a incidência de distúrbios metabólicos, na qual serão discutidos separadamente com ênfase em seus mecanismos de ação, utilização e eficácia. A partir da versão atualizada do NRC de 2001 serão abordadas algumas modificações na utilização de proteína com intuito de alcançar de forma precisa as exigências em nitrogênio e aminoácidos para vacas leiteiras. Além disso, observa-se que os principais avanços em manipular a gordura do leite estão relacionados com a suplementação lipídica na dieta, então, discutir-se-ão estudos sobre manipulação do perfil de ácidos graxos do leite na qual dependem da ação dos microrganismos ruminais sobre os ácidos graxos poli-insaturados da dieta, e também, os principais fatores relacionados à diminuição da gordura do leite.

  10. High protein flexibility and reduced hydration water dynamics are key pressure adaptive strategies in prokaryotes

    KAUST Repository

    Martinez, N.

    2016-09-06

    Water and protein dynamics on a nanometer scale were measured by quasi-elastic neutron scattering in the piezophile archaeon Thermococcus barophilus and the closely related pressure-sensitive Thermococcus kodakarensis, at 0.1 and 40 MPa. We show that cells of the pressure sensitive organism exhibit higher intrinsic stability. Both the hydration water dynamics and the fast protein and lipid dynamics are reduced under pressure. In contrast, the proteome of T. barophilus is more pressure sensitive than that of T. kodakarensis. The diffusion coefficient of hydration water is reduced, while the fast protein and lipid dynamics are slightly enhanced with increasing pressure. These findings show that the coupling between hydration water and cellular constituents might not be simply a master-slave relationship. We propose that the high flexibility of the T. barophilus proteome associated with reduced hydration water may be the keys to the molecular adaptation of the cells to high hydrostatic pressure.

  11. High protein flexibility and reduced hydration water dynamics are key pressure adaptive strategies in prokaryotes

    Science.gov (United States)

    Martinez, N.; Michoud, G.; Cario, A.; Ollivier, J.; Franzetti, B.; Jebbar, M.; Oger, P.; Peters, J.

    2016-09-01

    Water and protein dynamics on a nanometer scale were measured by quasi-elastic neutron scattering in the piezophile archaeon Thermococcus barophilus and the closely related pressure-sensitive Thermococcus kodakarensis, at 0.1 and 40 MPa. We show that cells of the pressure sensitive organism exhibit higher intrinsic stability. Both the hydration water dynamics and the fast protein and lipid dynamics are reduced under pressure. In contrast, the proteome of T. barophilus is more pressure sensitive than that of T. kodakarensis. The diffusion coefficient of hydration water is reduced, while the fast protein and lipid dynamics are slightly enhanced with increasing pressure. These findings show that the coupling between hydration water and cellular constituents might not be simply a master-slave relationship. We propose that the high flexibility of the T. barophilus proteome associated with reduced hydration water may be the keys to the molecular adaptation of the cells to high hydrostatic pressure.

  12. New trends in bio/nanotechnology: stable proteins as advanced molecular tools for health and environment.

    Science.gov (United States)

    Staiano, M; Baldassarre, M; Esposito, M; Apicella, E; Vitale, R; Aurilia, V; D'Auria, S

    2010-01-01

    In this work the thermophilic trehalose/maltose-binding protein from Thermococcus litoralis is presented as a probe for the design of a high stable fluorescence biosensor for glucose. In particular, we show the possibility of modulating the protein specificity by changing temperature. In addition to glucose sensing, we also report on the possibility of utilizing odorant-binding proteins as a probe for the development of optical sensors for analytes of environmental interests.

  13. A possible biochemical missing link among archaebacteria

    Science.gov (United States)

    Achenbach-Richter, Laurie; Woese, Carl R.; Stetter, Karl O.

    1987-01-01

    The characteristics of the newly discovered strain of archaebacteria, VC-16, the only archaebacterium known to reduce sulfate, suggest that VC-16 might represent a transitional form between an anaerobic thermophilic sulfur-based type of metabolism and methanogenesis. It is shown here, using a matrix of evolutionary distances derived from an alignment of various archaebacterial 16S rRNAs and the phylogenetic tree derived from these evolutionary distances, that the lineage represented by strain VC-16 arises from the archaebacterial tree precisely where such an interpretation would predict that it would, between the Methanococcus lineage and that of Thermococcus.

  14. Integration of biohydrogen fermentation and gas separation processes to recover and enrich hydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Belafi-Bako, K.; Bucsu, D. [Research Institute of Chemical and Process Engineering, University of Veszprem, Egyetem u. 2., 8200 Veszprem (Hungary); Pientka, Z. [Institute of Macromolecular Chemistry, Czech Academy of Sciences, Heyrovsky sq. 2., Prague (Czech Republic); Balint, B.; Herbel, Z.; Kovacs, K.L. [Department of Biotechnology and Institute of Biophysics, Biological Research Center, Hungarian Academy of Sciences, University of Szeged, Temesvari krt. 62., 6726 Szeged (Hungary); Wessling, M. [Membrane Technology Group, University of Twente, P.O. Box 217, 7500 AE Enschede (Netherlands)

    2006-09-15

    An integrated system for biohydrogen production and separation was designed, constructed and operated where biohydrogen was fermented by Thermococcus litoralis, a heterotrophic archaebacterium, and a two-step gas separation process was coupled to recover and concentrate hydrogen. A special liquid seal system was built to deliver, compress and collect the laboratory scale, low volume gas mixtures consisting of hydrogen, nitrogen and carbon dioxide. As a result, gas mixture with 73% high hydrogen content was produced by a combination of a porous and a non-porous gas separation membrane. (author)

  15. Stress management skills in the subsurface: H2 stress on thermophilic heterotrophs and methanogens

    Science.gov (United States)

    Topcuoglu, B. D.; Holden, J. F.

    2017-12-01

    Marine hyperthermophilic heterotrophs and methanogens belonging to the Thermococcales and Methanococcales are often found in subsurface environments such as coal and shale beds, marine sediments, and oil reservoirs where they encounter H2 stress conditions. It is important to study the H2 stress survival strategies of these organisms and their cooperation with one another for survival to better understand their biogeochemical impact in hot subsurface environments. In this study, we have shown that H2 inhibition changed the growth kinetics and the transcriptome of Thermococcus paralvinellae. We observed a significant decrease in batch phase growth rates and cell concentrations with high H2 background. Produced metabolite production measurements, RNA-seq analyses of differentially expressed genes and in silico experiments we performed with the T. paralvinellae metabolic model showed that T. paralvinellae produces formate by a formate hydrogenlyase to survive H2 inhibition. We have also shown that H2 limitation caused a significant decrease in batch phase growth rates and methane production rates of the methanogen, Methanocaldococcus jannaschii. H2 stress of both organisms can be ameliorated by syntrophic growth. H2 syntrophy was demonstrated in microcosm incubations for a natural assemblage of Thermococcus and hyperthermophilic methanogens present in hydrothermal fluid samples. This project aims to describe how a hyperthermophilic heterotroph and a hyperthermophilic methanogen eliminate H2 stress and explore cooperation among thermophiles in the hot subsurface.

  16. An in vitro synthetic biology platform for the industrial biomanufacturing of myo-inositol from starch.

    Science.gov (United States)

    You, Chun; Shi, Ting; Li, Yunjie; Han, Pingping; Zhou, Xigui; Zhang, Yi-Heng Percival

    2017-08-01

    Myo-Inositol (vitamin B8) is widely used in the drug, cosmetic, and food & feed industries. Here, we present an in vitro non-fermentative enzymatic pathway that converts starch to inositol in one vessel. This in vitro pathway is comprised of four enzymes that operate without ATP or NAD + supplementation. All enzyme BioBricks are carefully selected from hyperthermophilic microorganisms, that is, alpha-glucan phosphorylase from Thermotoga maritima, phosphoglucomutase from Thermococcus kodakarensis, inositol 1-phosphate synthase from Archaeoglobus fulgidus, and inositol monophosphatase from T. maritima. They were expressed efficiently in high-density fermentation of Escherichia coli BL21(DE3) and easily purified by heat treatment. The four-enzyme pathway supplemented with two other hyperthermophilic enzymes (i.e., 4-α-glucanotransferase from Thermococcus litoralis and isoamylase from Sulfolobus tokodaii) converts branched or linear starch to inositol, accomplishing a very high product yield of 98.9 ± 1.8% wt./wt. This in vitro (aeration-free) biomanufacturing has been successfully operated on 20,000-L reactors. Less costly inositol would be widely added in heath food, low-end soft drink, and animal feed, and may be converted to other value-added biochemicals (e.g., glucarate). This biochemical is the first product manufactured by the in vitro synthetic biology platform on an industrial scale. Biotechnol. Bioeng. 2017;114: 1855-1864. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.

  17. Physiological and molecular studies of the resistance to ionizing radiations of hyper-thermophilic archaea isolated from deep ocean hydrothermal sources

    International Nuclear Information System (INIS)

    Jolivet, E.

    2002-10-01

    In this study, we have first tested in vivo the effect of gamma irradiation on Pyrococcus abyssi, a hyper-thermophilic archaeon, isolated from a deep-sea hydrothermal vent. We have shown that this strain was as radioresistant as P. furiosus but less than Deinococcus radiodurans. The rates of double stranded breaks provoked into DNA following irradiation were monitored by the pulsed-field gel electrophoresis technique (P.F.G.E.) with P. abyssi, P. furiosus, D. radiodurans and Escherichia coli. Results clearly showed that all these rates were similar suggesting that no specific DNA protection system exits in Pyrococcus species. The growth of P. abyssi was efficiently recovered within two hours following the exposure to 2.5 kGy of gamma irradiation. As revealed by P.F.G.E., genomic DNA of P. abyssi totally fragmented after irradiation was efficiently restored within two hours presumably by inter chromosomal homologous recombination. The DNA replication in P. abyssi cells following irradiation at 2.5 kGy was blocked for 90 minutes that corresponds to the decay for repairing damaged DNA. Moreover, following irradiation P. abyssi actively expulse damaged DNA material before DNA replication resumes, preventing the amplification of genetic mutations. We have also showed that at least a subset cf P. abyssi DNA repair and replication proteins, such as RadA, RPA-41 and RFC-S. were constitutively expressed in chromatin bound forms in stationary phase cells. Our results were in agreement with the view that P. abyssi contains a very efficient DNA repair system, which is continuously ready to counteract the DNA damaged caused by the high temperature and/or ionizing radiation. For the first time, three novel hyper-thermophilic archaea species from deep-sea hydrothermal vents more radioresistant than P. abyssi were isolated and characterized, after 'y-irradiation exposures of some enrichment cultures. Thermococcus marinus, Thermococcus radiophilus and Thermococcus gammafolerans

  18. Characterization of protein interactomes of DNA damages: application to oxidation injuries

    International Nuclear Information System (INIS)

    Pietras-Barbier, Ewa

    2013-01-01

    Cyclo-nucleosides are complex DNA damages implying both bases and sugar residues. They are generated by free radicals, in particular by the effect of ionizing radiations, and are not easily covered by cellular mechanisms. Using a protein trapping technique on probes containing these injuries, the negative influence of cyclo-nucleosides on the recognition of its target sequence by a DREF transcription factor and on the interactions of PARP1 with DNA have been identified. Interactions between Fpg bacterial glycosylase and cyclo-nucleosides have been analysed and it has been found that this enzyme has an affinity for them, without excision activity. Finally, a Thermococcus gammatolerans radiation resistant archae has been studied: the formation of simple and complex oxidation injuries at strong radiation doses has been measured and the action mechanism of two new glycosylases has been explained. (author) [fr

  19. Characterization of technetium(vII) reduction by cell suspensions of thermophilic bacteria and archaea.

    Science.gov (United States)

    Chernyh, Nikolay A; Gavrilov, Sergei N; Sorokin, Vladimir V; German, Konstantin E; Sergeant, Claire; Simonoff, Monique; Robb, Frank; Slobodkin, Alexander I

    2007-08-01

    Washed cell suspensions of the anaerobic hyperthermophilic archaea Thermococcus pacificus and Thermoproteus uzoniensis and the anaerobic thermophilic gram-positive bacteria Thermoterrabacterium ferrireducens and Tepidibacter thalassicus reduced technetium [(99)Tc(VII)], supplied as soluble pertechnetate with molecular hydrogen as an electron donor, forming highly insoluble Tc(IV)-containing grayish-black precipitate. Apart from molecular hydrogen, T. ferrireducens reduced Tc(VII) with lactate, glycerol, and yeast extract as electron donors, and T. thalassicus reduced it with peptone. Scanning electron microscopy and X-ray microanalysis of cell suspensions of T. ferrireducens showed the presence of Tc-containing particles attached to the surfaces of non-lysed cells. This is the first report on the reduction in Tc(VII) by thermophilic microorganisms of the domain Bacteria and by archaea of the phylum Euryarchaeota.

  20. γ-irradiation resistance and UV-sensitivity of extremely thermophilic archebacteria and eubacteria

    International Nuclear Information System (INIS)

    Kopylov, V.M.; Bonch-Osmolovskaya, E.A.; Svetlichnyi, V.A.; Miroshnichenko, M.L.; Skobkin, V.S.

    1993-01-01

    Cells of extremely thermophilic sulfur-dependent archebacteria Desulfurococcus amylolyticus Z533 and Thermococcus stelleri K15 are resistant to γ-irradiation. These archebacteria survive γ-irradiation at a dose of up to 5 kGy but are no longer viable after 8-9 kGy. Comparison of the survival profiles showed that archebacteria are 12 to 25 times more resistant to γ-irradiation at moderate doses (LD 50 and LD 90 ) than E. coli K12 but are 2 to 2.5 times more sensitive than D. radiodurans. γ-irradiation at a dose of 1 to 2.5 kGy killed extremely thermophilic anaerobic eubacteria Thermotoga maritima 2706 and Thermodesulfobacterium P. All extreme thermophiles studied were more sensitive to UV-irradiation than E. coli

  1. Utilization of keratin-containing biowaste to produce biohydrogen

    Energy Technology Data Exchange (ETDEWEB)

    Balint, B.; Rakhely, G.; Kovacs, K.L. [Szeged Univ. (Hungary). Dept. of Biotechnology; Hungarian Academy of Sciences, Szeged (Hungary). Inst. of Biophysics; Bagi, Z.; Perei, K. [Szeged Univ. (Hungary). Dept. of Biotechnology; Toth, A. [Hungarian Academy of Sciences, Szeged (Hungary). Inst. of Biophysics

    2005-12-01

    A two-stage fermentation system was constructed to test and demonstrate the feasibility of biohydrogen generation from keratin-rich biowaste. We isolated a novel aerobic Bacillus strain (Bacillus licheniformis KK1) that displays outstanding keratinolytic activity. The isolated strain was employed to convert keratin-containing biowaste into a fermentation product that is rich in amino acids and peptides. The process was optimized for the second fermentation step, in which the product of keratin fermentation-supplemented with essential minerals-was metabolized by Thermococcus litoralis, an anaerobic hyperthermophilic archaeon. T. litoralis grew on the keratin hydrolysate and produced hydrogen gas as a physiological fermentation byproduct. Hyperthermophilic cells utilized the keratin hydrolysate in a similar way as their standard nutrient, i.e., bacto-peptone. The generalization of the findings to protein-rich waste treatment and production of biohydrogen is discussed and possible means of further improvements are listed. (orig.)

  2. Single-molecule fluorescence polarization study of conformational change in archaeal group II chaperonin.

    Directory of Open Access Journals (Sweden)

    Ryo Iizuka

    Full Text Available Group II chaperonins found in archaea and in eukaryotic cytosol mediate protein folding without a GroES-like cofactor. The function of the cofactor is substituted by the helical protrusion at the tip of the apical domain, which forms a built-in lid on the central cavity. Although many studies on the change in lid conformation coupled to the binding and hydrolysis of nucleotides have been conducted, the molecular mechanism of lid closure remains poorly understood. Here, we performed a single-molecule polarization modulation to probe the rotation of the helical protrusion of a chaperonin from a hyperthermophilic archaeum, Thermococcus sp. strain KS-1. We detected approximately 35° rotation of the helical protrusion immediately after photorelease of ATP. The result suggests that the conformational change from the open lid to the closed lid state is responsible for the approximately 35° rotation of the helical protrusion.

  3. Effect of nitrate addition on prokaryotic diversity and the activity of sulfate-reducing prokaryotes in high-temperature oil production systems

    DEFF Research Database (Denmark)

    Gittel, Antje; Wieczorek, Adam; Sørensen, Ketil

    Adding nitrate to injection water is a possible strategy to control the activity of sulfate-reducing prokaryotes (SRP) in oil production system. To assess the effects of nitrate addition, prokaryotic diversity (Bacteria, Archaea, SRP) and SRP activity were studied in the production waters...... of a nitrate-treated and a non-treated system. Comparative analyses of clone libraries indicated that troublesome prokaryotes were enriched at the non-treated site represented by both sulfate- and sulfur-reducing prokaryotes within the Bacteria (Deltaproteobacteria, Desulfotomaculum spp.) and Archaea...... (Archaeoglobus spp., Thermococcus spp.). In contrast, they were less frequently detected at the nitrate-treated site, whereas the abundance of potential nitrate reducers (Deferribacterales, Sulfurospirillum spp., Clostridia) and methanogens appeared to be stimulated. The presence of active SRP at the non...

  4. Bacterial and archaeal resistance to ionizing radiation

    International Nuclear Information System (INIS)

    Confalonieri, F; Sommer, S

    2011-01-01

    Organisms living in extreme environments must cope with large fluctuations of temperature, high levels of radiation and/or desiccation, conditions that can induce DNA damage ranging from base modifications to DNA double-strand breaks. The bacterium Deinococcus radiodurans is known for its resistance to extremely high doses of ionizing radiation and for its ability to reconstruct a functional genome from hundreds of radiation-induced chromosomal fragments. Recently, extreme ionizing radiation resistance was also generated by directed evolution of an apparently radiation-sensitive bacterial species, Escherichia coli. Radioresistant organisms are not only found among the Eubacteria but also among the Archaea that represent the third kingdom of life. They present a set of particular features that differentiate them from the Eubacteria and eukaryotes. Moreover, Archaea are often isolated from extreme environments where they live under severe conditions of temperature, pressure, pH, salts or toxic compounds that are lethal for the large majority of living organisms. Thus, Archaea offer the opportunity to understand how cells are able to cope with such harsh conditions. Among them, the halophilic archaeon Halobacterium sp and several Pyrococcus or Thermococcus species, such as Thermococcus gammatolerans, were also shown to display high level of radiation resistance. The dispersion, in the phylogenetic tree, of radioresistant prokaryotes suggests that they have independently acquired radioresistance. Different strategies were selected during evolution including several mechanisms of radiation byproduct detoxification and subtle cellular metabolism modifications to help cells recover from radiation-induced injuries, protection of proteins against oxidation, an efficient DNA repair tool box, an original pathway of DNA double-strand break repair, a condensed nucleoid that may prevent the dispersion of the DNA fragments and specific radiation-induced proteins involved in

  5. Two Strategies for Microbial Production of an Industrial Enzyme-Alpha-Amylase

    Science.gov (United States)

    Bernhardsdotter, Eva C. M. J.; Garriott, Owen; Pusey, Marc L.; Ng, Joseph D.

    2003-01-01

    Extremophiles are microorganisms that thrive in, from an anthropocentric view, extreme environments including hot springs, soda lakes and arctic water. This ability of survival at extreme conditions has rendered extremophiles to be of interest in astrobiology, evolutionary biology as well as in industrial applications. Of particular interest to the biotechnology industry are the biological catalysts of the extremophiles, the extremozymes, whose unique stabilities at extreme conditions make them potential sources of novel enzymes in industrial applications. There are two major approaches to microbial enzyme production. This entails enzyme isolation directly from the natural host or creating a recombinant expression system whereby the targeted enzyme can be overexpressed in a mesophilic host. We are employing both methods in the effort to produce alpha-amylases from a hyperthermophilic archaeon (Thermococcus) isolated from a hydrothermal vent in the Atlantic Ocean, as well as from alkaliphilic bacteria (Bacillus) isolated from a soda lake in Tanzania. Alpha-amylases catalyze the hydrolysis of internal alpha-1,4-glycosidic linkages in starch to produce smaller sugars. Thermostable alpha-amylases are used in the liquefaction of starch for production of fructose and glucose syrups, whereas alpha-amylases stable at high pH have potential as detergent additives. The alpha-amylase encoding gene from Thermococcus was PCR amplified using carefully designed primers and analyzed using bioinformatics tools such as BLAST and Multiple Sequence Alignment for cloning and expression in E.coli. Four strains of Bacillus were grown in alkaline starch-enriched medium of which the culture supernatant was used as enzyme source. Amylolytic activity was detected using the starch-iodine method.

  6. Sports-related concussion relevant to the South African rugby ...

    African Journals Online (AJOL)

    (NMDA) receptor leads to further neuronal depolarisation with efflux of potassium and influx of calcium. These ionic shifts lead to acute and subacute changes in cellular physiology. Acutely, in an effort to restore the neuronal membrane potential, the sodium-potassium. (Na1-K1) pump works overtime. The Na1-K1 pump ...

  7. Structure of the family B DNA polymerase from the hyperthermophilic archaeon Pyrobaculum calidifontis.

    Science.gov (United States)

    Guo, Jingxu; Zhang, Wenling; Coker, Alun R; Wood, Steve P; Cooper, Jonathan B; Ahmad, Shazeel; Ali, Syed; Rashid, Naeem; Akhtar, Muhummad

    2017-05-01

    The family B DNA polymerase from Pyrobaculum calidifontis (Pc-polymerase) consists of 783 amino acids and is magnesium-ion dependent. It has an optimal pH of 8.5, an optimal temperature of 75°C and a half-life of 4.5 h at 95°C, giving it greater thermostability than the widely used Taq DNA polymerase. The enzyme is also capable of PCR-amplifying larger DNA fragments of up to 7.5 kb in length. It was shown to have functional, error-correcting 3'-5' exonuclease activity, as do the related high-fidelity DNA polymerases from Pyrococcus furiosus, Thermococcus kodakarensis KOD1 and Thermococcus gorgonarius, which have extensive commercial applications. Pc-polymerase has a quite low sequence identity of approximately 37% to these enzymes, which, in contrast, have very high sequence identity to each other, suggesting that the P. calidifontis enzyme is distinct. Here, the structure determination of Pc-polymerase is reported, which has been refined to an R factor of 24.47% and an R free of 28.81% at 2.80 Å resolution. The domains of the enzyme are arranged in a circular fashion to form a disc with a narrow central channel. One face of the disc has a number of connected crevices in it, which allow the protein to bind duplex and single-stranded DNA. The central channel is thought to allow incoming nucleoside triphosphates to access the active site. The enzyme has a number of unique structural features which distinguish it from other archaeal DNA polymerases and may account for its high processivity. A model of the complex with the primer-template duplex of DNA indicates that the largest conformational change that occurs upon DNA binding is the movement of the thumb domain, which rotates by 7.6° and moves by 10.0 Å. The surface potential of the enzyme is dominated by acidic groups in the central region of the molecule, where catalytic magnesium ions bind at the polymerase and exonuclease active sites. The outer regions are richer in basic amino acids that

  8. A Ge-Si active target for the measurement of short lifetimes

    International Nuclear Information System (INIS)

    Amendolia, S.R.; Bedeschi, F.; Bertolucci, E.; Bettoni, D.; Bosisio, L.; Bradaschia, C.; Dell'Orso, M.; Fidecaro, F.; Foa, L.; Focardi, E.; Giannetti, P.; Giorgi, M.A.; Marrocchesi, P.S.; Menzione, A.; Ristori, L.; Scribano, A.; Tenchini, R.; Triggiani, G.; Tonelli, G.; Bologna, G.; D'Ettorre Piazzoli, B.; Mannocchi, G.; Picchi, P.; Consiglio Nazionale delle Ricerche, Turin; D'Angelo, P.; Manfredi, P.F.; Menasce, D.; Meroni, E.; Moroni, L.; Pedrini, D.; Perasso, L.; Sala, S.; Fabbri, F.L.; Enorini, M.; Laurelli, P.; Spillantini, P.; Zallo, A.

    1984-01-01

    A new Ge-Si active target is presently used in the Na1 experiment at CERN to study photoproduction of charmed particles and to measure their lifetimes. Some general comments on the active target technique are made. (orig.)

  9. Sequence, Structure, and Binding Analysis of Cyclodextrinase (TK1770 from T. kodakarensis (KOD1 Using an In Silico Approach

    Directory of Open Access Journals (Sweden)

    Ramzan Ali

    2015-01-01

    Full Text Available Thermostable cyclodextrinase (Tk1770 CDase from hyperthermophilic archaeon Thermococcus kodakarensis (KOD1 hydrolyzes cyclodextrins into linear dextrins. The sequence of Tk1770 CDase retrieved from UniProt was aligned with sequences of sixteen CD hydrolyzing enzymes and a phylogenetic tree was constructed using Bayesian inference. The homology model of Tk1770 CDase was constructed and optimized with Modeller v9.14 program. The model was validated with ProSA server and PROCHECK analysis. Four conserved regions and the catalytic triad consisting of Asp411, Glu437, and Asp502 of GH13 family were identified in catalytic site. Also an additional fifth conserved region downstream to the fourth region was also identified. The structure of Tk1770 CDase consists of an additional N′-domain and a helix-loop-helix motif that is conserved in all archaeal CD hydrolyzing enzymes. The N′-domain contains an extended loop region that forms a part of catalytic domain and plays an important role in stability and substrate binding. The docking of substrate into catalytic site revealed the interactions with different conserved residues involved in substrate binding and formation of enzyme-substrate complex.

  10. Dissimilatory oxidation and reduction of elemental sulfur in thermophilic archaea.

    Science.gov (United States)

    Kletzin, Arnulf; Urich, Tim; Müller, Fabian; Bandeiras, Tiago M; Gomes, Cláudio M

    2004-02-01

    The oxidation and reduction of elemental sulfur and reduced inorganic sulfur species are some of the most important energy-yielding reactions for microorganisms living in volcanic hot springs, solfataras, and submarine hydrothermal vents, including both heterotrophic, mixotrophic, and chemolithoautotrophic, carbon dioxide-fixing species. Elemental sulfur is the electron donor in aerobic archaea like Acidianus and Sulfolobus. It is oxidized via sulfite and thiosulfate in a pathway involving both soluble and membrane-bound enzymes. This pathway was recently found to be coupled to the aerobic respiratory chain, eliciting a link between sulfur oxidation and oxygen reduction at the level of the respiratory heme copper oxidase. In contrast, elemental sulfur is the electron acceptor in a short electron transport chain consisting of a membrane-bound hydrogenase and a sulfur reductase in (facultatively) anaerobic chemolithotrophic archaea Acidianus and Pyrodictium species. It is also the electron acceptor in organoheterotrophic anaerobic species like Pyrococcus and Thermococcus, however, an electron transport chain has not been described as yet. The current knowledge on the composition and properties of the aerobic and anaerobic pathways of dissimilatory elemental sulfur metabolism in thermophilic archaea is summarized in this contribution.

  11. Role of Mn2+ and compatible solutes in the radiation resistance of thermophilic bacteria and archaea.

    Science.gov (United States)

    Webb, Kimberly M; DiRuggiero, Jocelyne

    2012-01-01

    Radiation-resistant bacteria have garnered a great deal of attention from scientists seeking to expose the mechanisms underlying their incredible survival abilities. Recent analyses showed that the resistance to ionizing radiation (IR) in the archaeon Halobacterium salinarum is dependent upon Mn-antioxidant complexes responsible for the scavenging of reactive oxygen species (ROS) generated by radiation. Here we examined the role of the compatible solutes trehalose, mannosylglycerate, and di-myo-inositol phosphate in the radiation resistance of aerobic and anaerobic thermophiles. We found that the IR resistance of the thermophilic bacteria Rubrobacter xylanophilus and Rubrobacter radiotolerans was highly correlated to the accumulation of high intracellular concentration of trehalose in association with Mn, supporting the model of Mn(2+)-dependent ROS scavenging in the aerobes. In contrast, the hyperthermophilic archaea Thermococcus gammatolerans and Pyrococcus furiosus did not contain significant amounts of intracellular Mn, and we found no significant antioxidant activity from mannosylglycerate and di-myo-inositol phosphate in vitro. We therefore propose that the low levels of IR-generated ROS under anaerobic conditions combined with highly constitutively expressed detoxification systems in these anaerobes are key to their radiation resistance and circumvent the need for the accumulation of Mn-antioxidant complexes in the cell.

  12. Molecular analysis of the microbial community structures in water-flooding petroleum reservoirs with different temperatures

    Science.gov (United States)

    Wang, L.-Y.; Duan, R.-Y.; Liu, J.-F.; Yang, S.-Z.; Gu, J.-D.; Mu, B.-Z.

    2012-04-01

    Temperature is one of the most important environmental factors regulating the activity and determining the composition of the microbial community. Analysis of microbial communities from six water-flooding petroleum reservoirs at temperatures from 20 to 63 °C by 16S rRNA gene clone libraries indicates the presence of physiologically diverse and temperature-dependent microorganisms in these subterrestrial ecosystems. In high-temperature petroleum reservoirs, most of the archaeal sequences belong to the thermophilic archaea including the genera Thermococcus, Methanothermobacter and Thermoplasmatales, most of the bacterial sequences belong to the phyla Firmicutes, Thermotogae and Thermodesulfobacteria; in low-temperature petroleum reservoirs, most of the archaeal sequences are affiliated with the genera Methanobacterium, Methanoculleus and Methanocalculus, most of the bacterial sequences to the phyla Proteobacteria, Bacteroidetes and Actinobacteria. Canonical correspondence analysis (CCA) revealed that temperature, mineralization, ionic type as well as volatile fatty acids showed correlation with the microbial community structures. These organisms may be adapted to the environmental conditions of these petroleum reservoirs over geologic time by metabolizing buried organic matter from the original deep subsurface environment and became the common inhabitants in subsurface environments.

  13. Role of Mn2+ and Compatible Solutes in the Radiation Resistance of Thermophilic Bacteria and Archaea

    Directory of Open Access Journals (Sweden)

    Kimberly M. Webb

    2012-01-01

    Full Text Available Radiation-resistant bacteria have garnered a great deal of attention from scientists seeking to expose the mechanisms underlying their incredible survival abilities. Recent analyses showed that the resistance to ionizing radiation (IR in the archaeon Halobacterium salinarum is dependent upon Mn-antioxidant complexes responsible for the scavenging of reactive oxygen species (ROS generated by radiation. Here we examined the role of the compatible solutes trehalose, mannosylglycerate, and di-myo-inositol phosphate in the radiation resistance of aerobic and anaerobic thermophiles. We found that the IR resistance of the thermophilic bacteria Rubrobacter xylanophilus and Rubrobacter radiotolerans was highly correlated to the accumulation of high intracellular concentration of trehalose in association with Mn, supporting the model of Mn2+-dependent ROS scavenging in the aerobes. In contrast, the hyperthermophilic archaea Thermococcus gammatolerans and Pyrococcus furiosus did not contain significant amounts of intracellular Mn, and we found no significant antioxidant activity from mannosylglycerate and di-myo-inositol phosphate in vitro. We therefore propose that the low levels of IR-generated ROS under anaerobic conditions combined with highly constitutively expressed detoxification systems in these anaerobes are key to their radiation resistance and circumvent the need for the accumulation of Mn-antioxidant complexes in the cell.

  14. Involvement of thermophilic archaea in the biocorrosion of oil pipelines.

    Science.gov (United States)

    Davidova, Irene A; Duncan, Kathleen E; Perez-Ibarra, B Monica; Suflita, Joseph M

    2012-07-01

    Two thermophilic archaea, strain PK and strain MG, were isolated from a culture enriched at 80°C from the inner surface material of a hot oil pipeline. Strain PK could ferment complex organic nitrogen sources (e.g. yeast extract, peptone, tryptone) and was able to reduce elemental sulfur (S°), Fe(3+) and Mn(4+) . Phylogenetic analysis revealed that the organism belonged to the order Thermococcales. Incubations of this strain with elemental iron (Fe°) resulted in the abiotic formation of ferrous iron and the accumulation of volatile fatty acids during yeast extract fermentation. The other isolate, strain MG, was a H(2) :CO(2) -utilizing methanogen, phylogenetically affiliated with the genus Methanothermobacter family. Co-cultures of the strains grew as aggregates that produced CH(4) without exogenous H(2) amendment. The co-culture produced the same suite but greater concentrations of fatty acids from yeast extract than did strain PK alone. Thus, the physiological characteristics of organisms both alone and in combination could conceivably contribute to pipeline corrosion. The Thermococcus strain PK could reduce elemental sulfur to sulfide, produce fatty acids and reduce ferric iron. The hydrogenotrophic methanogen strain MG enhanced fatty acid production by fermentative organisms but could not couple the dissolution Fe° with the consumption of water-derived H(2) like other methanogens. © 2012 Society for Applied Microbiology and Blackwell Publishing Ltd.

  15. A 1-Cys Peroxiredoxin from a Thermophilic Archaeon Moonlights as a Molecular Chaperone to Protect Protein and DNA against Stress-Induced Damage.

    Directory of Open Access Journals (Sweden)

    Sangmin Lee

    Full Text Available Peroxiredoxins (Prxs act against hydrogen peroxide (H2O2, organic peroxides, and peroxynitrite. Thermococcus kodakaraensis KOD1, an anaerobic archaeon, contains many antioxidant proteins, including three Prxs (Tk0537, Tk0815, and Tk1055. Only Tk0537 has been found to be induced in response to heat, osmotic, and oxidative stress. Tk0537 was found to belong to a 1-Cys Prx6 subfamily based on sequence analysis and was named 1-Cys TkPrx. Using gel filtration chromatography, electron microscopy, and blue-native polyacrylamide gel electrophoresis, we observed that 1-Cys TkPrx exhibits oligomeric forms with reduced peroxide reductase activity as well as decameric and dodecameric forms that can act as molecular chaperones by protecting both proteins and DNA from oxidative stress. Mutational analysis showed that a cysteine residue at the N-terminus (Cys46 was responsible for the peroxide reductase activity, and cysteine residues at the C-terminus (Cys205 and Cys211 were important for oligomerization. Based on our results, we propose that interconversion between different oligomers is important for regulating the different functions of 1-Cys TkPrx.

  16. Identifying sequential substrate binding at the single-molecule level by enzyme mechanical stabilization.

    Science.gov (United States)

    Rivas-Pardo, Jaime Andrés; Alegre-Cebollada, Jorge; Ramírez-Sarmiento, César A; Fernandez, Julio M; Guixé, Victoria

    2015-01-01

    Enzyme-substrate binding is a dynamic process intimately coupled to protein structural changes, which in turn changes the unfolding energy landscape. By the use of single-molecule force spectroscopy (SMFS), we characterize the open-to-closed conformational transition experienced by the hyperthermophilic adenine diphosphate (ADP)-dependent glucokinase from Thermococcus litoralis triggered by the sequential binding of substrates. In the absence of substrates, the mechanical unfolding of TlGK shows an intermediate 1, which is stabilized in the presence of Mg·ADP(-), the first substrate to bind to the enzyme. However, in the presence of this substrate, an additional unfolding event is observed, intermediate 1*. Finally, in the presence of both substrates, the unfolding force of intermediates 1 and 1* increases as a consequence of the domain closure. These results show that SMFS can be used as a powerful experimental tool to investigate binding mechanisms of different enzymes with more than one ligand, expanding the repertoire of protocols traditionally used in enzymology.

  17. Experimental fossilisation of viruses from extremophilic Archaea

    Directory of Open Access Journals (Sweden)

    F. Orange

    2011-06-01

    Full Text Available The role of viruses at different stages of the origin of life has recently been reconsidered. It appears that viruses may have accompanied the earliest forms of life, allowing the transition from an RNA to a DNA world and possibly being involved in the shaping of tree of life in the three domains that we know presently. In addition, a large variety of viruses has been recently identified in extreme environments, hosted by extremophilic microorganisms, in ecosystems considered as analogues to those of the early Earth. Traces of life on the early Earth were preserved by the precipitation of silica on the organic structures. We present the results of the first experimental fossilisation by silica of viruses from extremophilic Archaea (SIRV2 – Sulfolobus islandicus rod-shaped virus 2, TPV1 – Thermococcus prieurii virus 1, and PAV1 – Pyrococcus abyssi virus 1. Our results confirm that viruses can be fossilised, with silica precipitating on the different viral structures (proteins, envelope over several months in a manner similar to that of other experimentally and naturally fossilised microorganisms. This study thus suggests that viral remains or traces could be preserved in the rock record although their identification may be challenging due to the small size of the viral particles.

  18. An industrial scale process for the enzymatic removal of steryl glucosides from biodiesel.

    Science.gov (United States)

    Peiru, Salvador; Aguirre, Andres; Eberhardt, Florencia; Braia, Mauricio; Cabrera, Rodolfo; Menzella, Hugo G

    2015-01-01

    Biodiesels produced from transesterification of vegetable oils have a major quality problem due to the presence of precipitates, which need to be removed to avoid clogging of filters and engine failures. These precipitates have been reported to be mostly composed of steryl glucosides (SGs), but so far industrial cost-effective methods to remove these compounds are not available. Here we describe a novel method for the efficient removal of SGs from biodiesel, based on the hydrolytic activity of a thermostable β-glycosidase obtained from Thermococcus litoralis. A steryl glucosidase (SGase) enzyme from T. litoralis was produced and purified from Escherichia coli cultures expressing a synthetic gene, and used to treat soybean-derived biodiesel. Several optimization steps allowed for the selection of optimal reaction conditions to finally provide a simple and efficient process for the removal of SGs from crude biodiesel. The resulting biodiesel displayed filterability properties similar to distilled biodiesel according to the total contamination (TC), the cold soak filtration test (CSFT), filter blocking tendency (FBT), and cold soak filter blocking tendency (CSFBT) tests. The process was successfully scaled up to a 20 ton reactor, confirming its adaptability to industrial settings. The results presented in this work provide a novel path for the removal of steryl glucosides from biodiesel using a cost-effective, environmentally friendly and scalable enzymatic process, contributing to the adoption of this renewable fuel.

  19. In vitro Ca(2+)-dependent maturation of milk-clotting recombinant Epr: minor extracellular protease: from Bacillus licheniformis.

    Science.gov (United States)

    Ageitos, José Manuel; Vallejo, Juan Andrés; Serrat, Manuel; Sánchez-Pérez, Angeles; Villa, Tomás G

    2013-06-01

    The minor extracellular protease (Epr) is secreted into the culture medium during Bacillus licheniformis, strain USC13, stationary phase of growth. Whereas, B. subtilis Epr has been reported to be involved in swarming; the B. licheniformis protease is also involved in milk-clotting as shown by the curd forming ability of culture broths expressing this protein. The objectives of this study are the characterization of recombinant B. licheniformis Epr (minor extracellular protease) and the determination of its calcium-dependent activation process. In this work, we have cloned and expressed B. licheniformis Epr in Escherichia coli. We were also able to construct a tridimensional model for Epr based on its homology to Thermococcus kodakarensis pro-tk-subtilisin 2e1p, fervidolysin from Fervidobacterium pennivorans 1rv6, and B. lentus 1GCI subtilisin. Recombinant Epr was accumulated into inclusion bodies; after protein renaturation, Epr undergoes an in vitro calcium-dependent activation, similar to that described for tk protease. The recombinant Epr is capable of producing milk curds with the same clotting activity previously described for the native B. licheniformis Epr enzyme although further rheological and industrial studies should be carried out to confirm its real applicability. This work represents for the first time that Epr may be successfully expressed in a non-bacilli microorganism.

  20. Expression and Characterization of the RKOD DNA Polymerase in Pichia pastoris.

    Directory of Open Access Journals (Sweden)

    Fei Wang

    Full Text Available The present study assessed high-level expression of the KOD DNA polymerase in Pichia pastoris. Thermococcus kodakaraensis KOD1 is a DNA polymerase that is widely used in PCR. The DNA coding sequence of KOD was optimized based on the codon usage bias of P. pastoris and synthesized by overlapping PCR, and the nonspecific DNA-binding protein Sso7d from the crenarchaeon Sulfolobus solfataricus was fused to the C-terminus of KOD. The resulting novel gene was cloned into a pHBM905A vector and introduced into P. pastoris GS115 for secretory expression. The yield of the target protein reached approximately 250 mg/l after a 6-d induction with 1% (v/v methanol in shake flasks. This yield is much higher than those of other DNA polymerases expressed heterologously in Escherichia coli. The recombinant enzyme was purified, and its enzymatic features were studied. Its specific activity was 19,384 U/mg. The recombinant KOD expressed in P. pastoris exhibited excellent thermostability, extension rate and fidelity. Thus, this report provides a simple, efficient and economic approach to realize the production of a high-performance thermostable DNA polymerase on a large scale. This is the first report of the expression in yeast of a DNA polymerase for use in PCR.

  1. Fermentation Technologies for the Optimization of Marine Microbial Exopolysaccharide Production

    Directory of Open Access Journals (Sweden)

    Ilaria Finore

    2014-05-01

    Full Text Available In the last decades, research has focused on the capabilities of microbes to secrete exopolysaccharides (EPS, because these polymers differ from the commercial ones derived essentially from plants or algae in their numerous valuable qualities. These biopolymers have emerged as new polymeric materials with novel and unique physical characteristics that have found extensive applications. In marine microorganisms the produced EPS provide an instrument to survive in adverse conditions: They are found to envelope the cells by allowing the entrapment of nutrients or the adhesion to solid substrates. Even if the processes of synthesis and release of exopolysaccharides request high-energy investments for the bacterium, these biopolymers permit resistance under extreme environmental conditions. Marine bacteria like Bacillus, Halomonas, Planococcus, Enterobacter, Alteromonas, Pseudoalteromonas, Vibrio, Rhodococcus, Zoogloea but also Archaea as Haloferax and Thermococcus are here described as EPS producers underlining biopolymer hyperproduction, related fermentation strategies including the effects of the chemical composition of the media, the physical parameters of the growth conditions and the genetic and predicted experimental design tools.

  2. Distribution of unusual archaea in subsurface biosphere

    Science.gov (United States)

    Takai, Ken; Inagaki, Fumio; Horikoshi, Koki

    Recent microbiological surveys of terrestrial and oceanic subsurface biospheres have revealed that sizable microbial populations are present in global subsurface environments. However, little is known about the community structure, genetic diversity, and distribution pattern of subsurface bacteria and archaea since these surveys are mainly dependent on microscopic observations and conventional cultivation techniques. Culture-independent, molecular phylogenetic techniques are now utilized to explore microbial communities in various subsurface environments such as underground mines, subterrestrial rocks, continental and ocean oil reservoirs, subseafloor sediments and subvent microbial ecosystems. It has become apparent that unique archaeal components are commonly present in these subsurface microbial habitats. The most frequently recovered genetic signatures are of members of the hyperthermophiles Thermococcus. Their unexpected ubiquity even in non-extreme subsurface environments may represent the great biomass potential of probably dormant extremophilic archaea in the global subsurface biosphere. Archaeal populations in deep-sea hydrothermal vents and subvent environments might serve as sources of dormant extremophiles. It therefore appears likely that global and local ocean hydrothermal activities have had a persistent and significant impact on the formation of subsurface microbial communities and the distribution of subsurface microorganisms.

  3. Bioenergetic and physiological studies of hyperthermophilic archaea. Final report

    Energy Technology Data Exchange (ETDEWEB)

    Kelly, R.M.

    1999-03-01

    This project focuses on physiological and bioenergetic characteristics of two representative hyperthermophilic archaea: Thermococcus litoralis (T{sub opt} 88 C) and Pyrococcus furiosus (T{sub opt} 98 C). Both are obligately anaerobic heterotrophs which grow in the presence or absence of reducible sulfur compounds. T. litoralis was studied in relation to information previously developed for P. furiosus: effect of sulfur reduction on bioenergetics, preferred fermentation patterns, tungsten requirement, etc. A defined medium was developed for T. litoralis consisting of amino acids, vitamins and nucleotides. This serves as the basis for continuous culture studies probing metabolic response to media changes. P. furiosus and T. litoralis have also been found to produce a polysaccharide in the presence of maltose and yeast extract. The composition and chemical structure of this polysaccharide was investigated as well as the metabolic motivation for its production. A novel and, perhaps, primitive intracellular proteolytic complex (previously designated as protease S66) in P. furiosus was isolated and the gene encoding the subunit of the complex was cloned, sequenced and the protease expressed in active form in Eschericia coli. Among other issues, the role of this complex in protein turnover and stress response was examined in the context of this organism in addition to comparing it to other complexes in eubacterial and eukaryotic cells. Biochemical characteristics of the protease have been measured in addition to examining other proteolytic species in P. furiosus.

  4. The production, properties, and applications of thermostable steryl glucosidases.

    Science.gov (United States)

    Aguirre, Andres; Eberhardt, Florencia; Hails, Guillermo; Cerminati, Sebastian; Castelli, María Eugenia; Rasia, Rodolfo M; Paoletti, Luciana; Menzella, Hugo G; Peiru, Salvador

    2018-02-21

    Extremophilic microorganisms are a rich source of enzymes, the enzymes which can serve as industrial catalysts that can withstand harsh processing conditions. An example is thermostable β-glucosidases that are addressing a challenging problem in the biodiesel industry: removing steryl glucosides (SGs) from biodiesel. Steryl glucosidases (SGases) must be tolerant to heat and solvents in order to function efficiently in biodiesel. The amphipathic nature of SGs also requires enzymes with an affinity for water/solvent interfaces in order to achieve efficient hydrolysis. Additionally, the development of an enzymatic process involving a commodity such as soybean biodiesel must be cost-effective, necessitating an efficient manufacturing process for SGases. This review summarizes the identification of microbial SGases and their applications, discusses biodiesel refining processes and the development of analytical methods for identifying and quantifying SGs in foods and biodiesel, and considers technologies for strain engineering and process optimization for the heterologous production of a SGase from Thermococcus litoralis. All of these technologies might be used for the production of other thermostable enzymes. Structural features of SGases and the feasibility of protein engineering for novel applications are explored.

  5. Effects of pressure on the dynamics of an oligomeric protein from deep-sea hyperthermophile

    Science.gov (United States)

    Shrestha, Utsab R.; Bhowmik, Debsindhu; Copley, John R. D.; Tyagi, Madhusudan; Leão, Juscelino B.; Chu, Xiang-qiang

    2015-01-01

    Inorganic pyrophosphatase (IPPase) from Thermococcus thioreducens is a large oligomeric protein derived from a hyperthermophilic microorganism that is found near hydrothermal vents deep under the sea, where the pressure is up to 100 MPa (1 kbar). It has attracted great interest in biophysical research because of its high activity under extreme conditions in the seabed. In this study, we use the quasielastic neutron scattering (QENS) technique to investigate the effects of pressure on the conformational flexibility and relaxation dynamics of IPPase over a wide temperature range. The β-relaxation dynamics of proteins was studied in the time ranges from 2 to 25 ps, and from 100 ps to 2 ns, using two spectrometers. Our results indicate that, under a pressure of 100 MPa, close to that of the native environment deep under the sea, IPPase displays much faster relaxation dynamics than a mesophilic model protein, hen egg white lysozyme (HEWL), at all measured temperatures, opposite to what we observed previously under ambient pressure. This contradictory observation provides evidence that the protein energy landscape is distorted by high pressure, which is significantly different for hyperthermophilic (IPPase) and mesophilic (HEWL) proteins. We further derive from our observations a schematic denaturation phase diagram together with energy landscapes for the two very different proteins, which can be used as a general picture to understand the dynamical properties of thermophilic proteins under pressure. PMID:26504206

  6. Fermentation technologies for the optimization of marine microbial exopolysaccharide production.

    Science.gov (United States)

    Finore, Ilaria; Di Donato, Paola; Mastascusa, Vincenza; Nicolaus, Barbara; Poli, Annarita

    2014-05-22

    In the last decades, research has focused on the capabilities of microbes to secrete exopolysaccharides (EPS), because these polymers differ from the commercial ones derived essentially from plants or algae in their numerous valuable qualities. These biopolymers have emerged as new polymeric materials with novel and unique physical characteristics that have found extensive applications. In marine microorganisms the produced EPS provide an instrument to survive in adverse conditions: They are found to envelope the cells by allowing the entrapment of nutrients or the adhesion to solid substrates. Even if the processes of synthesis and release of exopolysaccharides request high-energy investments for the bacterium, these biopolymers permit resistance under extreme environmental conditions. Marine bacteria like Bacillus, Halomonas, Planococcus, Enterobacter, Alteromonas, Pseudoalteromonas, Vibrio, Rhodococcus, Zoogloea but also Archaea as Haloferax and Thermococcus are here described as EPS producers underlining biopolymer hyperproduction, related fermentation strategies including the effects of the chemical composition of the media, the physical parameters of the growth conditions and the genetic and predicted experimental design tools.

  7. Unusual Starch Degradation Pathway via Cyclodextrins in the Hyperthermophilic Sulfate-Reducing Archaeon Archaeoglobus fulgidus Strain 7324▿

    Science.gov (United States)

    Labes, Antje; Schönheit, Peter

    2007-01-01

    The hyperthermophilic archaeon Archaeoglobus fulgidus strain 7324 has been shown to grow on starch and sulfate and thus represents the first sulfate reducer able to degrade polymeric sugars. The enzymes involved in starch degradation to glucose 6-phosphate were studied. In extracts of starch-grown cells the activities of the classical starch degradation enzymes, α-amylase and amylopullulanase, could not be detected. Instead, evidence is presented here that A. fulgidus utilizes an unusual pathway of starch degradation involving cyclodextrins as intermediates. The pathway comprises the combined action of an extracellular cyclodextrin glucanotransferase (CGTase) converting starch to cyclodextrins and the intracellular conversion of cyclodextrins to glucose 6-phosphate via cyclodextrinase (CDase), maltodextrin phosphorylase (Mal-P), and phosphoglucomutase (PGM). These enzymes, which are all induced after growth on starch, were characterized. CGTase catalyzed the conversion of starch to mainly β-cyclodextrin. The gene encoding CGTase was cloned and sequenced and showed highest similarity to a glucanotransferase from Thermococcus litoralis. After transport of the cyclodextrins into the cell by a transport system to be defined, these molecules are linearized via a CDase, catalyzing exclusively the ring opening of the cyclodextrins to the respective maltooligodextrins. These are degraded by a Mal-P to glucose 1-phosphate. Finally, PGM catalyzes the conversion of glucose 1-phosphate to glucose 6-phosphate, which is further degraded to pyruvate via the modified Embden-Meyerhof pathway. PMID:17921308

  8. Hydrogen Limitation, Competition and Syntrophy Among Thermophiles in the Hot Subseafloor

    Science.gov (United States)

    Holden, J. F.; Stewart, L. C.; Topcuoglu, B. D.

    2016-02-01

    To understand the biogeochemical impact of subseafloor life on surrounding environments and the overlying ocean, the rates of and constraints on growth and metabolite production must be determined for subseafloor microbes. The diversity of thermophiles and hyperthermophiles in the hot subseafloor is low, making them amenable to biogeochemical modeling. At hydrothermal vents, Methanothermococcus and Methanocaldococcus are common thermophilic and hyperthermophilic methanogens; Desulfurobacterium, common thermophilic autotrophic sulfur reducers; and Thermococcus, common hyperthermophilic H2-producing heterotrophs. Diffuse hydrothermal fluids (7-40°C) from Axial Seamount were incubated anaerobically at 55°C and 80°C. Microcosms with 1.2 mM added H2 produced 30-50 times more CH4 than those with 20 µM H2, demonstrating that H2 and heat were the primary constraints on the growth of thermophilic and hyperthermophilic methanogens. For Methanothermococcus thermolithotrophicus and Methanocaldococcus jannaschii, the lower H2 thresholds and half-saturation constants (Ks) for growth in a chemostat were 9-20 µM and 47-69 µM, respectively, near their optimum growth temperatures. The lower H2 threshold and Ks for Desulfurobacterium sp. strain HR11 grown in a batch reactor at 72°C were culture incubations showed that H2 production by T. paralvinellae supported the growth of Methanothermococcus sp. strain BW11, Methanocaldococcus bathoardescens, and strain HR11 in H2-free medium, suggesting that syntrophy is a possible alternative H2 source in the subseafloor.

  9. Survival of microorganisms representing the three Domains of life inside the International Space Station

    Science.gov (United States)

    Francesco, Canganella; Giovanna, Bianconi

    2007-09-01

    The present work was mainly focused to study the response of representative non pathogenic microorganisms to the environment inside the space vehicle at different mission stages (10, 56, and 226 days) within the frame of the Italian ENEIDE mission, from Feb to Oct 2005. Microorganisms were chosen according to their phylogenetic position and cell structures; they were representatives of the three taxonomic domains and belonged to different ecosystems (food, soil, intestinal tract, plants, deep-sea). They were the followings: Thermococcus guaymasensis (Domain Archaea); Saccharomyces cerevisiae (Domain Eucarya); Escherichia coli, Bacillus subtilis, Lactobacillus acidophilus, Enterococcus faecium, Pseudomonas fluorescens, and Rhizobium tropici (Domain Bacteria). As main environmental parameters we were interested in: a) space radiations; b) microgravity; c) temperature. The response of microorganisms was investigated in terms of survival rates, cell structure modifications, and genomic damages. The survival of cells was affected by both radiation doses and intrinsec cell features. As expected, only samples kept on the ISS for 226 days showed significant levels of mortality. Asfar as regard the effect on cell structures, these samples showed also remarkable morphological changes, particularly for Escherichia coli, Enterococcus faecium, and Saccharomyces cerevisiae. The data collected allowed to get new insights into the biological traits of microorganisms exposed to space environment during the flight on a spacecraft. Moreover, the result obtained may be important for the improvement of human conditions aboard space vehicles (nutraceuticals for astronauts and disinfections of ISS modules) and also for the potential development of closed systems devoted to vegetable productions and organic recycling.

  10. Directed evolution of thermotolerant malic enzyme for improved malate production.

    Science.gov (United States)

    Morimoto, Yumi; Honda, Kohsuke; Ye, Xiaoting; Okano, Kenji; Ohtake, Hisao

    2014-02-01

    The directed evolution of the thermotolerant NADP(H)-dependent malic enzyme from Thermococcus kodakarensis was conducted to alter the cofactor preference of the enzyme from NADP(H) to NAD(H). The construction and screening of two generations of mutant libraries led to the isolation of a triple mutant that exhibited 6-fold higher kcat/Km with NAD(+) than the wild type. We serendipitously found that, in addition to the change in the cofactor preference, the reaction specificity of the mutant enzyme was altered. The reductive carboxylation of pyruvate to malate catalyzed by the wild type enzyme is accompanied by HCO(3)(-)-independent reduction of pyruvate and gives lactate as a byproduct. The reaction specificity of the triple mutant was significantly shifted to malate production and the mutant gave a less amount of the byproduct than the wild type. When the triple mutant enzyme was used as a catalyst for pyruvate carboxylation with NADH, the enzyme gave 1.2 times higher concentration of malate than the wild type with NADPH. Single-point mutation analysis revealed that the substitution of Arg221 with Gly is responsible for the shift in reaction specificity. This finding may shed light on the catalytic mechanisms of malic enzymes and other related CO2- and/or HCO(3)(-)-fixing enzymes. Copyright © 2013 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  11. Final Development, Testing, and Flight Preparation of the Rigidizable Get-Away-Special Experiment (RIGEX)

    Science.gov (United States)

    2007-06-01

    Chemical & Plastics (USC) that specialize in developing specialty coatings for the automotive repair and refinishing market . It was finally decided...N/A 8AWG 10p Terminal Block N/A 1 RIGEX-2006-17-P RIGEX-2006-17-D Power Distribution Plate Al 2 ## N/A 8AWG 4p Terminal Block N/A 1 ## N/A 4Fuse

  12. Identification of the amino acid residues essential for proteolytic activity in an archaeal signal peptide peptidase.

    Science.gov (United States)

    Matsumi, Rie; Atomi, Haruyuki; Imanaka, Tadayuki

    2006-04-14

    Signal peptide peptidases (SPPs) are enzymes involved in the initial degradation of signal peptides after they are released from the precursor proteins by signal peptidases. In contrast to the eukaryotic enzymes that are aspartate peptidases, the catalytic mechanisms of prokaryotic SPPs had not been known. In this study on the SPP from the hyperthermophilic archaeon Thermococcus kodakaraensis (SppA(Tk)), we have identified amino acid residues that are essential for the peptidase activity of the enzyme. DeltaN54SppA(Tk), a truncated protein without the N-terminal 54 residues and putative transmembrane domain, exhibits high peptidase activity, and was used as the wild-type protein. Sixteen residues, highly conserved among archaeal SPP homologue sequences, were selected and replaced by alanine residues. The mutations S162A and K214A were found to abolish peptidase activity of the protein, whereas all other mutant proteins displayed activity to various extents. The results indicated the function of Ser(162) as the nucleophilic serine and that of Lys(214) as the general base, comprising a Ser/Lys catalytic dyad in SppA(Tk). Kinetic analyses indicated that Ser(184), His(191) Lys(209), Asp(215), and Arg(221) supported peptidase activity. Intriguingly, a large number of mutations led to an increase in activity levels of the enzyme. In particular, mutations in Ser(128) and Tyr(165) not only increased activity levels but also broadened the substrate specificity of SppA(Tk), suggesting that these residues may be present to prevent the enzyme from cleaving unintended peptide/protein substrates in the cell. A detailed alignment of prokaryotic SPP sequences strongly suggested that the majority of archaeal enzymes, along with the bacterial enzyme from Bacillus subtilis, adopt the same catalytic mechanism for peptide hydrolysis.

  13. A zinc-dependent protease AMZ-tk from a thermophilic archaeon is a new member of the archaemetzincin protein family

    Directory of Open Access Journals (Sweden)

    Baolei eJia

    2015-12-01

    Full Text Available A putative zinc-dependent protease (TK0512 in Thermococcus kodakarensis KOD1 shares a conserved motif with archaemetzincins, which are metalloproteases found in archaea, bacteria, and eukarya. Phylogenetic and sequence analyses showed that TK0512 and its homologues in Thermococcaceae represent new members in the archaemetzincins family, which we named AMZ-tk. We further confirmed its proteolytic activity biochemically by overexpression of the recombinant AMZ-tk in E. coli and characterization of the purified enzyme. In the presence of zinc, the purified enzyme degraded casein, while adding EDTA strongly inhibited the enzyme activity. AMZ-tk also exhibited self-cleavage activity that required Zn2+. These results demonstrated that AMZ-tk is a zinc-dependent protease within the archaemetzincin family. The enzyme displayed activity at alkaline pHs ranging from 7.0-10.0, with the optimal pH being 8.0. The optimum temperature for the catalytic activity of AMZ-tk was 55ºC. Quantitative reverse transcription-PCR revealed that transcription of AMZ-tk was also up-regulated after exposing the cells to 55 ºC and 65ºC. Mutant analysis suggests that Zn2+ binding histidine and catalytic glutamate plays key roles in proteolysis. AMZ-tk was thermostable on incubation for 4 h at 70°C in the presence of EDTA. AMZ-tk also retained >50% of its original activity in the presence of both laboratory surfactants and commercial laundry detergents. AMZ-tk further showed antibacterial activity against several bacteria. Therefore, AMZ-tk is of considerable interest for many purposes in view of its activity at alkaline pH, detergents, and thermostability.

  14. Thermo-resistance Acquisition of A Mesophilic Bacterium with The Aid of Vector Particles Originating from Thermophiles

    Science.gov (United States)

    Sugitate, T.; Inaba, N.; Kurusu, Y.; Hoaki, T.; Chiura, H. X.

    2004-12-01

    The present study was aimed to examine whether virus-like particles (VLPs) would be able to transfer and express the thermo-resistance gene of thermophilic microbes in the mesophilic auxotrophic Escherichia coli AB1157 mutant. A hyper-thermophilic archaea, Thermococcus kodakaraensis B41, that was isolated from the Suiyo Seamount APSK06 boring core, released particles (KD-VLPs) during culture. Transduction towards recipient E. coli AB1157 was carried out using KD-VLP as the gene transfer mediator, in order to examine the lethal effect and thermo-resistant gene transfer capability of the particle. The colony forming ability of the cells was examined in 7 % of gelrite supplemented-LB plates (LB-gelrite plates) at 50, 56, and 70 ° C. Regardless of UV irradiation, KD-VLP showed a reduced efficiency of plating (EOP) of recipient viable cell population to ca 65 %. Four colonies were formed in LB-gelrite plates at 50 ° C, which were named as KD-E-Trans, and the gene transfer frequency was estimated to be 5.12 × 10-8 cfu/particle. Obtained KD-E-Trans was cultured in LB liquid medium employing the same high temperature conditions. The cells grew 1.6 ˜ 6 fold of the inocula in 13 days at all the examined temperatures, and the generation time of the transductants were as follows: ca 28 hours at 50 ° C, ca 73 hours at 56 ° C, ca 266 hours at 70 ° C. Thus, the gene transfer of thermo-resistance to mesophilic E. coli from another Domain with the aid of KD-VLPs was demonstrated.

  15. Methanogenic H2 syntrophy among thermophiles: a model of metabolism, adaptation and survival in the subsurface

    Science.gov (United States)

    Topcuoglu, B. D.; Stewart, L. C.; Butterfield, D. A.; Huber, J. A.; Holden, J. F.

    2016-12-01

    Approximately 1 giga ton (Gt, 1015 g) of CH4 is formed globally per year from H2, CO2 and acetate through methanogenesis, largely by methanogens growing in syntrophic association with anaerobic microbes that hydrolyze and ferment biopolymers. However, our understanding of methanogenesis in hydrothermal regions of the subseafloor and potential syntrophic methanogenesis at thermophilic temperatures (i.e., >50°C) is nascent. In this study, the growth of natural assemblages of thermophilic methanogens from Axial Seamount was primarily limited by H2 availability. Heterotrophs supported thermophilic methanogenesis by H2 syntrophy in microcosm incubations of hydrothermal fluids at 55°C and 80°C supplemented with tryptone only. Based on 16S rRNA gene sequencing, only heterotrophic archaea that produce H2, H2-consuming methanogens, and sulfate reducing archaea were found in 80°C tryptone microcosms from Marker 113 vent. No bacteria were found. In 55°C tryptone microcosms, sequences were found from H2-producing bacteria and H2-consuming methanogens and sulfate-reducing bacteria. In order to model the impact of H2 syntrophy at hyperthemophilic temperatures, a co-culture was established consisting of the H2-producing hyperthermophilic heterotroph Thermococcus paralvinellae and a H2-consuming hyperthermophilic methanogen Methanocaldococcus bathoardescens. When grown alone in a chemostat, the growth rates and steady-state cell concentrations of T. paralvinellae decreased significantly when a high H2 (70 µM) background was present. H2 inhibition was ameliorated by the production of formate, but in silico modeling suggests less energetic yield for the cells. H2 syntrophy relieved H2 inhibition for both the heterotroph and the methanogenic partners. The results demonstrate that thermophilic H2 syntrophy can support methanogenesis within natural microbial assemblages and may be an important alternative energy source for thermophilic autotrophs in marine geothermal environments.

  16. Responses of Microbial Community Composition to Temperature Gradient and Carbon Steel Corrosion in Production Water of Petroleum Reservoir

    Directory of Open Access Journals (Sweden)

    Xiao-Xiao Li

    2017-12-01

    Full Text Available Oil reservoir production systems are usually associated with a temperature gradient and oil production facilities frequently suffer from pipeline corrosion failures. Both bacteria and archaea potentially contribute to biocorrosion of the oil production equipment. Here the response of microbial populations from the petroleum reservoir to temperature gradient and corrosion of carbon steel coupons were investigated under laboratory condition. Carbon steel coupons were exposed to production water from a depth of 1809 m of Jiangsu petroleum reservoir (China and incubated for periods of 160 and 300 days. The incubation temperatures were set at 37, 55, and 65°C to monitoring mesophilic, thermophilic and hyperthermophilic microorganisms associated with anaerobic carbon steel corrosion. The results showed that corrosion rate at 55°C (0.162 ± 0.013 mm year-1 and 37°C (0.138 ± 0.008 mm year-1 were higher than that at 65°C (0.105 ± 0.007 mm year-1, and a dense biofilm was observed on the surface of coupons under all biotic incubations. The microbial community analysis suggests a high frequency of bacterial taxa associated with families Porphyromonadaceae, Enterobacteriaceae, and Spirochaetaceae at all three temperatures. While the majority of known sulfate-reducing bacteria, in particular Desulfotignum, Desulfobulbus and Desulfovibrio spp., were predominantly observed at 37°C; Desulfotomaculum spp., Thermotoga spp. and Thermanaeromonas spp. as well as archaeal members closely related to Thermococcus and Archaeoglobus spp. were substantially enriched at 65°C. Hydrogenotrophic methanogens of the family Methanobacteriaceae were dominant at both 37 and 55°C; acetoclastic Methanosaeta spp. and methyltrophic Methanolobus spp. were enriched at 37°C. These observations show that temperature changes significantly alter the microbial community structure in production fluids and also affected the biocorrosion of carbon steel under anaerobic conditions.

  17. Hydrogen limitation and syntrophic growth among natural assemblages of thermophilic methanogens at deep-sea hydrothermal vents

    Directory of Open Access Journals (Sweden)

    Begüm D. Topçuoğlu

    2016-08-01

    Full Text Available Thermophilic methanogens are common autotrophs at hydrothermal vents, but their growth constraints and dependence on H2 syntrophy in situ are poorly understood. Between 2012 and 2015, methanogens and H2-producing heterotrophs were detected by growth at 80°C and 55°C at most diffuse (7-40°C hydrothermal vent sites at Axial Seamount. Microcosm incubations of diffuse hydrothermal fluids at 80°C and 55°C demonstrated that growth of thermophilic and hyperthermophilic methanogens is primarily limited by H2 availability. Amendment of microcosms with NH4+ generally had no effect on CH4 production. However, annual variations in abundance and CH4 production were observed in relation to the eruption cycle of the seamount. Microcosm incubations of hydrothermal fluids at 80°C and 55°C supplemented with tryptone and no added H2 showed CH4 production indicating the capacity in situ for methanogenic H2 syntrophy. 16S rRNA genes were found in 80°C microcosms from H2-producing archaea and H2-consuming methanogens, but not for any bacteria. In 55°C microcosms, sequences were found from the H2-producing bacteria and H2-consuming methanogens and sulfate-reducing bacteria. A co-culture of representative organisms showed that Thermococcus paralvinellae supported the syntrophic growth of Methanocaldococcus bathoardescens at 82°C and Methanothermococcus sp. strain BW11 at 60°C. The results demonstrate that modeling of subseafloor methanogenesis should focus primarily on H2 availability and temperature, and that thermophilic H2 syntrophy can support methanogenesis within natural microbial assemblages and may be an important energy source for thermophilic autotrophs in marine geothermal environments.

  18. Evolution and thermodynamics of the slow unfolding of hyperstable monomeric proteins

    Directory of Open Access Journals (Sweden)

    Koga Yuichi

    2010-07-01

    Full Text Available Abstract Background The unfolding speed of some hyperthermophilic proteins is dramatically lower than that of their mesostable homologs. Ribonuclease HII from the hyperthermophilic archaeon Thermococcus kodakaraensis (Tk-RNase HII is stabilized by its remarkably slow unfolding rate, whereas RNase HI from the thermophilic bacterium Thermus thermophilus (Tt-RNase HI unfolds rapidly, comparable with to that of RNase HI from Escherichia coli (Ec-RNase HI. Results To clarify whether the difference in the unfolding rate is due to differences in the types of RNase H or differences in proteins from archaea and bacteria, we examined the equilibrium stability and unfolding reaction of RNases HII from the hyperthermophilic bacteria Thermotoga maritima (Tm-RNase HII and Aquifex aeolicus (Aa-RNase HII and RNase HI from the hyperthermophilic archaeon Sulfolobus tokodaii (Sto-RNase HI. These proteins from hyperthermophiles are more stable than Ec-RNase HI over all the temperature ranges examined. The observed unfolding speeds of all hyperstable proteins at the different denaturant concentrations studied are much lower than those of Ec-RNase HI, which is in accordance with the familiar slow unfolding of hyperstable proteins. However, the unfolding rate constants of these RNases H in water are dispersed, and the unfolding rate constant of thermophilic archaeal proteins is lower than that of thermophilic bacterial proteins. Conclusions These results suggest that the nature of slow unfolding of thermophilic proteins is determined by the evolutionary history of the organisms involved. The unfolding rate constants in water are related to the amount of buried hydrophobic residues in the tertiary structure.

  19. Extremely Thermophilic Microorganisms as Metabolic Engineering Platforms for Production of Fuels and Industrial Chemicals

    Directory of Open Access Journals (Sweden)

    Benjamin M Zeldes

    2015-11-01

    Full Text Available Enzymes from extremely thermophilic microorganisms have been of technological interest for some time because of their ability to catalyze reactions of industrial significance at elevated temperatures. Thermophilic enzymes are now routinely produced in recombinant mesophilic hosts for use as discrete biocatalysts. Genome and metagenome sequence data for extreme thermophiles provide useful information for putative biocatalysts for a wide range of biotransformations, albeit involving at most a few enzymatic steps. However, in the past several years, unprecedented progress has been made in establishing molecular genetics tools for extreme thermophiles to the point that the use of these microorganisms as metabolic engineering platforms has become possible. While in its early days, complex metabolic pathways have been altered or engineered into recombinant extreme thermophiles, such that the production of fuels and chemicals at elevated temperatures has become possible. Not only does this expand the thermal range for industrial biotechnology, it also potentially provides biodiverse options for specific biotransformations unique to these microorganisms. The list of extreme thermophiles growing optimally between 70 and 100°C with genetic toolkits currently available includes archaea and bacteria, aerobes and anaerobes, coming from genera such as Caldicellulosiruptor, Sulfolobus, Thermotoga, Thermococcus and Pyrococcus. These organisms exhibit unusual and potentially useful native metabolic capabilities, including cellulose degradation, metal solubilization, and RuBisCO-free carbon fixation. Those looking to design a thermal bioprocess now have a host of potential candidates to choose from, each with its own advantages and challenges that will influence its appropriateness for specific applications. Here, the issues and opportunities for extremely thermophilic metabolic engineering platforms are considered with an eye towards potential technological

  20. Temperature and injection water source influence microbial community structure in four Alaskan North Slope hydrocarbon reservoirs.

    Directory of Open Access Journals (Sweden)

    Yvette Marisa Piceno

    2014-08-01

    Full Text Available A fundamental knowledge of microbial community structure in petroleum reservoirs can improve predictive modeling of these environments. We used hydrocarbon profiles, stable isotopes, and high-density DNA microarray analysis to characterize microbial communities in produced water from four Alaska North Slope hydrocarbon reservoirs. Produced fluids from Schrader Bluff (24-27°C, Kuparuk (47-70°C, Sag River (80°C, and Ivishak (80-83°C reservoirs were collected, with paired soured/non-soured wells sampled from Kuparuk and Ivishak. Chemical and stable isotope data suggested Schrader Bluff had substantial biogenic methane, whereas methane was mostly thermogenic in deeper reservoirs. Acetoclastic methanogens (Methanosaeta were most prominent in Schrader Bluff samples, and the combined δD and δ13C values of methane also indicated acetoclastic methanogenesis could be a primary route for biogenic methane. Conversely, hydrogenotrophic methanogens (e.g., Methanobacteriaceae and sulfide-producing Archaeoglobus and Thermococcus were more prominent in Kuparuk samples. Sulfide-producing microbes were detected in all reservoirs, uncoupled from souring status (e.g., the non-soured Kuparuk samples had higher relative abundances of many sulfate-reducers compared to the soured sample, suggesting sulfate-reducers may be living fermentatively/syntrophically when sulfate is limited. Sulfate abundance via long-term seawater injection resulted in greater relative abundances of Desulfonauticus, Desulfomicrobium, and Desulfuromonas in the soured Ivishak well compared to the non-soured well. In the non-soured Ivishak sample, several taxa affiliated with Thermoanaerobacter and Halomonas predominated. Archaea were not detected in the deepest reservoirs. Functional group taxa differed in relative abundance among reservoirs, likely reflecting differing thermal and/or geochemical influences.

  1. Sulfur metabolizing microbes dominate microbial communities in Andesite-hosted shallow-sea hydrothermal systems.

    Science.gov (United States)

    Zhang, Yao; Zhao, Zihao; Chen, Chen-Tung Arthur; Tang, Kai; Su, Jianqiang; Jiao, Nianzhi

    2012-01-01

    To determine microbial community composition, community spatial structure and possible key microbial processes in the shallow-sea hydrothermal vent systems off NE Taiwan's coast, we examined the bacterial and archaeal communities of four samples collected from the water column extending over a redoxocline gradient of a yellow and four from a white hydrothermal vent. Ribosomal tag pyrosequencing based on DNA and RNA showed statistically significant differences between the bacterial and archaeal communities of the different hydrothermal plumes. The bacterial and archaeal communities from the white hydrothermal plume were dominated by sulfur-reducing Nautilia and Thermococcus, whereas the yellow hydrothermal plume and the surface water were dominated by sulfide-oxidizing Thiomicrospira and Euryarchaeota Marine Group II, respectively. Canonical correspondence analyses indicate that methane (CH(4)) concentration was the only statistically significant variable that explains all community cluster patterns. However, the results of pyrosequencing showed an essential absence of methanogens and methanotrophs at the two vent fields, suggesting that CH(4) was less tied to microbial processes in this shallow-sea hydrothermal system. We speculated that mixing between hydrothermal fluids and the sea or meteoric water leads to distinctly different CH(4) concentrations and redox niches between the yellow and white vents, consequently influencing the distribution patterns of the free-living Bacteria and Archaea. We concluded that sulfur-reducing and sulfide-oxidizing chemolithoautotrophs accounted for most of the primary biomass synthesis and that microbial sulfur metabolism fueled microbial energy flow and element cycling in the shallow hydrothermal systems off the coast of NE Taiwan.

  2. Enzymatic sequencing of partially acetylated chitosan oligomers.

    Science.gov (United States)

    Hamer, Stefanie Nicole; Moerschbacher, Bruno Maria; Kolkenbrock, Stephan

    2014-06-17

    Chitosan oligosaccharides have diverse biological activities with potentially valuable applications, for example, in the fields of medicine and agriculture. These functionalities are thought to depend on their degree of polymerization and acetylation, and possibly on specific patterns of acetylation. Chitosan oligomers with fully defined architecture are difficult to produce, and their complete analysis is demanding. Analysis is typically done using MS or NMR, requiring access to expensive infrastructure, and yielding unequivocal results only in the case of rather small oligomers. We here describe a simple and cost-efficient method for the sequencing of μg amounts of chitosan oligosaccharides which is based on the sequential action of two recombinant glycosidases, namely an exo-β-N-acetylhexosaminidase (GlcNAcase) from Bacillus subtilis 168 and an exo-β-d-glucosaminidase (GlcNase) from Thermococcus kodakarensis KOD1. Starting from the non-reducing end, GlcNAcase and GlcNase specifically remove N-acetyl glucosamine (A) and glucosamine (D) units, respectively. By the sequential addition and removal of these enzymes in an alternating way followed by analysis of the products using high-performance thin-layer chromatography, the sequence of chitosan oligosaccharides can be revealed. Importantly, both enzymes work under identical conditions so that no buffer exchange is required between steps, and the enzyme can be removed conveniently using simple ultra-filtration devices. As proof-of-principle, the method was used to sequence the product of enzymatic deacetylation of chitin pentamer using a recombinant chitin deacetylase from Vibrio cholerae which specifically removes the acetyl group from the second unit next to the non-reducing end of the substrate, yielding mono-deacetylated pentamer with the sequence ADAAA. Copyright © 2014 Elsevier Ltd. All rights reserved.

  3. High sensitive RNA detection by one-step RT-PCR using the genetically engineered variant of DNA polymerase with reverse transcriptase activity from hyperthermophilies.

    Science.gov (United States)

    Okano, Hiroyuki; Baba, Misato; Kawato, Katsuhiro; Hidese, Ryota; Yanagihara, Itaru; Kojima, Kenji; Takita, Teisuke; Fujiwara, Shinsuke; Yasukawa, Kiyoshi

    2018-03-01

    One-step RT-PCR has not been widely used even though some thermostable DNA polymerases with reverse transcriptase (RT) activity were developed from bacterial and archaeal polymerases, which is owing to low cDNA synthesis activity from RNA. In the present study, we developed highly-sensitive one-step RT-PCR using the single variant of family A DNA polymerase with RT activity, K4pol L329A (L329A), from the hyperthermophilic bacterium Thermotoga petrophila K4 or the 16-tuple variant of family B DNA polymerase with RT activity, RTX, from the hyperthermophilic archaeon Thermococcus kodakarensis. Optimization of reaction condition revealed that the activities for cDNA synthesis and PCR of K4pol L329A and RTX were highly affected by the concentrations of MgCl 2 and Mn(OCOCH 3 ) 2 as well as those of K4pol L329A or RTX. Under the optimized condition, 300 copies/μl of target RNA in 10 μl reaction volumes were successfully detected by the one-step RT-PCR with K4pol L329A or RTX, which was almost equally sensitive enough compared with the current RT-PCR condition using retroviral RT and thermostable DNA polymerase. Considering that K4pol L329A and RTX are stable even at 90-100°C, our results suggest that the one-step RT-PCR with K4pol L329A or RTX is more advantageous than the current one. Copyright © 2017 The Society for Biotechnology, Japan. Published by Elsevier B.V. All rights reserved.

  4. Sulfur metabolizing microbes dominate microbial communities in Andesite-hosted shallow-sea hydrothermal systems.

    Directory of Open Access Journals (Sweden)

    Yao Zhang

    Full Text Available To determine microbial community composition, community spatial structure and possible key microbial processes in the shallow-sea hydrothermal vent systems off NE Taiwan's coast, we examined the bacterial and archaeal communities of four samples collected from the water column extending over a redoxocline gradient of a yellow and four from a white hydrothermal vent. Ribosomal tag pyrosequencing based on DNA and RNA showed statistically significant differences between the bacterial and archaeal communities of the different hydrothermal plumes. The bacterial and archaeal communities from the white hydrothermal plume were dominated by sulfur-reducing Nautilia and Thermococcus, whereas the yellow hydrothermal plume and the surface water were dominated by sulfide-oxidizing Thiomicrospira and Euryarchaeota Marine Group II, respectively. Canonical correspondence analyses indicate that methane (CH(4 concentration was the only statistically significant variable that explains all community cluster patterns. However, the results of pyrosequencing showed an essential absence of methanogens and methanotrophs at the two vent fields, suggesting that CH(4 was less tied to microbial processes in this shallow-sea hydrothermal system. We speculated that mixing between hydrothermal fluids and the sea or meteoric water leads to distinctly different CH(4 concentrations and redox niches between the yellow and white vents, consequently influencing the distribution patterns of the free-living Bacteria and Archaea. We concluded that sulfur-reducing and sulfide-oxidizing chemolithoautotrophs accounted for most of the primary biomass synthesis and that microbial sulfur metabolism fueled microbial energy flow and element cycling in the shallow hydrothermal systems off the coast of NE Taiwan.

  5. Synthetic metabolic engineering-a novel, simple technology for designing a chimeric metabolic pathway

    Directory of Open Access Journals (Sweden)

    Ye Xiaoting

    2012-09-01

    Full Text Available Abstract Background The integration of biotechnology into chemical manufacturing has been recognized as a key technology to build a sustainable society. However, the practical applications of biocatalytic chemical conversions are often restricted due to their complexities involving the unpredictability of product yield and the troublesome controls in fermentation processes. One of the possible strategies to overcome these limitations is to eliminate the use of living microorganisms and to use only enzymes involved in the metabolic pathway. Use of recombinant mesophiles producing thermophilic enzymes at high temperature results in denaturation of indigenous proteins and elimination of undesired side reactions; consequently, highly selective and stable biocatalytic modules can be readily prepared. By rationally combining those modules together, artificial synthetic pathways specialized for chemical manufacturing could be designed and constructed. Results A chimeric Embden-Meyerhof (EM pathway with balanced consumption and regeneration of ATP and ADP was constructed by using nine recombinant E. coli strains overproducing either one of the seven glycolytic enzymes of Thermus thermophilus, the cofactor-independent phosphoglycerate mutase of Pyrococcus horikoshii, or the non-phosphorylating glyceraldehyde-3-phosphate dehydrogenase of Thermococcus kodakarensis. By coupling this pathway with the Thermus malate/lactate dehydrogenase, a stoichiometric amount of lactate was produced from glucose with an overall ATP turnover number of 31. Conclusions In this study, a novel and simple technology for flexible design of a bespoke metabolic pathway was developed. The concept has been testified via a non-ATP-forming chimeric EM pathway. We designated this technology as “synthetic metabolic engineering”. Our technology is, in principle, applicable to all thermophilic enzymes as long as they can be functionally expressed in the host, and thus would be

  6. Geomicrobiological exploration and characterization of novel deep-sea hydrothermal activities accompanying with extremely acidic white smokers and elemental sulfur chimneys at the TOTO caldera in the Mariana Volcanic Arc

    Science.gov (United States)

    Takai, K.; Nakagawa, T.; Suzuki, Y.; Hirayama, H.; Kosaka, A.; Tsunogai, U.; Gamo, T.; Nealson, K. H.; Horikoshi, K.

    2004-12-01

    Novel hydrothermal activities accompanying effluent white smokers and elemental sulfur chimney structures at the northeast lava dome of the TOTO caldera depression in the Mariana Volcanic Arc were explored by the manned submersible Shinkai 6500 and characterized by geochemical and microbiological surveys. The white smoker hydrothermal fluids were observed in the potential hydrothermal activity center of the field and represented a maximal temperature of 172 degree C and a lowest pH of 1.59, that was the lowest pH of the hydrothermal fluid ever recorded. The chimney structures consisting all of elemental sulfur (sulfur chimney) were also peculiar to the TOTO caldera hydrothermal field in the world. The geochemical characterization strongly suggested that the TOTO caldera hydrothermal field was a novel system driven by subseafloor mixing between the oxygenated seawater and the superheated volcanic gasses. Microbial community structures in a sulfur chimney structure and its formation hydrothermal fluid with a high concentration of hydrogen sulfide (15 mM) were investigated by culture-dependent and _|independent analyses. Ribosomal rRNA gene clone analysis and fluorescence in situ hybridization (FISH) analysis revealed that epsilon-Proteobacteria, specifically classified into Group G and Group B, dominated the microbial communities in the sulfur chimney structure and formed a dense microbial mat covering the sulfur chimney surface. Archaeal phylotypes were consistently minor components in the communities and related to the genera Thermococcus, Pyrodictium, Aeropyrum, and the uncultivated archaeal group of Deep-sea Hydrothermal Vent Euryarchaeotal Group. Cultivation analysis suggested that the microbial components inhabiting in the sulfur chimney structure might be entrained by hydrothermal fluids from the potential subsurface habitats

  7. Electrostatic contribution of surface charge residues to the stability of a thermophilic protein: benchmarking experimental and predicted pKa values.

    Directory of Open Access Journals (Sweden)

    Chi-Ho Chan

    Full Text Available Optimization of the surface charges is a promising strategy for increasing thermostability of proteins. Electrostatic contribution of ionizable groups to the protein stability can be estimated from the differences between the pKa values in the folded and unfolded states of a protein. Using this pKa-shift approach, we experimentally measured the electrostatic contribution of all aspartate and glutamate residues to the stability of a thermophilic ribosomal protein L30e from Thermococcus celer. The pKa values in the unfolded state were found to be similar to model compound pKas. The pKa values in both the folded and unfolded states obtained at 298 and 333 K were similar, suggesting that electrostatic contribution of ionizable groups to the protein stability were insensitive to temperature changes. The experimental pKa values for the L30e protein in the folded state were used as a benchmark to test the robustness of pKa prediction by various computational methods such as H++, MCCE, MEAD, pKD, PropKa, and UHBD. Although the predicted pKa values were affected by crystal contacts that may alter the side-chain conformation of surface charged residues, most computational methods performed well, with correlation coefficients between experimental and calculated pKa values ranging from 0.49 to 0.91 (p<0.01. The changes in protein stability derived from the experimental pKa-shift approach correlate well (r = 0.81 with those obtained from stability measurements of charge-to-alanine substituted variants of the L30e protein. Our results demonstrate that the knowledge of the pKa values in the folded state provides sufficient rationale for the redesign of protein surface charges leading to improved protein stability.

  8. Crystal Structure and Product Analysis of an Archaeal myo-Inositol Kinase Reveal Substrate Recognition Mode and 3-OH Phosphorylation.

    Science.gov (United States)

    Nagata, Ryuhei; Fujihashi, Masahiro; Sato, Takaaki; Atomi, Haruyuki; Miki, Kunio

    2015-06-09

    The TK2285 protein from Thermococcus kodakarensis was recently characterized as an enzyme catalyzing the phosphorylation of myo-inositol. Only two myo-inositol kinases have been identified so far, the TK2285 protein and Lpa3 from Zea mays, both of which belong to the ribokinase family. In either case, which of the six hydroxyl groups of myo-inositol is phosphorylated is still unknown. In addition, little is known about the myo-inositol binding mechanism of these enzymes. In this work, we determined two crystal structures: those of the TK2285 protein complexed with the substrates (ATP analogue and myo-inositol) or the reaction products formed by the enzyme. Analysis of the ternary substrates-complex structure and site-directed mutagenesis showed that five residues were involved in the interaction with myo-inositol. Structural comparison with other ribokinase family enzymes indicated that two of the five residues, Q136 and R140, are characteristic of myo-inositol kinase. The crystal structure of the ternary products-complex, which was prepared by incubating the TK2285 protein with myo-inositol and ATP, holds 1d-myo-inositol 3-phosphate (Ins(3)P) in the active site. NMR and HPLC analyses with a chiral column also indicated that the TK2285 reaction product was Ins(3)P. The results obtained here showed that the TK2285 protein specifically catalyzes the phosphorylation of the 3-OH of myo-inositol. We thus designated TK2285 as myo-inositol 3-kinase (MI3K). The precise identification of the reaction product should provide a sound basis to further explore inositol metabolism in Archaea.

  9. Universal distribution of mutational effects on protein stability, uncoupling of protein robustness from sequence evolution and distinct evolutionary modes of prokaryotic and eukaryotic proteins

    Science.gov (United States)

    Faure, Guilhem; Koonin, Eugene V.

    2015-05-01

    Robustness to destabilizing effects of mutations is thought of as a key factor of protein evolution. The connections between two measures of robustness, the relative core size and the computationally estimated effect of mutations on protein stability (ΔΔG), protein abundance and the selection pressure on protein-coding genes (dN/dS) were analyzed for the organisms with a large number of available protein structures including four eukaryotes, two bacteria and one archaeon. The distribution of the effects of mutations in the core on protein stability is universal and indistinguishable in eukaryotes and bacteria, centered at slightly destabilizing amino acid replacements, and with a heavy tail of more strongly destabilizing replacements. The distribution of mutational effects in the hyperthermophilic archaeon Thermococcus gammatolerans is significantly shifted toward strongly destabilizing replacements which is indicative of stronger constraints that are imposed on proteins in hyperthermophiles. The median effect of mutations is strongly, positively correlated with the relative core size, in evidence of the congruence between the two measures of protein robustness. However, both measures show only limited correlations to the expression level and selection pressure on protein-coding genes. Thus, the degree of robustness reflected in the universal distribution of mutational effects appears to be a fundamental, ancient feature of globular protein folds whereas the observed variations are largely neutral and uncoupled from short term protein evolution. A weak anticorrelation between protein core size and selection pressure is observed only for surface residues in prokaryotes but a stronger anticorrelation is observed for all residues in eukaryotic proteins. This substantial difference between proteins of prokaryotes and eukaryotes is likely to stem from the demonstrable higher compactness of prokaryotic proteins.

  10. Europlanet 2020: Fostering the collaboration between professional scientists and amateur astronomers

    Science.gov (United States)

    Scherf, M.; Kargl, G.; Tautvaisiene, G.; Al-Ubaidi, T.

    2017-09-01

    The Horizon 2020 advanced research infrastructure project Europlanet 2020 aims to strengthen the collaboration in European planetary sciences. One of the major goals of the project's Work Package NA1 Task 12.5 "Coordination of ground-based observations" is to foster the cooperation between professional planetary scientists and amateur astronomers in Europe. This presentation will give an overview on Europlanet 2020 and will summarize the major activities of NA1-Task 12.5, focusing on how the project supports the activities of amateur astronomers and their collaboration with professional scientists in Europe. This will also include an overview on funding possibilities for amateur astronomers.

  11. Effect of substitution of titanium by magnesium and niobium on ...

    Indian Academy of Sciences (India)

    Administrator

    Therefore, the lead-free ceramics of (Bi1/2Na1/2). Ti1–x(Mg1/3Nb2/3)xO3 were prepared, and the effect of complex ions substitution of (Mg1/3Nb2/3)4+ for Ti4+ in the. B-sites for (Bi1/2Na1/2)TiO3 perovskite lattice on structure and piezoelectric properties was investigated. 2. Experimental. High-purity Bi2O3, Na2CO3, TiO2, ...

  12. Genetic diversity of Phytophthora ramorum in Belgium

    Science.gov (United States)

    Annelies Vercauteren; Isabelle De Dobbelaere; Martine Maes; Kurt Heungens

    2010-01-01

    Phytophthora ramorum is thought to be an introduced pathogen in North America and in Europe based on the presence of only three clonal lineages. The North American lineages (NA1 and NA2) are responsible for infections in North American forests and nurseries, while the European lineage (EU1) is responsible for infections in Europe, mostly in...

  13. Virulence, sporulation, and elicitin production in three clonal lineages of Phytophthora ramorum

    Science.gov (United States)

    Daniel Manter; Everett Hansen; Jennifer. Parke

    2010-01-01

    Phytophthora ramorum populations are clonal and consist of three clonal lineages: EU1 is the only lineage found in Europe with a few isolated nursery infections in the USA; NA1 is associated with natural infestations in California and Oregon as well as some nursery infections in North America, and NA2 has a limited distribution and has only...

  14. Dissolution Dynamic Nuclear Polarization of Non-Self-Glassing Agents: Spectroscopy and Relaxation of Hyperpolarized [1-13C]Acetate

    DEFF Research Database (Denmark)

    Flori, Alessandra; Liserani, Matteo; Bowen, Sean

    2015-01-01

    The intrinsic physicochemical properties of the sample formulation are the key factors for efficient hyperpolarization through dissolution dynamic nuclear polarization (dissolution-DNP). We provide a comprehensive characterization of the DNP process for Na-[1-13C]acetate selected as a model for non...

  15. Effect of substitution of titanium by magnesium and niobium on ...

    Indian Academy of Sciences (India)

    Administrator

    Effect of substitution of titanium by magnesium and niobium on structure and piezoelectric properties in (Bi1/2. Na1/2. )TiO3 ceramics. ZHOU CHANG-RONG*, LIU XIN-YU, LI WEI-ZHOU. † and YUAN CHANG-LAI. Department of Information Material Science and Engineering, Guilin University of Electronic Technology,. Guilin ...

  16. Untitled

    African Journals Online (AJOL)

    (Mathematics Department, ENSAnnexe Bambili -University of Yaounde 1). ABSTRACT. Mathematics is compulsory in secondary .... predominant in the University of Yaoundé. But mas- sive failure in mathematics is also ...... Mathematics Learning, For the Learning of Mathematics, vol.3, na. 1, pp 16-23. LERMAN, S. (1989) ...

  17. Search for doubly radiative np capture

    International Nuclear Information System (INIS)

    Miller, P.D.

    1974-01-01

    In the lecture the attempts are briefly reviewed that try to explain the 8% discrepancy between the experimental measurements and theoretical calculations of the np capture cross section. The experiment on doubly radiative np capture using two Na 1 (Tl) crystals with two RCA type 4522 fast photomultipliers is described

  18. General view of the Experimental Hall EHN1 in the SPS North Area.

    CERN Multimedia

    CERN PhotoLab

    1978-01-01

    By May 1978 the first hadron beam H8 from target T4 was commissioned together with the experiment NA3. By the end of 1978 also the beam H4, with its two branches E4 for electrons and photons to NA1 and N4 for neutrons to NA6 was running successfully.

  19. 40 CFR 1045.107 - What are the not-to-exceed emission standards?

    Science.gov (United States)

    2010-07-01

    ... the applicable zone specified in § 1045.515: Table 2 to § 1045.107—NTE Multipliers for Four-Stroke... Pollutant Subzone 1 Subzone 2 HC+NOX 1.50 1.00 CO N/A 1.00 (d) For two-stroke engines not equipped with a...

  20. The reactivity of CysF9[93]β sulphydryl group of des- HisHC3[146]β ...

    African Journals Online (AJOL)

    Administrator

    2011-10-31

    Oct 31, 2011 ... This is because the electrostatic environment of the sulphydryl group has been screened off. A similar obser- vation was obtained when organic phosphate, inositol hexakisphosphate, was added. This organic phosphate is known to bind to haemoglobin at the amino acid groups,. ValNA1[1]β, HisNA2[2]β, ...

  1. 76 FR 57871 - Approval of Air Quality Implementation Plans; California; South Coast; Attainment Plan for 1997 8...

    Science.gov (United States)

    2011-09-16

    ... yet acted on this rule. FLX-02 Refinery pilot n/a....... 1.6 tpd... Not yet program. adopted. MOB-05 AB923 LDV high 0.4 tpd... 0.7 tpd... No rule emitter program. associated with this measure. MOB-06 AB923...

  2. Lipid metabolism in the northern pike (Esox LuciusL.)—3. In vivo incorporation of 1-14C-acetate in the lipids

    NARCIS (Netherlands)

    Kluytmans, J.H.F.M.; Zandee, D.I.

    1974-01-01

    1. 1. The specific radioactivity of the total lipids isolated from different organs of the northern pike (Esox lucius L.) after injection of Na-1-1 4C-acetate showed the highest values in the liver and the gills. 2. 2. In the liver, radioactivity was found mainly in the fatty acids, while in the

  3. sequence for identification and intraspecific molecular typing of ...

    Indian Academy of Sciences (India)

    2013-04-23

    Apr 23, 2013 ... adopting a soil inoculation method according to Kumar. (2006). .... Mexico. NA. 1. IIB. CP002819/20. 28. Rsw-UW551. Geranium. USA. 3. 2. IIB. EAP73194.1. 29. Rs-CMR15/CFBP6941. Tomato. Cameroon. NA. 2T. III. FP885895.1 .... isolates wilted their respective hosts within 2 weeks upon soil inoculation ...

  4. Bulletin of Materials Science | News

    Indian Academy of Sciences (India)

    pp 77-81 Composites. Effects of fibre content on mechanical properties and fracture behaviour of short carbon fibre reinforced geopolymer matrix composites ... Effect of substitution of titanium by magnesium and niobium on structure and piezoelectric properties in (Bi1/2Na1/2)TiO3 ceramics · Zhou Chang-Rong Liu Xin-Yu ...

  5. Ultrasonic and structural features of some borosilicate glasses ...

    Indian Academy of Sciences (India)

    2017-06-09

    - perature in the quaternary glass system Na1.4B2.8Six Pb0.3−x O5.2+x on the parameter x (the lines are drawn as a guide to the eye). Another important parameter that depends on both the mean ultrasonic velocity and the ...

  6. Effect of paramagnetic manganese ions doping on frequency and ...

    Indian Academy of Sciences (India)

    The manganese doped layered ceramic samples (Na1.9Li0.1)Ti3O7 : XMn(0.01 ≤ X ≤ 0.1) have been prepared using high temperature solid state reaction. The room temperature electron paramagnetic resonance (EPR) investigations exhibit that at lower percentage of doping the substitution of manganese ions occur as ...

  7. On the renewal of the denitrifying layer in the Arabian Sea

    Digital Repository Service at National Institute of Oceanography (India)

    Somasundar, K.; Naqvi, S.W.A.

    . zone. When normalized to phosphate, there appears to be a deficiency in nitrate, estimated as lambda TgNa-1, in the water upwelling at ~3 km within the d. Zone, due to the downward diffusion of nitrate deficits from the d. Layer. Assuming...

  8. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    The manganese doped layered ceramic samples (Na1.9Li0.1)Ti3O7 : XMn(0.01 ≤ X ≤ 0.1) have been prepared using high temperature solid state reaction. The room ... Smeared peaks in temperature dependence of permittivity plots suggest diffuse nature of high temperature ferroelectric phase transition. The light ...

  9. Biosynthesis and composition of sterols and sterol esters in the land snail Cepaea nemoralis (L.) (gastropoda, pulmonata, stylommatophora)

    NARCIS (Netherlands)

    Horst, D.J. van der; Voogt, P.A.

    1972-01-01

    1. 1. The biosynthesis and composition of sterols and sterol esters were studied in the land snail Cepaea nemoralis after injection of Na-1-14C-acetate. 2. 2. Free and esterified sterols appeared to be synthesized by the animals, whilst the specific radioactivity of the sterols from the esters

  10. Bulletin of Materials Science | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    pp 677-682. Electrochemical and optical properties of a new donor–acceptor type conjugated polymer derived from 3,4–didodecyloxythiophene ... pp 691-696. Effect of paramagnetic manganese ions doping on frequency and high temperature dependence dielectric response of layered Na1.9Li0.1Ti3O7 ceramics.

  11. The RecJ2 protein in the thermophilic archaeon Thermoplasma acidophilum is a 3'-5' exonuclease that associates with a DNA replication complex.

    Science.gov (United States)

    Ogino, Hiromi; Ishino, Sonoko; Kohda, Daisuke; Ishino, Yoshizumi

    2017-05-12

    RecJ/cell division cycle 45 (Cdc45) proteins are widely conserved in the three domains of life, i.e. in bacteria, Eukarya, and Archaea. Bacterial RecJ is a 5'-3' exonuclease and functions in DNA repair pathways by using its 5'-3' exonuclease activity. Eukaryotic Cdc45 has no identified enzymatic activity but participates in the CMG complex, so named because it is composed of Cdc45, minichromosome maintenance protein complex (MCM) proteins 2-7, and GINS complex proteins (Sld5, Psf11-3). Eukaryotic Cdc45 and bacterial/archaeal RecJ share similar amino acid sequences and are considered functional counterparts. In Archaea, a RecJ homolog in Thermococcus kodakarensis was shown to associate with GINS and accelerate its nuclease activity and was, therefore, designated GAN ( G INS- a ssociated n uclease); however, to date, no archaeal RecJ·MCM·GINS complex has been isolated. The thermophilic archaeon Thermoplasma acidophilum has two RecJ-like proteins, designated TaRecJ1 and TaRecJ2. TaRecJ1 exhibited DNA-specific 5'-3' exonuclease activity, whereas TaRecJ2 had 3'-5' exonuclease activity and preferred RNA over DNA. TaRecJ2, but not TaRecJ1, formed a stable complex with TaGINS in a 2:1 molar ratio. Furthermore, the TaRecJ2·TaGINS complex stimulated activity of TaMCM ( T. acidophilum MCM) helicase in vitro , and the TaRecJ2·TaMCM·TaGINS complex was also observed in vivo However, TaRecJ2 did not interact with TaMCM directly and was not required for the helicase activation in vitro These findings suggest that the function of archaeal RecJ in DNA replication evolved divergently from Cdc45 despite conservation of the CMG-like complex formation between Archaea and Eukarya. © 2017 by The American Society for Biochemistry and Molecular Biology, Inc.

  12. Diversity and distribution of microbes in deep-sea sub-vent systems, using newly designed in situ growth chambers

    Science.gov (United States)

    Higashi, Y.; Sunamura, M.; Utsumi, M.; Urabe, T.; Maruyama, A.

    2004-12-01

    Subsurface of deep-sea hydrothermal vent environments is one of the most difficult fields on the Earth to approach and collect reliable samples for microbiological study. In our Archaean Park project, we developed in situ incubation instruments to directly collect microbes from sub-vent fields through a drilled borehole. After excavation using a portable submarine driller (BMS) around deep-sea hydrothermal vents in the Suiyo Seamount on the Izu-Bonin Arc (2001, 2002) and the South Mariana (2003), microbial diversity was examined in samples collected from the boreholes, as well as natural vents, using catheter- and column-type in situ growth chambers. In the catheter samples collected from the Suiyo Seamount, several novel phylotypes of microbial SSU rRNA genes were assigned within epsilon-Proteobacteria and hyperthermophile-related Euryarchaea groups. The former novel epsilon group (SSSV-BE1) was also detected in the South Mariana, but they only appeared in the catheter samples collected just below the venting seafloor. These suggest that the group must be significant in warm, shallow and microaerobic sub-vent layers over the sea, at least in the northwest Pacific Ocean. The column-type in situ growth chamber was specially designed for creating and maintaining physico-chemical gradients in a ca. 40-cm-long column situated on an active vent. In Suiyo Seamount samples (vent temp.: ca. 30-100 degree C), a unique vertical profile was found in the diversity of Archaea. At the column bottom, most of the clones were assigned to be members within the lithoautotrophic thermophilic Ignicoccus, while heterotrophic thermophilic Thermococcus were abundant at the column top. Similar vertical profile has also been appeared in the column samples from the South Mariana. Further quantitative population analysis is now under going using these samples. Our approach to the sub-vent biosphere by the combination of drilling and in situ incubation is almost sure to give us important clues

  13. Marine Subsurface Microbial Communities Across a Hydrothermal Gradient in Okinawa Trough Sediments

    Science.gov (United States)

    Brandt, L. D.; Hser Wah Saw, J.; Ettema, T.; House, C. H.

    2015-12-01

    IODP Expedition 331 to the Okinawa backarc basin provided an opportunity to study the microbial stratigraphy within the sediments surrounding a hydrothermal vent. The Okinawa backarc basin is a sedimented region of the seafloor located on a continental margin, and also hosts a hydrothermal network within the subsurface. Site C0014 within the Iheya North hydrothermal field is located 450 m east of the active vent and has a surface temperature of 5°C with no evidence of hydrothermal alteration within the top 10 meters below sea floor (mbsf). Temperature increases with depth at an estimated rate of 3°C/m and transitions from non-hydrothermal margin sediments to a hydrothermally altered regime below 10 mbsf. In this study, we utilized deep 16S rRNA sequencing of DNA from IODP Expedition 331 Site C0014 sediment horizons in order to assess diversity throughout the sediment column as well as determine the potential limits of the biosphere. Analysis of the amplicon data shows a shift over 15 mbsf from a heterogeneous community of cosmopolitan marine subsurface taxa toward an archaeal-dominated community in the deepest horizons of the predicted biosphere. Notably, the phylum Chloroflexi represents a substantial taxon through most horizons, where it appears to be replaced below 10 mbsf by punctuations of thermophilic and methanotrophic Archaea and Miscellaneous Crenarchaeotic Group abundances. DNA from the aforementioned transition horizons was further analyzed using metagenomic sequencing. Preliminary taxonomic analysis of the metagenomic data agrees well with amplicon data in capturing the shift in relative abundance of Archaea increasing with depth. Additionally, reverse gyrase, a gene found exclusively in hyperthermophilic microorganisms, was recovered only in the metagenome of the deepest horizon. A BLAST search of this protein sequence against the GenBank non-redudnant protein database produced top hits with reverse gyrase from Thermococcus and Pyrococcus, which are

  14. Distribution of Archaeal Communities along the Coast of the Gulf of Finland and Their Response to Oil Contamination

    Science.gov (United States)

    Yan, Lijuan; Yu, Dan; Hui, Nan; Naanuri, Eve; Viggor, Signe; Gafarov, Arslan; Sokolov, Sergei L.; Heinaru, Ain; Romantschuk, Martin

    2018-01-01

    archaeal core species network plausibly revealed resilience and the potential for oil degradation. Halobacteriaceae and putative cytochrome P450 pathways were significantly enriched in the oil-contaminated littoral sediment. The archaeal taxa formed highly interconnected and interactive networks, in which Halobacteriaceae, Thermococcus, and methanogens were the main components, implying a potential relevant trophic connection between hydrocarbon degradation, methanogenesis, sulfate reduction, and/or fermentative growth. PMID:29410652

  15. Evolution of mal ABC transporter operons in the Thermococcales and Thermotogales

    Directory of Open Access Journals (Sweden)

    Gogarten J Peter

    2008-01-01

    Full Text Available Abstract Background The mal genes that encode maltose transporters have undergone extensive lateral transfer among ancestors of the archaea Thermococcus litoralis and Pyrococcus furiosus. Bacterial hyperthermophiles of the order Thermotogales live among these archaea and so may have shared in these transfers. The genome sequence of Thermotoga maritima bears evidence of extensive acquisition of archaeal genes, so its ancestors clearly had the capacity to do so. We examined deep phylogenetic relationships among the mal genes of these hyperthermophiles and their close relatives to look for evidence of shared ancestry. Results We demonstrate that the two maltose ATP binding cassette (ABC transporter operons now found in Tc. litoralis and P. furiosus (termed mal and mdx genes, respectively are not closely related to one another. The Tc. litoralis and P. furiosus mal genes are most closely related to bacterial mal genes while their respective mdx genes are archaeal. The genes of the two mal operons in Tt. maritima are not related to genes in either of these archaeal operons. They are highly similar to one another and belong to a phylogenetic lineage that includes mal genes from the enteric bacteria. A unique domain of the enteric MalF membrane spanning proteins found also in these Thermotogales MalF homologs supports their relatively close relationship with these enteric proteins. Analyses of genome sequence data from other Thermotogales species, Fervidobacterium nodosum, Thermosipho melanesiensis, Thermotoga petrophila, Thermotoga lettingae, and Thermotoga neapolitana, revealed a third apparent mal operon, absent from the published genome sequence of Tt. maritima strain MSB8. This third operon, mal3, is more closely related to the Thermococcales' bacteria-derived mal genes than are mal1 and mal2. F. nodosum, Ts. melanesiensis, and Tt. lettingae have only one of the mal1-mal2 paralogs. The mal2 operon from an unknown species of Thermotoga appears to

  16. An In Vitro Enzyme System for the Production of myo-Inositol from Starch.

    Science.gov (United States)

    Fujisawa, Tomoko; Fujinaga, Shohei; Atomi, Haruyuki

    2017-08-15

    We developed an in vitro enzyme system to produce myo -inositol from starch. Four enzymes were used, maltodextrin phosphorylase (MalP), phosphoglucomutase (PGM), myo -inositol-3-phosphate synthase (MIPS), and inositol monophosphatase (IMPase). The enzymes were thermostable: MalP and PGM from the hyperthermophilic archaeon Thermococcus kodakarensis , MIPS from the hyperthermophilic archaeon Archaeoglobus fulgidus , and IMPase from the hyperthermophilic bacterium Thermotoga maritima The enzymes were individually produced in Escherichia coli and partially purified by subjecting cell extracts to heat treatment and removing denatured proteins. The four enzyme samples were incubated at 90°C with amylose, phosphate, and NAD + , resulting in the production of myo -inositol with a yield of over 90% at 2 h. The effects of varying the concentrations of reaction components were examined. When the system volume was increased and NAD + was added every 2 h, we observed the production of 2.9 g myo -inositol from 2.9 g amylose after 7 h, achieving gram-scale production with a molar conversion of approximately 96%. We further integrated the pullulanase from T. maritima into the system and observed myo -inositol production from soluble starch and raw potato with yields of 73% and 57 to 61%, respectively. IMPORTANCE myo -Inositol is an important nutrient for human health and provides a wide variety of benefits as a dietary supplement. This study demonstrates an alternative method to produce myo -inositol from starch with an in vitro enzyme system using thermostable maltodextrin phosphorylase (MalP), phosphoglucomutase (PGM), myo -inositol-3-phosphate synthase, and myo -inositol monophosphatase. By utilizing MalP and PGM to generate glucose 6-phosphate, we can avoid the addition of phosphate donors such as ATP, the use of which would not be practical for scaled-up production of myo -inositol. myo -Inositol was produced from amylose on the gram scale with yields exceeding 90

  17. The whole blood oxygen binding properties of a large but presumably sluggish polar elasmobranch, the Greenland shark Somniosus microcephalus

    DEFF Research Database (Denmark)

    Steffensen, John Fleng

    2012-01-01

    Australian and New Zealand Society for Comparative Physiology and Biochemistry. Auckland, N.Z., December 2012. Herbert, N.A.1, Skov, p.V.l, Tirsgaard, B.z and Steffensen, J.F. Z Only a few species of elasmobranch live in cold polar waters and the Greenland shark (Somniosus microcephalus) is the m......Australian and New Zealand Society for Comparative Physiology and Biochemistry. Auckland, N.Z., December 2012. Herbert, N.A.1, Skov, p.V.l, Tirsgaard, B.z and Steffensen, J.F. Z Only a few species of elasmobranch live in cold polar waters and the Greenland shark (Somniosus microcephalus......) is the most notable example. These extremely large and long-lived sharks are thought to be sluggish but their active hunting lifestyle has recently been questioned by the finding of mobile prey species in their stomach (i.e. squid, fish and seal). The whole blood oxygen binding property of S. microcephalus...

  18. The second sodium site in the dopamine transporter controls cation permeability and is regulated by chloride

    DEFF Research Database (Denmark)

    Borre, Lars; Andreassen, Thorvald F; Shi, Lei

    2014-01-01

    The dopamine transporter (DAT) belongs to the family of neurotransmitter:sodium symporters (NSSs) and controls dopamine (DA) homeostasis by mediating Na(+)- and Cl(-)-dependent reuptake of DA. Here we used two-electrode voltage clamp measurements in Xenopus oocytes together with targeted...... mutagenesis to investigate the mechanistic relationship between DAT ion binding sites and transporter conductances. In Li(+), DAT displayed a cocaine-sensitive cation leak current ~10-fold larger than the substrate-induced current in Na(+). Mutation of Na(+)-coordinating residues in the first (Na1) and second...... (Na2) binding sites suggested that the Li(+) leak depends on Li(+) interaction with Na2 rather than Na1. DA caused a marked inhibition of the Li(+) leak, consistent with the ability of the substrate to interact with the Li(+)-occupied state of the transporter. The leak current in Li(+) was also...

  19. 31P and 29Si NMR investigations of the structure of NASICON-compounds

    International Nuclear Information System (INIS)

    Jaeger, C.; Scheler, G.; Barth, S.; Feltz, A.

    1988-01-01

    First systematic NMR investigations of several NASICON compounds are described. In the original NASICON Na 1+x Zr 2 (SiO 4 ) x (PO 4 ) 3-x the observed down-field shift (for increasing x) of both 31 P and 29 Si MAS NMR lines is explained by a change of the net atomic charge of the zirconium atoms caused by the substitution of the lattice positions of phosphorus by silicon atoms. The 'von Alpen' compound Na 4 ZrSi 3 O 10 consists of two phases; the crystalline Na 4 Zr 2 (SiO 4 ) 3 and the glassy phase 2 Na 2 O · 3 SiO 2 . Moreover, it is shown that NMR can be used to investigate the statistical substitution of lattice positions of the zirconium atoms by magnesium atoms in the mixed crystals Na 1+2x Mg x Zr 2-x (PO 4 ) 3 . (author)

  20. Journal of Chemical Sciences | Indian Academy of Sciences

    Indian Academy of Sciences (India)

    B3LYP/6-31G() calculations were performed to obtain all the transition states and products for the 128 distinct reaction channels of Diels-Alder reactions by taking all possible combinations from a series of dienes (1N-a, 1N-b, 2N, 1P-a, 1P-b, 2P, 1O, 1S) and dienophiles (NE, PE, OE, SE, AE, OHE, MeE, CNE).

  1. Case report and a review of Literature

    African Journals Online (AJOL)

    She was transfused with 150ml of packed cells. (haematocrit was 17%) in ... sensible fluid losses (300ml/M°/day) and urine volume in the previous 24 hours. Protein ... Protein (15–45mg/dl) 85. Glucose (2.7 – 3.9mmol/L) 1.2. Urine. Protein ,. Specific gravity (1.025 – 1.035). FeNa (1%) ---,. Creatinine clearance SAAAAAAAS.

  2. Iron-based superconductors via soft chemistry

    International Nuclear Information System (INIS)

    Friederichs, Gina Maya

    2015-01-01

    This thesis provides new soft chemistry approaches to Fe-based superconductors. Mild syntheses were demonstrated to be able to overcome difficulties, occurring in conventional synthesis and to enable the access to new metastable phases. A solvent-based metathesis reaction led to β-FeSe exclusively. Contrary to solid state syntheses, the formation of hexagonal α-FeSe could be avoided under mild conditions. The deintercalation of interstitial Fe (by formation of Fe 3 O 4 ) could be proven by low temperature O 2 -annealing of Fe 1+x Te 1-y Se y . By using redox (de)intercalations K 1-x Fe 2-y Se 2 , metastable Na 1-x Fe 2-y As 2 and Na 1-x ((Fe 1-y Co y ) 1-z As) 2 could successfully be obtained at room temperature. The mild synthesis conditions led to compounds like FeSe and K 1-x Fe 2-y Se 2 which exhibited different physical properties than found by conventional high temperature methods. In general, the developed (de)intercalation reactions represent a new, universally applicable tool in order to manipulate the structure along with the properties of Fe-based superconductors. The basic structural features of the characteristic FeX 4/4 tetrahedral layers, however, are preserved. Soft chemistry syntheses have been shown to allow the formation of a variety of phases, like Na 1-x Fe 2-y As 2 , Na 1-x ((Fe 1-y Co y ) 1-z As) 2 and K 1-x Fe 2-y Se 2 . Hence, especially low temperature approaches may enable the realization of complex stacking sequences, potentially leading to the fulfillment of the greatest goal in the research of superconductors - room temperature superconductivity.

  3. Coherence and Chaos Phenomena in Josephson Oscillators for Superconducting Electronics.

    Science.gov (United States)

    1989-01-25

    Army through Contract No. DAJA- truzione (Italy). 45-85-C-0042, the Thomas B. Thriges Fond (Denmark), l’re~ent address: Istituto di Cibernetica del CNR...qiiesto articolo ai applica la teoria di ’Mclnikov per predire analiticarnonto la pre- seimi di caost (SmIale-horscghoc) inl uii pendolo cuitlutigliczza...Istituto di Cibernetica del Consiglio Na. 1 FFT2C routine, IMSL Inc., International Mathematical and zionale delle Ricerche, via Toiano 6, 1-80072

  4. Impacts of DNAPL Source Treatment: Experimental and Modeling Assessment of the Benefits of Partial DNAPL Source Removal

    Science.gov (United States)

    2009-09-01

    into segments separated by Norprene rubber washers to prevent vertical water flow in the PFM. A sample of the sorbent is collected for analysis of...of loose, well-graded sandy, cobbly gravel or gravelly sand). In the immediate vicinity of NA1, this unit is underlain by Vashon Till (consisting of...underlain by more Vashon Recessional Outwash/Steilacoom gravel or Vashon Advance Outwash (loose sandy gravel to gravelly sand with cobbles ). The

  5. Cancer Risks Associated With Inherited Mutations in Ovarian Cancer Susceptibility Genes Beyond BRCA1 and BRCA2

    Science.gov (United States)

    2017-05-01

    5 5. Changes /Problems 6 6. Products 6 7. Participants & Other Collaborating Organizations 7 8. Appendices NA 1. INTRODUCTION Ovarian, peritoneal...TERMS Ovarian cancer, drug resistance , rucaparib, phase 2, DNA repair, homologous recombination, nonhomologous end-joining (NHEJ), poly(ADP-ribose...who were eager to send us AA patients at the time we proposed this study, the change in clinical testing has hampered our enrollment. Please see

  6. A Pilot Study of Common Bile Duct Reconstruction with CorMatrix Extracellular Matrix in Swine (Sus scrofa)

    Science.gov (United States)

    2015-02-06

    degree of pain or distress experienced by study animals , or have animals of lower phylogenetic status or sentience been identified as potential study...60th Medical Group (AMC), Travis AFB, CA INSTITUTIONAL ANIMAL CARE AND USE COMMITTEE (IACUC) FINAL REPORT SUMMARY (Please~ all information. Use...TRIENNIAL REVISION DATE: N/A 1. RECORD OF ANIMAL USAGE: Animal Species: Total # Approved # Used this FY Total #Used to Date Swine (Sus scrofa) 10 10 10 2

  7. Turvalisus kõigepealt / Jukka Antila

    Index Scriptorium Estoniae

    Antila, Jukka

    2015-01-01

    TM võrdleb suverehve. Testiauto: Volkswagen Golf. Rehvimõõt: 205/55 R 16. Rehvid: Apollo Alnac 4G, Barum Bravuris 3 HM, Continental ContiPremiumContact 5, Dunlop Sport Blu Response, Firestone Firehawk TZ300, Goodride Sport SA-37, Goodyear Efficient Grip Performance, Hankook Ventus Prime 2, Kumho Solus HS51, Landsail LS 588 UHP, Michelin Primacy 3, Nankang Econex NA-1, Nokian Hakka Blue, Pirelli Cinturato P7 Blue, Vredestein Sportrac 5 Giugiaro

  8. Superconductivity and magnetism in iron sulfides intercalated by metal hydroxides.

    Science.gov (United States)

    Zhou, Xiuquan; Eckberg, Christopher; Wilfong, Brandon; Liou, Sz-Chian; Vivanco, Hector K; Paglione, Johnpierre; Rodriguez, Efrain E

    2017-05-01

    Inspired by naturally occurring sulfide minerals, we present a new family of iron-based superconductors. A metastable form of FeS known as the mineral mackinawite forms two-dimensional sheets that can be readily intercalated by various cationic guest species. Under hydrothermal conditions using alkali metal hydroxides, we prepare three different cation and metal hydroxide-intercalated FeS phases including (Li 1- x Fe x OH)FeS, [(Na 1- x Fe x )(OH) 2 ]FeS, and K x Fe 2- y S 2 . Upon successful intercalation of the FeS layer, the superconducting critical temperature T c of mackinawite is enhanced from 5 K to 8 K for the (Li 1- x Fe x OH) δ + intercalate. Layered heterostructures of [(Na 1- x Fe x )(OH) 2 ]FeS resemble the natural mineral tochilinite, which contains an iron square lattice interleaved with a hexagonal hydroxide lattice. Whilst heterostructured [(Na 1- x Fe x )(OH) 2 ]FeS displays long-range magnetic ordering near 15 K, K x Fe 2- y S 2 displays short range antiferromagnetism.

  9. Structural effects on the electronic characteristics of intramolecularly intercalated alkali-rubrene complexes

    International Nuclear Information System (INIS)

    Li, Tsung-Lung; Lu, Wen-Cai

    2016-01-01

    The geometric and electronic structures of neutral monolithium- and monosodium-rubrene (Li 1 Rub and Na 1 Rub) isomers are investigated and compared with monopotassium-rubrene (K 1 Rub). Based on the alkali binding site, all isomers of these alkali-rubrene complexes can be subdivided into two types: intramolecularly intercalated and extramolecularly adsorbed. The minimum-energy Li 1 Rub and Na 1 Rub are intercalated structures, whereas the minimum-energy K 1 Rub is adsorbed. The fact that the intercalated Li 1 Rub and Na 1 Rub structures are energetically favorable over the adsorbed ones can be explained by two energy rules. First, “double” proximity of the intercalating alkali element to a pair of phenyl side groups enormously reduces the total energy. Second, accommodation of a minuscule intercalant does not significantly deform the carbon frame and, thus, increases the energy only by a small amount. Additionally, the peculiar effects of intramolecular intercalation on the electronic structures of molecules are also studied in this simulation of monoalkali intercalation. In the monoalkali-intercalated rubrene complex, only one of the two pairs of phenyl groups of rubrene is intercalated, intentionally leaving another pair pristine, which facilitates the comparison of electronic structures between the intercalated and pristine pairs of phenyl side groups in a single molecule. The uniformity of chemical environments of the phenyl groups of the intercalated Li 1 Rub/Na 1 Rub is deteriorated by the incorporation of the intercalant, and leads to their spectral characteristics in contrast to K 1 Rub. In particular, the introduction of the intercalant promotes the carbon 2p orbitals of the intercalated phenyl pair to take part in the electronic structures of the HOMO and LUMO peaks of Li 1 Rub/Na 1 Rub. The unpaired electron in the HOMO is delocalized over the backbone with higher probability of distributing over the central two fused rings than over the outer two

  10. Microbial Life in the Subseafloor at Mid-Ocean Ridges: A Key to Understanding Ancient Ecosystems on Earth and Elsewhere?

    Science.gov (United States)

    Baross, J. A.; Delaney, J. R.

    2001-12-01

    indicates that they originated from a hot subseafloor habitat. Based on the 16S rRNA sequences and the RFLP patterns of the 500 base sequence between the 16S and 23S rRNA genes (intergenic spacer region), these heterotrophic archaea represent new species, and a new genus, within the Thermococcales (Summit and Baross, 1998; 2001). These isolates grow over an unusually wide temperature range and in low levels of organic material. While Thermococcus and Methanococcus species are the most commonly isolated species of hyperthermophiles from subseafloor biotopes, preliminary phylogenetic analyses based on 16S rRNA sequences of microbial communities in the diffuse flow fluids at new eruption sites show a high diversity of archaea that are not related to cultured organisms. Results to date support the hypothesis that subseafloor microbes associated with hydrothermal systems have nutritional, physiological and bioenergetic characteristics that reflect the physical and geochemical properties of their habitat. Moreover, we propose that deep-sea subsurface environments are analogs of ecosystems on other solar bodies. Thus, by examining the chemical and microbial ecology and energetics of the subsurface, and particularly the subsurface associated with hydrothermal systems, a framework for studying the prospects of extraterrestrial life can be developed. It is predicted that if there were life on other hydrothermally active solar bodies, the same energy sources would fuel microbial metabolism even though the molecular characteristics of these life forms may not resemble Earth organisms having identical metabolisms.

  11. Regulation of methane genes and genome expression

    Energy Technology Data Exchange (ETDEWEB)

    John N. Reeve

    2009-09-09

    , designated TFE, that had sequences in common with the eukaryotic general transcription factor TFIIE, stimulated archaeal transcription initiation and that the archaeal TATA-box binding protein (TBP) remained attached to the promoter region whereas the transcription factor TFB dissociated from the template DNA following initiation. DNA sequences that directed the localized assembly of archaeal histones into archaeal nucleosomes were identified, and we established that transcription by an archaeal RNA polymerase was slowed but not blocked by archaeal nucleosomes. We developed a new protocol to purify archaeal RNA polymerases and with this enzyme and additional improvements to the in vitro transcription system, we established the template requirements for archaeal transcription termination, investigated the activities of proteins predicted to be methane gene regulators, and established how TrpY, a novel archaeal regulator of expression of the tryptophan biosynthetic operon functions in M. thermautotrophicus. This also resulted in the discovery that almost all M. thermautotrophicus mutants isolated as spontaneously resistant to 5-methyl tryptophan (5MTR) had mutations in trpY and were therefore 5MTR through de-repressed trp operon expression. This established a very simple, practical procedure to determine and quantify the DNA sequence changes that result from exposure of this Archaeon to any experimental mutagenesis protocol. Following the discovery that the Thermococcus kodakaraensis was amenable to genetic manipulation, we established this technology at OSU and subsequently added plasmid expression, a reporter system and additional genetic selections to the T. kodakaraensis genetic toolbox. We established that transcription and translation are coupled in this Archaeon, and by combining in vitro transcription and in vivo genetics, we documented that both TFB1 and TFB2 support transcription initiation in T. kodakaraensis. We quantified the roles of ribosome binding sequences

  12. Bone position emission tomography with or without CT Is more accurate than bone scan for detection of bone metastasis

    Energy Technology Data Exchange (ETDEWEB)

    Lee, Soo Jin; Lee, Wom Woo; Kim, Sang Eun [Dept. of Nuclear Medicine, Seoul National University Bundang Hospital, Seoul National University College of Medicine, Seongnam (Korea, Republic of)

    2013-06-15

    Na1{sup 8F} bone positron emission tomography (bone PET) is a new imaging modality which is useful for the evaluation of bone diseases. Here, we compared the diagnostic accuracies between bone PET and bone scan for the detection of bone metastasis (BM). Sixteen cancer patients (M:F = 10:6, mean age = 60 ± 12 years) who underwent both bone PET and bone scan were analyzed. Bone PET was conducted 30 minutes after the injection of 370 MBq Na1{sup 8F}, and a bone scan was performed 3 hours after the injection of 1295 MBq 9{sup 9mT}c-hydroxymethylene diphosphonate. In the patient-based analysis (8 patients with BM and 8 without BM), the sensitivities of bone PET (100% 8/8) and bone scan (87.5% = 7/8) were not significantly different (p > 0.05), whereas the specificity of bone PET (87.5% = 7/8) was significantly greater than that of the bone scan (25% = 2/8) (p < 0.05). In the lesion-based analysis (43 lesions in 14 patients; 31 malignant and 12 benign), the sensitivity of bone PET (100% = 31/31) was significantly greater than that of bone scan (38.7% = 12/31) (p < 0.01), and the specificity of bone PET (75.0% = 9/12) was also significantly higher than that of bone scan (8.3% = 1/12) (p < 0.05). The receiver operating characteristic curve analysis showed that bone PET was significantly more accurate than the bone scan in the patient (p = 0.0306) and lesion (p = 0.0001) based analyses. Na1{sup 8F} bone PET is more accurate than bone scan for BM evaluation.

  13. An unprecedented tetranuclear niobium aqua ion with a capping μ4-sulfido ligand

    DEFF Research Database (Denmark)

    Ooi, Bee Lean; Søtofte, Inger

    2005-01-01

    A new niobium aqua ion, with an unprecedented metal-metal bonded tetranuclear Nb4(μ4-S)(μ2-O)54+ core, is obtained upon treatment of Zn-reduced ethanolic solutions of NbCl5 with HCl in the presence of a sulfide source. The red aqua ion, obtained upon cation-exchange chromatography, forms readily ...... the thiocyanate complex which have been crystallized as Cs4.67Na1.33[¬Nb4SO5(NCS)10]∙2.33H2O and structurally characterized....

  14. Rapid Energy Modeling Workflow Demonstration

    Science.gov (United States)

    2013-10-31

    Motion Picture Theatre, Museum, Office, Penitentiary , Performing Arts Theater, Police Station, Post Office, Religious Building, Retail, School Or...Family 1.00 0.70 N/A 0.06 0.25 Museum 1.00 1.10 9.75 0.2 0.10 Office 1.34 1.01 18.01 0.2 0.10 Parking Garage 0.30 0.30 N/A 1.5 5.00 Penitentiary

  15. High Efficiency GPS Block III L1 band Envelope Tracking Power Amplifier

    Science.gov (United States)

    2016-03-31

    envelope po undred kHz o ble to accurate he unique pro esign is shown ig. 2: Block dia ]. iency GP mball1, Tos owing deman ce to interfer three times mo...Althoug ly reproduce h perties of the in Fig. 4, a h gram of enve S Block hifumi Na 1MaX ds for higher ence, the GPS re accurate th a capability...to litary uses. E is 1575.42 M 1C data, and f the legacy sa n (P(Y)). In the SSPA due tioned that de GPS satellite. d cost due to enges, envelo all

  16. Final Environmental Assessment, Outgrant for Construction and Operation of a Solar Photovoltaic System in Area I, Nellis Air Force Base, Clark County, Nevada

    Science.gov (United States)

    2011-03-01

    La locallutd6n propuosta panl el sistema lotovoiUIIco solar esaa on Ia PO<c:i6n sur de Ia zo na 1 de Ia base earN de Neils, sur del Campo de golf...Sola del !sos MUltiples de la Escuela Elemental Martin luther King J r .. 2260 Betty Lario. Las Vegas, NV 89158 el 15 de junto, 2010. de las 6:30 a las 9...a Ia Nellis Sistemas De Energla Solar II Evaluaci6n Ambiental. Sugerencias sobre las alternalivas, las cuestiones de recursos . Ia particlpaci6n del

  17. Real-time cardiac metabolism assessed with hyperpolarized [1-13C]acetate in a large-animal model

    DEFF Research Database (Denmark)

    Flori, Alessandra; Liserani, Matteo; Frijia, Francesca

    2015-01-01

    Dissolution-dynamic nuclear polarization (dissolution-DNP) for magnetic resonance (MR) spectroscopic imaging has recently emerged as a novel technique for noninvasive studies of the metabolic fate of biomolecules in vivo. Since acetate is the most abundant extra- and intracellular short-chain fatty...... acid, we focused on [1-13C]acetate as a promising candidate for a chemical probe to study the myocardial metabolism of a beating heart. The dissolution-DNP procedure of Na[1-13C]acetate for in vivo cardiac applications with a 3 T MR scanner was optimized in pigs during bolus injection of doses of up...

  18. Energy harvesting for microsystems

    DEFF Research Database (Denmark)

    Xu, Ruichao

    to the first one, the screen printed PZT layer is replaced by a lead free piezoelectric material, (KxNa1-x)NbO3 (KNN). Some of the major challenges encountered during the development processes are bad adhesion, fragile structures and short circuiting through the PZT layer. All which have being fully......The purpose of this project is to design and fabricate piezoelectric energy harvesters based on integration of Pb(ZrxTi1-x)O3 (PZT) thick film technology and silicon microtechnology. The fabrication processes are carried out in close collaboration with Meggitt Sensing Systems (MSS) who has...

  19. Optimization of the synthesis of a high specific activity 125I-labelled hapten for radioimmunoassays

    International Nuclear Information System (INIS)

    Suraez, C.; Paz, D.; Simon, M. A.; Romero del Hombrebueno, B.

    1994-01-01

    In this first report it is described the synthesis, separation and purification of the 2-radioiodinated histamine- I-labelled histamine by a mixed anhydride reaction. About 75% incorporation of I - 125, from Na 1 25I, was achieved with a molecular ratio of 1:1 mixed anhydride:histamine. The radiochemical purity of the conjugate by TLC was > 99% and its theoretical specific activity, 3850 μCi/μg. Dissolved in ethanol and held at -20 degree centigree under darkness decomposition on storage didn't exceed 1% per month. (Author) 13 refs

  20. Temperature-Dependent Phase Transitions in the Lead-Free Piezoceramics (1 – x – y)(Bi1/2Na1/2)TiO3–xBaTiO3–y(K0.5Na0.5)NbO3 Observed by in situ Transmission Electron Microscopy and Dielectric Measurements

    DEFF Research Database (Denmark)

    Kling, Jens; Jo, Wook; Dittmer, Robert

    2013-01-01

    Lead-free piezoelectric (1 – x – y)(Bi1/2Na1/2)TiO3–xBaTiO3–y(K0.5Na0.5)NbO3 (BNT–BT–KNN) ceramics were examined in situ under increasing temperature in the transmission electron microscope. Changing superstructure reflections indicate a transition from rhombohedral to tetragonal to cubic phase...... with broad coexistence regions. The additional evolution of the microstructure in combination with dielectric measurements leads to a model of two relaxor-type phase evolutions with temperature....

  1. Efeito da monensina e da própolis sobre a atividade de fermentação de aminoácidos in vitro pelos microrganismos ruminais

    Directory of Open Access Journals (Sweden)

    Oliveira Juliana Silva de

    2006-01-01

    Full Text Available Foram estudados os efeitos in vitro dos inibidores monensina e própolis sobre a fermentação ruminal de aminoácidos. Utilizou-se líquido ruminal de um novilho em pastejo, acrescentado de solução de tripticase, em três tratamentos (controle, monensina e própolis. Na 1ª fase do experimento, foram feitas transferências diárias de inóculos para novos tubos com os mesmos tratamentos até o 10º dia e, no 11º dia, iniciou a 2ª fase, efetuando-se as combinações dos tratamentos da 1ª fase (C, M, P, no total de nove, com transferência diária e incubação por mais nove dias. Do 1º ao 10º dia de incubação (1ª fase, o ionóforo e a própolis não aumentaram significativamente a produção de amônia em comparação ao controle. A própolis foi mais eficiente em dimiuir a produção de amônia que a monensina na 1ª fase e ainda reduziu a produção de amônia e a atividade específica de produção de amônia (AEPA na 2ª fase, independentemente do tratamento aplicado na 1ª fase. Quando os inibidores estavam ausentes na 1ª fase, a monensina foi tão eficiente quanto a própolis na 2ª fase. Verificou-se que, ao remover os inibidores na 2ª fase no tratamento monesina, houve aumento significativo na produção de amônia, mas este efeito não foi detectado no tratamento com própolis, que manteve amônia em baixas concentrações.

  2. Electrochemical properties of polyaniline-modified sodium vanadate nanomaterials

    International Nuclear Information System (INIS)

    Reddy Channu, V.S.; Holze, Rudolf; Yeo, In-Hyeong; Mho, Sun-il; Kalluru, Rajamohan R.

    2011-01-01

    Sodium vanadate nanomaterials were synthesized at different pH-values of a sodium hydroxide solution of vanadium pentoxide. Polyaniline-modified sodium vanadate nanomaterials were prepared at room temperature and at 3 C by a chemical polymerization method. The crystal structure and phase purity of the samples have been examined by powder XRD. The samples were identified as HNaV 6 O 16 .4H 2 O and Na 1.1 V 3 O 7.9 . The electrochemical measurements show that polyaniline-modified sodium vanadate hydrated nanomaterials provide higher current density than the sodium vanadate nanomaterials. (orig.)

  3. TiO3 ceramics

    Indian Academy of Sciences (India)

    Administrator

    High purity Bi2O3, Na2CO3, TiO2, MgCO3 and Nb2O5. (purity over 99⋅5%) powders were used as starting mate- rials. Our preliminary experiments found that (Bi1/2Na1/2). Ti1–x(Mg1/3Nb2/3)xO3 ceramics were not well synthesized by mixing and calcinating all these above powders as used in the conventional oxide ...

  4. Downstream the hall EHN1

    CERN Document Server

    1978-01-01

    Jura is towards left, Saleve towards right. Starting from left the photo shows the area behind NA5 (not shown) where later the EHS (European Hybrid Spectrometer) was installed; the neutron beam line N4 to NA6 (neutron elastic scattering at very small angle, by the Freiburg-Moscow (ITEP) Collaboration); the E4/H4 beam line to NA1 (Photoproduction of vector and scalar bosons by the Frascati-Milan-Pisa-Roma (FRAMM) Collaboration); the area of the H6 beam, behind NA3.

  5. Efeito hipolipidêmico do suco de camu-camu em ratos

    OpenAIRE

    Schwertz,Maíra Cássia; Maia,Jeniffer Resende Patrocínio; Sousa,Risonilce Fernandes Silva de; Aguiar,Jaime Paiva Lopes; Yuyama,Lucia Kiyoko Ozaki; Lima,Emerson Silva

    2012-01-01

    OBJETIVO: Este estudo teve como objetivo avaliar o potencial hipolipidêmico do suco de camu-camu (Myrciaria dubia (Kunth) McVaugh) em ratos dislipidêmicos. MÉTODOS: Foram utilizados 72 ratos (Rattus norvegicus var. albinus) machos adultos da linhagem Wistar, com peso médio de 200g. O experimento foi dividido em duas fases: indução da dislipidemia e tratamento. Para indução da dislipidemia, todos os ratos receberam ração hiperlipídica (ração comercial adicionada a 10,0% de banha suína, 1,0% co...

  6. Obtención de polvos cerámicos de BNKT-KNN por el método Pechini

    Directory of Open Access Journals (Sweden)

    Yasnó, J. P.

    2013-10-01

    Full Text Available Pechini method was used in order to obtain fine ceramic and single-phase powders for a lead-free ferroelectric system 0,97[(Bi1/2Na1/21-x(Bi1/2K1/2xTiO3]-0,03[(Na1/2K1/2NbO3]or BNKT-KNN (x = 0.00, 0.18, 0.21, 0.24, 0.27. This method allowed obtaining powders with 100 % perovskite phase, which was confirmed by X-ray diffraction, for this particular system in all the studied stoichiometries using temperature as low as 600 ºC. The effects on the bonds present in the structure due to variation of the stoichiometry, Na-K, were determined using infrared spectroscopy, FT-IR. Irregular nanoparticles were observed by scanning electron microscopy.El método Pechini fue utilizado para obtener polvos cerámicos finos y monofásicos del sistema ferroeléctrico libre de plomo 0,97[(Bi1/2Na1/21-x(Bi1/2K1/2xTiO3]-0,03[(Na1/2K1/2NbO3] ó BNKT-KNN (x = 0.00, 0.18, 0.21, 0.24, 0.27. Este método permitió la obtención de polvos con 100 % de fase perovskita, para el sistema de interés en todas las estequiometrias estudiadas, a una temperatura tan baja como 600 ºC, lo que fue confirmado por difracción de rayos X. Por medio de espectroscopia infrarroja, FT-IR, se pudo determinar cómo afecta la variación de la estequiometria, Na-K, los enlaces presentes en la estructura. Mediante microscopia electrónica de barrido se observaron partículas nanométricas irregulares.

  7. Chemical composition and evolution of tourmaline-supergroup minerals from the Sb hydrothermal veins in Rožňava area, Western Carpathians, Slovakia

    Science.gov (United States)

    Bačík, Peter; Dikej, Jakub; Fridrichová, Jana; Miglierini, Marcel; Števko, Martin

    2017-09-01

    Tourmaline-supergroup minerals are common gangue minerals in Sb-hydrothermal veins on Betliar - Straková, Čučma - Gabriela and Rožňava - Peter-Pavol vein deposits in the Rožňava area, Slovakia. Tourmaline-supergroup minerals form relatively large prismatic to radial aggregates of parallel black to greyish-black crystals. Tourmaline-supergroup minerals from Betliar - Straková and Rožňava - Peter-Pavol are almost homogeneous with intermediate schorl-dravite composition. Čučma - Gabriela tourmaline have distinct zoning with massive core of the schorlitic-to-feruvitic shifting to schorlitic-to-dravitic composition, and dravitic to magnesio-foititic rim. The tourmaline composition is influenced by two main substitutions, namely Ca(Mg,Fe)Na-1Al-1 and X □AlNa-1(Mg,Fe)-1. Betliar - Straková and Rožňava - Peter-Pavol tourmaline-supergroup minerals exhibit only small extents of the X □AlNa-1(Mg,Fe)-1 substitution. This substitution shifts the composition to magnesio-foitite in Čučma - Gabriela tourmaline. The decrease of Al in the core of Čučma - Gabriela tourmaline crystals is caused by extensive Ca(Mg,Fe)Na-1Al-1 substitution. The unit-cell dimensions of all investigated tourmaline-supergroup minerals indicate an octahedral disorder with the Z (Fe3++Mg) proportion calculated from empirical equations varying between 0.85 and 0.87 apfu (atoms per formula unit). Based on Mössbauer spectra, the Z Fe3+ content varied between 0.25 apfu in Betliar - Straková tourmaline and 0.45 apfu in Čučma - Gabriela sample. Based on Fe/(Fe + Mg) ratio, Betliar - Straková tourmaline is slightly enriched in Fe compared to Rožňava - Peter-Pavol, suggesting the impact of the host-rock composition; first are grown in Fe-richer acidic metarhyolitic rocks, latter in metapelites. In Čučma - Gabriela, the variations in Fe/(Fe + Mg) are very likely reflecting the change in fluid composition. Magnesio-foitite is the product of second-stage crystallization forming rims and

  8. Obtención de polvos cerámicos de BNKT-KNN por el método Pechini

    Directory of Open Access Journals (Sweden)

    Yasnó, J. P.

    2013-08-01

    Full Text Available Pechini method was used in order to obtain fine ceramic and single-phase powders for a lead-free ferroelectric system 0,97[(Bi1/2Na1/21-x(Bi1/2K1/2xTiO3]-0,03[(Na1/2K1/2NbO3] or BNKT-KNN (x = 0.00, 0.18, 0.21, 0.24, 0.27. This method allowed obtaining powders with 100 % perovskite phase, which was confirmed by X-ray diffraction, for this particular system in all the studied stoichiometries using temperature as low as 600 ºC. The effects on the bonds present in the structure due to variation of the stoichiometry, Na-K, were determined using infrared spectroscopy, FT-IR. Irregular nanoparticles were observed by scanning electron microscopy.El método Pechini fue utilizado para obtener polvos cerámicos finos y monofásicos del sistema ferroeléctrico libre de plomo 0,97[(Bi1/2Na1/21-x(Bi1/2K1/2xTiO3]-0,03[(Na1/2K1/2NbO3] ó BNKT-KNN (x = 0.00, 0.18, 0.21, 0.24, 0.27. Este método permitió la obtención de polvos con 100 % de fase perovskita, para el sistema de interés en todas las estequiometrias estudiadas, a una temperatura tan baja como 600 ºC, lo que fue confirmado por difracción de rayos X. Por medio de espectroscopia infrarroja, FT-IR, se pudo determinar cómo afecta la variación de la estequiometria, Na-K, los enlaces presentes en la estructura. Mediante microscopia electrónica de barrido se observaron partículas nanométricas irregulares.

  9. Anaerobic Treatment of Wastewaters Containing Perchlorate from Munitions Handling and Production

    Science.gov (United States)

    2008-01-01

    2003. Brock Biology of Microorganisms . Prentice Hall, New Jersey, 576-587. Maloney, S. W., E. G. Engbert, M. T. Suidan, and R. F. Hickey. 1998...reactions for the two compounds are as follow: microorganisms 1.5 NaClO4- + C2H6O → 1.5...Cl- + 2 CO2 + 3 H2O + 1.5 Na (1) (perchlorate) (ethanol) microorganisms 2 C3H6N3(NO2)3 + C2H6O → 5 CO2 + 3 CH4 + 6 N2 + 3 H2O

  10. Lead-Free Metamaterials with Enormous Apparent Piezoelectric Response.

    Science.gov (United States)

    Zhou, Wanfeng; Chen, Pan; Pan, Qi; Zhang, Xiaotong; Chu, Baojin

    2015-11-04

    Lead-free flexoelectric piezoelectric metamaterials are created by applying an asymmetric chemical reduction to Na1/2 Bi1/2 TiO3 -BaTiO3 ceramics. The reduction induces two gradient-generating mechanisms, curvature structure and chemical inhomogeneity, and enhances the flexoelectric effect. The ceramics behave like piezoelectric materials, exhibiting an enormous and high-temperature stable apparent piezoelectric response, outperforming existing lead-oxide-based piezoelectrics. © 2015 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.

  11. Transition metal ion FRET uncovers K(+) regulation of a neurotransmitter/sodium symporter

    DEFF Research Database (Denmark)

    Billesbølle, Christian B; Mortensen, Jonas S; Sohail, Azmat

    2016-01-01

    Neurotransmitter/sodium symporters (NSSs) are responsible for Na(+)-dependent reuptake of neurotransmitters and represent key targets for antidepressants and psychostimulants. LeuT, a prokaryotic NSS protein, constitutes a primary structural model for these transporters. Here we show that K(+) in......(+)-effect. The K(+)-effect depended on an intact Na1 site and mutating the Na2 site potentiated K(+) binding by facilitating transition to the inward-facing state. The data reveal an unrecognized ability of K(+) to regulate the LeuT transport cycle....

  12. tRNA and Its Activation Targets as Biomarkers and Regulators of Breast Cancer

    Science.gov (United States)

    2013-09-01

    Dev 18: 1227–1240. Kadaba S, Wang X, Anderson JT. 2006. Nuclear RNA surveillance in Saccharomyces cerevisiae : Trf4p-dependent polyadenylation of na...1× medium (Thermo Scientific HyClone) supplemented with 10% FBS and 1% Penicillin/Streptomycin. To generate stable cell lines, cells were transfected...using Amaxa Nucleofector technology (LonzaBio). After 48 h, medium was sup- plemented with 500 μg/mL G418 (Sigma) for selection. After 2–4 wk, G418

  13. [The systems of molecular genetic markers under cancer of stomach].

    Science.gov (United States)

    Nemtsova, M V; Bykov, I I; Tchekinova, N V; Zaletaev, D V; Glikhov, A I; Khorobrykh, T V

    2013-11-01

    The study was organized to investigate the anomalous methylation of genes NA?1, RASSF1A, MLH1, N33, DAPK, the expression of genes hTERT. metalloproteinase MMP7, MMP9, survivin. COX-2, p53. The activity of telomerase in 106 samples of stomach tumors taken through intra-operation way and 53 samples of stomach tumors taken through endoscopic way and 50 samples of biopsy taken from patients with chronic calculous cholecystitis (comparison group) was analyzed too. These changes can be used as additional markers both in diagnostic of cancer of stomach and dynamic monitoring of operated patients.

  14. SIGIR Quarterly Report to the United States Congress

    Science.gov (United States)

    2007-04-30

    to bricks -and-mortar work, much electricity work is done before site mobilization. 49. GRD-PCO, response to SIGIR, January 20, 2007, p. 7; USACE-GRD...THROUGH MARCH 2007 744 MH146-NA-1 15TH FINANCE BATTALION STAMP PAD C-NEW IRAQI ARMY FACILITIES CONSTRUCTION $5.00 $5.00 $0.00 CEFMS IRRF CONSTRUCTION...THROUGH MARCH 2007 2075 W56HZV-04-D-B030-1-0001AA S C ROMAN SA (5) GARBAGE TRUCK PRESS PACK TIP AND MANUALS NC-OIL INFRASTRUCTURE NON-CONSTRUCTION

  15. Auger decay mechanism in photon-stimulated desorption of ions from surfaces

    International Nuclear Information System (INIS)

    Parks, C.C.

    1983-11-01

    Photon-stimulated desorption (PSD) of positive ions was studied with synchrotron radiation using an angle-integrating time-of-flight mass spectrometer. Ion yields as functions of photon energy near core levels were measured from condensed gases, alkali fluorides, and other alkali and alkaline earth halides. These results are compared to bulk photoabsorption measurements with emphasis on understanding fundamental desorption mechanisms. The applicability of the Auger decay mechanism, in which ion desorption is strictly proportional to surface absorption, is discussed in detail. The Auger decay model is developed in detail to describe Na + and F + desorption from NaF following Na(1s) excitation. The major decay pathways of the Na(1s) hole leading to desorption are described and equations for the energetics of ion desorption are developed. Ion desorption spectra of H + , Li + , and F + are compared to bulk photoabsorption near the F(2s) and Li(1s) edges of LiF. A strong photon beam exposure dependence of ion yields from alkali fluorides is revealed, which may indicate the predominance of metal ion desorption from defect sites. The large role of indirect mechanisms in ion desorption condensed N 2 -O 2 multilayers is demonstrated and discussed. Ion desorption spectra from several alkali halides and alkaline earth halides are compared to bulk photoabsorption spectra. Relative ion yields from BaF 2 and a series of alkali halides are discussed in terms of desorption mechanisms

  16. Genetic variability of respiratory syncytial virus A in hospitalized children in the last five consecutive winter seasons in Central Spain.

    Science.gov (United States)

    Calderón, Ana; Pozo, Francisco; Calvo, Cristina; García-García, Mluz; González-Esguevillas, Mónica; Molinero, Mar; Casas, Inmaculada

    2017-05-01

    Human respiratory syncytial virus group A (RSV-A) was detected in symptomatic hospital attended children in Central Spain for a continuous time period, September 2010 to April 2015. In order to accurately describe the epidemiology of this virus, the genetic diversity of the complete G gene and the clinical manifestations observed were jointly analyzed. Out of 3,011 respiratory specimens taken from 2,308 children, 640 were positive to RSV (21.3%) and 405 were RSV-A (63.2%). Complete G gene sequences of 166 randomly selected RSV-A virus identified NA1 and ON1 genotypes. In 2011-2012, ON1 emerged sporadically and become dominant in 2012-2013 with 38 cases (70%). In 2014-2015, all the 44 sequences contained the 72-nt duplication (100%). Clinical diagnosis of children with ON1 genotype were bronchiolitis in 55 (62.5%), recurrent wheezing or asthma exacerbations in 22 (25%), laryngotracheobronchitis in 3 (3.4%), and upper respiratory tract infections in eight. Results showed replacement and substitution of circulating NA1 genotype with the new ON1 genotype. Nevertheless, at this stage, none of the RSV-A genotypes identified have resulted in significant clinical differences. The amino acid composition of the complete G gene ON1 sequences demonstrated an accumulation of single changes not related with different clinical presentation. J. Med. Virol. 89:767-774, 2017. © 2016 Wiley Periodicals, Inc. © 2016 Wiley Periodicals, Inc.

  17. The whole blood oxygen binding properties of a large but presumably sluggish polar elasmobranch, the Greenland shark Somniosus microcephalus

    DEFF Research Database (Denmark)

    Steffensen, John Fleng

    2012-01-01

    Australian and New Zealand Society for Comparative Physiology and Biochemistry. Auckland, N.Z., December 2012. Herbert, N.A.1, Skov, p.V.l, Tirsgaard, B.z and Steffensen, J.F. Z Only a few species of elasmobranch live in cold polar waters and the Greenland shark (Somniosus microcephalus) is the m......Australian and New Zealand Society for Comparative Physiology and Biochemistry. Auckland, N.Z., December 2012. Herbert, N.A.1, Skov, p.V.l, Tirsgaard, B.z and Steffensen, J.F. Z Only a few species of elasmobranch live in cold polar waters and the Greenland shark (Somniosus microcephalus...... (¿ = -0.35. P>0.05). The blood-oxygen transport system of S. microcephalus does not therefore appear compatible with an active lifestyle and is not overly sensitive to an acute rise in temperature. The implications of these observations will be discussed with respect to the known feeding ecology and depth...

  18. Habilidades funcionais de crianças com deficiências em inclusão escolar: barreiras para uma inclusão efetiva

    Directory of Open Access Journals (Sweden)

    Fernanda Moreira Teles

    2013-10-01

    Full Text Available O objetivo deste artigo é descrever as incapacidades de alunos em processo de inclusão por meio do PEDI (Inventário de Avaliação Pediátrica de Incapacidades. Estudo transversal analítico. População: 181 alunos (7-10 anos de 31 escolas municipais de São Paulo. Por meio de questionário aplicado ao cuidador, foram avaliadas 197 atividades nas áreas de autocuidado, mobilidade e função social. Diferenças (p < 0,05 no desempenho dos alunos, segundo o PEDI, foram observadas entre as séries nas escalas de autocuidado (média de 77,8% na 1ª série e de 95,2% na 4ª série e mobilidade (média de 90,0% na 1ª série e 99,8% na 4ª série; a função social apresentou as menores médias, exceção ao grupo com deficiência física, cuja área mais afetada foi a mobilidade (média de 62,7%. O PEDI permitiu a identificação de incapacidades por grupo de deficiências e individual, podendo constituir instrumento importante para intervenção direcionada e acompanhamento na escola.

  19. Bone position emission tomography with or without CT Is more accurate than bone scan for detection of bone metastasis

    International Nuclear Information System (INIS)

    Lee, Soo Jin; Lee, Wom Woo; Kim, Sang Eun

    2013-01-01

    Na1 8F bone positron emission tomography (bone PET) is a new imaging modality which is useful for the evaluation of bone diseases. Here, we compared the diagnostic accuracies between bone PET and bone scan for the detection of bone metastasis (BM). Sixteen cancer patients (M:F = 10:6, mean age = 60 ± 12 years) who underwent both bone PET and bone scan were analyzed. Bone PET was conducted 30 minutes after the injection of 370 MBq Na1 8F , and a bone scan was performed 3 hours after the injection of 1295 MBq 9 9mT c-hydroxymethylene diphosphonate. In the patient-based analysis (8 patients with BM and 8 without BM), the sensitivities of bone PET (100% 8/8) and bone scan (87.5% = 7/8) were not significantly different (p > 0.05), whereas the specificity of bone PET (87.5% = 7/8) was significantly greater than that of the bone scan (25% = 2/8) (p 8F bone PET is more accurate than bone scan for BM evaluation.

  20. Crystal structure of the plasma membrane proton pump

    DEFF Research Database (Denmark)

    Pedersen, Bjørn P.; Buch-Pedersen, Morten Jeppe; Morth, J. Preben

    2007-01-01

    -3, and Na1,K1-ATPase (the sodium-potassium pump) in animals4. The name P-type derives from the fact that these proteins exploit a phosphorylated reaction cycle intermediate of ATP hydrolysis5.The plasma membrane proton pumps belong to the type III P-type ATPase subfamily, whereas Na1,K1-ATPase and Ca21......- ATPase are type II6. Electron microscopy has revealed the overall shape of proton pumps7, however, an atomic structure has been lacking. Here we present the first structure of a P-type proton pump determined by X-ray crystallography. Ten transmembrane helices and three cytoplasmic domains define...... the functional unit of ATP-coupled proton transport across the plasma membrane, and the structure is locked in a functional state not previously observed in P-type ATPases. The transmembrane domain reveals a large cavity, which is likely to be filled with water, located near the middle of the membrane plane...

  1. Dimensional t-factor variation and increase of stability of the ferroelectric state in (Na0.5Bi0.5TiO3-based solid solutions

    Directory of Open Access Journals (Sweden)

    V. M. Ishchuk

    2017-10-01

    Full Text Available The influence of the B-site ion substitutions in (1−x(Bi1∕2Na1∕2TiO3–xBaTiO3 system of solid solutions on the relative stability of the antiferroelectric (AFE and ferroelectric (FE phases has been studied. The ions of zirconium, tin, and (In0.5Nb0.5, (Fe0.5Nb0.5, (Al0.5V0.5 ion complexes have been used as substituting elements. An increase in the concentration of the substituting ion results in a near linear variation in the size of the crystal lattice cell. Along with the cell size variation, a change in the relative stability of the AFE and FE phases takes place according to the changes of the tolerance factor of the solid solution. An increase in the tolerance factor leads to the increase in the temperature of the FE–AFE phase transition, and vice versa. Obtained results indicate the way for raising the temperature of the FE–AFE phase transition in (Bi1∕2Na1∕2TiO3-based solid solutions.

  2. Avaliação das carcaças de novilhos F1 Angus-Nelore em pastagens de Brachiaria decumbens submetidos a diferentes regimes alimentares Carcass evaluation of F1 Angus-Nellore steers on Brachiaria decumbens pasture under different feeding regimes

    Directory of Open Access Journals (Sweden)

    Gelson Luís Dias Feijó

    2001-06-01

    Full Text Available O experimento foi conduzido no Centro Nacional de Gado de Corte da Empresa Brasileira de Pesquisa Agropecuária (Embrapa Gado de Corte. Foram utilizados 45 novilhos F1 Aberdeen Angus-Nelore para avaliar o efeito de diferentes regimes alimentares, nos períodos secos da recria/terminação, sobre as características de carcaça. Os tratamentos aplicados foram: testemunha, sem suplementação (S/S; suplementação na 2ª seca (S2S; suplementação na 1ª seca (S1S; suplementação nas duas secas (S12S e suplementação na 1ª seca e confinamento na 2ª (S1C2. Os animais foram abatidos com pesos entre 460 e 480 kg. O efeito dos tratamentos foi avaliado pelo método dos quadrados mínimos. Animais com melhor nível nutricional na 2ª seca (S1C2, S2S e S12S apresentaram melhor rendimento de carcaça e maiores pesos de carcaça quente e fria do que aqueles suplementados somente na 1ª seca ou não suplementados. A suplementação somente na 1ª seca produziu carcaças semelhantes, em todos os aspectos avaliados, às do tratamento testemunha. Conclui-se que melhorar o nível alimentar na 2ª seca da vida do animal é fundamental para aumentar o rendimento de carcaça. Suplementação na 1ª seca, como prática isolada, não contribui para o rendimento e qualidade da carcaça.This trial was conducted at National Beef Cattle Research Center of Brazilian Agricultural Research Corporation (Embrapa Beef Cattle. Forty five F1 Aberdeen Angus-Nellore steers were used to evaluate the effects of different dry seasons feeding schemes on carcass characteristics. The treatments were: control, without supplementation (S/S; supplementation in 2nd dry period (S2S; supplementation in 1st dry period (S1S; supplementation in 1st and 2nd dry periods (S12S and supplementation in 1st dry period and confinament in 2nd one (S1C2. Animals were slaughtered at 460-480 kg of live weight and the treatments effects were evaluated by least square means. Steers with higher

  3. A new fast and programmable trigger logic

    International Nuclear Information System (INIS)

    Fucci, A.; Amendolia, S.R.; Bertolucci, E.; Bottigli, U.; Bradaschia, C.; Foa, L.; Giazotto, A.; Giorgi, M.; Givoletti, M.; Lucardesi, P.; Menzione, A.; Passuello, D.; Quaglia, M.; Ristori, L.; Rolandi, L.; Salvadori, P.; Scribano, A.; Stanga, R.; Stefanini, A.; Vincelli, M.L.

    1977-01-01

    The NA1 (FRAMM) experiment, under construction for the CERN-SPS North Area, deals with more than 1000 counter signals which have to be combined together in order to build sophisticated and highly selective triggers. These requirements have led to the development of a low cost, combinatorial, fast electronics which can replace, in an advantageous way the standard NIM electronics at the trigger level. The essential performances of the basic circuit are: 1) programmability of any desired logical expression; 2) trigger time independent of the chosen expression; 3) reduced cost and compactness due to the use of commercial RAMs, PROMs, and PLAs; 4) short delay, less than 20 ns, between input and output pulses. (Auth.)

  4. cis-Tetrachlorido-bis(indazole)osmium(iv) and its osmium(iii) analogues: paving the way towards the cis-isomer of the ruthenium anticancer drugs KP1019 and/or NKP1339.

    Science.gov (United States)

    Büchel, Gabriel E; Kossatz, Susanne; Sadique, Ahmad; Rapta, Peter; Zalibera, Michal; Bucinsky, Lukas; Komorovsky, Stanislav; Telser, Joshua; Eppinger, Jörg; Reiner, Thomas; Arion, Vladimir B

    2017-09-12

    The relationship between cis-trans isomerism and anticancer activity has been mainly addressed for square-planar metal complexes, in particular, for platinum(ii), e.g., cis- and trans-[PtCl 2 (NH 3 ) 2 ], and a number of related compounds, of which, however, only cis-counterparts are in clinical use today. For octahedral metal complexes, this effect of geometrical isomerism on anticancer activity has not been investigated systematically, mainly because the relevant isomers are still unavailable. An example of such an octahedral complex is trans-[RuCl 4 (Hind) 2 ] - , which is in clinical trials now as its indazolium (KP1019) or sodium salt (NKP1339), but the corresponding cis-isomers remain inaccessible. We report the synthesis of Na[cis-Os III Cl 4 (κN2-1H-ind) 2 ]·(Na[1]) suggesting a route to the cis-isomer of NKP1339. The procedure involves heating (H 2 ind)[Os IV Cl 5 (κN1-2H-ind)] in a high boiling point organic solvent resulting in an Anderson rearrangement with the formation of cis-[Os IV Cl 4 (κN2-1H-ind) 2 ] ([1]) in high yield. The transformation is accompanied by an indazole coordination mode switch from κN1 to κN2 and stabilization of the 1H-indazole tautomer. Fully reversible spectroelectrochemical reduction of [1] in acetonitrile at 0.46 V vs. NHE is accompanied by a change in electronic absorption bands indicating the formation of cis-[Os III Cl 4 (κN2-1H-ind) 2 ] - ([1] - ). Chemical reduction of [1] in methanol with NaBH 4 followed by addition of nBu 4 NCl afforded the osmium(iii) complex nBu 4 N[cis-Os III Cl 4 (κN2-1H-ind) 2 ] (nBu 4 N[1]). A metathesis reaction of nBu 4 N[1] with an ion exchange resin led to the isolation of the water-soluble salt Na[1]. The X-ray diffraction crystal structure of [1]·Me 2 CO was determined and compared with that of trans-[Os IV Cl 4 (κN2-1H-ind) 2 ]·2Me 2 SO (2·2Me 2 SO), also prepared in this work. EPR spectroscopy was performed on the Os III complexes and the results were analyzed by ligand

  5. Synthesis and Characterization of 8-Yttrium(III-Containing 81-Tungsto-8-Arsenate(III, [Y8(CH3COO(H2O18(As2W19O684(W2O62(WO4]43−

    Directory of Open Access Journals (Sweden)

    Masooma Ibrahim

    2015-06-01

    Full Text Available The 8-yttrium(III-containing 81-tungsto-8-arsenate(III [Y8(CH3COO(H2O18(As2W19O684(W2O62(WO4]43− (1 has been synthesized in a one-pot reaction of yttrium(III ions with [B-α-AsW9O33]9− in 1 M NaOAc/HOAc buffer at pH 4.8. Polyanion 1 is composed of four {As2W19O68} units, two {W2O10} fragments, one {WO6} group, and eight YIII ions. The hydrated cesium-sodium salt of 1 (CsNa-1 was characterized in the solid-state by single-crystal XRD, FT-IR spectroscopy, thermogravimetric and elemental analyses.

  6. Mediating conducting polymer growth within hydrogels by controlling nucleation

    Directory of Open Access Journals (Sweden)

    A. J. Patton

    2015-01-01

    Full Text Available This study examines the efficacy of primary and secondary nucleation for electrochemical polymerisation of conductive polymers within poly(vinyl alcohol methacrylate hydrogels. The two methods of nucleation investigated were a primary heterogeneous mechanism via introduction of conductive bulk metallic glass (Mg64Zn30Ca5Na1 particles and a secondary mechanism via introduction of “pre-polymerised” conducting polymer within the hydrogel (PEDOT:PSS. Evidence of nucleation was not seen in the bulk metallic glass loaded gels, however, the PEDOT:PSS loaded gels produced charge storage capacities over 15 mC/cm2 when sufficient polymer was loaded. These studies support the hypothesis that secondary nucleation is an efficient approach to producing stand-alone conducting hydrogels.

  7. Measurement and analysis of field-induced crystallographic texture using curved position-sensitive diffraction detectors

    DEFF Research Database (Denmark)

    Simons, Hugh; Daniels, John E.; Studer, Andrew J.

    2014-01-01

    This paper outlines measurement and analysis methodologies created for determining the structural responses of electroceramics to an electric field. A sample stage is developed to apply electric fields to ceramic materials at elevated temperatures during neutron diffraction experiments. The tested...... employing a curved positive sensitive detector. Methodologies are proposed to account for the geometrical effects when vector fields are applied to textured materials with angularly dispersive detector geometries. Representative results are presented for the ferroelectric (Bi1/2Na1/2)TiO3-6%BaTiO3 (BNT-6BT......) which show both phase transformation and ferroelectric domain texturing under the application of an electric field. This experimental and analysis approach is well suited for time-resolved measurements such as stroboscopic and in situ studies on a variety of electro-active materials....

  8. The effect of inter-granular constraints on the response of polycrystalline piezoelectric ceramics at the surface and in the bulk

    DEFF Research Database (Denmark)

    Hossain, Mohammad J.; Wang, Zhiyang; Khansur, Neamul H.

    2016-01-01

    The electro-mechanical coupling mechanisms in polycrystalline ferroelectric materials, including a soft PbZrxTi1−xO3 (PZT) and lead-free 0.9375(Bi1/2Na1/2)TiO3-0.0625BaTiO3 (BNT-6.25BT), have been studied using a surface sensitive low-energy (12.4 keV) and bulk sensitive high-energy (73 ke...... methods demonstrates that the intergranular constraints have a significant influence on the electric-field-induced electro-mechanical responses in polycrystalline ferroelectrics. These results have implications for the design of higher performance polycrystalline piezoelectrics....

  9. Neutropenia Inmune - Aloinmune neonatal: IgG sérica reactiva y fenotipo específico de los neutrófilos evaluados por citometría de flujo Autoimmune-alloimmune neonatal neutropenia: Serum reactive IgG and neutrophil-specific phenotype detected by flow cytometry

    Directory of Open Access Journals (Sweden)

    Norma E. Riera

    2006-10-01

    Full Text Available La neutropenia inmune se diagnostica por la presencia de auto o aloanticuerpos reactivos con los neutrófilos. La neutropenia aloinmune neonatal es consecuencia de la sensibilización materna a los antígenos específicos de los neutrófilos paternos que afectan al neonato al atravesar la barrera placentaria. Se presentan 4 casos de niños, 2 de ellos hermanos consanguíneos con doble vínculo. Se estudiaron los sueros de los pacientes y sus padres. Por citometría de flujo se establecen los valores de referencia de la IgG sérica reactiva con los neutrófilos en voluntarios sanos, para 3 diluciones (1/2, 1/5 y 1/20 en reacción autóloga (suero y células de un mismo individuo y heteróloga (suero y células de diferentes individuos. Los resultados se expresan por un índice definido como el cociente entre la mediana de la intensidad de fluorescencia media del suero incógnita y la de un suero utilizado como referencia. Por leucoaglutinación se evaluó la dilución del suero 1/20. Se determinó el nivel de complejos inmunes circulantes. Se determinó el fenotipo, para los epitopes HNA-1a, HNA-1b y HNA-2a. En los 4 niños se encontró IgG reactiva y/o factores aglutinantes; 2/3 sueros maternos fueron reactivos con los neutrófilos del cónyuge y de los hijos. Los complejos inmunes circulantes fueron positivos en 2/4 sueros negativos en 3/3 sueros maternos. Se encontró incompatibilidad materno-infantil en los 4 casos. Las 3 madres tenían igual fenotipo: homocigotos NA1/NA1, NB1+. En síntesis, se presenta el hallazgo de 4 casos con neutropenia inmune: 3/4 auto-inmune, 1/3 se asocia a complejos inmunes circulantes y 1/4 con neutropenia neonatal aloinmune.Auto or alloantibodies reactive with neutrophils define immune neutropenia. Alloimmune neonatal neutropenia is caused by maternal sensitization to paternal neutrophil antigens, resulting in IgG antibodies that are transferred to the fetus through the placenta. We present the studies in 4

  10. Synthesis and Structures of Reduced Niobates with Four Perovskite-like Layers and Their Semiconducting Properties

    Science.gov (United States)

    Sugimoto, W.; Ohkawa, H.; Naito, M.; Sugahara, Y.; Kuroda, K.

    1999-12-01

    Carriers were successfully doped into RbCa2NaNb4O13 by the substitution of Sr2+ for Na+, yielding electroconducting niobates with a layered structure consisting of four perovskite-like layers. Single-phase products of polycrystalline RbCa2Na1-xSrxNb4O13 (x=0.2 and 0.4) were synthesized by the solid-state reaction of RbCa2Nb3O10, Sr5Nb4O15, Nb2O5, and Nb metal. The solid solutions were indexed based on a tetragonal structure, corresponding to the end-member RbCa2NaNb4O13. With the increase in the amount of strontium substitution, an expansion of the c-axis was observed while the a-axis was essentially constant. The products showed semiconducting properties.

  11. PHYSICAL AND ELECTRICAL PROPERTIES ENHANCEMENT OF RARE-EARTH DOPED-POTASSIUM SODIUM NIOBATE (KNN: A REVIEW

    Directory of Open Access Journals (Sweden)

    Akmal Mat Harttat Maziati

    2015-06-01

    Full Text Available Alkaline niobate mainly potassium sodium niobate, (KxNa1-x NbO3 (abreviated as KNN has long attracted attention as piezoelectric materials as its high Curie temperature (Tc and piezoelectric properties. The volatility of alkaline element (K, Na is, however detrimental to the stoichiometry of KNN, contributing to the failure to achieve high-density structure and lead to the formation of intrinsic defects. By partially doping of several rare-earth elements, the inherent defects could be improved significantly. Therefore, considerable attempts have been made to develop doped-KNN based ceramic materials with high electrical properties. In this paper, these research activities are reviewed, including dopants type and doping role in KNN perovskite structure.

  12. A study on the realization of high resolution solid immersion lens-based near-field imaging optics by use of an annular aperture.

    Science.gov (United States)

    Moon, Hyungbae; Yoon, Yong-Joong; Kim, Wan-Chin; Park, No-Cheol; Park, Kyoung-Su; Park, Young-Pil

    2010-08-02

    We report on the realization of solid immersion lens (SIL)-based near-field (NF) optics with an annular aperture, which is targeted to achieve high optical resolution. A numerical aperture (NA) = 1.84 hemisphere SIL-optics with an annular aperture achieves higher optical resolution than the conventional NA = 2.0 SIL-optics. The designed aperture is fabricated by photo-lithography and dry-etching technique. Experimental verification of the designed optics was performed through beam spot profile measurement under NF imaging conditions. A 15% smaller full-width-at-half-maximum spot diameter is obtained by the aperture. We verified that this method gives an improvement of the resolution in the optical imaging systems requiring higher resolution.

  13. Entretenimiento, espiritualidad, familia y la influencia de pares universitarios en el consumo de drogas

    Directory of Open Access Journals (Sweden)

    Aydee Rivera de Parada

    2015-01-01

    Full Text Available El objetivo del estudio fue examinar la relación de los factores socio-culturales de familia, entretenimiento y espiritualidad y la influencia de pares y el consumo de drogas entre los estudiantes universitarios. Estudio es multicéntrico, con un diseño transversal, participaron 250 estudiantes de una universidad en San Salvador, El Salvador. Se realizaron análisis porcentuales, pruebas de asociación y correlación. Se encontró que los factores socioculturales de familia y espiritualidad podrían estar protegiendo ya que la mayoría 80% valoran positivamente estos dos valores. La mayoría de estudiantes consumen muy poco drogas ilícitas, marihuana 2%, cocaína 1% y anfetaminas 1.2%; pero consume más las drogas lícitas alcohol 42%, tabaco 21%.

  14. Synthesis, Microstructure and Bulk Properties of Complex Nasicon-Type Ceramics

    Science.gov (United States)

    Lipinska, Kristina; Hemmers, Oliver; Romann, Julien; Sinogeikin, Stanislav; Kalita, Patricia; Balagopal, Shekar; Nickens, Anthony

    2011-03-01

    Fast ion-conductors from the NASICON family (Na 1+x Zr 2 Si x P3 - x O12) have been the subject of extensive research due to their use in electrochemical devices such as batteries, fuel cells, thermoelectric generators and chemical sensors A fabrication challenge for these materials is to maintain long term chemical and physical stability in harsh environments We apply a multi-technique approach to show how partial substitutions with tetravalent and pentavalent cations produce NASICONs with specific morphology and modify the primary to secondary crystalline phase ratios. We use in situ synchrotron x-ray diffraction to investigate pressure-induced structural modifications and compressibility. DOE award DE-FG36-06GO86036. Use of HPCAT: DOE-BES, DOE-NNSA (CDAC), NSF, DOD-TACOM, W.M. Keck Found. Use of APS: DOE-BES, W-31-109-ENG-38.

  15. Estado atual da leishmaniose cutânea difusa (LCD no Estado do Maranhão: II. aspectos epidemiológicos, clínico-evolutivos

    Directory of Open Access Journals (Sweden)

    Jackson Maurício Lopes Costa

    1992-06-01

    Full Text Available Os Autores fazem um estudo retrospectivo e prospectivo de 6 pacientes portadores de leishmaniose cutânea difusa, observados no Estado do Maranhão a partir de 1974. Os casos abordados são oriundos de diversas regiões do estado, observando-se em todos eles o envolvimento da leishmania (Leishmania amazonensis, sendo que 5 (84% dos pacientes apresentaram início de doença na 1ª década de vida. Em todos os pacientes envolvidos no estudo, houve relato de lesão inicial nodular única, que, posteriormente, em período variável de tempo, disseminou-se adquirindo outros aspectos. Evolutivamente apresentaram múltiplas lesões nodulares e ulceradas, intradermorreação de Montenegro(- e refratariedade aos esquemas terapêuticos utilizados até ao presente momento.

  16. Kinetics and Mechanism of Nanoparticles-Catalyzed Piperidinolysis of Anionic Phenyl Salicylate

    Directory of Open Access Journals (Sweden)

    Norazizah Abd. Razak

    2014-01-01

    Full Text Available The values of the relative counterion (X binding constant RXBr (=KX/KBr, where KX and KBr represent cetyltrimethylammonium bromide, CTABr, micellar binding constants of Xv- (in non-spherical micelles, v=1,2, and Br− (in spherical micelles are 58, 68, 127, and 125 for Xv−=1−, 12−, 2−, and 22-, respectively. The values of 15 mM CTABr/[NavX] nanoparticles-catalyzed apparent second-order rate constants for piperidinolysis of ionized phenyl salicylate at 35°C are 0.417, 0.488, 0.926, and 0.891 M−1 s−1 for NavX = Na1, Na21, Na2, and Na22, respectively. Almost entire catalytic effect of nanoparticles catalyst is due to the ability of nonreactive counterions, Xv-, to expel reactive counterions, 3−, from nanoparticles to the bulk water phase.

  17. Avaliação das carcaças de novilhos F1 Angus-Nelore em pastagens de Brachiaria decumbens submetidos a diferentes regimes alimentares

    OpenAIRE

    Feijó,Gelson Luís Dias; Euclides Filho,Kepler; Euclides,Valéria Pacheco Batista; Figueiredo,Geraldo Ramos de

    2001-01-01

    O experimento foi conduzido no Centro Nacional de Gado de Corte da Empresa Brasileira de Pesquisa Agropecuária (Embrapa Gado de Corte). Foram utilizados 45 novilhos F1 Aberdeen Angus-Nelore para avaliar o efeito de diferentes regimes alimentares, nos períodos secos da recria/terminação, sobre as características de carcaça. Os tratamentos aplicados foram: testemunha, sem suplementação (S/S); suplementação na 2ª seca (S2S); suplementação na 1ª seca (S1S); suplementação nas duas secas (S12S) e s...

  18. INFLUENCIA DEL TRATAMIENTO CON AMINAS EN LOS PARAMETROS HEMODINAMICOS y METABOLICOS EN EL SHOCK SEPTICO EXPERIMENTAL

    Directory of Open Access Journals (Sweden)

    Felisa Alonso Garcia,

    2003-01-01

    Full Text Available OBJETIVO: Estudiar las variaciones hemodinámicas y metabólicas de las primeras fases del Shock Séptico Experimental (SSE, inducidas por el tratamiento con distinta asociación de aminas. METODO: Investigación experimental en 22 perros. Se les indujo SSE mediante la administración de endotoxina de E. Coli (Serotipo 0111 B.M. Difco Laboratories. Michigan. USA. En función del tiempo se establecieron 5 fases: Basal ó "t=0" (considerado tiempo 0, SSE ó "t=30" (a los 30 minutos del inicio de la infusión del estímulo séptico, "t = 60", "t = 90" y "t = 120" a los 60, 90 y 120 minutos respectivamente de la administración de la endotoxina. En relación al tratamiento administrado, se distinguieron 3 grupos: Grupo A (n=7: tratamiento de soporte; Grupo B (n=8: Dopamina a 10 mcg/kg/min y Dobutamina a 5 mcg/kg/min (DPDB en la fase "t=60", DPDB más Noradrenalina (NA a 0,5 mcg/kg/min (NA0,5 en la fase "t=90"; DPDB más NA a 1 mcg/kg/min (NA1 en la fase "t=120"; Grupo C (n=7: Dopexamina a 12 mcg/kg/min (DX en la fase "t=60", DX más NA0,5 en la fase "t=90" y DX más NA1 en la fase "t=120". La comparación estadística se realizó mediante: "t" de Student-Fisher, Análisis de la Varianza, Chi Cuadrado y cálculo de la potencia estadística en caso necesario. RESULTADOS: Grupo B respecto al A: DP-DB NA0.5 aumentó la Frecuencia cardiaca (FC; DPDB-NA1 además incrementó la Presión diastólica (TAD. Grupo C respecto al A: DX- NA0,5 aumentó la FC; DX- NA1, incrementó la FC y TAD. CONCLUSIONES: La FC, TAS y TAD, se modificaron significativamente con las diversas asociaciones de aminas, mientras que no se evidenciaron variaciones intergrupo de la glucemia y plaquetas. Los cambios significativos en las últimas fases de la investigación experimental, de la glucemia y de las plaquetas, fueron secundarios a la progresión del shock séptico experimental y no a la diferente terapia recibida en cada grupo (ya que se comportaron de forma independiente al

  19. Archaeological Survey Within Designated Portions of the Proposed Len Small Floodway in Dogtooth Bend, Alexander County, Illinois

    Science.gov (United States)

    2005-01-01

    tlM.Np M.MNM.aa M .aIIM,p 1 ..p m NEaRm . .N..Mmmmv.v.IN,.W. .MM . . .N ....I .MM.INN MM.. norma Eir _ama mum .M.Y NMmpNmmp.I.1. .N or .M.1 .laM...PY•ANNPNVf ...1•.W1NANV.. PNMNff PP /PN•N/AMAWA NN NW. HAPWWtl f•.R .•N1PW.tl/vxPW1W1W/ ... APA HWWII•NN•• ....A1M.. ••1.AA1.111.1 P _]MiN...Mm• AY .m.MNmmNMM./mtlMM MAWNp AMPAWxNVWOWMmPAMPA x.vvW Niiii .NA1VWWm1•NN: CMN mWMpm /fAMWY maroonsAmur.. MEP AMP. APA ~MWMA/AWtl/MNMu

  20. Standard Test Method for Measuring Fast-Neutron Reaction Rates by Radioactivation of Aluminum

    CERN Document Server

    American Society for Testing and Materials. Philadelphia

    2011-01-01

    1.1 This test method covers procedures measuring reaction rates by the activation reaction 27Al(n,α)24Na. 1.2 This activation reaction is useful for measuring neutrons with energies above approximately 6.5 MeV and for irradiation times up to about 2 days (for longer irradiations, see Practice E261). 1.3 With suitable techniques, fission-neutron fluence rates above 106 cm−2·s−1 can be determined. 1.4 Detailed procedures for other fast neutron detectors are referenced in Practice E261. 1.5 This standard does not purport to address all of the safety concerns, if any, associated with its use. It is the responsibility of the user of this standard to establish appropriate safety and health practices and determine the applicability of regulatory limitations prior to use.

  1. Consumo de drogas psicoativas por adolescentes escolares de Assis, SP

    Directory of Open Access Journals (Sweden)

    Guimarães José Luiz

    2004-01-01

    Full Text Available Com o objetivo de quantificar o consumo das diferentes drogas psicoativas entre os estudantes da cidade de Assis, SP, e investigar as variáveis relacionadas com seu uso, foi aplicado um questionário que identificava dados sociodemográficos e padrão de uso não-médico de psicotrópicos em 20% dos estudantes das escolas públicas e privadas da cidade. Os maiores índices de consumo para o uso na vida foram os do álcool com 68,9% e o tabaco com 22,7%. As drogas mais utilizadas foram: solventes (10,0%; maconha (6,6%; ansiolíticos (3,8%; anfetamínicos (2,6%; cocaína (1,6% e anticolinérgicos (1,0%.

  2. Consumo de drogas psicoativas por adolescentes escolares de Assis, SP

    Directory of Open Access Journals (Sweden)

    José Luiz Guimarães

    2004-02-01

    Full Text Available Com o objetivo de quantificar o consumo das diferentes drogas psicoativas entre os estudantes da cidade de Assis, SP, e investigar as variáveis relacionadas com seu uso, foi aplicado um questionário que identificava dados sociodemográficos e padrão de uso não-médico de psicotrópicos em 20% dos estudantes das escolas públicas e privadas da cidade. Os maiores índices de consumo para o uso na vida foram os do álcool com 68,9% e o tabaco com 22,7%. As drogas mais utilizadas foram: solventes (10,0%; maconha (6,6%; ansiolíticos (3,8%; anfetamínicos (2,6%; cocaína (1,6% e anticolinérgicos (1,0%.

  3. Effective M3 operator and relevant transitions in 24Al, 24Na, 34Cl, 38K, and 38Cl

    International Nuclear Information System (INIS)

    Brown, B.A.; Massen, S.E.; Chung, W.; Wildenthal, B.H.; Shibata, T.A.

    1980-01-01

    Theoretical calculations are presented for the magnetic octupole electromagnetic matrix elements in light nuclei. Shell-model wave functions are used to calculate the M3 matrix elements for the cases 24 Al 1 + → 4 + , 24 Na 1 + → 4 + , 34 Cl 3 + → 0 + , 38 K 0 + → 3 + , and 38 Cl 5 - → 2 - . The radial matrix elements are calculated with harmonic-oscillator and spherical Hartree-Fock potentials. The comparison of the calculated and experimental matrix elements is expressed in terms of effective spin g factors. Theoretical calculations for the core-polarization corrections are presented and relations between the E2 core-polarization charge and the M3 effective spin g factors are derived

  4. Measurement of (n, p) reaction cross sections for short-lived products (T1/2=0.6-13.8 s) by 14 MeV neutrons

    International Nuclear Information System (INIS)

    Kasugai, Yoshimi; Ikeda, Yujiro; Takeuchi, Hiroshi

    2001-01-01

    Activation cross sections of the (n, p) reactions at 14 MeV for short-lived products were measured by using the D-T neutrons source, FNS (Fusion Neutronics Source) at JAERI. Measured reactions were 11 B(n, p) 11 Be(T 1/2 =13.8 s), 18 O(n, p) 18 N(0.63 s), 26 Mg(n, p) 26 Na(1.07 s), 30 Si(n, p) 30 Al(3.60 s) and 34 S(n, p) 34 S(12.4 s). Using the present results, systematic trend of the (n, p) reaction cross sections for light-mass-targets was discussed. (author)

  5. Radioiodination of ibuprofen with 125I and its biological behavior in mice

    International Nuclear Information System (INIS)

    Amin, A. M.; Abd El-bary, A.; Shoukry, M. and other

    2012-12-01

    A procedure for radioiodination of Ibuprofen with iodine-125 is carried out via an electrophilic substitution reaction. The reaction parameters were studied Ibuprofen concentration, pH of the reaction mixture, reaction time temperature, and different oxidizing agents to optimize the conditions for the labeling of Ibuprofen to abstain a high radiochemical yield of 1 25I -Ibuprofen (1 25I -Ib up). Using 3.7 MBq of of Na 1 25I , 100μg of ibuprofen as substrate and 100μg of iodogen as oxidizing agent in ethanol at 60 O C for 10 min, a maximum radiochemical yield of 1 25I -Ib up (78%) was obtained. The labeled compound was separated and purified from inactive Ibuprofen by means of high-pressure liquid chromatography (HPLC). The biological distribution in normal and inflamed mice indicates the suitability of radioiodinated Ibuprofen for imaging of inflammation only induced with turpentine oil. (Author)

  6. Sharper focal spot formed by higher-order radially polarized laser beams.

    Science.gov (United States)

    Kozawa, Yuichi; Sato, Shunichi

    2007-06-01

    The intensity distributions near the focal point for radially polarized laser beams including higher-order transverse modes are calculated based on vector diffraction theory. For higher-order radially polarized mode beams as well as a fundamental mode (R-TEM01*) beam, the strong longitudinal component forms a sharper spot at the focal point under a high-NA focusing condition. In particular, double-ring-shaped radially polarized mode (R-TEM11*) beams can effectively reduce the focal spot size because of destructive interference between the inner and the outer rings with pi phase shift. Compared with an R-TEM01* beam focusing in a limit of NA=1, the full width at half-maximum values of the focal spot for an R-TEM11* beam are decreased by 13.6% for the longitudinal component and 25.8% for the total intensity.

  7. Warship Combat System Selection Methodology Based on Discrete Event Simulation

    Science.gov (United States)

    2010-09-01

    DPG 35 mm 1 SGE-30 Goalkee per 30 mm 16 RIM 7P 8 Harpoon Block 1C (2 quad) 2 Mk 46 Mod 5 Lekiu Malaysia 1845 Ton DA08; Sea Giraffe 150HC...Seagull S DSQS- 23BZ N/A N/A 1 - 76 mm AK 176M 2 - 30 mm Type 730B 8 SA-N-4 8 C-802 6 ET-52C Type 054A China 3500 Ton Top Plate (Fregat MAE...system 4 CSN-56 OTO Melara 76 mm/62 2 AK- 630M Barak 1 No 2x2 improved DTA -53 533 mm Milgem Turkey 1500 Ton SMART-S Mk2 Sonar 2170, Sea

  8. Detecção de problemas visuais e auditivos de escolares em Ribeirão Preto: estudo comparativo por nível sócio-econômico

    OpenAIRE

    Cano,Maria Aparecida Tedeschi; Silva,Graciette Borges da

    1994-01-01

    A avaliação das funções visuais e auditivas dos alunos ingressantes na 1ª série do 1º grau é considerada uma ação básica de saúde do escolar. A criança, ao ingressar na primeira série, inicia (ou continua) o processo de alfabetização, considerado um dos mais importantes da área educacional e necessita portanto da visão e audição normais (ou com correção) para que esse processo seja facilitado. Neste trabalho, procuramos estudar os distúrbios visuais e auditivos dos escolares de Ribeirão Preto...

  9. Water transport by the renal Na(+)-dicarboxylate cotransporter

    DEFF Research Database (Denmark)

    Meinild, A K; Loo, D D; Pajor, A M

    2000-01-01

    This study investigated the ability of the renal Na(+)-dicarboxylate cotransporter, NaDC-1, to transport water. Rabbit NaDC-1 was expressed in Xenopus laevis oocytes, cotransporter activity was measured as the inward current generated by substrate (citrate or succinate), and water transport...... was monitored by the changes in oocyte volume. In the absence of substrates, oocytes expressing NaDC-1 showed an increase in osmotic water permeability, which was directly correlated with the expression level of NaDC-1. When NaDC-1 was transporting substrates, there was a concomitant increase in oocyte volume....... This solute-coupled influx of water took place in the absence of, and even against, osmotic gradients. There was a strict stoichiometric relationship between Na(+), substrate, and water transport of 3 Na(+), 1 dicarboxylate, and 176 water molecules/transport cycle. These results indicate that the renal Na...

  10. Processing by both classical and mechanosynthesis routes and characterization of a new solid solution of tungsten-bronze structure ceramics

    International Nuclear Information System (INIS)

    Khachane, M.; Moure, A.; Elaatmani, M.; Zegzouti, A.; Daoud, M.; Castro, A.

    2006-01-01

    A new family of ferroelectric compounds with Ba 2-x Na 1+x Li x Nb 5 O 15 composition (0 ≤ x ≤ 1) and tetragonal tungsten-bronze structure is processed for the first time. This new family of materials derived from Ba 2 NaNb 5 O 15 compound was processed by classical solid-state reaction and by mechanosynthesis. The powders prepared by these two routes were characterized by X-ray diffraction (at room and high temperature), differential thermal analysis, thermogravimetry and scanning electron microscopy. The results confirm the formation of the solid solution in the whole range of composition. The influence of Li addition on the dielectric permittivity and losses and on the ferro-paraelectric transition temperature is also studied

  11. cis-Tetrachlorido-bis(indazole)osmium(iv) and its osmium(iii) analogues: paving the way towards the cis-isomer of the ruthenium anticancer drugs KP1019 and/or NKP1339

    KAUST Repository

    Büchel, Gabriel E.

    2017-08-15

    The relationship between cis-trans isomerism and anticancer activity has been mainly addressed for square-planar metal complexes, in particular, for platinum(II), e.g., cis- and trans-[PtCl2(NH3)(2)], and a number of related compounds, of which, however, only cis-counterparts are in clinical use today. For octahedral metal complexes, this effect of geometrical isomerism on anticancer activity has not been investigated systematically, mainly because the relevant isomers are still unavailable. An example of such an octahedral complex is trans-[RuCl4(Hind)(2)](-), which is in clinical trials now as its indazolium (KP1019) or sodium salt (NKP1339), but the corresponding cis-isomers remain inaccessible. We report the synthesis of Na[cis-(OsCl4)-Cl-III(kappa N2-1H-ind)(2)] . (Na[1]) suggesting a route to the cis-isomer of NKP1339. The procedure involves heating (H(2)ind)[(OsCl5)-Cl-IV(kappa N1-2H-ind)] in a high boiling point organic solvent resulting in an Anderson rearrangement with the formation of cis-[(OsCl4)-Cl-IV(kappa N2-1H-ind)(2)] ([1]) in high yield. The transformation is accompanied by an indazole coordination mode switch from kappa N1 to kappa N2 and stabilization of the 1H-indazole tautomer. Fully reversible spectroelectrochemical reduction of [1] in acetonitrile at 0.46 V vs. NHE is accompanied by a change in electronic absorption bands indicating the formation of cis-[(OsCl4)-Cl-III(kappa N2-1H-ind)(2)](-) ([1](-)). Chemical reduction of [1] in methanol with NaBH4 followed by addition of nBu(4)NCl afforded the osmium(III) complex nBu(4)N[cis-(OsCl4)-Cl-III(kappa N2-1H-ind)(2)] (nBu(4)N [1]). A metathesis reaction of nBu(4)N[1] with an ion exchange resin led to the isolation of the water-soluble salt Na[1]. The X-ray diffraction crystal structure of [1] . Me2CO was determined and compared with that of trans-[(OsCl4)-Cl-IV(kappa N2-1H-ind)(2)] . 2Me(2)SO (2 . 2Me(2)SO), also prepared in this work. EPR spectroscopy was performed on the Os-III complexes and

  12. Improved phase sensitivity in spectral domain phase microscopy using line-field illumination and self phase-referencing

    Science.gov (United States)

    Yaqoob, Zahid; Choi, Wonshik; Oh, Seungeun; Lue, Niyom; Park, Yongkeun; Fang-Yen, Christopher; Dasari, Ramachandra R.; Badizadegan, Kamran; Feld, Michael S.

    2010-01-01

    We report a quantitative phase microscope based on spectral domain optical coherence tomography and line-field illumination. The line illumination allows self phase-referencing method to reject common-mode phase noise. The quantitative phase microscope also features a separate reference arm, permitting the use of high numerical aperture (NA > 1) microscope objectives for high resolution phase measurement at multiple points along the line of illumination. We demonstrate that the path-length sensitivity of the instrument can be as good as 41 pm/Hz, which makes it suitable for nanometer scale study of cell motility. We present the detection of natural motions of cell surface and two-dimensional surface profiling of a HeLa cell. PMID:19550464

  13. Antecipação e experiência de parto e depressão após o parto

    OpenAIRE

    Costa, Raquel A.

    2004-01-01

    Dissertação de mestrado em Psicologia Clínica. Este estudo tem como objectivo geral analisar o impacto das circunstâncias demográficas, psicossociais e obstétricas na qualidade da antecipação e da experiência de parto e na sintomatologia depressiva na 1ª semana e 3 meses após o parto. Por outro lado, foi também nosso interesse averiguar a relação entre a antecipação de parto e a experiência de parto. Finalmente debruçamo-nos sobre a relação e o impacto da qualidade da antecipação e expe...

  14. Consumo de cafeína e prematuridade

    OpenAIRE

    Souza,Rita Adriana Gomes de; Sichieri,Rosely

    2005-01-01

    A cafeína (1, 3, 7-trimetilxantina) é uma metilxantina que facilmente atravessa a barreira placentária, com quantidades substanciais passando para o líquido amniótico, sangue do cordão umbilical, plasma e urina dos neonatos. As maiores fontes de cafeína são café, chá, chocolate e refrigerantes do tipo cola. Além disso, cerca de mil drogas prescritas e 2 mil drogas não prescritas contêm cafeína, e 25 dessas drogas podem ser usadas na gravidez. Embora estudos em animais indiquem que a cafeína l...

  15. Consumo de cafeína e de alimentos-fonte de cafeína e prematuridade: um estudo caso-controle

    OpenAIRE

    Souza,Rita Adriana Gomes de; Sichieri,Rosely

    2005-01-01

    A cafeína (1,3,7-trimetilxantina) é um alcalóide que facilmente atravessa a barreira placentária podendo interferir no crescimento e desenvolvimento das células fetais e comprometer a oxigenação fetal. Considerando o amplo consumo de alimentos que contêm cafeína no Brasil, o objetivo do estudo foi avaliar a associação entre o consumo total de cafeína e de alimentos-fonte de cafeína com a prematuridade. Um estudo caso-controle de 140 casos (recém-nascidos com idade gestacional inferior a 37 se...

  16. AIRTOURS: Application of an Interactive Computer Model to Analyze the Manpower Requirements and Operational Tour Opportunities of the Aviation Warfare Community.

    Science.gov (United States)

    1980-12-01

    O 6 N4 N 1 hata . ? V) +ah - N" " U N~N 4 m’~N ... haha )O6 Q i XQ N 6 NO N6 c0Na 1.0 N lAN . "O &a a ha - ha *2 NC-ha N. *NI a O N -j ~h f-h hahaa...caa 64 It ba 4 Q -W L hZ4 IaShaa.. ftQ haha -V ha.~~0 -a.hah a a Qzl 06 1a54. -. ~~m haS aka6. - M ha Ma b.. Aa V3 "hf aa ha Gas% ha 2 -CS ha4 La cu

  17. Overview of EHN1

    CERN Multimedia

    1982-01-01

    The beams enter from the bottom of the photo. Starting from left (Jura side)three experiments lay upstream of the European Hybrid Spectrometer (EHS), NA20, NA25 (with a small HOlographic Bubble Chamber, HOBC) and NA24. The EHS houses NA21, NA22 and NA23 with the Rapid Cycling Bubble Chamber RCBC, NA26, NA27 with the HOlographic LExan Bubble Chamber, HOLEBC. Along the beam line most at the right (H8) lays the NA3 setup, while downstream one sees the assembly of the GAMS detector (blue) of the CERN/USSR experiment NA12. At the centre run the beam H2/E2 for the FRAMM experiments NA1 (now completed), NA7 and NA29, and the beam H6 for NA30 and NA11.

  18. Rhombohedral prussian white as cathode for rechargeable sodium-ion batteries.

    Science.gov (United States)

    Wang, Long; Song, Jie; Qiao, Ruimin; Wray, L Andrew; Hossain, Muhammed A; Chuang, Yi-De; Yang, Wanli; Lu, Yuhao; Evans, David; Lee, Jong-Jan; Vail, Sean; Zhao, Xin; Nishijima, Motoaki; Kakimoto, Seizoh; Goodenough, John B

    2015-02-25

    A novel air-stable sodium iron hexacyanoferrate (R-Na1.92Fe[Fe(CN)6]) with rhombohedral structure is demonstrated to be a scalable, low-cost cathode material for sodium-ion batteries exhibiting high capacity, long cycle life, and good rate capability. The cycling mechanism of the iron redox is clarified and understood through synchrotron-based soft X-ray absorption spectroscopy, which also reveals the correlation between the physical properties and the cell performance of this novel material. More importantly, successful preparation of a dehydrated iron hexacyanoferrate with high sodium-ion concentration enables the fabrication of a discharged sodium-ion battery with a non-sodium metal anode, and the manufacturing feasibility of low cost sodium-ion batteries with existing lithium-ion battery infrastructures has been tested.

  19. A novel method for effective sodium ion implantation into silicon

    Energy Technology Data Exchange (ETDEWEB)

    Lu Qiuyuan; Chu, Paul K. [Department of Physics and Materials Science, City University of Hong Kong, Tat Chee Avenue, Kowloon (Hong Kong)

    2012-07-15

    Although sodium ion implantation is useful to the surface modification of biomaterials and nano-electronic materials, it is a challenging to conduct effective sodium implantation by traditional implantation methods due to its high chemical reactivity. In this paper, we present a novel method by coupling a Na dispenser with plasma immersion ion implantation and radio frequency discharge. X-ray photoelectron spectroscopy (XPS) depth profiling reveals that sodium is effectively implanted into a silicon wafer using this apparatus. The Na 1s XPS spectra disclose Na{sub 2}O-SiO{sub 2} bonds and the implantation effects are confirmed by tapping mode atomic force microscopy. Our setup provides a feasible way to conduct sodium ion implantation effectively.

  20. Population genetic analysis infers migration pathways of Phytophthora ramorum in US nurseries.

    Directory of Open Access Journals (Sweden)

    Erica M Goss

    2009-09-01

    Full Text Available Recently introduced, exotic plant pathogens may exhibit low genetic diversity and be limited to clonal reproduction. However, rapidly mutating molecular markers such as microsatellites can reveal genetic variation within these populations and be used to model putative migration patterns. Phytophthora ramorum is the exotic pathogen, discovered in the late 1990s, that is responsible for sudden oak death in California forests and ramorum blight of common ornamentals. The nursery trade has moved this pathogen from source populations on the West Coast to locations across the United States, thus risking introduction to other native forests. We examined the genetic diversity of P. ramorum in United States nurseries by microsatellite genotyping 279 isolates collected from 19 states between 2004 and 2007. Of the three known P. ramorum clonal lineages, the most common and genetically diverse lineage in the sample was NA1. Two eastward migration pathways were revealed in the clustering of NA1 isolates into two groups, one containing isolates from Connecticut, Oregon, and Washington and the other isolates from California and the remaining states. This finding is consistent with trace forward analyses conducted by the US Department of Agriculture's Animal and Plant Health Inspection Service. At the same time, genetic diversities in several states equaled those observed in California, Oregon, and Washington and two-thirds of multilocus genotypes exhibited limited geographic distributions, indicating that mutation was common during or subsequent to migration. Together, these data suggest that migration, rapid mutation, and genetic drift all play a role in structuring the genetic diversity of P. ramorum in US nurseries. This work demonstrates that fast-evolving genetic markers can be used to examine the evolutionary processes acting on recently introduced pathogens and to infer their putative migration patterns, thus showing promise for the application of

  1. Molecular Characterization of Human Respiratory Syncytial Virus in the Philippines, 2012-2013.

    Directory of Open Access Journals (Sweden)

    Rungnapa Malasao

    Full Text Available Human respiratory syncytial virus (HRSV is a major cause of acute lower respiratory tract infections in infants and children worldwide. We performed molecular analysis of HRSV among infants and children with clinical diagnosis of severe pneumonia in four study sites in the Philippines, including Biliran, Leyte, Palawan, and Metro Manila from June 2012 to July 2013. Nasopharyngeal swabs were collected and screened for HRSV using real-time polymerase chain reaction (PCR. Positive samples were tested by conventional PCR and sequenced for the second hypervariable region (2nd HVR of the G gene. Among a total of 1,505 samples, 423 samples were positive for HRSV (28.1%, of which 305 (72.1% and 118 (27.9% were identified as HRSV-A and HRSV-B, respectively. Two genotypes of HRSV-A, NA1 and ON1, were identified during the study period. The novel ON1 genotype with a 72-nucleotide duplication in 2nd HVR of the G gene increased rapidly and finally became the predominant genotype in 2013 with an evolutionary rate higher than the NA1 genotype. Moreover, in the ON1 genotype, we found positive selection at amino acid position 274 (p<0.05 and massive O- and N-glycosylation in the 2nd HVR of the G gene. Among HRSV-B, BA9 was the predominant genotype circulating in the Philippines. However, two sporadic cases of GB2 genotype were found, which might share a common ancestor with other Asian strains. These findings suggest that HRSV is an important cause of severe acute respiratory infection among children in the Philippines and revealed the emergence and subsequent predominance of the ON1 genotype and the sporadic detection of the GB2 genotype. Both genotypes were detected for the first time in the Philippines.

  2. Auger decay mechanism in photon-stimulated desorption of ions from surfaces

    Energy Technology Data Exchange (ETDEWEB)

    Parks, C.C.

    1983-11-01

    Photon-stimulated desorption (PSD) of positive ions was studied with synchrotron radiation using an angle-integrating time-of-flight mass spectrometer. Ion yields as functions of photon energy near core levels were measured from condensed gases, alkali fluorides, and other alkali and alkaline earth halides. These results are compared to bulk photoabsorption measurements with emphasis on understanding fundamental desorption mechanisms. The applicability of the Auger decay mechanism, in which ion desorption is strictly proportional to surface absorption, is discussed in detail. The Auger decay model is developed in detail to describe Na/sup +/ and F/sup +/ desorption from NaF following Na(1s) excitation. The major decay pathways of the Na(1s) hole leading to desorption are described and equations for the energetics of ion desorption are developed. Ion desorption spectra of H/sup +/, Li/sup +/, and F/sup +/ are compared to bulk photoabsorption near the F(2s) and Li(1s) edges of LiF. A strong photon beam exposure dependence of ion yields from alkali fluorides is revealed, which may indicate the predominance of metal ion desorption from defect sites. The large role of indirect mechanisms in ion desorption condensed N/sub 2/-O/sub 2/ multilayers is demonstrated and discussed. Ion desorption spectra from several alkali halides and alkaline earth halides are compared to bulk photoabsorption spectra. Relative ion yields from BaF/sub 2/ and a series of alkali halides are discussed in terms of desorption mechanisms.

  3. Impact of promoting self-care in nursing workload.

    Science.gov (United States)

    Trettene, Armando Dos Santos; Fontes, Cassiana Mendes Bertoncelo; Razera, Ana Paula Ribeiro; Gomide, Marcia Ribeiro

    2016-01-01

    To assess the impact of promoting self-care in nursing workload and associate it to the variables: age, gender, socioeconomic status, education, marital status and number of children of caregivers. Prospective study with 31 children and their caregivers. Participants were assessed at two moments, 1st and 2nd hospitalization, the nursing workload was measured by the Nursing Activities Score (NAS). The mean NAS in the 1st hospitalization was 60.9% and in the 2nd hospitalization was 41.6%, that is, 14.6 and 9.9 hours of nursing, respectively. The nursing workload on the first day of hospitalization was higher compared to the last day, both for the 1st (penfermagem e associá-la às variáveis: idade, gênero, classificação socioeconômica, escolaridade, estado civil e número de filhos dos cuidadores. Estudo prospectivo, onde participaram 31 crianças e seus respectivos cuidadores. Os participantes foram avaliados em dois momentos, 1ª e 2ª internação, quanto à carga de trabalho de enfermagem mensurada por meio do Nursing Activities Score (NAS). A média NAS na 1ª internação foi de 60,9%, e na 2ª internação foi de 41,6%, ou seja, 14,6 e 9,9 horas de enfermagem, respectivamente. A carga de trabalho de enfermagem no primeiro dia de internação foi maior quando comparada ao último dia, tanto na 1ª (penfermagem referente à promoção do autocuidado correspondeu a 14,6 horas e foi superior ao determinado pela legislação existente.

  4. Screening of Less known Two Food Plants for Comparison of Nutrient Contents: Iranian and Indian Vegetables

    Directory of Open Access Journals (Sweden)

    Ali Aberoumand

    2011-10-01

    Full Text Available Background: Greater consumption of fruits and vegetables is associated with reduced risk of cardiovascular disease, stroke, and cancers. The most important nutrients present in plants are carbohydrates, such as the starch and free sugars, oils, proteins, minerals, ascorbic acid, and the antioxidant phenols. Plants are an essential component of the universe. Human beings have used those as medicine from the very beginning of time.Methods: The proximate composition and mineral constituents of Asparagus officinalis stem and Momordica dioica fruit were evaluated in order to scientific standard methods of Association for Official and Analytical Chemists (AOAC.Results: The stem contained ashes: 10.70% crude protein: 32.69%, crude lipid: 3.44%, crude fiber: 18.50%, and carbohydrates: 34.67%. Stem also have high energy value (384.27kcal/100g dry weight. Mineral ranges (mg/100g dry weight, DW were: K (10.94, Na (1.84, Ca (0.67, Fe (0.19, and Zn (2.60. The fruits contained ashes: 9.1%, crude protein: 5.44%, crude lipid: 3.25%, crude fiber: 22.9%, and carbohydrates: 59.31%. The fruits also have high energy value (288.25kcal/100g dry weight. Mineral ranges (mg/100g dry weight, DW were: K (4.63, Na (1.62, Ca (7.37, Fe (5.04, and Zn (3.83.Conclusion: Comparing proximate and minerals contents of the stem and the fruit, the results indicated that Asparagus officinalis stem could be a good supplement for some nutrients such as protein, lipid, potassium and zinc, fibre and carbohydrates while Momordica dioica fruit was good source of lipid, crude fiber, carbohydrates, iron and zinc.Functional Foods in Health and Disease 2011; 10:416-424

  5. Molecular Characterization of Human Respiratory Syncytial Virus in the Philippines, 2012-2013.

    Science.gov (United States)

    Malasao, Rungnapa; Okamoto, Michiko; Chaimongkol, Natthawan; Imamura, Tadatsugu; Tohma, Kentaro; Dapat, Isolde; Dapat, Clyde; Suzuki, Akira; Saito, Mayuko; Saito, Mariko; Tamaki, Raita; Pedrera-Rico, Gay Anne Granada; Aniceto, Rapunzel; Quicho, Reynaldo Frederick Negosa; Segubre-Mercado, Edelwisa; Lupisan, Socorro; Oshitani, Hitoshi

    2015-01-01

    Human respiratory syncytial virus (HRSV) is a major cause of acute lower respiratory tract infections in infants and children worldwide. We performed molecular analysis of HRSV among infants and children with clinical diagnosis of severe pneumonia in four study sites in the Philippines, including Biliran, Leyte, Palawan, and Metro Manila from June 2012 to July 2013. Nasopharyngeal swabs were collected and screened for HRSV using real-time polymerase chain reaction (PCR). Positive samples were tested by conventional PCR and sequenced for the second hypervariable region (2nd HVR) of the G gene. Among a total of 1,505 samples, 423 samples were positive for HRSV (28.1%), of which 305 (72.1%) and 118 (27.9%) were identified as HRSV-A and HRSV-B, respectively. Two genotypes of HRSV-A, NA1 and ON1, were identified during the study period. The novel ON1 genotype with a 72-nucleotide duplication in 2nd HVR of the G gene increased rapidly and finally became the predominant genotype in 2013 with an evolutionary rate higher than the NA1 genotype. Moreover, in the ON1 genotype, we found positive selection at amino acid position 274 (pPhilippines. However, two sporadic cases of GB2 genotype were found, which might share a common ancestor with other Asian strains. These findings suggest that HRSV is an important cause of severe acute respiratory infection among children in the Philippines and revealed the emergence and subsequent predominance of the ON1 genotype and the sporadic detection of the GB2 genotype. Both genotypes were detected for the first time in the Philippines.

  6. The Fc Receptor Polymorphisms and Expression of Neutrophil Activation Markers in Patients with Sickle Cell Disease from Western India

    Directory of Open Access Journals (Sweden)

    Harshada K. Kangne

    2013-01-01

    Full Text Available Objective. Sickle cell disease has variable clinical manifestations. Activation of neutrophils plays an important role in the initiation and propagation of vaso occlusive crises which can be analysed by determining the expression of neutrophil antigens such as CD16, CD32, and CD62L. The common FcγR polymorphisms (FcγRIIA and FcγRIIIB are considered to influence clinical presentation. This study focuses on distribution of FcγR polymorphisms and their association with neutrophil activity among the patients from western India. Methods. In this paper 127 sickle cell anemia patients and 58 patients with sickle-β-thalassemia (median age 12±8.58 years with variable clinical phenotypes along with 175 normals were investigated. FcγRs polymorphisms were analysed by RFLP and AS-PCR. Activation of neutrophils was measured by flow cytometry. Results. The genotypic frequency of the H/R genotype of FcγRIIA and the NA1/NA1 genotype of FcγRIIIB was significantly decreased in patients compared to normals (P-0.0074, P-0.0471, resp.. We found a significant difference in the expression of CD32 and CD62L among the patients as against normals. A significantly higher expression of CD32 was seen in the milder patients with the H/H genotype (P-0.0231, whereas the expression of CD16 was higher in severe patients with the NA2/NA2 genotype (P-0.0312. Conclusion. The two FcγR polymorphisms had significant association with variable phenotypes of sickle cell disease. The expression of CD62L decreased in our patients indicating activation of neutrophils.

  7. Comparison of phase composition, morphology and electrochemical property for Li3−xNaxV2(PO4)3 (x=0.5, 1.5 and 2.0) as lithium storage cathode materials

    International Nuclear Information System (INIS)

    Mao, Jinli; Shao, Lianyi; Li, Peng; Lin, Xiaoting; Shui, Miao; Long, Nengbing; Shu, Jie

    2015-01-01

    Graphical abstract: Display Omitted -- Highlights: •Li 3−x Na x V 2 (PO 4 ) 3 is prepared by a solid-state reaction method. •Li 2.5 Na 0.5 V 2 (PO 4 ) 3 is a three-phase mixture. •Both Li 1.5 Na 1.5 V 2 (PO 4 ) 3 and LiNa 2 V 2 (PO 4 ) 3 are two-phase composite. •Lithium ion diffusion coefficient is detected by cyclic voltammetry. •Structural change of LiNa 2 V 2 (PO 4 ) 3 is observed by in-situ XRD. -- Abstract: Three Li 3-x Na x V 2 (PO 4 ) 3 (x=0.5, 1.5 and 2.0) samples are synthesized by a traditional solid-state reaction method in this work. Their phase composition, surface morphology and electrochemical property are described and compared by using various physical/chemical methods. Phase analysis results reveal that Li 2.5 Na 0.5 V 2 (PO 4 ) 3 consists of monoclinic Li 3 V 2 (PO 4 ) 3 , rhombohedral Li 3 V 2 (PO 4 ) 3 and rhombohedral Na 3 V 2 (PO 4 ) 3. While, both Li 1.5 Na 1.5 V 2 (PO 4 ) 3 and LiNa 2 V 2 (PO 4 ) 3 are the two-phase mixture consisted of rhombohedral Li 3 V 2 (PO 4 ) 3 and rhombohedral Na 3 V 2 (PO 4 ) 3 . Electrochemical testing results reveal that LiNa 2 V 2 (PO 4 ) 3 and Li 1.5 Na 1.5 V 2 (PO 4 ) 3 can deliver the initial discharge capacities of 101.4 mAh g −1 and 108.6 mAh g −1 with a long potential plateau at 3.69 V, respectively. In contrast, Li 2.5 Na 0.5 V 2 (PO 4 ) 3 presents an initial discharge capacity of 111.7 mAh g −1 with four potential plateaus. High lithium ion diffusion coefficient in Li 2.5 Na 0.5 V 2 (PO 4 ) 3 indicates that the existence of monoclinic Li 3 V 2 (PO 4 ) 3 phase can improve the ionic conductivity and then be responsible for good electrochemical performance. Besides, in-situ X-ray diffraction observation of LiNa 2 V 2 (PO 4 ) 3 demonstrates that the phase transition is not fully reversible but quasi-reversible during the lithiation-delithiation process. The partial irreversibility of structural evolution for LiNa 2 V 2 (PO 4 ) 3 induces the capacity loss upon repeated cycles

  8. O efeito da retração dos dentes anteriores sobre o ponto A em pacientes submetidos ao tratamento ortodôntico corretivo The effect of retraction of anterior teeth on the point A in patients submitted to corrective orthodontic treatment

    Directory of Open Access Journals (Sweden)

    Tien Li An

    2008-04-01

    Full Text Available OBJETIVO: avaliar o efeito da retração anterior sobre o ponto A sagital e verticalmente, bem como a correlação e a previsibilidade do comportamento dessas estruturas. METODOLOGIA: sessenta telerradiografias em norma lateral foram usadas, tomadas no início e no final do tratamento ortodôntico corretivo, a partir de 30 pacientes (22 feminino e 8 masculino com idade entre 10 e 17 anos antes do tratamento, com má oclusão de Classe II, divisão 1 ou Classe I, que foram submetidos às extrações dos quatro primeiros pré-molares ou somente dois primeiros pré-molares superiores. Além das variáveis .1NA,1-NA, 1.PP e 1-A, mensurações lineares horizontais e verticais foram feitas em relação a uma linha de referência construída a partir da linha SN menos 7º e uma linha perpendicular a ela. Todos os dados foram mensurados duas vezes, e as médias foram submetidas ao teste t emparelhado, de correlação linear e de regressão. RESULTADOS: em média, o ponto A retraiu 0,71mm e movimentou para baixo 2,38mm, seguindo 1,03mm e 4,13mm de retração, respectivamente, do ápice radicular e da borda incisal, e 2,35mm de extrusão dentária. A retração do ponto A apresentou correlação positiva em relação ao ápice radicular (r = 0,75; alfa OBJECTIVE: it was aimed to evaluate the effect of retraction of anterior teeth on the point A sagittally and vertically, as well as the correlation and the predictability of the behavior of these structures. METHODS: sixty lateral cephalograms were used, which were taken at the beginning and at the end of fixed appliance orthodontic treatment, from thirty patients (22 female and 8 male aging from 10 to 17 years at baseline, with Class II, Division 1 or Class I malocclusion, who underwent four first premolars extractions or maxillary first premolars extractions only. Besides the variables 1.NA, 1-NA, U1/PP and U1«AVERT, horizontal and vertical linear measurements were made in relation to a horizontal

  9. Association of Fcγ receptor IIB polymorphism with cryptococcal meningitis in HIV-uninfected Chinese patients.

    Directory of Open Access Journals (Sweden)

    Xiu-Ping Hu

    Full Text Available BACKGROUND: As important regulators of the immune system, the human Fcγ receptors (FcγRs have been demonstrated to play important roles in the pathogenesis of various infectious diseases. The aim of the present study was to identify the association between FCGR polymorphisms and cryptococcal meningitis. METHODOLOGY/PRINCIPAL FINDINGS: In this case control genetic association study, we genotyped four functional polymorphisms in low-affinity FcγRs, including FCGR2A 131H/R, FCGR3A 158F/V, FCGR3B NA1/NA2, and FCGR2B 232I/T, in 117 patients with cryptococcal meningitis and 190 healthy controls by multiplex SNaPshot technology. Among the 117 patients with cryptococcal meningitis, 59 had predisposing factors. In patients with cryptococcal meningitis, the FCGR2B 232I/I genotype was over-presented (OR = 1.652, 95% CI [1.02-2.67]; P = 0.039 and the FCGR2B 232I/T genotype was under-presented (OR = 0.542, 95% CI [0.33-0.90]; P = 0.016 in comparison with control group. In cryptococcal meningitis patients without predisposing factors, FCGR2B 232I/I genotype was also more frequently detected (OR = 1.958, 95% CI [1.05-3.66]; P = 0.033, and the FCGR2B 232I/T genotype was also less frequently detected (OR = 0.467, 95% CI [0.24-0.91]; P = 0.023 than in controls. No significant difference was found among FCGR2A 131H/R, FCGR3A 158F/V, and FCGR3B NA1/NA2 genotype frequencies between patients and controls. CONCLUSION/SIGNIFICANCE: We found for the first time associations between cryptococcal meningitis and FCGR2B 232I/T genotypes, which suggested that FcγRIIB might play an important role in the central nervous system infection by Cryptococcus in HIV-uninfected individuals.

  10. Tracking Sodium-Antimonide Phase Transformations in Sodium-Ion Anodes: Insights from Operando Pair Distribution Function Analysis and Solid-State NMR Spectroscopy

    Energy Technology Data Exchange (ETDEWEB)

    Allan, Phoebe K. [University of Cambridge, University Chemical Laboratory, Lensfield Road, Cambridge, CB2 1EW, U.K.; Gonville and Caius College, Trinity; Griffin, John M. [University of Cambridge, University Chemical Laboratory, Lensfield Road, Cambridge, CB2 1EW, U.K.; Darwiche, Ali [Institut; Réseau sur le Stockage Electrochimique de l’Energie (RS2E), FR CNRS 3459, 80039 Amiens Cedex, France; Borkiewicz, Olaf J. [X-ray; Wiaderek, Kamila M. [X-ray; Chapman, Karena W. [X-ray; Morris, Andrew J. [Theory of; Chupas, Peter J. [X-ray; Monconduit, Laure [Institut; Réseau sur le Stockage Electrochimique de l’Energie (RS2E), FR CNRS 3459, 80039 Amiens Cedex, France; Grey, Clare P. [University of Cambridge, University Chemical Laboratory, Lensfield Road, Cambridge, CB2 1EW, U.K.

    2016-02-15

    Operando pair distribution function (PDF) analysis and ex situ Na-23 magic-angle spinning solid-state nuclear magnetic resonance (MAS ssNMR) spectroscopy are used to gain insight into the alloying mechanism of high-capacity antimony anodes for sodium-ion batteries. Subtraction of the PDF of crystalline NaxSb phases from the total PDF, an approach constrained by chemical phase information gained from Na-23 ssNMR in reference to relevant model compounds, identifies two previously uncharacterized intermediate species formed electro-chemically; a-Na3-xSb (x approximate to 0.4-0.5), a structure locally similar to crystalline Na3Sb (c-Na3Sb) but with significant numbers of sodium vacancies and a limited correlation length, and a-Na1.7Sb, a highly amorphous structure featuring some Sb-Sb bonding. The first sodiation breaks down the crystalline antimony to form first a-Na3-xSb and, finally, crystalline Na3Sb. Desodiation results in the formation of an electrode formed of a composite of crystalline and amorphous antimony networks. We link the different reactivity of these networks to a series of sequential sodiation reactions manifesting as a cascade of processes observed in the electrochemical profile of subsequent cycles. The amorphofis network reacts at higher voltages reforming a-Na1.7Sb, then a-Na3-xSb, whereas lower potentials are required for the sodiation of crystalline antimony, which reacts to form a-Na3-xSb without the formation of a-Na3-xSb. a-Na3-xSb is converted to crystalline Na3Sb at the end of the second discharge. We find no evidence of formation of NaSb. Variable temperature Na-23 NMR experiments reveal significant sodium mobility within c-Na3Sb; this is a possible contributing factor to the excellent rate performance of Sb anodes.

  11. Comparative study of A-site order in the lead-free bismuth titanates M1/2Bi1/2TiO3 (M=Li, Na, K, Rb, Cs, Ag, Tl) from first-principles

    International Nuclear Information System (INIS)

    Gröting, Melanie; Albe, Karsten

    2014-01-01

    We investigate the possibility of enhancing chemical order in the relaxor ferroelectric Na 1/2 Bi 1/2 TiO 3 upon substitution of Na + by other monovalent cations M + using total energy calculations based on density functional theory. All chemically available monovalent cations M + , which are Li, Na, Ag, K, Tl, Rb and Cs, are considered and an analysis of the structurally relaxed structures in terms of symmetry-adapted distortion modes is given in order to quantify the chemically induced structural distortions. We demonstrate that the replacement of Na + by other monovalent cations can hardly alter the tendency of chemical order with respect to Na 1/2 Bi 1/2 TiO 3 . Only Tl 1/2 Bi 1/2 TiO 3 and Ag 1/2 Bi 1/2 TiO 3 show enhanced tendency for chemical ordering. Both heavy metals behave similar to the light alkali metals in terms of structural relaxations and relative stabilities of the ordered configurations. Although a comparison of the Goldschmidt factors of components (M TiO 3 ) − reveals for Tl a value above the upper stability limit for perovskites, the additional lone-pair effect of Tl + stabilizes the ordered structure. - Graphical abstract: Amplitudes of chemically induced distortion modes in different ordered perovskites M 1/2 Bi 1/2 TiO 3 and visualisation of atomic displacements associated with distortion mode X + 1 in the 001-ordered compounds Li 1/2 Bi 1/2 TiO 3 and Cs 1/2 Bi 1/2 TiO 3 . Due to a substantial size mismatch between bismuth (green) and caesium (dark blue), incorporation of the latter leads to enhanced displacements of oxygen atoms (red) and suppresses displacements of titanium (silver) as compared to lithium (light blue) or other smaller monovalent cations. - Highlights: • Lead-free A-site mixed bismuth titanates M 1/2 Bi 1/2 TiO 3 are studied by first-principles calculations. • Investigation of chemical ordering tendency for M=Li, Na, K, Rb, Cs, Ag, and Tl. • Group theoretical analysis of different ordered structures. • Ag and Tl

  12. Uso da cor da casca como indicador de qualidade do maracujá amarelo (Passiflora edulis Sims. f. flavicarpa Deg. destinado à industrialização

    Directory of Open Access Journals (Sweden)

    DE MARCHI Renata

    2000-01-01

    Full Text Available As características físico-químicas do maracujá amarelo em três estádios de cor de casca (1/3 amarelo, 2/3 amarelo e inteiro amarelo, em quatro épocas da safra/99 foram avaliadas, visando estabelecer o ponto de colheita de melhor qualidade da fruta para a industrialização. Foram determinados o tamanho dos frutos, a cor da casca e da polpa, o rendimento de extração da polpa, o teor de sólidos solúveis totais, o pH, a acidez total, o ratio e o teor de vitamina C. Foi empregado o delineamento experimental inteiramente casualizado, com 8 repetições, 5 frutos por parcela e 3 tratamentos. Os resultados mostraram que o rendimento de polpa não apresentou diferença significativa entre os tratamentos e entre as colheitas. Com relação à cor da polpa, houve diferença significativa entre os três estádios apenas na 1ª colheita. Os frutos de casca 1/3 amarela apresentaram teor de sólidos solúveis significativamente inferior aos demais apenas na 3ª e 4ª colheitas, mas o maior valor médio ocorreu na 4ª colheita. O teor de acidez total dos frutos de casca inteira amarela foi significativamente inferior àqueles das colheitas 2, 3 e 4. Os valores mais elevados de vitamina C foram obtidos na 1ª colheita e, os frutos de casca 1/3 amarela apresentaram teores significativamente inferiores nas colheitas 1 e 2. De maneira geral, os resultados indicaram que, embora tenham ocorrido algumas diferenças nas características físico-químicas dos frutos nos diferentes estádios de cor de casca, frutos colhidos em todos os estádios de cor de casca estudados apresentaram-se adequados à industrialização.

  13. Enhanced methodology of focus control and monitoring on scanner tool

    Science.gov (United States)

    Chen, Yen-Jen; Kim, Young Ki; Hao, Xueli; Gomez, Juan-Manuel; Tian, Ye; Kamalizadeh, Ferhad; Hanson, Justin K.

    2017-03-01

    As the demand of the technology node shrinks from 14nm to 7nm, the reliability of tool monitoring techniques in advanced semiconductor fabs to achieve high yield and quality becomes more critical. Tool health monitoring methods involve periodic sampling of moderately processed test wafers to detect for particles, defects, and tool stability in order to ensure proper tool health. For lithography TWINSCAN scanner tools, the requirements for overlay stability and focus control are very strict. Current scanner tool health monitoring methods include running BaseLiner to ensure proper tool stability on a periodic basis. The focus measurement on YIELDSTAR by real-time or library-based reconstruction of critical dimensions (CD) and side wall angle (SWA) has been demonstrated as an accurate metrology input to the control loop. The high accuracy and repeatability of the YIELDSTAR focus measurement provides a common reference of scanner setup and user process. In order to further improve the metrology and matching performance, Diffraction Based Focus (DBF) metrology enabling accurate, fast, and non-destructive focus acquisition, has been successfully utilized for focus monitoring/control of TWINSCAN NXT immersion scanners. The optimal DBF target was determined to have minimized dose crosstalk, dynamic precision, set-get residual, and lens aberration sensitivity. By exploiting this new measurement target design, 80% improvement in tool-to-tool matching, >16% improvement in run-to-run mean focus stability, and >32% improvement in focus uniformity have been demonstrated compared to the previous BaseLiner methodology. Matching <2.4 nm across multiple NXT immersion scanners has been achieved with the new methodology of set baseline reference. This baseline technique, with either conventional BaseLiner low numerical aperture (NA=1.20) mode or advanced illumination high NA mode (NA=1.35), has also been evaluated to have consistent performance. This enhanced methodology of focus

  14. Escolha de alimentos durante a abstinência alcoólica: influência na fissura e no peso corporal

    Directory of Open Access Journals (Sweden)

    Mayla Cardoso Fernandes Toffolo

    2011-01-01

    Full Text Available Objetivo: Avaliar a influência da fissura na escolha de alimentos doces e alteração do peso corporal em pacientes alcoolistas. Métodos: Vinte e um pacientes alcoolistas em tratamento no Centro de Atenção Psicossocial de álcool e drogas (CAPSad, Ouro Preto/MG, foram selecionados para participar deste estudo (14 homens e 7 mulheres, com idade entre 25 e 64 anos. Foi aplicado questionário para avaliar a fissura (craving e o consumo alimentar. A alteração do peso corporal e do índice de massa corporal (IMC foi estimada por métodos antropométricos para avaliar o estado nutricional. As avaliações foram realizadas no momento inicial e final, contemplando até três meses de tratamento. Resultados: As mulheres apresentaram ganho de peso (1,9 ± 1,86 kg e os homens, perda de peso corporal (-0,13 ± 2,09 kg (p = 0,04. Não houve diferença estatística quando essa variação de peso foi comparada entre os abstinentes (AB e não abstinentes (NA (Homens: AB = 0,39 ± 2,19 kg; NA: -1,06 ± 1,75 kg/Mulheres: AB: 2,73 ± 1,95 kg; NA: 1,42 ± 1,85 kg. A presença de fissura inicial e final foi semelhante entre os que recaíram e os abstinentes. Os abstinentes mantiveram menor fissura e maior sensação de bem-estar com o consumo de alimentos fontes de carboidratos simples ou complexos. Conclusão: Os alcoolistas que conseguiram se abster tiveram menor grau de fissura com maior bem-estar com o consumo de alimentos fontes de carboidratos. Houve mudanças do peso corporal ao longo do tempo de acompanhamento dos alcoolistas em tratamento para a abstinência.

  15. Relationship of bacteriophages to alpha toxin production in Clostridium novyi types A and B.

    Science.gov (United States)

    Eklund, M W; Poysky, F T; Peterson, M E; Meyers, J A

    1976-09-01

    The relationship of specific bacteriophages to the production of the lethal alpha toxin in Clostridium novyi types A and B was investigated. When type A strain 5771 reverted to the phage-sensitive state, it ceased to produce alpha toxin but continued to produce the gamma and epsilon antigens. This "nontoxigenic" culture, therefore, more closely resembled C. botulinum types C and D than the other C. novyi types. Phage-sensitive type B strains also ceased to produce the alpha toxin but continued to produce the beta toxin, and therefore very colesly resembled C. novyi type D (C. haemolyticum). Alpha toxin was again produced when the phage-sensitive cultures were reinfected with the respective tox+ phages. Alpha toxin production could also be induced in the "nontoxigenic" phage-sensitive derivatives from type B strain 8024 by tox+ phages isolated from other strains of type B. tox- phages were also isolated, but they did not affect alpha toxin production. The tox+ phages also caused a marked change in the colonial morphology of type B strains. In this report we present evidence that alpha toxin production by C. novyi type A strain 5771 and type B strain 8024 depends upon the continued presence and participation of specific bacteriophages designated as NA1tox+ and NB1tox+, respectively.

  16. Measurement of the electromagnetic form factors of $\\pi$ and $K$ mesons at the SPS

    CERN Multimedia

    2002-01-01

    This experiment will measure the electro-magnetic form factors of $\\pi$ and K mesons by determining the elastic scattering cross sections of these particles from stationary electrons in a liquid hydrogen target. It is planned to use an incident beam momentum of 300 GeV/c which corresponds to a maximum four momentum transfer of 0.29 (GeV/c)$^{2}$ for $\\pi$-e scattering and of 0.17 (GeV/c)$^{2}$ for K-e scattering. \\\\ \\\\ The apparatus will consist of the forward spectrometer of the NA1 experiment as described in proposal SPSC/74-15/P6 and addenda, preceded by modules of multiwire proportional chambers which determine the trajectories of the incident and scattered particles. The event trigger will be produced by scintillation counters arranged to discriminate against the strong interaction background and by the identification of one of the scattered particles as an electron by the photon detectors which form part of the forward spectrometer.

  17. Raman spectroscopy of organic, solid and fluid inclusions in the Oldest Halite of LGOM area (SW Poland)

    Science.gov (United States)

    Toboła, Tomasz

    2018-01-01

    Raman spectroscopy was applied to determine the degree of recrystallization and the influence of the secondary solution migration on the Oldest Halite (Na1) in Lubin-Głogów Copper District (LGOM). Numerous organic matter (OM) inclusions which generally show weak structural ordering was found in halite crystals. In this context they are similar to solid bitumens or carbonaceous matter of low thermal alteration. The difference in the Raman line-shape of OM indicated various thermal alteration of salt from the Oldest Halite formation due to hot fluid flow. Solutions included in the secondary fluid inclusions often contain dissolved gases such as CH4, N2, H2S. The presence of these gases is connected with migration process from basement to the salt formation. Moissanite in fluid inclusions was accidentally trapped during inclusion formation, i.e. is not a daughter mineral. It was also found in the halite as an individual solid inclusions as well as in the anhydrite concentrations. Raman spectroscopy allowed to determine also such solid inclusions in halite as celestine, magnesite, pyrite, lepidocrocite and goethite as well as hydrocarbons.

  18. Development of organic-inorganic double hole-transporting material for high performance perovskite solar cells

    Science.gov (United States)

    Jo, Jea Woong; Seo, Myung-Seok; Jung, Jae Woong; Park, Joon-Suh; Sohn, Byeong-Hyeok; Ko, Min Jae; Son, Hae Jung

    2018-02-01

    The control of the optoelectronic properties of the interlayers of perovskite solar cells (PSCs) is crucial for achieving high photovoltaic performances. Of the solution-processable interlayer candidates, NiOx is considered one of the best inorganic hole-transporting layer (HTL) materials. However, the power conversion efficiencies (PCEs) of NiOx-based PSCs are limited by the unfavorable contact between perovskite layers and NiOx HTLs, the high density of surface trap sites, and the inefficient charge extraction from perovskite photoactive layers to anodes. Here, we introduce a new organic-inorganic double HTL consisting of a Cu:NiOx thin film passivated by a conjugated polyelectrolyte (PhNa-1T) film. This double HTL has a significantly lower pinhole density and forms better contact with perovskite films, which results in enhanced charge extraction. As a result, the PCEs of PSCs fabricated with the double HTL are impressively improved up to 17.0%, which is more than 25% higher than that of the corresponding PSC with a Cu:NiOx HTL. Moreover, PSCs with the double HTLs exhibit similar stabilities under ambient conditions to devices using inorganic Cu:NiOx. Therefore, this organic-inorganic double HTL is a promising interlayer material for high performance PSCs with high air stability.

  19. An Analytical Model for Adsorption and Diffusion of Atoms/Ions on Graphene Surface

    Directory of Open Access Journals (Sweden)

    Yan-Zi Yu

    2015-01-01

    Full Text Available Theoretical investigations are made on adsorption and diffusion of atoms/ions on graphene surface based on an analytical continuous model. An atom/ion interacts with every carbon atom of graphene through a pairwise potential which can be approximated by the Lennard-Jones (L-J potential. Using the Fourier expansion of the interaction potential, the total interaction energy between the adsorption atom/ion and a monolayer graphene is derived. The energy-distance relationships in the normal and lateral directions for varied atoms/ions, including gold atom (Au, platinum atom (Pt, manganese ion (Mn2+, sodium ion (Na1+, and lithium-ion (Li1+, on monolayer graphene surface are analyzed. The equilibrium position and binding energy of the atoms/ions at three particular adsorption sites (hollow, bridge, and top are calculated, and the adsorption stability is discussed. The results show that H-site is the most stable adsorption site, which is in agreement with the results of other literatures. What is more, the periodic interaction energy and interaction forces of lithium-ion diffusing along specific paths on graphene surface are also obtained and analyzed. The minimum energy barrier for diffusion is calculated. The possible applications of present study include drug delivery system (DDS, atomic scale friction, rechargeable lithium-ion graphene battery, and energy storage in carbon materials.

  20. Analysis of the sodium recirculation theory of solute-coupled water transport in small intestine.

    Science.gov (United States)

    Larsen, Erik Hviid; Sørensen, Jakob Balslev; Sørensen, Jens Nørkaer

    2002-07-01

    Our previous mathematical model of solute-coupled water transport through the intestinal epithelium is extended for dealing with electrolytes rather than electroneutral solutes. A 3Na+-2K+ pump in the lateral membranes provides the energy-requiring step for driving transjunctional and translateral flows of water across the epithelium with recirculation of the diffusible ions maintained by a 1Na+-1K+-2Cl- cotransporter in the plasma membrane facing the serosal compartment. With intracellular non-diffusible anions and compliant plasma membranes, the model describes the dependence on membrane permeabilities and pump constants of fluxes of water and electrolytes, volumes and ion concentrations of cell and lateral intercellular space (lis), and membrane potentials and conductances. Simulating physiological bioelectrical features together with cellular and paracellular fluxes of the sodium ion, computations predict that the concentration differences between lis and bathing solutions are small for all three ions. Nevertheless, the diffusion fluxes of the ions out of lis significantly exceed their mass transports. It is concluded that isotonic transport requires recirculation of all three ions. The computed sodium recirculation flux that is required for isotonic transport corresponds to that estimated in experiments on toad small intestine. This result is shown to be robust and independent of whether the apical entrance mechanism for the sodium ion is a channel, a SGLT1 transporter driving inward uphill water flux, or an electroneutral Na+-K+-2Cl- cotransporter.

  1. Determination of the neutron fluence spectra in the neutron therapy room of KIRAMS.

    Science.gov (United States)

    Kim, B H; Kim, J S; Kim, J L; Kim, Y S; Yang, T G; Lee, M Y

    2007-01-01

    High energy proton induced neutron fluence spectra were determined at the Korea Institute of Radiological and Medical Sciences (KIRAMS) using an extended Bonner Sphere (BS) set from the Korea Atomic Energy Research Institute (KAERI) in a series of measurements to quantify the neutron field. At the facility of the MC50 cyclotron of KIRAMS, two Be targets of different thicknesses, 1.0 and 10.5 mm, were bombarded by 35 and 45-MeV protons to produce six kinds of neutron fields, which were classified according to the measurement position and the use or no use of a beam collimator such as the gantry of the neutron therapy unit. In order to obtain a priori information to unfold the measured BS data the MCNPX code was used to calculate the neutron spectrum, and the influence of the surrounding materials for cooling the target assembly were also reviewed through this calculation. Some dosimetric quantities were determined by using the spectra determined in this measurement. Dose equivalent rates of these neutron fields ranged from 0.21 to 5.66 mSv h(-1)nA(-1) and the neutron yields for a thick Be target were 3.05 and 4.77% in the case of using a 35 and a 45-MeV proton, respectively.

  2. Determination of the neutron fluence spectra in the neutron therapy room of KIRAMS

    International Nuclear Information System (INIS)

    Kim, B. H.; Kim, J. S.; Kim, J. L.; Kim, Y. S.; Yang, T. G.; Lee, M. Y.

    2007-01-01

    High energy proton induced neutron fluence spectra were determined at the Korea Inst. of Radiological and Medical Sciences (KIRAMS) using an extended Bonner Sphere (BS) set from the Korea Atomic Energy Research Inst. (KAERI) in a series of measurements to quantify the neutron field. At the facility of the MC50 cyclotron of KIRAMS, two Be targets of different thicknesses, 1.0 and 10.5 mm, were bombarded by 35 and 45-MeV protons to produce six kinds of neutron fields, which were classified according to the measurement position and the use or no use of a beam collimator such as the gantry of the neutron therapy unit. In order to obtain a priori information to unfold the measured BS data the MCNPX code was used to calculate the neutron spectrum, and the influence of the surrounding materials for cooling the target assembly were also reviewed through this calculation. Some dosimetric quantities were determined by using the spectra determined in this measurement. Dose equivalent rates of these neutron fields ranged from 0.21 to 5.66 mSv h -1 nA -1 and the neutron yields for a thick Be target were 3.05 and 4.77% in the case of using a 35 and a 45-MeV proton, respectively. (authors)

  3. Character of meteoric leaks in the salt mines of south Louisiana, U.S.A.

    Science.gov (United States)

    Kumar, Madhurendu B.

    1983-10-01

    The brine leaks of salt mines of south Louisiana are of two genetic categories: meteoric and non-meteoric (connate/formation water type), as established essentially on the basis of oxygen- and hydrogen-isotope analyses. This paper highlights the hydrochemical aspects of those mine leaks and develops simple non-isotopic criteria to differentiate the meteoric leaks from the non-meteoric. The meteoric leaks of the salt mines generally occur down to a depth level of 214 m (700 ft.) (below mean sea level) below which the leaks are mostly non-meteoric. The meteoric brine is essentially Na1bCl in type, reflecting the mineralogy of almost pure halite (with ˜ 1-2% anhydrite) of the Gulf (of Mexico) Coast dome salt. The meteoric leaks are distinctly different from the non-meteoric leaks on the log-log plots of chloride concentrations vs. those of Ca 2+, Mg 2+, K +, Sr + and Br -, in all of which the meteoric brines are conspicuously low. This study is potentially useful in the development of a mine or crypt in salt dome(s) under consideration for possible nuclear-waste isolation in the Gulf Coast region.

  4. Comparative study of radon in Sudan

    International Nuclear Information System (INIS)

    Gharbi, Shaza Ismail Mohammed

    2014-07-01

    This study was conducted primarily to contribute radon data for radon map in Sudan and identify regions with elevated radon levels and improve data collection and analysis for the future radon levels evaluation. This study partially covered three states of Sudan ( Red Sea - Khartoum - South Khordofan). Previous work done has been considered in this study which focused and investigated the levels of radon concentration in ( indoor radon gas and water) by using gamma spectrometry equipped with ( HPGe detector) or (Na1 (T1) detector). The results obtained are within the acceptable levels and dose not poses any risk from radiation protection point of view. Red Sea state ( port-sudan): (124.39±6.21) Bq/m 3 . Khartoum state ( Suba): (151.52) Bq/m 3 . (Omdurman): ( 127±23) Bq/m 3 . Radon in water: (59) Bq/L. South Kordofan State: (102.8) Bq/m 3 . In water (Kadugli): (3 1 39)) Bq/L.(Author)

  5. Concentrações séricas eficazes após doses únicas de drogas anti-epiléticas: conceito de dose carga

    Directory of Open Access Journals (Sweden)

    Paulo R.M. Bittencourt

    1985-03-01

    Full Text Available Doses únicas de fenitoína (500 a l.OOOmg, carbamazepina (400 e l.OOOmg e valproato de sódio (600mg foram administradas oralmente a 5 voluntários normais jovens e concentrações séricas foram determinadas entre 1 e 8 horas após administração. A técnica foi duplo-cega, controlada por placebo. Concentrações séricas "terapêuticas" foram obtidas após valproato de sódio e após a dose de l.OOOmg de carbamazepina. Os resultados sugerem que doses-carga de fenitoína (1.500-2.000mg e carbamazepina (800mg são úteis no controle sub-agudo de crises epilépticas freqüentes em pacientes de ambulatório e que carbamazepina pode ser utilizada para o controle crônico de estado de mal epiléptico inicialmente tratado com diazepam ou outra preparação de ação rápida.

  6. The cardiac electrogenic sodium/bicarbonate cotransporter (NBCe1) is activated by aldosterone through the G protein-coupled receptor 30 (GPR 30).

    Science.gov (United States)

    Orlowski, Alejandro; De Giusti, Verónica C; Ciancio, María C; Espejo, María S; Aiello, Ernesto A

    2016-09-02

    The sodium/bicarbonate cotransporter (NBC) transports extracellular Na + and HCO 3 - into the cytoplasm upon intracellular acidosis, restoring the acidic pH i to near neutral values. Two different NBC isoforms have been described in the heart, the electroneutral NBCn1 (1Na + :1HCO 3 - ) and the electrogenic NBCe1 (1Na + :2HCO 3 - ). Certain non-genomic effects of aldosterone (Ald) were due to an orphan G protein-couple receptor 30 (GPR30). We have recently demonstrated that Ald activates GPR30 in adult rat ventricular myocytes, which transactivates the epidermal growth factor receptor (EGFR) and in turn triggers a reactive oxygen species (ROS)- and PI3K/AKT-dependent pathway, leading to the stimulation of NBC. The aim of this study was to investigate the NBC isoform involved in the Ald/GPR30-induced NBC activation. Using specific NBCe1 inhibitory antibodies (a-L3) we demonstrated that Ald does not affect NBCn1 activity. Ald was able to increase NBCe1 activity recorded in isolation. Using immunofluorescence and confocal microscopy analysis we showed in this work that both NBCe1 and GPR30 are localized in t-tubules. In conclusion, we have demonstrated that NBCe1 is the NBC isoform activated by Ald in the heart.

  7. Development of capacitive beam position, beam current and Schottky-signal monitors for the Cryogenic Storage Ring (CSR)

    International Nuclear Information System (INIS)

    Laux, Felix

    2011-01-01

    In this thesis novel techniques based on capacitive pickups for the determination of the beam current, the beam position and the Schottky-signal in storage rings have been developed. Beam current measurements at the heavy ion storage ring TSR with a capacitive pickup have been found in very good agreement with the theory. Using this device the accurate measurement of beam currents at the TSR far below 1 μA is now possible. This method will also be used at the Cryogenic Storage Ring (CSR) at which beam currents in the range of 1 nA-1 μA are expected. For the first time, position measurements with a resonant amplifier system for capacitive pickups have been examined at the TSR for later use of this technique in the CSR. With this method an increased signal-to-noise ratio can be achieved using a parallel inductance. A comparison with measurements using the rest gas beam profile monitor has shown very good agreement even at very low intensities. Experiments with the cryo-capable electronics for the CSR beam position monitors have shown an achievable quality factor of Q=500, resulting in the prospect of precise position measurements at the CSR even at very low beam currents. The CSR Schottky-Pickup will also be equipped with a resonant amplifier system with a comparable quality factor. An estimation of the signal-to-noise ratio suggests a detection limit of a few protons. (orig.)

  8. Electromechanical properties of Na0.5Bi0.5TiO3-SrTiO3-PbTiO3 solid solutions

    Science.gov (United States)

    Svirskas, Šarūnas; Dunce, Marija; Birks, Eriks; Sternberg, Andris; Banys, Jūras

    2018-03-01

    Thorough studies of electric field-induced strain are presented in 0.4Na1/2Bi1/2TiO3-(0.6-x)SrTiO3-xPbTiO3 (NBT-ST-PT) ternary solid solutions. The increase of concentration of lead x induces crossover from relaxor to ferroelectric. Strain in a relaxor state can be described by electrostrictive behavior. The electrostrictive coefficients correspond to other well-known relaxor ferroelectrics. The concentration region with a stable ferroelectric phase revealed that the polarization dependence of strain does not exhibit nonlinearity, although they are inherent to the electric field dependence of strain. In this case, electric field dependence of strain is described in terms of the Rayleigh law and the role of domain wall contribution is extracted. Finally, the character of strain at the electric field-induced phase transition between the nonpolar and the ferroelectric states is studied. The data shows that in the vicinity of the electric field induced phase transition the strain vs. electric field displays electrostrictive character.

  9. Determination of reference values of elements in whole blood of the wistar rats using neutron activation analysis (NAA)

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Laura C.; Zamboni, Cibele B., E-mail: laura@ipen.b [Instituto de Pesquisas Energeticas e Nucleares (IPEN/CNEN-SP), Sao Paulo, SP (Brazil)

    2011-07-01

    Some investigations, especially biochemistry analysis, can be performed using whole blood if the normality limits are established. The present study deals with the determination of reference values for elements of clinical interest, in whole blood of Wistar rats using the Neutron Activation Analysis technique. Usually these small-sized animals are used as guinea-pig on experiments that involves testing new medicines and medical diagnostic studies. In this investigation, the reference values for blood were determined for: Br (0.0011 - 0.0095 gL{sup -1}), Ca (0.0 - 0.66 gL{sup -1}), Cl (2.35 - 4.91 gL{sup -1}), K (1.00 - 3.12 gL{sup -1}), Mg (0.044 - 0.108 gL{sup -1}), Na (1.13 - 3.09 gL{sup -1}) and S (0.53 - 1.81 gL{sup -1}). These data will allow researchers to optimize their studies, both in terms of cost and time by selecting species that fits to the experimental model as a clinical reference as well as performing biochemical analyses in whole blood using small quantities (few {mu}L) compared to the conventional analyses performed in serum (few mL). (author)

  10. EFFECT OF ALKALINE IONS ON THE PHASE EVOLUTION, PHOTOLUMINESCENCE, AND AFTERGLOW PROPERTIES OF SrAl2O4: Eu2+, Dy3+ PHOSPHOR

    Directory of Open Access Journals (Sweden)

    HYUNHO SHIN

    2012-12-01

    Full Text Available A series of SrAl2O4: Eu2+, Dy3+ long-afterglow (LAG phosphors with varying concentration of Li+, Na+ and K+, has been synthesized. The increased concentration of the three types of alkaline ions does not decrease the quantity of the total luminescent phases (SrAl2O4 plus Sr4Al14O25, but a different set of secondary phases has been evoluted for the K+-added series due to the failure of the incorporation of relatively large K+ (1.38 Å to the Sr2+ (1.18 Å site in the hosts, unlike the cases of smaller Li+ (0.76 Å and Na+ (1.02 Å ions. PL excitation, PL emission, and LAG luminescence, are decreased by all investigated alkaline ions, which would be due to the diminished incorporation of Eu2+ and Dy3+ activators into the luminescent hosts by the alkaline ions. For the cases of the Li+ and Na+-added series, the incorporated Li+ or Na+ to the luminescent hosts would also limit the activation of Eu2+ and charge trapping/detrapping of Dy3+ to yield the diminished PL properties and LAG luminescence. The type of defect complex formed by the addition of Li+ and Na+ ions has been deduced and compared with that formed when no alkaline ion is added.

  11. Aprendendo a gerenciar conflitos: um programa de intervenção para a 1ª série do ensino fundamental

    Directory of Open Access Journals (Sweden)

    Dâmaris Simon Camelo Borges

    2009-04-01

    Full Text Available Dificuldades interpessoais precoces na escola podem acarretar problemas acadêmicos e comportamentais persistentes. O objetivo deste estudo foi verificar a efetividade de um programa para melhorar a convivência na 1ª série do ensino fundamental. Uma intervenção multimodal, incluindo ensino de habilidades de solução de problemas interpessoais, valores humanos e autocontrole emocional, foi conduzida em uma classe de 1ª série com 30 alunos, nos meses de abril a outubro. Antes e depois da intervenção foram avaliados o desempenho pró-social e a percepção de estressores. Conflitos foram registrados em um diário de campo. Os resultados mostraram redução consistente nos conflitos interpessoais registrados no diário de campo e aumento no indicador pró-social. Comparadas a um grupo de 31 alunos que não passaram pela intervenção, depois de expostas ao programa, as crianças apresentaram melhor desempenho pró-social e menor suscetibilidade a situações estressantes. Conclui-se que o programa contribuiu efetivamente para melhorar os relacionamentos entre as crianças.

  12. Energy levels and oscillator strengths of excited states in sodium and sodium like ions

    International Nuclear Information System (INIS)

    Younis, W.O.; Allam, S.H.; El-Sherbini, TH.M.

    2005-01-01

    The Hartree- Fock (IIF) wave functions of The ,round states IS2 2 S2 2 P6 3s ('S) of members of the sodium isoelectronic sequence (up to Kr XXVI) have been constructed using the Clementi Roetti form of the radial wave functions. The radial wave functions of the excited orbitals of the type ns, rip, rid, nf (n 3 6 for Na 1 and M. 11, and n 3 5 for the other members of the sequence) have been optimized using the C1V3 computer code. The configuration interaction (Cl) wave functions thus obtained have been used in calculatin,' level energies, oscillator strengths and lifetimes of the excited levels of the sodium like ions. Our calculated values agree very well with the values calculated using the Multi configurational Hartree Fock method (MCHF), Non orthogonal Spline Cl method (NOSC1),Multi configurational Dirae Fock method (MCDHF) and compiled data by the National Institute Of Standards and Technology (NIST). Meanwhile some new values for energy levels and oscillator strengths, not reported before, are given in the present work

  13. Consumo de drogas psicoativas por adolescentes escolares de Assis, SP Psychoactive drug use in school age adolescents, Brazil

    Directory of Open Access Journals (Sweden)

    José Luiz Guimarães

    2004-02-01

    Full Text Available Com o objetivo de quantificar o consumo das diferentes drogas psicoativas entre os estudantes da cidade de Assis, SP, e investigar as variáveis relacionadas com seu uso, foi aplicado um questionário que identificava dados sociodemográficos e padrão de uso não-médico de psicotrópicos em 20% dos estudantes das escolas públicas e privadas da cidade. Os maiores índices de consumo para o uso na vida foram os do álcool com 68,9% e o tabaco com 22,7%. As drogas mais utilizadas foram: solventes (10,0%; maconha (6,6%; ansiolíticos (3,8%; anfetamínicos (2,6%; cocaína (1,6% e anticolinérgicos (1,0%.To quantify psychoactive drug use and investigate use-related variables among students of Assis, Brazil, a questionnaire was administered to collect sociodemographic data and identify the pattern of non-medical use of psychoactive drugs in 20% of public and private school students. The largest consumption indexes for lifetime use were seen for alcohol (68.9% and tobacco (22.7%. Drugs most often used were: solvents (10.0%; marijuana (6.6%; benzodiazepines (3.8%; amphetamines (2.6%; cocaine (1.6%; and anticholinergics (1.0%.

  14. Average stopping powers and the use of non-analyte spiking for the determination of phosphorus and sodium by PIPPS

    International Nuclear Information System (INIS)

    Olivier, C.; Morland, H.J.

    1991-01-01

    By using particle induced prompt photon spectrometry, PIPPS, the ratios of the average stopping powers in samples and standards can be used to determine elemental compositions. Since the average stopping powers in the samples are in general unknown, this procedure poses a problem. It has been shown that by spiking the sample with a known amount of a compound with known stopping power and containing a non-analyte element, appropriate stopping powers in the samples can be determined by measuring the prompt gamma-ray yields induced in the spike. Using 5-MeV protons and lithium compounds as non-analyte spikes, sodium and phosphorus were determined in ivory, while sodium was determined in geological samples. For the stopping power determinations in the samples the 429-keV 7 Li n(1,0) and 478-keV 7 Li (1,0) gamma rays were measured, while for phosphorus and sodium determinations the high yield 1,266-keV 31 P (1,0), 440-keV 23 Na (1,0), 1,634-keV, Na 23 α(1,0) and 1,637-keV 23 Na (2,1) gamma rays were used. The method was tested by analyzing the standard reference materials SRM 91, 120c and 694

  15. Investigating the influence of Na+ and Sr2+ on the structure and solubility of SiO2-TiO2-CaO-Na2O/SrO bioactive glass.

    Science.gov (United States)

    Li, Y; Placek, L M; Coughlan, A; Laffir, F R; Pradhan, D; Mellott, N P; Wren, A W

    2015-02-01

    This study was conducted to determine the influence that network modifiers, sodium (Na+) and strontium (Sr2+), have on the solubility of a SiO2-TiO2-CaO-Na2O/SrO bioactive glass. Glass characterization determined each composition had a similar structure, i.e. bridging to non-bridging oxygen ratio determined by X-ray photoelectron spectroscopy. Magic angle spinning nuclear magnetic resonance (MAS-NMR) confirmed structural similarities as each glass presented spectral shifts between -84 and -85 ppm. Differential thermal analysis and hardness testing revealed higher glass transition temperatures (Tg 591-760 °C) and hardness values (2.4-6.1 GPa) for the Sr2+ containing glasses. Additionally the Sr2+ (~250 mg/L) containing glasses displayed much lower ion release rates than the Na+ (~1,200 mg/L) containing glass analogues. With the reduction in ion release there was an associated reduction in solution pH. Cytotoxicity and cell adhesion studies were conducted using MC3T3 Osteoblasts. Each glass did not significantly reduce cell numbers and osteoblasts were found to adhere to each glass surface.

  16. Application of optical tweezers and excimer laser to study protoplast fusion

    Science.gov (United States)

    Kantawang, Titirat; Samipak, Sompid; Limtrakul, Jumras; Chattham, Nattaporn

    2015-07-01

    Protoplast fusion is a physical phenomenon that two protoplasts come in contact and fuse together. Doing so, it is possible to combine specific genes from one protoplast to another during fusion such as drought resistance and disease resistance. There are a few possible methods to induce protoplast fusion, for example, electrofusion and chemical fusion. In this study, chemical fusion was performed with laser applied as an external force to enhance rate of fusion and observed under a microscope. Optical tweezers (1064 nm with 100X objective N.A. 1.3) and excimer laser (308 nm LMU-40X-UVB objective) were set with a Nikon Ti-U inverted microscope. Samples were prepared by soaking in hypertonic solution in order to induce cell plasmolysis. Elodea Canadensis and Allium cepa plasmolysed leaves were cut and observed under microscope. Concentration of solution was varied to induce difference turgor pressures on protoplasts pushing at cell wall. Free protoplasts in solution were trapped by optical tweezers to study the effect of Polyethylene glycol (PEG) solution. PEG was diluted by Ca+ solution during the process to induced protoplast cell contact and fusion. Possibility of protoplast fusion by excimer laser was investigated and found possible. Here we report a novel tool for plant cell fusion using excimer laser. Plant growth after cell fusion is currently conducted.

  17. Reference values in blood elements in crioula breed horses by nuclear methodology

    International Nuclear Information System (INIS)

    Baptista, Tatyana Spinosa

    2010-01-01

    In this study the reference value for Br (0,0008 - 0,0056 gL -1 ), Ca (0,089 - 0,369 gL -1 ), Cl (2,10 - 3,26 gL -1 ), Fe (0,381 - 0,689 gL -1 ), I (0,00018 - 0,00266 gL -1 ), K (1,14 - 2,74 gL -1 ), Mg (0,030 - 0,074 gL -1 ), Na (1,36 - 2,80 gL -1 ), P ( -1 ), S (0,99 - 2,79 gL -1 ) and Zn (0,0012 - 0,0048 gL -1 ) as well as the correlation matrix in blood of Crioulo breed horses were determined using nuclear methodology (Neutron Activation Analysis Technique). These data allowed to identifying physiological alterations related to the sex and regime of exercise (hyperimmune sera production at Butantan Institute, Sao Paulo, Brasil). To perform these analyses was used 20 adult horses (8 males and 12 females), with average mass 350 kg, without clinical signs of disease, 1-3 years old, kept on pasture in Sao Joaquim Farm at Butantan Institute (Sao Paulo city). Other group just immunized, composed by 6 equines males (same age and weight), were also analyzed. These data are an important support to understand the physiological functions of these elements in blood during the process of sera production. (author)

  18. Chemical characterization of kid meat from Moxotó goat and Pardo Alpina x Moxotó Crossbreeds

    OpenAIRE

    Beserra, Frederico José; Monte, Antonia Lucivânia de Sousa; Bezerra, Luciana Cristina Nogueira de Moraes; Nassu, Renata Tieko

    2000-01-01

    O objetivo da pesquisa foi avaliar a composição química da carne de cabrito-mamão (idade média de 72 dias), da raça Moxotó (MOX), grupos genéticos ¾ Pardo Alpina x ¼ Moxotó (3/4 PAMOX) e ½ Pardo Alpina x ½ Moxotó (1/2 PAMOX). A análise apresentou valores médios entre 77,80% a 80,25% de umidade; 15,90% a 19,08% de proteína; 1,12% a 1,21% de gordura, e 1,29% a 2,03% de cinzas. Quanto à composição mineral, os valores médios variaram de 5,62 mg/100 g a 8,21 mg/100 g de cálcio; 156,97 mg/100 g a 1...

  19. Temperature dependent polarization reversal mechanism in 0.94(Bi1/2Na1/2) TiO3-0.06Ba(Zr0.02Ti0.98)O3 relaxor ceramics

    DEFF Research Database (Denmark)

    Glaum, Julia; Simons, Hugh; Hudspeth, Jessica

    2015-01-01

    The temperature at which the electric field induced long-range ordered ferroelectric state undergoes transition into the short-range ordered relaxor state, TF-R, is commonly defined by the onset of strong dispersion of the dielectric permittivity. However, this combined macroscopic property and s...... associated with different polarization reversal processes. Such diagrams are useful tools for identifying the best operational temperature regimes for a given composition in actuator applications....... and structural investigation of the polarization reversal process in the prototypical lead-free relaxor 0.94(Bi1/2Na1/2)TiO3-0.06Ba(Zr0.02Ti0.98)O3 reveals that an applied electric field can trigger depolarization and onset of relaxor-like behavior well below TF-R. The polarization reversal process can....... These results are concomitant with a continuous ferroelectric to relaxortransition occurring over a broad temperature range, during which mixed behavior is observed. The nature of polarization reversal can be illustrated in electric-field-temperature (E-T) diagrams showing the electric field amplitudes...

  20. Direct whole-genome deep-sequencing of human respiratory syncytial virus A and B from Vietnamese children identifies distinct patterns of inter- and intra-host evolution

    Science.gov (United States)

    Wilm, Andreas; van Doorn, H. Rogier; Lam, Ha Minh; Sim, Shuzhen; Sukumaran, Rashmi; Tran, Anh Tuan; Nguyen, Bach Hue; Tran, Thi Thu Loan; Tran, Quynh Huong; Vo, Quoc Bao; Dac, Nguyen Anh Tran; Trinh, Hong Nhien; Nguyen, Thi Thanh Hai; Binh, Bao Tinh Le; Le, Khanh; Nguyen, Minh Tien; Thai, Quang Tung; Vo, Thanh Vu; Ngo, Ngoc Quang Minh; Dang, Thi Kim Huyen; Cao, Ngoc Huong; Tran, Thu Van; Ho, Lu Viet; Farrar, Jeremy; de Jong, Menno; Chen, Swaine; Nagarajan, Niranjan; Bryant, Juliet E.; Hibberd, Martin L.

    2015-01-01

    Human respiratory syncytial virus (RSV) is the major cause of lower respiratory tract infections in children < 2 years of age. Little is known about RSV intra-host genetic diversity over the course of infection or about the immune pressures that drive RSV molecular evolution. We performed whole-genome deep-sequencing on 53 RSV-positive samples (37 RSV subgroup A and 16 RSV subgroup B) collected from the upper airways of hospitalized children in southern Vietnam over two consecutive seasons. RSV A NA1 and RSV B BA9 were the predominant genotypes found in our samples, consistent with other reports on global RSV circulation during the same period. For both RSV A and B, the M gene was the most conserved, confirming its potential as a target for novel therapeutics. The G gene was the most variable and was the only gene under detectable positive selection. Further, positively selected sites in G were found in close proximity to and in some cases overlapped with predicted glycosylation motifs, suggesting that selection on amino acid glycosylation may drive viral genetic diversity. We further identified hotspots and coldspots of intra-host genetic diversity in the RSV genome, some of which may highlight previously unknown regions of functional importance. PMID:26407694

  1. Axially-confined in vivo single-cell labeling by primed conversion using blue and red lasers with conventional confocal microscopes.

    Science.gov (United States)

    Taniguchi, Atsushi; Kimura, Yukiko; Mori, Ikue; Nonaka, Shigenori; Higashijima, Shin-Ichi

    2017-12-01

    Green-to-red photoconvertible fluorescent proteins have been found to undergo efficient photoconversion by a new method termed primed conversion that uses dual wave-length illumination with blue and red/near-infrared light. By modifying a confocal laser-scanning microscope (CLSM) such that two laser beams only meet at the focal plane, confined photoconversion at the axial dimension has been achieved. The necessity of this custom modification to the CLSM, however, has precluded the wide-spread use of this method. Here, we investigated whether spatially-restricted primed conversion could be achieved with CLSM without any hardware modification. We found that the primed conversion of Dendra2 using a conventional CLSM with two visible lasers (473 nm and 635 nm) and a high NA objective lens (NA, 1.30) resulted in dramatic restriction of photoconversion volume: half-width half-maximum for the axial dimension was below 5 μm, which is comparable to the outcome of the original method that used the microscope modification. As a proof of this method's effectiveness, we used this technique in living zebrafish embryos and succeeded in revealing the complex anatomy of individual neurons packed between neighboring cells. Because unmodified CLSMs are widely available, this method can be widely applicable for labeling cells with single-cell resolution. © 2017 The Authors Development, Growth & Differentiation published by John Wiley & Sons Australia, Ltd on behalf of Japanese Society of Developmental Biologists.

  2. Effect of spatial spectrum overlap on Fourier ptychographic microscopy

    Directory of Open Access Journals (Sweden)

    Qiulan Liu

    2017-03-01

    Full Text Available Fourier ptychographic microscopy (FPM is a newly developed imaging technique which stands out by virtue of its high-resolution and wide FOV. It improves a microscope’s imaging performance beyond the diffraction limit of the employed optical components by illuminating the sample with oblique waves of different incident angles, similar to the concept of synthetic aperture. We propose to use an objective lens with high-NA to generate oblique illuminating waves in FPM. We demonstrate utilizing an objective lens with higher NA to illuminate the sample leads to better resolution by simulations, in which a resolution of 0.28μm is achieved by using a high-NA illuminating objective lens (NA=1.49 and a low-NA collecting objective lens (NA=0.2 in coherent imaging (λ=488nm. We then deeply study FPM’s exact relevance of convergence speed to spatial spectrum overlap in frequency domain. The simulation results show that an overlap of about 60% is the optimal choice to acquire a high-quality recovery (520*520 pixels with about 2 min’s computing time. In addition, we testify the robustness of the algorithm of FPM to additive noises and its suitability for phase objects, which further proves FPM’s potential application in biomedical imaging.

  3. ZnO Nanorods Based Enzymatic Biosensor for Selective Determination of Penicillin

    Directory of Open Access Journals (Sweden)

    Magnus Willander

    2011-10-01

    Full Text Available In this study, we have successfully demonstrated the fabrication of a biosensor based on well aligned single-crystal zinc oxide (ZnO nanorods which were grown on gold coated glass substrate using a low temperature aqueous chemical growth (ACG method. The ZnO nanorods were immobilized with penicillinase enzyme using the physical adsorption approach in combination with N-5-azido-2-nitrobenzoyloxysuccinimide (ANB-NOS as cross linking molecules. The potentiometric response of the sensor configuration revealed good linearity over a large logarithmic concentration range from 100 µM to 100 mM. During the investigations, the proposed sensor showed a good stability with high sensitivity of ~121 mV/decade for sensing of penicillin. A quick electrochemical response of less than 5 s with a good selectivity, repeatability, reproducibility and a negligible response to common interferents such as Na1+, K1+, d-glucose, l-glucose, ascorbic acid, uric acid, urea, sucrose, lactose, glycine, penicilloic acid and cephalosporins, was observed.

  4. Plant hormones in arbuscular mycorrhizal symbioses: an emerging role for gibberellins

    Science.gov (United States)

    Foo, Eloise; Ross, John J.; Jones, William T.; Reid, James B.

    2013-01-01

    Background and Aims Arbuscular mycorrhizal symbioses are important for nutrient acquisition in >80 % of terrestrial plants. Recently there have been major breakthroughs in understanding the signals that regulate colonization by the fungus, but the roles of the known plant hormones are still emerging. Here our understanding of the roles of abscisic acid, ethylene, auxin, strigolactones, salicylic acid and jasmonic acid is discussed, and the roles of gibberellins and brassinosteroids examined. Methods Pea mutants deficient in gibberellins, DELLA proteins and brassinosteroids are used to determine whether fungal colonization is altered by the level of these hormones or signalling compounds. Expression of genes activated during mycorrhizal colonization is also monitored. Key Results Arbuscular mycorrhizal colonization of pea roots is substantially increased in gibberellin-deficient na-1 mutants compared with wild-type plants. This is reversed by application of GA3. Mutant la cry-s, which lacks gibberellin signalling DELLA proteins, shows reduced colonization. These changes were parallelled by changes in the expression of genes associated with mycorrhizal colonization. The brassinosteroid-deficient lkb mutant showed no change in colonization. Conclusions Biologically active gibberellins suppress arbuscule formation in pea roots, and DELLA proteins are essential for this response, indicating that this role occurs within the root cells. PMID:23508650

  5. Comparison of lithium and sodium intercalation materials

    Directory of Open Access Journals (Sweden)

    Vujković Milica

    2015-01-01

    Full Text Available Low abundance of lithium in Earth’s crust and its high participation in overall cost of lithium-ion batteries incited intensive investigation of sodium-ion batteries, in hope that they may become similar in basic characteristics: specific energy and specific power. Furthermore, over the last years the research has been focused on the replacement of organic electrolytes of Li- and Na-ion batteries, by aqueous electrolytes, in order to simplify the production and improve safety of use. In this lecture, some recent results on the selected intercalation materials are presented: layered structure vanadium oxides, olivine and nasicon phosphates, potentially usable in both Li and Na aqueous rechargeable batteries. After their characterization by X-ray diffraction and electron microscopy, the electrochemical behavior was studied by both cyclic voltammetry and hronopotenciometry. By comparing intercalation kinetics and coulombic capacity of these materials in LiNO3 and NaNO3 solutions, it was shown that the following ones: Na1.2V3O8, Na2V6O16/C , NaFePO4/C and NaTi2(PO43/C may be used as electrode materials in aqueous alkali-ion batteries.

  6. Pixelated source and mask optimization for immersion lithography.

    Science.gov (United States)

    Ma, Xu; Han, Chunying; Li, Yanqiu; Dong, Lisong; Arce, Gonzalo R

    2013-01-01

    Immersion lithography systems with hyper-numerical aperture (hyper-NA) (NA>1) have become indispensable in nanolithography for technology nodes of 45 nm and beyond. Source and mask optimization (SMO) has emerged as a key technique used to further improve the imaging performance of immersion lithography. Recently, a set of pixelated gradient-based SMO approaches were proposed under the scalar imaging models, which are inaccurate for hyper-NA settings. This paper focuses on developing pixelated gradient-based SMO algorithms based on a vector imaging model that is accurate for current immersion lithography. To achieve this goal, an integrative and analytic vector imaging model is first used to formulate the simultaneous SMO (SISMO) and sequential SMO (SESMO) frameworks. A gradient-based algorithm is then exploited to jointly optimize the source and mask. Subsequently, this paper studies and compares the performance of individual source optimization (SO), individual mask optimization (MO), SISMO, and SESMO. Finally, a hybrid SMO (HSMO) approach is proposed to take full advantage of SO, SISMO, and MO, consequently achieving superior performance.

  7. Murmanite and lomonosovite as Ag-selective ionites: kinetics and products of ion exchange in aqueous AgNO3 solutions

    Science.gov (United States)

    Lykova, Inna S.; Chukanov, Nikita V.; Kazakov, Anatoliy I.; Tarasov, Viktor P.; Pekov, Igor V.; Yapaskurt, Vasiliy O.; Chervonnaya, Nadezhda A.

    2013-09-01

    Products and kinetics of ion exchange of heterophyllosilicate minerals lomonosovite and murmanite with aqueous AgNO3 solutions under low-temperature conditions have been studied using scanning electron microscopy, electron microprobe analysis, single-crystal X-ray diffraction, infrared spectroscopy, 23Na nuclear magnetic resonance spectroscopy and dynamic calorimetry. Both minerals show strong affinity for silver in cation exchange. Simplified formulae of Ag-exchanged forms of murmanite and lomonosovite are (Ag3.0Ca0.5Na0.5) (Ti,Nb,Mn,Fe)3.7-4 (Si2O7)2O4·4(H2O,OH) and (Ag8.2Na1.2Ca0.3) (Ti,Nb,Mn,Fe)3.9-4 (Si2O7)2 (PO4)1.9O4· xH2O, respectively. The reaction of ion exchange for murmanite follows the first-order kinetic model up to ca. 70-80 % conversion. The rate of the process is described by the equation k(h-1) = 107.64±0.60 exp[-(12.2 ± 0.9)·103/RT]. The average heat release value in the temperature range 39.4-72 °C is 230 J g-1. The cation exchange is limited by processes in solid state, most probably binding of silver.

  8. The dielectric and ferroelectric properties of (Ba0.5Sr0.5TiO3-doped (Bi0.5Na0.5TiO3 lead-free ceramics

    Directory of Open Access Journals (Sweden)

    Guoliang Xue

    2017-08-01

    Full Text Available This work prepares (Ba0.5Sr0.5TiO3 (BST-doped (Bi1∕2Na1∕2TiO3 (NBT lead free ceramics through conventional solid reaction method and analyzes the doping effect of BST on phases, microstructure, dielectric and ferroelectric properties. The phase and structure of the NBT-BST ceramics were investigated through X-ray diffractometer (XRD and Raman. The XRD results showed that BST has diffused into the NBT lattices to form a stable solid solution; while, Raman spectrum showed the bands at low frequency are different with that of pure NBT and divided into two ranges around 247cm−1 and 303cm−1. Relative dense and homogeneous ceramic microstructures could be achieved, with the observation of a slight decrease in average grain size with the increase of BST doping content. The dielectric and ferroelectric properties were also investigated. The dielectric constant increases gradually with increasing the temperature to Tm, and then decrease. The temperature dependence property showed diffused phase transition near Tm. The polarization-electric field (P-E hysteresis loops of BST-doped NBT ceramics showed typical ferroelectric or relaxor nature. Both the Ec and Pr increased first, then decreased with respect to the increase of the BST content.

  9. Impact of metal ionic characteristics on adsorption potential of Ficus carica leaves using QSPR modeling.

    Science.gov (United States)

    Batool, Fozia; Iqbal, Shahid; Akbar, Jamshed

    2018-04-03

    The present study describes Quantitative Structure Property Relationship (QSPR) modeling to relate metal ions characteristics with adsorption potential of Ficus carica leaves for 13 selected metal ions (Ca +2 , Cr +3 , Co +2 , Cu +2 , Cd +2 , K +1 , Mg +2 , Mn +2 , Na +1 , Ni +2 , Pb +2 , Zn +2 , and Fe +2 ) to generate QSPR model. A set of 21 characteristic descriptors were selected and relationship of these metal characteristics with adsorptive behavior of metal ions was investigated. Stepwise Multiple Linear Regression (SMLR) analysis and Artificial Neural Network (ANN) were applied for descriptors selection and model generation. Langmuir and Freundlich isotherms were also applied on adsorption data to generate proper correlation for experimental findings. Model generated indicated covalent index as the most significant descriptor, which is responsible for more than 90% predictive adsorption (α = 0.05). Internal validation of model was performed by measuring [Formula: see text] (0.98). The results indicate that present model is a useful tool for prediction of adsorptive behavior of different metal ions based on their ionic characteristics.

  10. Piezoelectricity and rotostriction through polar and non-polar coupled instabilities in bismuth-based piezoceramics.

    Science.gov (United States)

    Acosta, Matias; Schmitt, Ljubomira A; Cazorla, Claudio; Studer, Andrew; Zintler, Alexander; Glaum, Julia; Kleebe, Hans-Joachim; Donner, Wolfgang; Hoffman, Mark; Rödel, Jürgen; Hinterstein, Manuel

    2016-07-01

    Coupling of order parameters provides a means to tune functionality in advanced materials including multiferroics, superconductors, and ionic conductors. We demonstrate that the response of a frustrated ferroelectric state leads to coupling between order parameters under electric field depending on grain orientation. The strain of grains oriented along a specific crystallographic direction, 〈h00〉, is caused by converse piezoelectricity originating from a ferrodistortive tetragonal phase. For 〈hhh〉 oriented grains, the strain results from converse piezoelectricity and rotostriction, as indicated by an antiferrodistortive instability that promotes octahedral tilting in a rhombohedral phase. Both strain mechanisms combined lead to a colossal local strain of (2.4 ± 0.1) % and indicate coupling between oxygen octahedral tilting and polarization, here termed "rotopolarization". These findings were confirmed with electromechanical experiments, in situ neutron diffraction, and in situ transmission electron microscopy in 0.75Bi1/2Na1/2TiO3-0.25SrTiO3. This work demonstrates that polar and non-polar instabilities can cooperate to provide colossal functional responses.

  11. Study on different pre-treatment procedures for metal determination in Orujo spirit samples by ICP-AES

    International Nuclear Information System (INIS)

    Barciela, Julia; Vilar, Manuela; Garcia-Martin, Sagrario; Pena, Rosa M.; Herrero, Carlos

    2008-01-01

    In this work several pre-treatment methods were studied for metal (Na, K, Mg, Cu and Ca) determination in Orujo spirit samples using inductively coupled plasma atomic emission spectrometry (ICP-AES). Dilution, digestion, evaporation, and cryogenic desolvatation techniques were comparatively evaluated. Because of their analytical characteristics, digestion and evaporation with nitrogen current were found to be appropriate procedures for the determination of metals in alcoholic spirit samples. Yet, if simplicity and application time are to be considered, the latter-evaporation in a water bath with a nitrogen current-stands out as the optimum procedure for any further determinations in Orujo samples by ICP-AES. Low detection levels and wide linear ranges (sufficient to determine these metals in the samples studied) were achieved for each metal. The recoveries (in the 97.5-100.5% range) and the precision (R.S.D. lower than 5.6%) obtained were also satisfactory. The selected procedure was applied to determine the content of metals in 80 representative Galician Orujo spirit samples with and without a Certified Brand of Origin (CBO) which had been produced using different distillation systems. The metal concentrations ranged between 0.37 and 79.7 mg L -1 for Na, -1 for K, 0.02-4.83 mg L -1 for Mg content, -1 for Cu and 0.03-13.10 mg L -1 for Ca

  12. Development of advanced methodology for defect assessment in FBR power plants

    International Nuclear Information System (INIS)

    Meshii, Toshiyuki; Asayama, Tai

    2001-03-01

    As a preparation for developing a code for FBR post construction code, (a) JSME Code NA1-2000 was reviewed on the standpoint of applying it to FBR power plants and the necessary methodologies for defect assessment for FBR plants were pointed out (b) large capacity-high speed fatigue crack propagation (FCP) testing system was developed and some data were acquired to evaluate the FCP characteristics under thermal stresses. Results showed that the extended research on the following items are necessary for developing FBR post construction code. (1) Development of assessment for multiple defects due to creep damage. Multiple defects due to creep damage are not considered in the existing code, which is established for nuclear power plants in service under negligible-creep temperature. Therefore method to assess the integrity of these multiple defects due to creep damage is necessary. (2) FCP resistance for small load. Since components of FBR power plants are designed to minimize thermal stresses, the accuracy of FCP resistance for small load is important to estimate the crack propagation under thermal stresses accurately. However, there is not a sufficient necessary FCP data for small loads, maybe because the data is time consuming. Therefore we developed a large capacity-high speed FCP testing system, made a guideline for accelerated test and acquired some data to meet the needs. Continuous efforts to accumulate small load FCP data for various materials are necessary. (author)

  13. Interface properties of NO-annealed 4H-SiC (0001), ( 11 2 ¯ 0 ), and ( 1 1 ¯ 00 ) MOS structures with heavily doped p-bodies

    Science.gov (United States)

    Kobayashi, Takuma; Nakazawa, Seiya; Okuda, Takafumi; Suda, Jun; Kimoto, Tsunenobu

    2017-04-01

    We investigated electrical characteristics of nitric oxide (NO)-annealed silicon carbide (SiC) ( 0001 ) , ( 11 2 ¯ 0 ) , and ( 1 1 ¯ 00 ) metal-oxide-semiconductor field effect transistors (MOSFETs) with heavily doped p-bodies (NA = 1 × 1017-3 × 1018 cm-3). Regardless of crystal faces or off-direction, the channel mobility decreased for higher acceptor density. We evaluated the interface state density (Dit) very near the bottom edge of 2-dimensional density of states (2D-DOS) in the conduction band of SiC from the low-temperature subthreshold slope of the MOSFETs. When the acceptor density of the p-body of the MOSFET is increased, the energy levels of 2D-DOS increase due to a stronger quantum confinement effect. Accordingly, the carriers in the heavily doped channel are influenced by the interface states located at higher energy levels. In the SiC MOS structures, the Dit values significantly increase near the conduction band edge (EC). Thus, MOSFETs on heavily doped p-bodies are affected by the higher density of Dit, leading to substantially lower mobility.

  14. Piezoelectricity and rotostriction through polar and non-polar coupled instabilities in bismuth-based piezoceramics

    Science.gov (United States)

    Acosta, Matias; Schmitt, Ljubomira A.; Cazorla, Claudio; Studer, Andrew; Zintler, Alexander; Glaum, Julia; Kleebe, Hans-Joachim; Donner, Wolfgang; Hoffman, Mark; Rödel, Jürgen; Hinterstein, Manuel

    2016-07-01

    Coupling of order parameters provides a means to tune functionality in advanced materials including multiferroics, superconductors, and ionic conductors. We demonstrate that the response of a frustrated ferroelectric state leads to coupling between order parameters under electric field depending on grain orientation. The strain of grains oriented along a specific crystallographic direction, , is caused by converse piezoelectricity originating from a ferrodistortive tetragonal phase. For oriented grains, the strain results from converse piezoelectricity and rotostriction, as indicated by an antiferrodistortive instability that promotes octahedral tilting in a rhombohedral phase. Both strain mechanisms combined lead to a colossal local strain of (2.4 ± 0.1) % and indicate coupling between oxygen octahedral tilting and polarization, here termed “rotopolarization”. These findings were confirmed with electromechanical experiments, in situ neutron diffraction, and in situ transmission electron microscopy in 0.75Bi1/2Na1/2TiO3-0.25SrTiO3. This work demonstrates that polar and non-polar instabilities can cooperate to provide colossal functional responses.

  15. John Strong (1941 - 2006)

    CERN Multimedia

    Wickens, F

    Our friend and colleague John Strong was cruelly taken from us by a brain tumour on Monday 31st July, a few days before his 65th birthday John started his career working with a group from Westfield College, under the leadership of Ted Bellamy. He obtained his PhD and spent the early part of his career on experiments at Rutherford Appleton Laboratory (RAL), but after the early 1970s his research was focussed on experiments in CERN. Over the years he made a number of notable contributions to experiments in CERN: The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon cameras to record the sparks in the spark chambers; He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems; He was responsible for the second level trigger system for the ALEPH detector and spent five years leading a team that designed and built the system, which ran for twelve years with only minor interventions. Following ALEPH he tur...

  16. John Strong 1941-2006

    CERN Multimedia

    2006-01-01

    John started his career and obtained his PhD in a group from Westfield College, initially working on experiments at Rutherford Appleton Laboratory (RAL). From the early 1970s onwards, however, his research was focused on experiments in CERN, with several particularly notable contributions. The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon Cameras (a type of television camera) to record the sparks in the spark chambers. This highly automated system allowed Omega to be used in a similar way to bubble chambers.  He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems. In these experiments the Westfield group joined forces with Italian colleagues to measure the form factors of the pion and the kaon, and the lifetime of some of the newly discovered charm particles. Such has been the lasting impact of these measurements that the paper on the pion form-factor had been cited 323 times up to the time of J...

  17. John Strong - 1941-2006

    CERN Document Server

    2006-01-01

    Our friend and colleague John Strong was cruelly taken from us by a brain tumour on 31 July, a few days before his 65th birthday. John started his career and obtained his PhD in a group from Westfield College, initially working on experiments at Rutherford Appleton Laboratory (RAL). From the early 1970s onwards, however, his research was focused on experiments in CERN, with several particularly notable contributions. The Omega spectrometer adopted a system John had originally developed for experiments at RAL using vidicon cameras (a type of television camera) to record the sparks in the spark chambers. This highly automated system allowed Omega to be used in a similar way to bubble chambers. He contributed to the success of NA1 and NA7, where he became heavily involved in the electronic trigger systems. In these experiments the Westfield group joined forces with Italian colleagues to measure the form factors of the pion and the kaon, and the lifetime of some of the newly discovered charm particles. Such h...

  18. Structure of sodium perbromate monohydrate

    International Nuclear Information System (INIS)

    Blackburn, A.C.; Gallucci, J.C.; Gerkin, R.E.; Reppart, W.J.

    1992-01-01

    NaBrO 4 .H 2 O, M r =184.90, monoclinic, C2/c, a=15.7575(19), b=5.7373(15), c=11.3390(19) A, β=111.193(10)deg. In this structure, there are two inequivalent Na ions, each coordinated by six O atoms. In each of the two types of distorted octahedra, there are three inequivalent Na-O distances; the average Na(1)-O and Na(2)-O distances are 2.379(10) and 2.405(23) A, respectively. The perbromate ion in this structure displays very nearly regular tetrahedral geometry, although it is subject to no symmetry constraints; the average observed Br-O distance is 1.601(4) A, while the average observed O-Br-O angle is 109.5(9)deg. These values agree well with previously reported values. The perbromate ion, but neither of the sodium coordination polyhedra, shows rigid-body behavior. The average rigid-body corrected Br-O distance in the perbromate ion is 1.624(3) A. Refinement of the two inequivalent H atoms permitted detailed analysis of the hydrogen bonding, which is slightly different from that reported for the isomorphic sodium perchlorate monohydrate. Dynamic disordering of the H atoms as detailed by magnetic resonance methods for sodium perchlorate monohydrate is not clearly indicated in our X-ray study of sodium perbromate monohydrate. (orig./GSCH)

  19. Commercial Charcoal Characterisation For Water Purification

    International Nuclear Information System (INIS)

    Saryati; Sumardjo; Sutisna; Handayani, Ari; Suprapti, Siti

    2001-01-01

    In order to provide a drinking water purification substance, has been studied the charcoal characterisation that based on a porous profile and an adsorption properties of the charcoal. There were using the commercial charcoal like wood charcoals, coconut shell charcoals and activated charcoals. The porous profile was studied by using an electron microscope SEM-EDX and the adsorption properties was studied by using the water sample simulation that contains several metal ions. The concentration of all ions was ten times greater that the maximum ions concentration that permissible in the drinking water. From the grain surface microscopic analysis was shown that the pore structure of the wood charcoal was more regular than the coconut shell charcoal. Mean while the activated charcoal has pore more than wood and coconut shell charcoal. Grains size was not an adsorption parameter. The absorptivitas charcoal was affected by pH solution, but this effect was not linear proportion. There are no significant deference in the adsorptivitas among the tree charcoals that has been studied for Al 3 + , Cr 3+ , Ag 1 +, and Pb 2+ ions the adsorption was large enough (> 60%), for Mn 2+ , Fe 3+ , Se 4+ , Cd 2+ and Ba 2+ ions was 20%-60% dan for Mg 2+ , Na 1+ , Ca 2+ , and Zn 2+ ions was less than 20 %. Generally the wood and coconut shell charcoal absorptivity in the pH 4 solutions was lower than in the pH 5-7 solutions

  20. Computer simulation of Gumboro disease outbreak. IV. Epizootics obtained by mode G-4 with flock size, age and immunity changed.

    Science.gov (United States)

    Takizawa, T; Ito, T; Tanaka, T; Mizumura, Y

    1980-01-01

    For the computer simulation of Gumboro disease outbreak by Model G-4 a program was written in FORTRAN. Of over twenty parameters involved in the model, the following three were used as input variables: (1) age of chickens at housing a1 (= 1 and 21); (2) size of flock at housing, N(a1) (= 100 and 1,000); and (3) geometric mean of the level of parentally conferred immunity at hatching, G(1) (= 0, 2, 8, and 32). The outputs were the graphic images demonstrating the chronological changes in a flock of innate resistance, parentally conferred immunity, and their sum, and the epizootic patterns composed of numbers of chickens at subclinical stage, clinically diseased, recovered, condemned, etc. at each age. As a result, stronger epizootics were produced at a lower level of parentally conferred immunity, and a higher age and a larger size of flocks. It was suggested that the subclinical stage might not be understood as an inapparent infection, and that a further postulate on the infection might be necessary to be introduced into this model to increase the practical utility, as well as the theoretical soundness, of this series of studies.

  1. Effects of the Electronic Doping In the Stability of the Metal Hydride NaH

    Science.gov (United States)

    Olea-Amezcua, Monica-Araceli; Rivas-Silva, Juan-Francisco; de La Peña-Seaman, Omar; Heid, Rolf; Bohnen, Klaus-Peter

    2015-03-01

    Despite metal hydrides light weight and high hydrogen volumetric densities, the Hydrogen desorption process requires excessively high temperatures due to their high stability. Attempts for improvement the hydrogenation properties have been focus on the introduction of defects, impurities and doping on the metal hydride. We present a systematic study of the electronic doping effects on the stability of a model system, NaH doped with magnesium, forming the alloying system Na1-xMgxH. We use the density functional theory (DFT) and the self-consistent version of the virtual crystal approximation (VCA) to model the doping of NaH with Mg. The evolution of the ground state structural and electronic properties is analyzed as a function of Mg-content. The full-phonon dispersion, calculated by the linear response theory (LRT) and density functional perturbation theory (DFPT), is analyzed for several Mg-concentrations, paying special attention to the crystal stability and the correlations with the electronic structure. Applying the quasiharmonic approximation (QHA), the free energy from zero-point motion is obtained, and its influence on the properties under study is analyzed. This work is partially supported by the VIEP-BUAP (OMPS-EXC14-I) and CONACYT-Mexico (No. 221807) projects.

  2. Effects of electron doping on the stability of the metal hydride NaH

    Science.gov (United States)

    Olea-Amezcua, M. A.; Rivas-Silva, J. F.; de la Peña-Seaman, O.; Heid, R.; Bohnen, K. P.

    2017-04-01

    Alkali and alkali-earth metal hydrides have high volumetric and gravimetric hydrogen densities, but due to their high thermodynamic stability, they possess high dehydrogenation temperatures which may be reduced by transforming these compounds into less stable states/configurations. We present a systematic computational study of the electron doping effects on the stability of the alkali metal hydride NaH substituted with Mg, using the self-consistent version of the virtual crystal approximation to model the alloy Na1-x Mg x H. The phonon dispersions were studied paying special attention to the crystal stability and the correlations with the electronic structure taking into account the zero point energy contribution. We found that substitution of Na by Mg in the hydride invokes a reduction of the frequencies, leading to dynamical instabilities for Mg content of 25%. The microscopic origin of these instabilities could be related to the formation of ellipsoidal Fermi surfaces centered at the L point due to the metallization of the hydride by the Mg substitution. Applying the quasiharmonic approximation, thermodynamic properties like heat capacities, vibrational entropies and vibrational free energies as a function of temperature at zero pressure are obtained. These properties determine an upper temperature for the thermodynamic stability of the hydride, which decreases from 600 K for NaH to 300 K at 20% Mg concentration. This significant reduction of the stability range indicates that dehydrogenation could be favoured by electron doping of NaH.

  3. Synthesis of the intermetallic clathrate Na2Ba6Si46 by oxidation of Na2BaSi4 with HCl

    Directory of Open Access Journals (Sweden)

    Bodo Böhme, Umut Aydemir, Alim Ormeci, Walter Schnelle, Michael Baitinger and Yuri Grin

    2007-01-01

    Full Text Available A new preparation route to the intermetallic clathrate-I compound Na2Ba6Si46 is introduced, which allows one to make large amounts of product with standard laboratory equipment. The precursor Na2BaSi4 is oxidized with gaseous HCl at 673 K to Na2Ba6Si46, NaCl and BaCl2. Full-profile refinement of the crystal structure from the X-ray powder diffraction data revealed a composition close to Na2Ba6Si46 (Na1.94(1Ba6.06(1Si46, space group Pmbar 3n, a=10.281(1 Å. Differential scanning calorimetry showed an exothermic effect at 874 K, indicating that Na2Ba6Si46 is metastable. The product was additionally characterized by scanning electron microscopy. The electronic structure of Na2Ba6Si46 was investigated by a first-principles, all-electron full-potential method, predicting metallic conductivity. Na2Ba6Si46 obtained by oxidation with HCl shows Pauli paramagnetism; no bulk superconductivity was found down to 1.8 K in a magnetic field of 20 Oe.

  4. Ground Based Support for Exoplanet Space Missions

    Science.gov (United States)

    Haukka, H.; Hentunen, V.-P.; Salmi, T.; Aartolahti, H.; Juutilainen, J.; Vilokki, H.; Nissinen, M.

    2011-10-01

    Taurus Hill Observatory (THO), observatory code A95, is an amateur observatory located in Varkaus, Finland. The observatory is maintained by the local astronomical association Warkauden Kassiopeia. THO research team has observed and measured various stellar objects and phenomena. Observatory has mainly focused to asteroid [1] and exoplanet light curve measurements, observing the gamma rays burst, supernova discoveries and monitoring [2] and long term monitoring projects [3]. In the early 2011 Europlanet NA1 and NA2 organized "Coordinated Observations of Exoplanets from Ground and Space"-workshop in Graz, Austria. The workshop gathered together proam astronomers who have the equipment to measure the light curves of the exoplanets. Also there were professional scientists working in the exoplanet field who attended to the workshop. The result of the workshop was to organize coordinated observation campaign for follow-up observations of exoplanets (e.g. CoRoT planets). Also coordinated observation campaign to observe stellar CME outbreaks was planned. THO has a lot of experience in field of exoplanet light curve measurements and therefore this campaign is very supported by the research team of the observatory. In next coming observing seasons THO will concentrate its efforts for this kind of campaigns.

  5. Characteristics Studies of 125I- and total PSA antibody's Binding with prostate specific antigen (PSA) in Human Uterus Tumors

    International Nuclear Information System (INIS)

    Al-Mudaffar, S.; Al-Salihi, J.

    2005-01-01

    Two groups of uterus tumors (benign and malignant) postmenopausal patients were used to investigate the presence of prostate specific antigen (PSA). Preliminary experiments were performed to follow the binding of '1 25 I-anti total PSA antibody with PSA in uterus tissues homogenates of the two groups with their corresponding antigen and found to be (8.8,7.1%) for benign and malignant tumors, respectively. An Immuno Radio Metric Assay (IRMA) procedure was developed for measuring PSA in benign and malignant uterus tumors homogenates. The optimum conditions of the binding of 125 I-anti total PSA antibody with PSA were as follows: PSA concentration (150,200 μg protein),tracer antibody concentration (125,250 μg protein), p H (7.6,7.2), temp (15,25?C) and time (1.5 hrs) for postmenopausal benign and malignant uterus tumors tissue homogenates, respectively. The use of different concentrations of Na + and Mg 2+ ions were shown to cause an increase in the binding at concentration of (125,75 mΜ) of Na 1+ ions (75,225 mΜ) of Mg 2+ ions for benign and malignant uterus tumors homogenates, respectively, while the use of different concentrations of urea and polyethylene glycol (PEG) Caused a decrease in the binding with the increase in the concentration of each of urea and PEG in the both cases

  6. The impact of the depth of field on cytogenetic image quality in scanning microscopy

    Science.gov (United States)

    Qiu, Yuchen; Chen, Xiaodong; Li, Yuhua; Zheng, Bin; Li, Shibo; Zhang, Roy R.; Chen, Wei R.; Liu, Hong

    2011-03-01

    The purpose of this study is to investigate the impact of the depth of field (DOF) of microscopic systems on cytogenetic image qualities. Due to the narrow DOF of high magnification, large numerical aperture (N.A.) objective lenses, random vibrations of even high precision scanning stages may result in large amount of off focused images. In this study, the DOF of microscopic systems with various objective magnifications/numerical apertures (N.A.) is first measured using standard resolution targets. The impact of DOF on cytogenetic image qualities is then subjectively evaluated with clinical samples, by comparing the band shape and sharpness of analyzable chromosomes. For a specific digital microscopic system with 100× objective lens (N.A. = 1.25), the results of observational studies revealed that chromosomal bands are still recognizable when the images are obtained approximately +/- 1 μm from the focusing plane. The chromosomal bands become fuzzy and unrecognizable when the system is 1.5 μm away from the focusing position. The results of this preliminary experimental study may provide useful design trade-off parameters for developing optimal scanning microscopic systems for cytogenetic applications.

  7. Ion conductivity of nasicon ceramics

    International Nuclear Information System (INIS)

    Hoj, J.W.; Engell, J.

    1989-01-01

    The Nasicon ss ,Na 1 + X Zr 2 Si X P 3 - X O 12 o , X , 3, includes some of the best solid state sodium conductors known today. Compositions in the interval 1.6 , X , 2.6 show conductivities comparable to the best β double-prime-alumina ceramics. It is well known that the ion conductivity of β-alumina is strongly dependent on the texture of the ceramic. Here a similar behavior is reported for Nasicon ceramics. Ceramics of the bulk composition Na 2.94 Zr 1.49 Si 2.20 P 0.80 O 10.85 were prepared by a gel method. The final ceramics consist of Nasicon crystals with x = 2.14 and a glass phase. The grain size and texture of the ceramics were controlled by varying the thermal history of the gel based raw materials and the sintering conditions. The room temperature resistivity of the resulting ceramics varies from 3.65*10 3 ohm cm to 1.23*10 3 ohm cm. Using the temperature comparison method and estimates of the area of grain boundaries in the ceramics, the resistivity of the Nasicon phase is estimated to be 225 ohm cm at 25 degrees C. B 2 O 3 - or Al 2 O 3 -doping of the glass bearing Nasicon ceramic lower the room temperature resistivity by a factor 2 to 5. The dopants do not substitute into the Nasicon phase in substantial amounts

  8. Wear characteristics of polished and glazed lithium disilicate ceramics opposed to three ceramic materials.

    Science.gov (United States)

    Saiki, Osamu; Koizumi, Hiroyasu; Akazawa, Nobutaka; Kodaira, Akihisa; Okamura, Kentaro; Matsumura, Hideo

    2016-01-01

    This study compared the wear characteristics of a heat-pressed lithium disilicate ceramic material opposed to feldspathic porcelain, a lithium disilicate glass ceramic, and zirconia materials. Ceramic plate specimens were prepared from feldspathic porcelain (EX-3 nA1B), lithium disilicate glass ceramics (e.max CAD MO1/C14), and zirconia (Katana KT 10) and then ground or polished. Rounded rod specimens were fabricated from heat-pressed lithium disilicate glass ceramic (e.max press LT A3) and then glazed or polished. A sliding wear testing apparatus was used for wear testing. Wear of glazed rods was greater than that of polished rods when they were abraded with ground zirconia, ground porcelain, polished porcelain, or polished lithium disilicate ceramics. For both glazed and polished rods, wear was greater when the rods were abraded with ground plates. The findings indicate that application of a polished surface rather than a glazed surface is recommended for single restorations made of heat-pressed lithium disilicate material. In addition, care must be taken when polishing opposing materials, especially those used in occlusal contact areas. (J Oral Sci 58, 117-123, 2016).

  9. Phytophthora ramorum in Canada: evidence for migration within North America and from Europe.

    Science.gov (United States)

    Goss, Erica M; Larsen, Meg; Vercauteren, Annelies; Werres, Sabine; Heungens, Kurt; Grünwald, Niklaus J

    2011-01-01

    Phytophthora ramorum, the cause of sudden oak death on oak and ramorum blight on woody ornamentals, has been reported in ornamental nurseries on the West Coast of North America from British Columbia to California. Long-distance migration of P. ramorum has occurred via the nursery trade, and shipments of host plants are known to have crossed the U.S.-Canadian border. We investigated the genotypic diversity of P. ramorum in Canadian nurseries and compared the Canadian population with U.S. and European nursery isolates for evidence of migration among populations. All three of the P. ramorum clonal lineages were found in Canada but, unexpectedly, the most common was the NA2 lineage. The NA1 clonal lineage, which has been the most common lineage in U.S. nurseries, was found relatively infrequently in Canada, and these isolates may have been the result of migration from the United States to Canada. The EU1 lineage was observed almost every year and shared multilocus genotypes with isolates from Europe and the United States. Estimation of migration rates between Europe and North America indicated that migration was higher from Europe to North America than vice versa, and that unidirectional migration from Europe to North America was more likely than bidirectional migration.

  10. Assessment of Shelf-Life Ability of Apples cv. ‘Auksis’ after Long-term Storage Under Different Conditions

    Directory of Open Access Journals (Sweden)

    Juhņeviča-Radenkova Karina

    2016-12-01

    Full Text Available The objective of the current research was to ascertain the shelf-life ability of apple ‘Auksis’ after 6 months of cold storage under different conditions. The effect of storage conditions such as: cold storage under normal atmosphere (NA, 1-methylcyclopropene (1-MCP + cold storage, and ultra-low oxygen (ULO-controlled atmosphere (CA [2.0% CO2 and 1.0% O2 (ULO1 and 2.5% CO2 and 1.5% O2 (ULO2] on the quality of apples during shelf-life was evaluated. Apple fruits immediately after cold storage and after 25 days of maintaining at market condition had been evaluated. The physical (firmness, weight losses, chemical (total soluble solids and acid contents, and sensory (aroma, taste, acidity, sweetness, juiciness, and color characteristics of apples had been evaluated after 5, 10, 15, 20, and 25 days to ascertain maximal shelf-life. Results from sensory evaluation indicated that apples treated with 1-MCP and stored at NA were characterized with distinctive aroma, whereas apples stored under CA were poor in sweetness and had remarkable acidity and juiciness. Apples that were stored in cold had pronounced aroma and color but without taste. Based on the evaluation by panelist, maximum shelf-life of apples that were kept under cold storage and ULO1 was 15 days, whereas that of apples that had been treated with 1-MCP and stored at NA and those stored in ULO2 was 25 days.

  11. Determination of reference values of elements in whole blood of the wistar rats using neutron activation analysis (NAA)

    International Nuclear Information System (INIS)

    Oliveira, Laura C.; Zamboni, Cibele B.

    2011-01-01

    Some investigations, especially biochemistry analysis, can be performed using whole blood if the normality limits are established. The present study deals with the determination of reference values for elements of clinical interest, in whole blood of Wistar rats using the Neutron Activation Analysis technique. Usually these small-sized animals are used as guinea-pig on experiments that involves testing new medicines and medical diagnostic studies. In this investigation, the reference values for blood were determined for: Br (0.0011 - 0.0095 gL -1 ), Ca (0.0 - 0.66 gL -1 ), Cl (2.35 - 4.91 gL -1 ), K (1.00 - 3.12 gL -1 ), Mg (0.044 - 0.108 gL -1 ), Na (1.13 - 3.09 gL -1 ) and S (0.53 - 1.81 gL -1 ). These data will allow researchers to optimize their studies, both in terms of cost and time by selecting species that fits to the experimental model as a clinical reference as well as performing biochemical analyses in whole blood using small quantities (few μL) compared to the conventional analyses performed in serum (few mL). (author)

  12. Fcgamma receptor IIIA polymorphism as a risk-factor for coronary artery disease.

    Science.gov (United States)

    Gavasso, Sonia; Nygård, Ottar; Pedersen, Eva Ringdal; Aarseth, Jan H; Bleie, Oyvind; Myhr, Kjell-Morten; Vedeler, Christian A

    2005-06-01

    Inflammation is important in the pathogenesis of atherosclerosis. Polymorphisms of Fc receptors for IgG (FcgammaR) are associated with modifying effects of several infectious and autoimmune diseases. We have assessed the relationship between polymorphisms in three different FcgammaR genes and coronary artery disease (CAD). We genotyped for the FcgammaRIIA-R/H131, the FcgammaRIIIB-Na1/Na2, and the FcgammaRIIIA-F/V158 polymorphisms in 882 patients undergoing diagnostic coronary angiography. Significant CAD was defined as >/=50% lumen diameter stenosis in at least one coronary artery. In the analysis, no association was found between the FcgammaRIIA and FcgammaRIIIB genotypes and CAD, whereas the FcgammaRIIIA genotype was strongly related. Compared to those being heterozygous, or homozygous for the F allele, patients homozygous for the V allele had significantly reduced risk: OR, 0.53; (CI, 0.32-0.90). Additional adjustment for classical risk factors and sedimentation rate did not affect the results. The V/V genotype was also inversely related to the extent of CAD defined as no CAD, single, double or triple vessel disease (P trend=0.002). Our data provide evidence for an association between FcgammaRIIIA allelic variants and coronary atherosclerosis. Genetic variation in this IgG-receptor may influence the clearance of antibodies by monocyte-derived macrophages involved in the pathogenesis of CAD.

  13. Stability of alkali-metal hydrides: effects of n-type doping

    Science.gov (United States)

    Olea Amezcua, Monica Araceli; de La Peña Seaman, Omar; Rivas Silva, Juan Francisco; Heid, Rolf; Bohnen, Klaus-Peter

    Metal hydrides could be considered ideal solid-state hydrogen storage systems, they have light weight and high hydrogen volumetric densities, but the hydrogen desorption process requires excessively high temperatures due to their high stability. Efforts have been performed to improve their dehydrogenation properties, based on the introduction of defects, impurities and doping. We present a systematic study of the n-type (electronic) doping effects on the stability of two alkali-metal hydrides: Na1-xMgxH and Li1-xBexH. These systems have been studied within the framework of density functional perturbation theory, using a mixed-basis pseudopotential method and the self-consistent version of the virtual crystal approximation to model the doping. The full-phonon dispersions are analyzed for several doping content, paying special attention to the crystal stability. It is found a doping content threshold for each system, where they are close to dynamical instabilities, which are related to charge redistribution in interstitial zones. Applying the quasiharmonic approximation, the vibrational free energy, the linear thermal expansion and heat capacities are obtained for both hydrides systems and are analyzed as a function of the doping content. This work is partially supported by the VIEP-BUAP 2016 and CONACYT-México (No.221807) projects.

  14. Lattice dynamics and dielectric spectroscopy of BZT and NBT lead-free perovskite relaxors - comparison with lead-based relaxors

    Science.gov (United States)

    Petzelt, Jan; Nuzhnyy, Dmitry; Bovtun, Viktor; Kempa, Martin; Savinov, Maxim; Kamba, Stanislav; Hlinka, Jiri

    2015-03-01

    Appearance of the polar nanoregions (PNR) and their manifestation in the dielectric spectra is discussed for lead-free Ba(ZrxTi1-x)O3 (BZT-x) and (Na1/2Bi1/2)TiO3 (NBT) ceramics. Phonon softening is not as pronounced as in the lead-based relaxors, but the relaxation contribution is dominating in all cases, caused by the dynamics of the off-centred ions (Ti4+, Bi3+, Pb2+). In the lead-based relaxors, where there is no relation between the quenched chemical clusters at the B-sites and PNR, which concern the A-site Pb-ion correlations, the relaxation dynamics follows the Vogel-Fulcher behaviour with a clear freezing. However, in BZT and NBT, the PNR are smaller, since they are localised within the small quenched chemical clusters of BaTiO3 and BiTiO3, respectively. Their dynamics is Arrhenius-like, which indicates hopping of the off-centred Ti4+ and Bi3+ ions, respectively, without their complete freezing. BZT can be classified as a dipolar glass and NBT as a nanoscopic ferroelectric with peculiar Bi-ion dynamics.

  15. Phylogenetic Relationships among Species of Phellinus sensu stricto, Cause of White Trunk Rot of Hardwoods, from Northern North America

    Directory of Open Access Journals (Sweden)

    Nicholas J. Brazee

    2015-11-01

    Full Text Available Species in Phellinus s.s. are some of the most important wood-decaying fungal pathogens in northern temperate forests, yet data on species incidence in North America remains limited. Therefore, phylogenetic analyses were performed using four loci (ITS, nLSU, tef1 and rpb2 with isolates representing 13 species. Results of phylogenetic analyses using maximum likelihood and Bayesian inference revealed that eight species of Phellinus s.s. occur in North America, and include: P. alni, P. arctostaphyli, P. betulinus, P. lundellii, P. nigricans, P. tremulae and two undescribed species, P. NA1 and P. NA2. Meanwhile, P. tuberculosus, P. igniarius s.s., P. populicola, P. laevigatus s.s. and P. orienticus were not detected and appear restricted to Europe and/or Asia. The tef1 dataset outperformed all other loci used and was able to discriminate among all 13 of the currently known Phellinus s.s. species with significant statistical support. The internal transcribed spacer (ITS region performed well but a high level of intraspecific variation could lead to inflated taxa recognition. Phellinus alni exhibited the broadest host range, as demonstrated previously, and appears to be the most common species in northern hardwood (Acer-Betula-Fagus, northern floodplain (Fraxinus-Populus-Ulmus and coastal alder (Alnus forests of North America.

  16. Interaction of the univalent silver cation with [Gly6]-antamanide: Experimental and theoretical study

    Science.gov (United States)

    Makrlík, Emanuel; Böhm, Stanislav; Kvíčala, Jaroslav; Vaňura, Petr; Ruzza, Paolo

    2018-03-01

    On the basis of extraction experiments and γ-activity measurements, the extraction constant corresponding to the equilibrium Ag+(aq) + 1.Na+(nb) ⇄ 1.Ag+ (nb) + Na+(aq) occurring in the two-phase water - nitrobenzene system (1 = [Gly6]-antamanide; aq = aqueous phase, nb = nitrobenzene phase) was determined as log Kex (Ag+,1·Na+) = 1.5 ± 0.1. Further, the stability constant of the 1·Ag+ complex in nitrobenzene saturated with water was calculated for a temperature of 25 °C: log βnb (1·Ag+) = 4.5 ± 0.2. Finally, by using quantum chemical DFT calculations, the most probable structure of the cationic complex species 1·Ag+ was derived. In the resulting complex, the "central" cation Ag+ is coordinated by four noncovalent interactions to the corresponding four carbonyl oxygen atoms of the parent ligand 1. Besides, the whole 1·Ag+ complex structure is stabilized by two intramolecular hydrogen bonds. The interaction energy of the considered 1·Ag+ complex was found to be -465.5 kJ/mol, confirming also the formation of this cationic species.

  17. Diversity and Adaptation of Human Respiratory Syncytial Virus Genotypes Circulating in Two Distinct Communities: Public Hospital and Day Care Center

    Directory of Open Access Journals (Sweden)

    Gustavo Rocha Garcia

    2012-10-01

    Full Text Available HRSV is one of the most important pathogens causing acute respiratory tract diseases as bronchiolitis and pneumonia among infants. HRSV was isolated from two distinct communities, a public day care center and a public hospital in São José do Rio Preto – SP, Brazil. We obtained partial sequences from G gene that were used on phylogenetic and selection pressure analysis. HRSV accounted for 29% of respiratory infections in hospitalized children and 7.7% in day care center children. On phylogenetic analysis of 60 HRSV strains, 48 (80% clustered within or adjacent to the GA1 genotype; GA5, NA1, NA2, BA-IV and SAB1 were also observed. SJRP GA1 strains presented variations among deduced amino acids composition and lost the potential O-glycosilation site at amino acid position 295, nevertheless this resulted in an insertion of two potential O-glycosilation sites at positions 296 and 297. Furthermore, a potential O-glycosilation site insertion, at position 293, was only observed for hospital strains. Using SLAC and MEME methods, only amino acid 274 was identified to be under positive selection. This is the first report on HRSV circulation and genotypes classification derived from a day care center community in Brazil.

  18. Factores de riesgo relacionados al uso de drogas ilegales: perspectiva crítica de familiares y personas cercanas en un centro de salud público en San Pedro Sula, Honduras Fatores de risco relacionados ao uso de drogas ilegais, perspectiva crítica de familiares e pessoas próximas, em um centro da saúde público em San Pedro Sula, Honduras Risk factors related to the use of illegal drugs: the critial perspective of drug users' relatives and acquaintances at a public health center in San Pedro Sula, Honduras

    Directory of Open Access Journals (Sweden)

    Gladys Magdalena Rodríguez Funes

    2009-01-01

    Full Text Available En este estudio, se presentan datos cuantitativos del estudio multicéntrico, multimétodos, de corte transversal realizado en un centro de salud público en San Pedro Sula, en Honduras. Su objetivo es describir la perspectiva crítica que tienen los familiares o personas, que se consideran afectadas por tener a alguien cercano que usa o ha usado drogas ilegales, con relación a factores de riesgo. Los datos se obtuvieron mediante una encuesta con 100 entrevistados. La mayor parte de las personas informantes eran mujeres pobres con baja escolaridad. Los consumidores eran en su mayoría hombres con edad promedio de 23,3 años. La droga más usada fue la marihuana (78% seguida de crack/cocaína (72%, pegamento/inhalantes (27%, alucinógenos (éxtasis/LSD (3%, anfetaminas/estimulantes (1% y heroína (1%. Los factores de riesgo identificados fueron la experiencia previa con alcohol/tabaco, el tener amigos/amigas que usan drogas, la falta de conocimiento, la baja autoestima , la edad, entre otros factores personales, familiares y sociales. Se concluye que es necesario fortalecer las medidas de prevención y protección.São apresentados, aqui, dados quantitativos de um estudo multicêntrico, multimétodos, de corte transversal, realizado em um centro de saúde pública em San Pedro Sula, Honduras. O objetivo foi descrever a perspectiva crítica dos membros da família ou pessoas que se sentem afetadas por terem alguém próximo que usa ou usou drogas ilegais, em relação aos fatores de risco. Os dados foram coletados através de questionário aplicado em 100 indivíduos. A maioria era composta por mulheres pobres, com pouca escolaridade. Os consumidores eram majoritariamente varões, com idade média de 23,3 anos. A droga mais utilizada foi a maconha (78%, seguida por crack/cocaína (72%, cola/inalantes (27%, alucinógenos (ecstasy/LSD (3%, anfetaminas/estimulantes (1%, heroína (1%. Entre os fatores de risco identificados estão: experi

  19. Crescimento facial espontâneo Padrão II: estudo cefalométrico longitudinal Spontaneous facial growth in Pattern II: a longitudinal cephalometric study

    Directory of Open Access Journals (Sweden)

    Omar Gabriel da Silva Filho

    2009-02-01

    Full Text Available OBJETIVO: o presente estudo cefalométrico longitudinal investigou as alterações espontâneas ocorridas em crianças com má oclusão Classe II, divisão 1, Padrão II. MÉTODOS: foram selecionadas 40 crianças, 20 meninos e 20 meninas, distribuídas na faixa etária compreendida entre 6 e 14 anos de idade. Para avaliar o comportamento das bases apicais, dos incisivos e do tecido mole, as seguintes grandezas cefalométricas foram mensuradas: SN.Ba, SNA, SNB, SND, SN.Pog, ANB, NAP, SN.PP, SN.GoGn, SN.Gn, Ar.Go.Gn, 1.PP, 1.NA, 1.SN, IMPA e ANL. As seguintes grandezas alcançaram significância estatística com o crescimento: SNB, SND,SN.Pog,ANB,NAP,SN.GoGn,SN.Gn,Ar.Go.Gn e IMPA. RESULTADOS: os resultados demonstraram que as principais alterações quantitativas registradas estavam relacionadas com o crescimento mandibular,independentemente do gênero. A mandíbula deslocou-se para frente, com tendência de rotação no sentido anti-horário e com conseqüente redução nos ângulos de convexidade facial. No entanto, as oscilações quantitativas nas grandezas cefalométricas não foram suficientes para mudar a morfologia dentofacial ao longo do período de acompanhamento. CONCLUSÃO: conclui-se, portanto, que a morfologia facial é definida precocemente e é mantida, configurando o determinismo genético na determinação do arcabouço esquelético.AIM: The current longitudinal cephalometric study investigated the spontaneous alterations in growing Class II, division 1, Pattern II patients. METHODS: Forty children (twenty boys and twenty girls with ages ranging between 6 and 14 years were selected to comprise the sample. The behavior of the apical bases, incisors and facial profile was evaluated on the basis of the following cephalometric measurements: SN.Ba, SNA, SNB, SND, SN.Pog, ANB, NAP, SN.GoGn, SN.PP, SN.Gn, Ar.Go.Gn, 1.PP, 1.NA, 1.SN, IMPA and nasolabial angle. The following measurements were statistically significant along growth: SNB

  20. Programa de capacitação em ressuscitação cardiorrespiratória com uso do desfibrilador externo automático em uma universidade Programa de formación en reanimación cardiopulmonar con el uso del desfibrilador externo automático en una universidad Training program on cardiopulmonary resuscitation with the use of automated external defibrillator in a university

    Directory of Open Access Journals (Sweden)

    Ana Paula Boaventura

    2012-03-01

    Full Text Available A desfibrilação precoce na ressuscitação cardiopulmonar (RCP recebe crescente destaque quanto à prioridade e rapidez. Este é um relato de experiência da implantação de um programa de capacitação em RCP, utilizando o desfibrilador em uma universidade privada. O programa em manobras básicas de RCP foi baseado nas diretrizes mundiais, envolvendo um curso teórico com demonstração prática das manobras de RCP com desfibrilador, treinamento prático individual, avaliação teórica e prática. Quanto ao desempenho dos alunos na avaliação prática, a média das pontuações obtidas pelos alunos na 1ª Etapa foi de 26,4 pontos e na 2ª Etapa a média aumentou para 252,8 pontos, já na Avaliação teórica na 1ª Etapa foi de 3,06 pontos e na 2ª Etapa a média aumentou para 9,0 pontos. A implantação desse tipo de programas contribui para a aquisição efetiva de conhecimento (teórico e da habilidade (prática nos atendimentos a vítimas de PCR.La desfibrilación temprana en reanimación cardiopulmonar (RCP recibe mayor énfasis en la prioridad y la velocidad de su uso. Esta es una experiencia de la aplicación de un programa de entrenamiento en RCP, utilizando el desfibrilador en una universidad privada. El programa de entrenamiento en las maniobras básicas de resucitación cardiopulmonar se basó en las directrices globales. El programa incluía un curso teórico con demostración práctica de maniobras de RCP con la desfibrilador, formación práctica y teoría de la evaluación individual práctica. El rendimiento de los estudiantes en la evaluación práctica, las puntuaciones medias obtenidas en el primer paso tenía 26,4 puntos en la segundo paso se elevó a 252,8 puntos, como en la evaluación teórica del primer paso fue 3,06 puntos y el segundo paso se elevó a 9,0 puntos. La aplicación de programas contributye a la adquisición efectiva de conocimiento (teoría y habilidad (prática en cuidado de las víctimas de la PCR

  1. O QUE A ESCRITA DE UNIVERSITÁRIOS PODE DIZER SOBRE SUAS PRÁTICAS DE LEITURA

    Directory of Open Access Journals (Sweden)

    Lou-Ann Kleppa

    2012-07-01

    Full Text Available O gesto de escrever, segundo Flusser (1991, é diferente do gesto de falar. Contudo, ambos têm em comum a procura pelo outro. Em outro texto, o autor (Flusser, 2010 afirma que textos publicados são resultado da atividade de ourives: são lapidados (seja pelo escritor, seja pelo editor. Os textos analisados aqui são redações de alunos ingressantes (em 2011 no curso de Biologia na Universidade Federal de Rondônia. As 102 redações dos alunos examinadas aqui trazem marcas de oralidade e poucos indícios de edição (revisão e corte de redundâncias. São analisadas 36 narrativas que agrupamos sob o título Era uma vez, 28 narrativas que agrupamos sob o título de Continuação, 10 textos argumentativos que agrupamos sob o título de Sacolinhas e 28 textos argumentativos que agrupamos sob o título TV no ônibus. O deslizamento da oralidade para a escrita se faz evidente na (1 ortografia, (2 marcas de concordância, (3 preposições e pronomes reflexivos, (4 preenchimento do pronome-sujeito e (5 repetições vocabulares. As ortografias que representam a fala, as repetições, preposições e pronomes reflexivos empregados de maneira sui generis, além de concordâncias que não são realizadas na fala apontam para as parcas práticas de leitura dos alunos; já que a leitura envolve a memória pictográfica: quer seja a leitura do próprio texto, quer seja a leitura em geral.

  2. Functional, spectroscopic and structural properties of haemoglobin from chamois (Rupicapra rupicapra) and steinbock (Capra hircus ibex).

    Science.gov (United States)

    Ascenzi, P; Clementi, M E; Condò, S G; Coletta, M; Petruzzelli, R; Polizio, F; Rizzi, M; Giunta, C; Peracino, V; Giardina, B

    1993-01-01

    The functional and spectroscopic properties of chamois (Rupicapra rupicapra) and steinbock (Capra hircus ibex) haemoglobin (Hb) have been studied with special reference to the action of allosteric effectors and temperature. Moreover, the amino acid sequences of the N-terminal segments of the alpha- and beta-chains have been determined. The present results indicate that chamois and steinbock Hbs display a low affinity for O2, which appears to be modulated in vivo by Cl- ions rather than 2,3-bisphosphoglycerate. The Bohr effect for O2 binding to chamois and steinbock Hb is higher than for reindeer and bovine Hbs, being similar to that of human Hb. Moreover, the temperature-dependence of oxygenation appears intermediate between that of human and reindeer Hbs. E.p.r. and absorption spectroscopic properties of the ferrous nitrosylated derivative of chamois and steinbock Hbs suggest that both haemoproteins are in a low-affinity conformation even in the absence of InsP6. The reduced effect of polyphosphates on the functional and spectroscopic properties of chamois and steinbock Hb agree with amino acid differences in the N-terminal segment of the beta-chains (i.e. the deletion of Val(NA1) and the replacement of His(NA2), present in human Hb, and Gln(NA2), present in horse Hb, by Met). The molecular mechanism modulating the basic reaction of O2 with chamois and steinbock Hb may be linked to specific physiological needs related to the high-altitude habitats of these two animals. PMID:8257425

  3. Alterações sexuais na epilepsia: resultados de uma avaliação multidisciplinar

    Directory of Open Access Journals (Sweden)

    ALMEIDA SILVA HELGA C.

    1999-01-01

    Full Text Available Onze pacientes do sexo masculino com epilepsia e queixa de alteração sexual foram submetidos a avaliação multidisciplinar. A média de idade foi 27 anos (20-34, a duração média da epilepsia foi 19 anos (0,5-32 e a frequência média das crises foi duas por semana (0-7. Dez pacientes apresentavam crises parciais e um, mioclônicas. Dez pacientes recebiam drogas antiepilépticas (difenil-hidantoína - 1, carbamazepina - 8, clonazepam - 3, clobazam - 2, valproato - 3, vigabatrina - 1. Segundo os critérios do DSM III -- R, as queixas foram disfunção erétil (9, redução da libido (4, froteurismo (4, inibição do orgasmo (3, ejaculação precoce (3, fetichismo (2, voyeurismo (2, exibicionismo (2, pedofilia (1 e aversão sexual (1. A avaliação endocrinológica mostrou hipogonadismo hipogonadotrófico em dois pacientes. A avaliação urológica revelou disfunção erétil orgânica em outros dois. Em um paciente a alteração sexual foi considerada psicogênica. Em seis pacientes não foi possível estabelecer diagnóstico etiológico definitivo. Este estudo mostra que a alteração da sexualidade na epilepsia é multifatorial e necessita de abordagem multidisciplinar.

  4. Impacts of at-site wastewater disposal systems on the groundwater aquifer in arid regions: case of Sfax City, Southern Tunisia

    Science.gov (United States)

    Chamtouri, Ibticem; Abida, Habib; Khanfir, Hafedh; Bouri, Salem

    2008-09-01

    Groundwater in Sfax City (Tunisia) has been known since the beginning of the century for its deterioration in quality, as a result of wastewater recharge into the aquifer. An average value of 12 × 106 m3 of untreated wastewater reaches the groundwater aquifer each year. This would result not only in a chemical and biological contamination of the groundwater, but also in an increase of the aquifer piezometric level. Quantitative impacts were evaluated by examining the groundwater piezometric level at 57 surface wells and piezometers. The survey showed that, during the last two decades, the groundwater level was ever increasing in the urban area with values reaching 7 m in part; and decreasing in Sidi Abid (agricultural area) with values exceeding -3 m. Groundwater samples for chemical and microbial analysis were collected from 41 wells spread throughout the study area. Results showed significantly elevated levels of sodium, chlorides, nitrates and coliform bacteria all over the urban area. High levels (NO3: 56-254 mg/l; Na >1,500 mg/l; Coliforms >30/100 ml) can be related to more densely populated areas with a higher density of pit latrine and recharge wells. Alternatively results showed a very variable chemical composition of groundwater, e.g. electrical conductivity ranges from 4,040 to19,620 μs/cm and the dry residual varies between 1.4 and 14 g/l with concentrations increasing downstream. Furthermore a softening of groundwater in Set Ezzit (highly populated sector) was observed.

  5. Parameter estimation for mathematical models of a nongastric H+(Na+)-K(+)(NH4+)-ATPase.

    Science.gov (United States)

    Nadal-Quirós, Mónica; Moore, Leon C; Marcano, Mariano

    2015-09-01

    The role of nongastric H(+)-K(+)-ATPase (HKA) in ion homeostasis of macula densa (MD) cells is an open question. To begin to explore this issue, we developed two mathematical models that describe ion fluxes through a nongastric HKA. One model assumes a 1H(+):1K(+)-per-ATP stoichiometry; the other assumes a 2H(+):2K(+)-per-ATP stoichiometry. Both models include Na+ and NH4+ competitive binding with H+ and K+, respectively, a characteristic observed in vitro and in situ. Model rate constants were obtained by minimizing the distance between model and experimental outcomes. Both 1H(+)(1Na(+)):1K(+)(1NH4 (+))-per-ATP and 2H(+)(2Na(+)):2K(+)(2NH4 (+))-per-ATP models fit the experimental data well. Using both models, we simulated ion net fluxes as a function of cytosolic or luminal ion concentrations typical for the cortical thick ascending limb and MD region. We observed that (1) K+ and NH4+ flowed in the lumen-to-cytosol direction, (2) there was competitive behavior between luminal K+ and NH4+ and between cytosolic Na+ and H+, 3) ion fluxes were highly sensitive to changes in cytosolic Na+ or H+ concentrations, and 4) the transporter does mostly Na+ / K+ exchange under physiological conditions. These results support the concept that nongastric HKA may contribute to Na+ and pH homeostasis in MD cells. Furthermore, in both models, H+ flux reversed at a luminal pH that was <5.6. Such reversal led to Na+ / H+ exchange for a luminal pH of <2 and 4 in the 1:1-per-ATP and 2:2-per-ATP models, respectively. This suggests a novel role of nongastric HKA in cell Na+ homeostasis in the more acidic regions of the renal tubules. Copyright © 2015 the American Physiological Society.

  6. Ferroelectric and octahedral tilt twin disorder and the lead-free piezoelectric, sodium potassium niobate system

    International Nuclear Information System (INIS)

    Schiemer, Jason; Withers, Ray L.; Liu, Yun; Yi, Zhiguo

    2012-01-01

    Using electron diffraction, trends in the local structural behaviour of the K x Na 1−x NbO 3 (KNN x) ‘solid solution’ system are investigated and interpreted using an order/disorder based theoretical framework. At room temperature, electron diffraction shows a single plane of transverse polarised, diffuse intensity perpendicular to [0 1 0] p ⁎ (p for parent sub-structure) across the entire phase diagram, indicative of ferroelectric disorder along the [0 1 0] p direction co-existing with long range ferroelectric order along the orthogonal [1 0 0] p and [0 0 1] p directions. An additional characteristic pattern of diffuse scattering is also observed, involving rods of diffuse intensity running along the [1 0 0] p * and [0 0 1] p * directions of the perovskite sub-structure and indicative of octahedral tilt disorder about the [1 0 0] p and [0 0 1] p axes co-existing with long range ordered octahedral tilting around the [0 1 0] p direction. A possible crystal chemical explanation for the existence of this latter octahedral tilt disorder is explored through bond valence sum calculations. The possible influence of both types of disorder on the previously refined, room temperature space group/s and average crystal structure/s is examined. - Graphical abstract: [−3,0.−1]p zone axis EDP of K 0.46 Na 0.54 NbO 3 indexed according to both the relevant Pcm21 space groups (no subscripts) and the parent perovskite subcell (denoted by a subscript p). Highlights: ► Characterises ferroelectric and octahedral tilt disorder in the KNN solid solution. ► Discusses the possible driving forces for this disorder. ► Discusses the implications of this disorder for physical properties. ► Discusses the effects of this disorder on powder diffraction data.

  7. Molecular epidemiology of human respiratory syncytial virus over three consecutive seasons in Latvia.

    Science.gov (United States)

    Balmaks, Reinis; Ribakova, Irina; Gardovska, Dace; Kazaks, Andris

    2014-11-01

    Lower respiratory tract infections caused by the human respiratory syncytial virus (HRSV) represent an immense burden of the disease, especially in young children. This study aimed to investigate the evolutionary history of HRSV strains isolated in the Children's Clinical University Hospital (Riga, Latvia) over three consecutive HRSV seasons. Of 207 samples from children hospitalized with lower respiratory tract infections, 88 (42.5%) tested positive for HRSV by RT-PCR. The seasonal activity started and peaked later than the average for the Northern hemisphere. Patients with HRSV lower respiratory tract infection were significantly younger than patients not infected with HRSV. HRSV-A viruses predominated for two consecutive seasons and were followed by an HRSV-B dominant season. Phylogenetic analysis based on glycoprotein G gene partial sequences revealed that viruses of both groups belonged to the worldwide dominant genotypes NA1 (HRSV-A) and BA-IV (HRSV-B). High diversity of this gene was driven only partially by selection pressure, as only two positively selected sites were identified in each group. Two of the HRSV-A isolates in this study contained a 72-nt duplication in the C-terminal end of the G gene (genotype ON1) that was first described in Canada in the 2010-2011 season. Initial spatial and temporal dynamics of this novel genotype were reconstructed by discrete phylogeographic analysis. Fifteen years after acquiring comparable 60-nt duplication in the G gene, genotype BA lineages have replaced all other HRSV-B strains. However, the population size of genotype ON1 plateaued soon and even decreased slightly before the beginning of the 2012-2013 season. © 2013 Wiley Periodicals, Inc.

  8. Charge-Shift Corrected Electronegativities and the Effect of Bond Polarity and Substituents on Covalent-Ionic Resonance Energy.

    Science.gov (United States)

    James, Andrew M; Laconsay, Croix J; Galbraith, John Morrison

    2017-07-13

    Bond dissociation energies and resonance energies for H n A-BH m molecules (A, B = H, C, N, O, F, Cl, Li, and Na) have been determined in order to re-evaluate the concept of electronegativity in the context of modern valence bond theory. Following Pauling's original scheme and using the rigorous definition of the covalent-ionic resonance energy provided by the breathing orbital valence bond method, we have derived a charge-shift corrected electronegativity scale for H, C, N, O, F, Cl, Li, and Na. Atomic charge shift character is defined using a similar approach resulting in values of 0.42, 1.06, 1.43, 1.62, 1.64, 1.44, 0.46, and 0.34 for H, C, N, O, F, Cl, Li, and Na, respectively. The charge-shift corrected electronegativity values presented herein follow the same general trends as Pauling's original values with the exception of Li having a smaller value than Na (1.57 and 1.91 for Li and Na respectively). The resonance energy is then broken down into components derived from the atomic charge shift character and polarization effects. It is then shown that most of the resonance energy in the charge-shift bonds H-F, H 3 C-F, and Li-CH 3 and borderline charge-shift H-OH is associated with polarity rather than the intrinsic atomic charge-shift character of the bonding species. This suggests a rebranding of these bonds as "polar charge-shift" rather than simply "charge-shift". Lastly, using a similar breakdown method, it is shown that the small effect the substituents -CH 3 , -NH 2 , -OH, and -F have on the resonance energy (<10%) is mostly due to changes in the charge-shift character of the bonding atom.

  9. Estimulação da consciência fonológica na educação infantil: prevenção de dificuldades na escrita

    Directory of Open Access Journals (Sweden)

    Magda Solange Vanzo Pestun

    Full Text Available Consciência fonológica é uma competência metalinguística que possibilita o acesso consciente ao patamar fonológico da fala e a manipulação cognitiva das representações neste nível. Este estudo objetivou verificar se um programa de estimulação dessa habilidade no pré-III favoreceria a aquisição da escrita na 1ª série. Participaram do estudo 85 crianças alunas de escola pública. Procedimento: 1 pré-teste: avaliação do quociente intelectual, da consciência fonológica e da escrita; 2 elaboração do programa de estimulação e classificação das crianças em grupos: experimental (GE e controle (GC, a partir de balanceamento estatístico; 3 aplicação do programa; 4 pós-teste: reavaliação da consciência fonológica e escrita. Os resultados indicaram que os dois grupos evoluíram em todas as variáveis do pré para o pós-teste. Qualitativamente, a evolução foi maior para o GE. Contudo, a diferença entre ambos não foi estatisticamente significante. Hipóteses: número insuficiente de sessões, número grande de crianças por grupo e/ou inexperiência das experimentadoras em práticas pedagógicas.

  10. Adsorption/desorption kinetics of Na atoms on reconstructed Si (111)-7 x 7 surface

    International Nuclear Information System (INIS)

    Chauhan, Amit Kumar Singh; Govind; Shivaprasad, S.M.

    2010-01-01

    Self-assembled nanostructures on a periodic template are fundamentally and technologically important as they put forward the possibility to fabricate and pattern micro/nano-electronics for sensors, ultra high-density memories and nanocatalysts. Alkali-metal (AM) nanostructure grown on a semiconductor surface has received considerable attention because of their simple hydrogen like electronic structure. However, little efforts have been made to understand the fundamental aspects of the growth mechanism of self-assembled nanostructures of AM on semiconductor surfaces. In this paper, we report organized investigation of kinetically controlled room-temperature (RT) adsorption/desorption of sodium (Na) metal atoms on clean reconstructed Si (111)-7 x 7 surface, by X-ray photoelectron spectroscopy (XPS). The RT uptake curve shows a layer-by-layer growth (Frank-vander Merve growth) mode of Na on Si (111)-7 x 7 surfaces and a shift is observed in the binding energy position of Na (1s) spectra. The thermal stability of the Na/Si (111) system was inspected by annealing the system to higher substrate temperatures. Within a temperature range from RT to 350 o C, the temperature induced mobility to the excess Na atoms sitting on top of the bilayer, allowing to arrange themselves. Na atoms desorbed over a wide temperature range of 370 o C, before depleting the Si (111) surface at temperature 720 o C. The acquired valence-band (VB) spectra during Na growth revealed the development of new electronic-states near the Fermi level and desorption leads the termination of these. For Na adsorption up to 2 monolayers, decrease in work function (-1.35 eV) was observed, whereas work function of the system monotonically increases with Na desorption from the Si surface as observed by other studies also. This kinetic and thermodynamic study of Na adsorbed Si (111)-7 x 7 system can be utilized in fabrication of sensors used in night vision devices.

  11. Evaluation of two novel methods for assessing intracellular oxygen

    International Nuclear Information System (INIS)

    Williams, Catrin F; Lloyd, David; Kombrabail, M; Vijayalakshmi, K; Krishnamoorthy, G; White, Nick

    2012-01-01

    The ability to resolve the spatio-temporal complexity of intracellular O 2 distribution is the ‘Holy Grail’ of cellular physiology. In an effort to obtain a non-invasive approach of mapping intracellular O 2 tensions, two methods of phosphorescent lifetime imaging microscopy were examined in the current study. These were picosecond time-resolved epiphosphorescence microscopy (single 0.5 µm focused spot) and two-photon confocal laser scanning microscopy with pinhole shifting. Both methods utilized nanoparticle-embedded Ru complex (45 nm diameter) as the phosphorescent probe, excited using pulsed outputs of Ti–sapphire Tsunami lasers (710–1050 nm). The former method used a 1 ps pulse width excitation beam with vertical polarization via a dichroic mirror (610 nm, XF43) and a 20× objective (NA 0.55, Nikon). Transmitted luminescence (1–2 × 10 4 counts s −1 ) was collected and time-correlated single photon counted decay times measured. Alternatively, an unmodified Zeiss LSM510 Confocal NLO microscope with 40× objective (NA 1.3) used successively shifted pinhole positions to collect image data from the lagging trail of the raster scan. Images obtained from two-photon excitation of a yeast (Schizosaccharomyces pombe) and a flagellate fish parasite (Spironucleus vortens), electroporated with Ru complex, indicated the intracellular location and magnitude of O 2 gradients, thus confirming the feasibility of optical mapping under different external O 2 concentrations. Both methods gave similar lifetimes for Ru complex phosphorescence under aerobic and anaerobic gas phases. Estimation of O 2 tensions within individual fibroblasts (human dermal fibroblast (HDF)) and mammary adenocarcinoma (MCF-7) cells was possible using epiphosphorescence microscopy. MCF-7 cells showed lower intracellular O 2 concentrations than HDF cells, possibly due to higher metabolic rates in the former. Future work should involve construction of higher resolution 3D maps of Ru coordinate

  12. Evaluation of two novel methods for assessing intracellular oxygen

    Science.gov (United States)

    Williams, Catrin F.; Kombrabail, M.; Vijayalakshmi, K.; White, Nick; Krishnamoorthy, G.; Lloyd, David

    2012-08-01

    The ability to resolve the spatio-temporal complexity of intracellular O2 distribution is the ‘Holy Grail’ of cellular physiology. In an effort to obtain a non-invasive approach of mapping intracellular O2 tensions, two methods of phosphorescent lifetime imaging microscopy were examined in the current study. These were picosecond time-resolved epiphosphorescence microscopy (single 0.5 µm focused spot) and two-photon confocal laser scanning microscopy with pinhole shifting. Both methods utilized nanoparticle-embedded Ru complex (45 nm diameter) as the phosphorescent probe, excited using pulsed outputs of Ti-sapphire Tsunami lasers (710-1050 nm). The former method used a 1 ps pulse width excitation beam with vertical polarization via a dichroic mirror (610 nm, XF43) and a 20× objective (NA 0.55, Nikon). Transmitted luminescence (1-2 × 104 counts s-1) was collected and time-correlated single photon counted decay times measured. Alternatively, an unmodified Zeiss LSM510 Confocal NLO microscope with 40× objective (NA 1.3) used successively shifted pinhole positions to collect image data from the lagging trail of the raster scan. Images obtained from two-photon excitation of a yeast (Schizosaccharomyces pombe) and a flagellate fish parasite (Spironucleus vortens), electroporated with Ru complex, indicated the intracellular location and magnitude of O2 gradients, thus confirming the feasibility of optical mapping under different external O2 concentrations. Both methods gave similar lifetimes for Ru complex phosphorescence under aerobic and anaerobic gas phases. Estimation of O2 tensions within individual fibroblasts (human dermal fibroblast (HDF)) and mammary adenocarcinoma (MCF-7) cells was possible using epiphosphorescence microscopy. MCF-7 cells showed lower intracellular O2 concentrations than HDF cells, possibly due to higher metabolic rates in the former. Future work should involve construction of higher resolution 3D maps of Ru coordinate complex lifetime

  13. INFLUÊNCIA DA MARCA E DA EMBALAGEM DE REQUEIJÃO CREMOSO NO COMPORTAMENTO DOS CONSUMIDORES

    Directory of Open Access Journals (Sweden)

    Felipe Furtini Haddad

    2010-12-01

    Full Text Available Foi realizado, inicialmente, um levantamento das pequenas e médias empresas (laticínios localizadas na região do sul de Minas Gerais que produzem requeijão cremoso. Em seguida, os requeijões cremosos, produzidos por estas empresas e que se encontraram disponíveis no mercado da cidade de Lavras - MG (5 marcas: A,B,C,D e E foram adquiridos, os quais foram objetos de estudo nesta pesquisa. Após a aquisição dos produtos, foi realizado um teste de aceitação com 62 consumidores de requeijão cremoso. O teste foi dividido em 3 (três seções: na 1ª seção, os consumidores avaliaram a amostra codificada, sem informação sobre a marca e embalagem do produto (Teste Cego; na 2ª seção, os consumidores avaliaram somente a embalagem dos produtos; finalmente, na 3ª seção, os consumidores avaliaram as amostras, juntamente com suas respectivas embalagens. Foi realizado um teste t para análise dos resultados, verificando uma diferença significativa (p? 0,06 para as amostras B, C, D e E quando julgadas no teste cego e no teste com informação, sendo que a aceitação, quando informada a marca e a embalagem, foi menor em todas as 4 amostras. Isto nos mostra uma influência negativa das marcas e embalagens deste estudo perante o consumidor.

  14. Crosstalk between EGFR and integrin affects invasion and proliferation of gastric cancer cell line, SGC7901

    Directory of Open Access Journals (Sweden)

    Dan L

    2012-10-01

    Full Text Available Li Dan,1,* Ding Jian,2,* Lin Na,1 Wang Xiaozhong,1 1Digestive Department, the Union Hospital of Fujian Medical University, Fujian, People’s Republic of China; 2Digestive Department, the First Affiliated Hospital of Fujian Medical University, Fuzhou, Fujian, People’s Republic of China*These authors contributed equally to this workBackground/objective: To investigate the crosstalk between epidermal growth factor receptor (EGFR and integrin-mediated signal transduction pathways in human gastric adenocarcinoma cells.Methods: EGF was used as a ligand of EGFR to stimulate the gastric adenocarcinoma cell, SGC7901. Signal molecules downstream of the integrin, FAK(Y397 and p130cas(Y410 phosphorylation, were measured by immunoprecipitation and western blot. Fibronectin (Fn was used as a ligand of integrin to stimulate the same cell line. Signal molecules downstream of EGFR and extracellular signal-regulated kinase (ERK general phosphorylation were also measured. Focal adhesion kinase (FAK small-interfering RNA was designed and transfected into SGC7901 cells to decrease the expression of FAK. Modified Boyden chambers and MTT assay were used to examine the effect of FAK inhibition on the invasiveness and proliferation of SGC7901.Results: EGF activated FAK(Y397 and p130cas(Y410 phosphorylation, while Fn activated ERK general phosphorylation. Inhibition of FAK expression decreased p130cas(Y410 phosphorylation activated by EGF and ERK general phosphorylation activated by Fn, also decreased the invasiveness and proliferation of SGC7901 cells activated by EGF or Fn.Conclusion: There is crosstalk between EGFR and integrin signal transduction. FAK may be a key cross point of the two signal pathways and acts as a potential target for human gastric cancer therapy.Keywords: gastric adenocarcinoma, epidermal growth factor receptor, integrin, focal adhesion kinase, crosstalk

  15. Uso de drogas psicotrópicas por estudantes: prevalência e fatores sociais associados

    Directory of Open Access Journals (Sweden)

    Soldera Meire

    2004-01-01

    Full Text Available OBJETIVO: Determinar a prevalência do uso pesado de drogas por estudantes de primeiro e segundo graus em uma amostra de escolas públicas e particulares, e identificar fatores demográficos, psicológicos e socioculturais associados. MÉTODOS: Trata-se de um estudo transversal com uma técnica de amostragem do tipo intencional comparando-se escolas públicas de áreas periféricas e centrais e escolas particulares. Foi utilizado um questionário anônimo de autopreenchimento. A amostra foi constituída por 2.287 estudantes de primeiro e segundo graus da cidade de Campinas, SP, no ano de 1998. Considerou-se uso pesado, o uso de drogas em 20 dias ou mais nos 30 dias que antecederam a pesquisa. Para análise estatística, utilizou-se a análise de regressão logística politômica - modelo logito, visando identificar fatores que influenciem este modo de usar drogas. RESULTADOS: O uso pesado de drogas lícitas e ilícitas foi de: álcool (11,9%, tabaco (11,7%, maconha (4,4%, solventes (1,8%, cocaína (1,4%, medicamentos (1,1%, ecstasy (0,7%. O uso pesado foi maior entre os estudantes da escola pública central, do período noturno, que trabalhavam, pertencentes aos níveis socioeconômicos A e B, e cuja educação religiosa na infância foi pouco intensa. CONCLUSÕES: Maior disponibilidade de dinheiro e padrões específicos de socialização foram identificados como fatores associados ao uso pesado de drogas em estudantes.

  16. Effects of moisture and extrusion temperatures on the oxidative stability of milling oat products with granularity below 532 µm

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Gutkoski

    1998-08-01

    Full Text Available The present research had as objective to study the effects of moisture and extrusion temperatures on the oxidative stability of oat fine (Estudos foram realizados com o objetivo avaliar os efeitos de umidade inicial da matéria-prima e da temperatura de extrusão na estabilidade oxidativa de produtos de aveia (Avena sativa L. Cariopses de aveia foram moídas em moinho de rolos Brabender e obtidas frações de granulometrias superior e inferior a 532 µm. A fração de granulometria inferior a 532 µm, de alto teor de a,mido e baixos teores de proteínas, lipídios e fibra alimentar, foi condicionada na umidade desejada (15,5-25,5% e extrusada em extrusor de laboratório Brabender monorosca. As condições usadas na extrusão foram taxa de compressão de 3:1, rotação de 100 rpm, matriz de 6 mm de diâmetro e temperaturas entre 77,6 e 162,4ºC nas 2ª e 3ª zonas e de 80ºC na 1ª zona. O material extrusado foi seco em estufa, moído, acondicionado em sacos plásticos e utilizado periodicamente nas determinações de peróxidos e de n-hexanal. O conteúdo de ácidos graxos insaturados no óleo da fração de aveia estudada foi elevado (79,20%. Independentemente do teor de umidade inicial da matéria-prima, todos os produtos extrusados em temperaturas inferiores a 120 ºC apresentaram baixa rancidez oxidativa.

  17. Unique atom hyper-kagome order in Na4Ir3O8 and in low-symmetry spinel modifications.

    Science.gov (United States)

    Talanov, V M; Shirokov, V B; Talanov, M V

    2015-05-01

    Group-theoretical and thermodynamic methods of the Landau theory of phase transitions are used to investigate the hyper-kagome atomic order in structures of ordered spinels and a spinel-like Na4Ir3O8 crystal. The formation of an atom hyper-kagome sublattice in Na4Ir3O8 is described theoretically on the basis of the archetype (hypothetical parent structure/phase) concept. The archetype structure of Na4Ir3O8 has a spinel-like structure (space group Fd\\bar 3m) and composition [Na1/2Ir3/2](16d)[Na3/2](16c)O(32e)4. The critical order parameter which induces hypothetical phase transition has been stated. It is shown that the derived structure of Na4Ir3O8 is formed as a result of the displacements of Na, Ir and O atoms, and ordering of Na, Ir and O atoms, ordering dxy, dxz, dyz orbitals as well. Ordering of all atoms takes place according to the type 1:3. Ir and Na atoms form an intriguing atom order: a network of corner-shared Ir triangles called a hyper-kagome lattice. The Ir atoms form nanoclusters which are named decagons. The existence of hyper-kagome lattices in six types of ordered spinel structures is predicted theoretically. The structure mechanisms of the formation of the predicted hyper-kagome atom order in some ordered spinel phases are established. For a number of cases typical diagrams of possible crystal phase states are built in the framework of the Landau theory of phase transitions. Thermodynamical conditions of hyper-kagome order formation are discussed by means of these diagrams. The proposed theory is in accordance with experimental data.

  18. Chemical Characteristics of Rainwater in Sumatera, Indonesia, during 2001–2010

    Directory of Open Access Journals (Sweden)

    Tuti Budiwati

    2016-01-01

    Full Text Available The chemical composition of acid deposition shows that ammonium and chloride concentrations as the indicators of forest fires were higher than sulfate and nitrate in Sumatera areas such as Medan, Lampung, Palembang, and Kototabang. Chloride had higher concentration than sodium (Na+ sea originated with the ratio value of Cl−/Na+ > 1.16 found in Medan and Palembang. Ionic compositions from the lowest to the highest concentration in Kototabang were H+ > Cl− > Na+ > NH4+ > nss-Ca2+ > K+ > NO3- > nss-SO42- > Mg2+ > ss-SO42- > ss-Ca2+. Acid rain takes place if the acid compounds such as sulfates, nitrates, and chlorides dominate. If the ratio value of NO3-/(nss-SO42- + NO3- < 0.5 then it indicates that nss-SO42- is higher than NO3-. Between 2001 and 2010 it was found that the frequency value of NO3-/(nss-SO42- + NO3- < 0.5 was 97% from annual mean of 34 pieces of data in Medan, Kototabang, Lampung, and Palembang. Forest fires influence was more dominant than anthropogenic activities in Kototabang, Palembang and Lampung, except in Medan. It showed that ammonium was higher than NO3- content if the ratio value of NO3-/(NH4+ + NO3- < 0.5 was 62%. For the period 2001–2010 the frequency value of NO3-/(NH4+ + NO3- < 0.5 was 74% from total 34 annual mean pieces of data in four locations, that is, Medan, Kototabang, Palembang, and Lampung.

  19. Elemental compositions of suspended particles released from iron and steel works

    International Nuclear Information System (INIS)

    Mamuro, Tetsuo; Mizohata, Akira; Kubota, Torahide

    1980-01-01

    Suspended particles released from iron and steel works were subjected to multielement analysis by means of instrumental neutron activation method and energy dispersive X-ray fluorescence spectrometry, and their characteristics in elemental composition were examined in detail. Elemental compositions of suspended particles from electric furnaces producing medium steel and special steel were rather similar with each other. The suspended particles from these electric steel furnaces were found to be enriched in the elements listed below. Fe (Geometric mean of measured concentrations: 16%), Zn (5.2%), Ca (4.5%), Cl (3.4%), Mn (2.2%), Na (1.4%), Pb (1.4%), K (1.3%), Al (1.0%), Cu (0.4%), Cr (0.3%), Ni (0.3%) and Ti (0.1%). elemental compositions of suspended particles from cupolas were found to be similar with those of the suspended particles from the electric steel furnaces, but, it was noticed that the cupola particles were condiderably higher in Si concentration (--25%). Suspended particles from heating furnaces for processing various iron and steel products, which are heated by oil combustion, were found to be quite similar in elemental composition with suspended particles released from heavy oil boilers, as was expected, being quite different from the particles from the electric steel furnaces and the cupolas. The electric steel furnace particles were 15 to 180 times more enriched in the elements, Cl, K, Ca, Sc, Cr, Mn, Fe, Zn, Br, Sb and Pb, and one 70th less enriched in the element V than oil boiler particles. The contributions of iron and steel works to aerosols over two big cities, Osaka and Kawasaki, in a particle size range below several micron, were roughly estimated under simple assumptions. High contributions of iron and steel works were found for various elements, being especially large for Cr, Mn, Ni, Zn, Cl, Fe and so on. (J.P.N.)

  20. Epidemiology and Molecular Characterization of Human Respiratory Syncytial Virus in Senegal after Four Consecutive Years of Surveillance, 2012–2015

    Science.gov (United States)

    Cisse, El Hadj Abdel Kader; Kiori, Davy E.; Sarr, Fatoumata Diene; Sy, Sara; Goudiaby, Debora; Richard, Vincent; Niang, Mbayame Ndiaye

    2016-01-01

    Background The burden of respiratory syncytial virus (RSV) infection remains poorly defined in Africa. To address this, we carried out a descriptive and retrospective pilot study, with a focus on the epidemiology of RSV in Senegal after 4 years of surveillance. Methodology and Results From January 2012 to October 2015 swabs were collected from consenting ILI outpatients. Viral detection was performed using RV16 kit enabling direct subtyping of RSV-A and B. For the molecular characterization of HRSV, the second hypervariable region of the Glycoprotein (G) gene was targeted for sequencing. We enrolled 5338 patients with 2803 children younger than five years of age (52.5%). 610 (11.4%) were positive for RSV infection: 276 (45.2%) were group A infections, 334 (54.8%) were group B infections and 21 (3.4%) were A/B co-infections. RSV detection rate is significantly higher (P Senegal clustered with strains that were previously assigned NA1 and novel ON1 genotype sequences. RSV-B sequences from Senegal clustered with the BA9 genotype. At the amino acid level, RSV-A strains from Senegal show proximity with the genotype ON1 characterized by a 72 nt insertion in G, resulting in 24 extra amino acids of which 23 are duplications of aa 261–283. Conclusion Globally our results show a clear circulation pattern of RSV in the second half of each year, between June and September and possibly extending into November, with children under 5 being more susceptible. Molecular studies identified the novel strains ON1 and BA9 as the major genotypes circulating in Senegal between 2012 and 2015. PMID:27315120

  1. Epidemiology and Molecular Characterization of Human Respiratory Syncytial Virus in Senegal after Four Consecutive Years of Surveillance, 2012-2015.

    Science.gov (United States)

    Fall, Amary; Dia, Ndongo; Cisse, El Hadj Abdel Kader; Kiori, Davy E; Sarr, Fatoumata Diene; Sy, Sara; Goudiaby, Debora; Richard, Vincent; Niang, Mbayame Ndiaye

    2016-01-01

    The burden of respiratory syncytial virus (RSV) infection remains poorly defined in Africa. To address this, we carried out a descriptive and retrospective pilot study, with a focus on the epidemiology of RSV in Senegal after 4 years of surveillance. From January 2012 to October 2015 swabs were collected from consenting ILI outpatients. Viral detection was performed using RV16 kit enabling direct subtyping of RSV-A and B. For the molecular characterization of HRSV, the second hypervariable region of the Glycoprotein (G) gene was targeted for sequencing. We enrolled 5338 patients with 2803 children younger than five years of age (52.5%). 610 (11.4%) were positive for RSV infection: 276 (45.2%) were group A infections, 334 (54.8%) were group B infections and 21 (3.4%) were A/B co-infections. RSV detection rate is significantly higher (P Senegal clustered with strains that were previously assigned NA1 and novel ON1 genotype sequences. RSV-B sequences from Senegal clustered with the BA9 genotype. At the amino acid level, RSV-A strains from Senegal show proximity with the genotype ON1 characterized by a 72 nt insertion in G, resulting in 24 extra amino acids of which 23 are duplications of aa 261-283. Globally our results show a clear circulation pattern of RSV in the second half of each year, between June and September and possibly extending into November, with children under 5 being more susceptible. Molecular studies identified the novel strains ON1 and BA9 as the major genotypes circulating in Senegal between 2012 and 2015.

  2. High genetic barrier nucleos(t)ide analogue(s) for prophylaxis from hepatitis B virus recurrence after liver transplantation: a systematic review.

    Science.gov (United States)

    Cholongitas, E; Papatheodoridis, G V

    2013-02-01

    The combination of hepatitis B immunoglobulin (HBIG) and nucleos(t)ide analogues [NA(s)] is considered as the standard of care for prophylaxis against HBV recurrence after liver transplantation (LT), but the optimal protocol is controversial. We evaluated the efficacy of the newer NAs with high genetic barrier (hgbNA) [i.e. entecavir (ETV) or tenofovir (TDF)] with or without HBIG as prophylaxis against HBV recurrence after LT. In total, 519 HBV liver transplant recipients from 17 studies met the inclusion criteria and they were compared to those under lamivudine (LAM) and HBIG who had been selected in our previous review. Patients under HBIG and LAM developed HBV recurrence (115/1889 or 6.1%): (a) significantly more frequently compared to patients under HBIG and a hgbNA [1.0% (3/303), p < 0.001], and (b) numerically but not significantly more frequently compared to the patients who received a newer NA after discontinuation of HBIG [3.9% (4/102), p = 0.52]. The use of a hgbNA without any HBIG offered similar antiviral prophylaxis compared to HBIG and LAM combination, if the definition of HBV recurrence was based on HBV DNA detectability [0.9% vs. 3.8%, p = 0.11]. Our findings favor the use of HBIG and a hgbNA instead of HBIG and LAM combined prophylaxis against HBV recurrence after LT. © Copyright 2012 The American Society of Transplantation and the American Society of Transplant Surgeons.

  3. Estado atual da leishmaniose cutânea difusa (LCD no Estado do Maranhão: II. aspectos epidemiológicos, clínico-evolutivos

    Directory of Open Access Journals (Sweden)

    Jackson Maurício Lopes Costa

    1992-06-01

    Full Text Available Os Autores fazem um estudo retrospectivo e prospectivo de 6 pacientes portadores de leishmaniose cutânea difusa, observados no Estado do Maranhão a partir de 1974. Os casos abordados são oriundos de diversas regiões do estado, observando-se em todos eles o envolvimento da leishmania (Leishmania amazonensis, sendo que 5 (84% dos pacientes apresentaram início de doença na 1ª década de vida. Em todos os pacientes envolvidos no estudo, houve relato de lesão inicial nodular única, que, posteriormente, em período variável de tempo, disseminou-se adquirindo outros aspectos. Evolutivamente apresentaram múltiplas lesões nodulares e ulceradas, intradermorreação de Montenegro(- e refratariedade aos esquemas terapêuticos utilizados até ao presente momento.The authors describe a retrospective and prospective study of 6 patients with diffuse cutaneous leishmaniasis observed in the State of Maranhão, since 1974. The patients comefromdifferentruralregions of the state and in all of them Leishmania (Leishmania amazonensis was the cause five of the patients initiated their disease in the first decade of life. All the patients first had a solitary, nodular lesion, that after a variable period of time, disseminated and acquired other aspects. Sequentially the patients presented multiple nodular and ulcerative lesions, negative leishmania skin-lests and a refractory response to the therapeutic schedules used up to the present.

  4. The calcium fluoride effect on properties of cryolite melts feasible for low-temperature production of aluminum and its alloys

    Science.gov (United States)

    Tkacheva, O.; Dedyukhin, A.; Redkin, A.; Zaikov, Yu.

    2017-07-01

    The CaF2 effect on the liquidus temperature, electrical conductivity and alumina solubility in the potassium-sodium and potassium-lithium cryolite melts with cryolite ratio (CR = (nKF+nMF)/nAlF3, M = Li, Na) 1.3 was studied. The liquidus temperature in the quisi-binary system [KF-LiF-AlF3]-CaF2 changes with the same manner as in the [KF-NaF-AlF3]-CaF2. The electrical conductivity in the KF-NaF-AlF3-CaF2 melt decreases with increasing the CaF2 content, but it slightly raises with the first small addition of CaF2 into the KF-LiF-AlF3-CaF2 melts, enriched with KF, which was explained by the increased K+ ions mobility due to their relatively low ionic potential. The contribution of the Li+ cations in conductivity of the KF-LiF-AlF3-CaF2 electrolyte is not noteworthy. The Al2O3 solubility in the KF-NaF-AlF3 electrolyte rises with the increasing KF content, but the opposite tendency is observed in the cryolite mixtures containing CaF2. The insoluble compounds - KCaAl2F9 or KCaF3 - formed in the molten mixtures containing potassium and calcium ions endorse the increase of the liquidus temperature. The calcium fluoride effect on the side ledge formation in the electrolytic cell during low-temperature aluminum electrolysis is discussed.

  5. Study of the distribution of ions and metals in blood using nuclear methodology; Estudo da distribuicao de ions e metais em sangue via metodologia nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Oliveira, Laura Cristina de

    2008-07-01

    The present study consists of using nuclear tools aiming to establish an alternative procedure to perform biochemistry analyses in whole blood to help the diagnosis of diverse pathologies. The aim is to determine the ions and metals concentrations in whole blood of human beings (specifically: Br, Cl, K e Na), using neutron activation analysis, providing the limits of normality, as well as, the matrix of the correlation for these elements. To perform this study, 283 samples of whole blood had been analyzed (of healthy volunteers selected from blood banks), resulting in the limits of normality for Br (0.0067 - 0.0263 gl{sup -1}), Cl (2.54 - 3.50 gl{sup -1}), K (1.33 - 1.89 gl{sup -1}) and Na (1.48 - 2.06 gl{sup -1}). These data are the first estimates for reference values in whole blood of the Brazilian population. These limits were evaluated in function of the sex and age for checking the biological differences. The behavior of these limits was also evaluated for different populations, i.e., in two distinct regions: Southeast (blood collection carried out in Sao Paulo city) and Northeast (blood collection carried out in Recife city). These places were chosen in function of the similarities (cities with high concentration people and industrialized). Furthermore, a systematic study of these limits was also evaluated, in the period of 4 (four) years, in Sao Paulo city. This analysis was elaborated in function of time due the necessity to update these data, therefore they act as environment monitors. The estimation for Ca and Fe were also proposal for a set of 22 samples of whole blood.(author)

  6. Plasma rico em plaquetas e fatores de crescimento: técnica de preparo e utilização em cirurgia plástica

    Directory of Open Access Journals (Sweden)

    Fabiel Spani Vendramin

    Full Text Available OBJETIVO: Estabelecer um método barato e eficiente de preparação do plasma rico em plaquetas e fatores de crescimento para utilização em cirurgia plástica. MÉTODO: Foram realizados 20 testes através de centrifugação de sangue, variando-se a força e o tempo de centrifugação, para determinarmos o melhor método que proporcione uma maior concentração plaquetária e mais 10 testes para comprovar a reprodutibilidade do método. RESULTADOS: A utilização de uma força de centrifugação de 300 g por 10 minutos na 1ª. centrifugação e de 640 g por 10 minutos na 2ª. centrifugação obtiveram as maiores concentrações plaquetárias, superiores a 4,5 vezes a concentração na amostra, e os testes foram reprodutíveis. CONCLUSÕES: Uma alta concentração plaquetária pode ser obtida por este protocolo de obtenção de plasma rico em plaquetas e fatores de crescimento e a formação do gel é possível através da utilização de trombina autóloga, também obtida pelo protocolo descrito, facilitando sua utilização em cirurgia plástica, onde vem mostrando bons resultados na cicatrização de feridas e na integração de enxertos ósseos e cutâneos.

  7. Study of the distribution of ions and metals in blood using nuclear methodology

    International Nuclear Information System (INIS)

    Oliveira, Laura Cristina de

    2008-01-01

    The present study consists of using nuclear tools aiming to establish an alternative procedure to perform biochemistry analyses in whole blood to help the diagnosis of diverse pathologies. The aim is to determine the ions and metals concentrations in whole blood of human beings (specifically: Br, Cl, K e Na), using neutron activation analysis, providing the limits of normality, as well as, the matrix of the correlation for these elements. To perform this study, 283 samples of whole blood had been analyzed (of healthy volunteers selected from blood banks), resulting in the limits of normality for Br (0.0067 - 0.0263 gl -1 ), Cl (2.54 - 3.50 gl -1 ), K (1.33 - 1.89 gl -1 ) and Na (1.48 - 2.06 gl -1 ). These data are the first estimates for reference values in whole blood of the Brazilian population. These limits were evaluated in function of the sex and age for checking the biological differences. The behavior of these limits was also evaluated for different populations, i.e., in two distinct regions: Southeast (blood collection carried out in Sao Paulo city) and Northeast (blood collection carried out in Recife city). These places were chosen in function of the similarities (cities with high concentration people and industrialized). Furthermore, a systematic study of these limits was also evaluated, in the period of 4 (four) years, in Sao Paulo city. This analysis was elaborated in function of time due the necessity to update these data, therefore they act as environment monitors. The estimation for Ca and Fe were also proposal for a set of 22 samples of whole blood.(author)

  8. Effects of Heat Acclimation on Photosynthesis, Antioxidant Enzyme Activities, and Gene Expression in Orchardgrass under Heat Stress

    Directory of Open Access Journals (Sweden)

    Xin Xin Zhao

    2014-09-01

    Full Text Available The present study was designed to examine the effects of heat acclimation on enzymatic activity, transcription levels, the photosynthesis processes associated with thermostability in orchardgrass (Dactylis glomerata L..The stomatal conductance (Gs, net photosynthetic rate (Pn, and transpiration rates (Tr of both heat-acclimated (HA and non-acclimated (NA plants were drastically reduced during heat treatment [using a 5-day heat stress treatment (38/30 °C ‒ day/night followed by a 3-day recovery under control conditions (25/20 °C ‒ day/night, in order to consolidate the second cycle was permitted]. Water use efficiency increased more steeply in the HA (4.9 times versus the NA (1.8 times plants, and the intercellular CO2 concentration decreased gently in NA (10.9% and HA (25.3% plants after 20 d of treatments compared to 0 days’. Furthermore, heat-acclimated plants were able to maintain significant activity levels of superoxide disumutase (SOD, catalase (CAT, guaiacol peroxidase (POD, and transcription levels of genes encoding these enzymes; in addition, HA plants displayed lower malondialdehyde content and lower electrolyte leakage than NA plants. These results suggest that maintenance of activity and transcription levels of antioxidant enzymes as well as photosynthesis are associated with variable thermostability in HA and NA plants. This likely occurs through cellular membrane stabilization and improvements in water use efficiency in the photosynthetic process during heat stress. The association between antioxidant enzyme activity and gene expression, both of which may vary with genetic variation in heat tolerance, is important to further understand the molecular mechanisms that contribute to heat tolerance.

  9. Na+ -K+ -2Cl- Cotransporter (NKCC) Physiological Function in Nonpolarized Cells and Transporting Epithelia.

    Science.gov (United States)

    Delpire, Eric; Gagnon, Kenneth B

    2018-03-25

    Two genes encode the Na + -K + -2Cl - cotransporters, NKCC1 and NKCC2, that mediate the tightly coupled movement of 1Na + , 1K + , and 2Cl - across the plasma membrane of cells. Na + -K + -2Cl - cotransport is driven by the chemical gradient of the three ionic species across the membrane, two of them maintained by the action of the Na + /K + pump. In many cells, NKCC1 accumulates Cl - above its electrochemical potential equilibrium, thereby facilitating Cl - channel-mediated membrane depolarization. In smooth muscle cells, this depolarization facilitates the opening of voltage-sensitive Ca 2+ channels, leading to Ca 2+ influx, and cell contraction. In immature neurons, the depolarization due to a GABA-mediated Cl - conductance produces an excitatory rather than inhibitory response. In many cell types that have lost water, NKCC is activated to help the cells recover their volume. This is specially the case if the cells have also lost Cl - . In combination with the Na + /K + pump, the NKCC's move ions across various specialized epithelia. NKCC1 is involved in Cl - -driven fluid secretion in many exocrine glands, such as sweat, lacrimal, salivary, stomach, pancreas, and intestine. NKCC1 is also involved in K + -driven fluid secretion in inner ear, and possibly in Na + -driven fluid secretion in choroid plexus. In the thick ascending limb of Henle, NKCC2 activity in combination with the Na + /K + pump participates in reabsorbing 30% of the glomerular-filtered Na + . Overall, many critical physiological functions are maintained by the activity of the two Na + -K + -2Cl - cotransporters. In this overview article, we focus on the functional roles of the cotransporters in nonpolarized cells and in epithelia. © 2018 American Physiological Society. Compr Physiol 8:871-901, 2018. Copyright © 2018 American Physiological Society. All rights reserved.

  10. Substrate specificity of the electrogenic sodium/bicarbonate cotransporter NBCe1-A (SLC4A4, variant A) from humans and rabbits.

    Science.gov (United States)

    Lee, Seong-Ki; Boron, Walter F; Parker, Mark D

    2013-04-01

    In the basolateral membrane of proximal-tubule cells, NBCe1-A (SLC4A4, variant A), operating with an apparent Na(+):HCO(3)(-) stoichiometry of 1:3, contributes to the reclamation of HCO(3)(-) from the glomerular filtrate, thereby preventing whole body acidosis. Others have reported that NBCe1-like activity in human, rabbit, and rat renal preparations is substantially influenced by lithium, sulfite, oxalate, and harmaline. These data were taken as evidence for the presence of distinct Na(+) and CO(3)(2-) binding sites in NBCe1-A, favoring a model of 1 Na(+):1 HCO(3)(-):1 CO(3)(2-). Here, we reexamine these findings by expressing human or rabbit NBCe1-A clones in Xenopus oocytes. In oocytes, NBCe1-A exhibits a 1:2 stoichiometry and could operate in one of five thermodynamically equivalent transport modes: 1) cotransport of Na(+) + 2 HCO(3)(-), 2) cotransport of Na(+) + CO(3)(2-), 3) transport of NaCO(3)(-), 4) exchange of Na(+) + HCO(3)(-) for H(+), or 5) HCO(3)(-)-activated exchange of Na(+) for 2 H(+). In contrast to the behavior of NBCe1-like activity in renal preparations, we find that cloned NBCe1-A is only slightly stimulated by Li(+), not at all influenced by sulfite or oxalate, and only weakly inhibited by harmaline. These negative data do not uniquely support any of the five models above. In addition, we find that NBCe1-A mediates a small amount of Na(+)-independent NO(3)(-) transport and that NBCe1-A is somewhat inhibited by extracellular benzamil. We suggest that the features of NBCe1-like activity in renal preparations are influenced by yet-to-be-identified renal factors. Thus the actual ionic substrates of NBCe1 remain to be identified.

  11. The red mud accident in ajka (hungary): plant toxicity and trace metal bioavailability in red mud contaminated soil.

    Science.gov (United States)

    Ruyters, Stefan; Mertens, Jelle; Vassilieva, Elvira; Dehandschutter, Boris; Poffijn, André; Smolders, Erik

    2011-02-15

    The red mud accident of October 4, 2010, in Ajka (Hungary) contaminated a vast area with caustic, saline red mud (pH 12) that contains several toxic trace metals above soil limits. Red mud was characterized and its toxicity for plants was measured to evaluate the soil contamination risks. Red mud radioactivity (e.g., (238)U) is about 10-fold above soil background and previous assessments revealed that radiation risk is limited to indoor radon. The plant toxicity and trace metal availability was tested with mixtures of this red mud and a local noncontaminated soil up to a 16% dry weight fraction. Increasing red mud applications increased soil pH to maximally 8.3 and soil solution EC to 12 dS m(-1). Shoot yield of barley seedlings was affected by 25% at 5% red mud in soil and above. Red mud increased shoot Cu, Cr, Fe, and Ni concentrations; however, none of these exceed toxic limits reported elsewhere. Moreover, NaOH amended reference treatments showed similar yield reductions and similar changes in shoot composition. Foliar diagnostics suggest that Na (>1% in affected plants) is the prime cause of growth effects in red mud and in corresponding NaOH amended soils. Shoot Cd and Pb concentrations decreased by increasing applications or were unaffected. Leaching amended soils (3 pore volumes) did not completely remove the Na injury, likely because soil structure was deteriorated. The foliar composition and the NaOH reference experiment allow concluding that the Na salinity, not the trace metal contamination, is the main concern for this red mud in soil.

  12. Reference values in blood elements in crioula breed horses by nuclear methodology; Valores de referencia de elementos em sangue de cavalos da raca crioula via metodologia nuclear

    Energy Technology Data Exchange (ETDEWEB)

    Baptista, Tatyana Spinosa

    2010-07-01

    In this study the reference value for Br (0,0008 - 0,0056 gL{sup -1}), Ca (0,089 - 0,369 gL{sup -1}), Cl (2,10 - 3,26 gL{sup -1}), Fe (0,381 - 0,689 gL{sup -1}), I (0,00018 - 0,00266 gL{sup -1}), K (1,14 - 2,74 gL{sup -1}), Mg (0,030 - 0,074 gL{sup -1}), Na (1,36 - 2,80 gL{sup -1}), P (<1,99 gL{sup -1}), S (0,99 - 2,79 gL{sup -1}) and Zn (0,0012 - 0,0048 gL{sup -1}) as well as the correlation matrix in blood of Crioulo breed horses were determined using nuclear methodology (Neutron Activation Analysis Technique). These data allowed to identifying physiological alterations related to the sex and regime of exercise (hyperimmune sera production at Butantan Institute, Sao Paulo, Brasil). To perform these analyses was used 20 adult horses (8 males and 12 females), with average mass 350 kg, without clinical signs of disease, 1-3 years old, kept on pasture in Sao Joaquim Farm at Butantan Institute (Sao Paulo city). Other group just immunized, composed by 6 equines males (same age and weight), were also analyzed. These data are an important support to understand the physiological functions of these elements in blood during the process of sera production. (author)

  13. FCGR2A single nucleotide polymorphism confers susceptibility to childhood-onset idiopathic nephrotic syndrome.

    Science.gov (United States)

    Rossi, Giovanni M; Bonatti, Francesco; Adorni, Alessia; Alberici, Federico; Bodria, Monica; Bonanni, Alice; Ghiggeri, Gian M; Martorana, Davide; Vaglio, Augusto

    2018-01-01

    Childhood-onset idiopathic nephrotic syndrome affects 1.15-3.4 children/100,000 children/year in Western Countries. Immune-mediated mechanisms, particularly T cell-mediated, are thought to play a key pathogenic role. The genetic basis of the disease is still poorly understood. We tested the association between single nucleotide polymorphisms (SNPs) of four genes encoding Fc gamma receptors (FCGR2A, FCGR2B, FCGR3A, FCGR3B) and idiopathic nephrotic syndrome in a case-control study of paediatric patients. Children with idiopathic nephrotic syndrome (aged 1-16 years) were included. FCGR2A rs1801274 and FCGR3A rs396991 SNPs were genotyped using real-time PCR with the TaqMan method, while FCGR2B rs1050501 and FCGR3B NA1/NA2 were genotyped using Sanger sequencing. Fisher's exact test was used to explore genetic association. We enrolled 103 idiopathic nephrotic syndrome patients and 181 healthy controls. A significant association was found between idiopathic nephrotic syndrome and FCGR2A rs1801274 SNP (both with the T allele and the TT genotype, p value=0.0009, OR 1.81, 95% CI 1.27-2.59 and p value=0.0007, OR 2.39, 95% CI 1.44-3.99, respectively). No associations were found for the remaining SNPs. Fc gamma receptors might modulate response to rituximab; since 60 of the enrolled patients were treated with rituximab, we also tested the association between the studied SNPs and rituximab efficacy in this patient subgroup, but found only a weak association with FCGR2A CC genotype (p value=0.03). The FCGR2A rs1801274 SNP in the gene encoding the activating receptor CD32A confers susceptibility to idiopathic nephrotic syndrome. Copyright © 2017 European Federation of Immunological Societies. Published by Elsevier B.V. All rights reserved.

  14. Concurrent aggregation and transport of graphene oxide in saturated porous media: Roles of temperature, cation type, and electrolyte concentration.

    Science.gov (United States)

    Wang, Mei; Gao, Bin; Tang, Deshan; Yu, Congrong

    2018-01-02

    Simultaneous aggregation and retention of nanoparticles can occur during their transport in porous media. In this work, the concurrent aggregation and transport of GO in saturated porous media were investigated under the conditions of different combinations of temperature, cation type (valence), and electrolyte concentration. Increasing temperature (6-24 °C) at a relatively high electrolyte concentration (i.e., 50 mM for Na + , 1 mM for Ca 2+ , 1.75 mM for Mg 2+ , and 0.03 and 0.05 mM for Al 3+ ) resulted in enhanced GO retention in the porous media. For instance, when the temperature increased from 6 to 24 °C, GO recovery rate decreased from 31.08% to 6.53% for 0.03 mM Al 3+ and from 27.11% to 0 for 0.05 mM Al 3+ . At the same temperature, increasing cation valence and electrolyte concentration also promoted GO retention. Although GO aggregation occurred in the electrolytes during the transport, the deposition mechanisms of GO retention in the media depended on cation type (valence). For 50 mM Na + , surface deposition via secondary minima was the dominant GO retention mechanism. For multivalent cation electrolytes, GO aggregation was rapid and thus other mechanisms such as physical straining and sedimentation also played important roles in controlling GO retention in the media. After passing through the columns, the GO particles in the effluents showed better stability with lower initial aggregation rates. This was probably because less stable GO particles with lower surface charge densities in the porewater were filtered by the porous media, resulting in more stable GO particle with higher surface charge densities in the effluents. An advection-dispersion-reaction model was applied to simulate GO breakthrough curves and the simulations matched all the experimental data well. Copyright © 2017 Elsevier Ltd. All rights reserved.

  15. Assessment of dose in cervical vertebrae radiographic examinations

    International Nuclear Information System (INIS)

    Owrnasir, Wafa Fadol Orsud

    2014-12-01

    Reference dose levels provide a framework to reduce doses variability and aid in the optimization of radiation protection.This study was performed in Khartoum Teaching Hospital in period of January to June 2014. This study performed to assess the entrance surface dose ( ESD) received in Cervical Vertebrae radiographic examination and to analyze effective dose distributions among radiological departments under study. The study was performed in Khartoum Teaching Hospital, covering two x-ray units and a sample of 64 patients. The following parameter were recorded; age, weight, height, body mass index (BMI) derived from weight (kg) and height (m) and exposure factors. The dose was measured for Cervical Vertebrae x-ray examinations, the entrance surface dose (ESD) values were estimated from the x-ray tube output parameters for Cervical Vertebrae AP and lateral examinations. The ESD values were then calculated using IAEA calculation methods. The results of ESD values calculated showed than patient exposure were within the normal range of exposure. The mean ED values calculated were ( 3.85 ±0.04) and (4.02 ±0.05) mGy for Cervical Vertebrae AP and lateral examinations, respectively in department Na1 and (3.99± 0.15) and (4.23± 0.34) mGy, for Cervical Vertebrae Ap and lateral examinations respectively in department Na2, the IAEA standard value of ESD for cervical equal (7), (20) mGy AP and LAT, Further studies are recommended with more number of patients and using more than two modalities for comparison. (Author)

  16. Thermal Emission of Alkali Metal Ions from Al30-Pillared Montmorillonite Studied by Mass Spectrometric Method.

    Science.gov (United States)

    Motalov, V B; Karasev, N S; Ovchinnikov, N L; Butman, M F

    2017-01-01

    The thermal emission of alkali metal ions from Al 30 -pillared montmorillonite in comparison with its natural form was studied by mass spectrometry in the temperature range 770-930 K. The measurements were carried out on a magnetic mass spectrometer MI-1201. For natural montmorillonite, the densities of the emission currents ( j ) decrease in the mass spectrum in the following sequence (T = 805 K, A/cm 2 ): K + (4.55 · 10 -14 ), Cs + (9.72 · 10 -15 ), Rb + (1.13 · 10 -15 ), Na + (1.75 · 10 -16 ), Li + (3.37 · 10 -17 ). For Al 30 -pillared montmorillonite, thermionic emission undergoes temperature-time changes. In the low-temperature section of the investigated range (770-805 K), the value of j increases substantially for all ions in comparison with natural montmorillonite (T = 805 K, A/cm 2 ): Cs + (6.47 · 10 -13 ), K + (9.44 · 10 -14 ), Na + (3.34 · 10 -15 ), Rb + (1.77 · 10 -15 ), and Li + (4.59 · 10 -16 ). A reversible anomaly is observed in the temperature range 805-832 K: with increasing temperature, the value of j of alkaline ions falls abruptly. This effect increases with increasing ionic radius of M + . After a long heating-up period, this anomaly disappears and the ln j - 1/ T dependence acquires a classical linear form. The results are interpreted from the point of view of the dependence of the efficiency of thermionic emission on the phase transformations of pillars.

  17. Thermal Emission of Alkali Metal Ions from Al30-Pillared Montmorillonite Studied by Mass Spectrometric Method

    Directory of Open Access Journals (Sweden)

    V. B. Motalov

    2017-01-01

    Full Text Available The thermal emission of alkali metal ions from Al30-pillared montmorillonite in comparison with its natural form was studied by mass spectrometry in the temperature range 770–930 K. The measurements were carried out on a magnetic mass spectrometer MI-1201. For natural montmorillonite, the densities of the emission currents (j decrease in the mass spectrum in the following sequence (T = 805 K, A/cm2: K+ (4.55 · 10−14, Cs+ (9.72 · 10−15, Rb+ (1.13 · 10−15, Na+ (1.75 · 10−16, Li+ (3.37 · 10−17. For Al30-pillared montmorillonite, thermionic emission undergoes temperature-time changes. In the low-temperature section of the investigated range (770–805 K, the value of j increases substantially for all ions in comparison with natural montmorillonite (T = 805 K, A/cm2: Cs+ (6.47 · 10−13, K+ (9.44 · 10−14, Na+ (3.34 · 10−15, Rb+ (1.77 · 10−15, and Li+ (4.59 · 10−16. A reversible anomaly is observed in the temperature range 805–832 K: with increasing temperature, the value of j of alkaline ions falls abruptly. This effect increases with increasing ionic radius of M+. After a long heating-up period, this anomaly disappears and the lnj-1/T dependence acquires a classical linear form. The results are interpreted from the point of view of the dependence of the efficiency of thermionic emission on the phase transformations of pillars.

  18. Monitoring of heavy metals in marine and freshwater fishes and nutritional evaluation of fish consumption

    International Nuclear Information System (INIS)

    Rina Mulyaningsih

    2014-01-01

    Fish is a food source of minerals. Uptake of heavy metals in fish could come from water, sediment and fish feed. Monitoring of minerals content and contaminants in fish has been carried out to evaluate nutrition and food safety, using neutron activation analysis techniques. Marine fish species that being analyzed are Kembung (Rastrelliger faughni), mackerel (Acanthocybium solandri), Tuna (Authis thazard) and freshwater fishes are Bawal (Colossoma macropomum), Nila (Oreochromis niloticus), Mas (Cyprinus carpio), sampled from 6 markets in North Jakarta. Monitoring results indicate that the essential minerals contained in fish are Fe, K, Na, Zn, Ca, Mg, and Se. Se and Ca concentrations in marine fish are higher than in freshwater fish. The concentration of other essential elements varies depending on the type of fish. The concentration of arsenic in marine fish is 3 times higher than that of freshwater fish; Hg and Cr content in all fish species were observed. From the evaluation of the adequacy of nutrition, with assuming a consumption of 86.68 g fish/day, for men aged 19 - 30 years, and referring to data from the Institute of Medicine USA, the Ca intake : 2.5 - 6.3; Cl : 1.5 - 3.3; Fe : 11.5 - 26.9; Na : 1.5 - 4.1; K : 3.4 - 6.7 and Zn 3.9 - 7.2% of the recommended value. Cr intake exceeds the recommended value, while As and Hg is not recommended in the food. In fact these metals contained in the studied fish, but the concentration is still below the value of standards issued by BPOM. (author)

  19. Novel sulfonated poly(ether ether ketone ketone)s for direct methanol fuel cells usage: Synthesis, water uptake, methanol diffusion coefficient and proton conductivity

    Science.gov (United States)

    Zhang, Gang; Fu, Tiezhu; Shao, Ke; Li, Xianfeng; Zhao, Chengji; Na, Hui; Zhang, Hong

    A novel series of sulfonated poly(ether ether ketone ketone)s (SPEEKKs) with different degrees of sulfonation (Ds) were synthesized from 1,3-bis(3-sodium sulfonate-4-fluorobenzoyl)benzene (1,3-SFBB-Na), 1,3-bis(4-fluorobenzoyl)benzene (1,3-FBB) and 3,3‧,5,5‧-tetramethyl-4,4‧-biphenol (TMBP) by aromatic nucleophilic polycondensation. The chemical structures of SPEEKKs were confirmed by FT-IR spectroscopy and the Ds values of the polymers were calculated by 1H NMR and titration methods, respectively. The thermal stabilities of the SPEEKKs in acid and sodium forms were characterized by thermogravimetric analysis (TGA), which showed that SPEEKKs had excellent thermal properties at high temperatures. All the SPEEKK polymers were easily solution cast into tough membranes. Water uptakes, proton conductivities and methanol diffusion coefficients of the SPEEKK membranes were measured. Water uptake increased with Ds and temperature. Compared to Nafion, the SPEEKK-60, -70 and -80 membranes showed higher proton conductivities at 80 °C, while the other SPEEKK membranes showed relatively lower proton conductivities. This may be due to the different distribution of ion-conducting domains in membrane. However, these membranes showed lower methanol diffusions in the range of 8.32 × 10 -9 to 1.14 × 10 -7 cm 2 s -1 compared with that of Nafion (2 × 10 -6 cm 2 s -1) at the same temperature. The membranes also showed excellent mechanical properties (with a Young's modulus > 1 GPa and a tensile strength > 40 MPa). These results indicate that the SPEEKK membranes are promising materials for use in direct methanol fuel cell (DMFC) applications.

  20. Hardening of electromechanical properties in piezoceramics using a composite approach

    Science.gov (United States)

    K. V., Lalitha; Riemer, Lukas M.; Koruza, Jurij; Rödel, Jürgen

    2017-07-01

    Piezoelectric applications such as ultrasonic motors, transformers and therapeutic ultrasonics demand high power generation with low losses, which is facilitated by "hard" ferroelectrics. Hardening of piezoelectric properties, characterized by high mechanical quality factor (Qm), is usually achieved by doping with lower valence elements, thereby tailoring the domain wall dynamics. In the present study, we demonstrate a hardening mechanism by developing composites of 0.94(Na1/2Bi1/2)TiO3-0.06BaTiO3 (NBT-6BT) with ZnO inclusions, as an alternative to chemical modifications. A decrease in the saturation polarization and total strain, higher internal bias fields, lower hysteretic losses and a two-fold increase in Qm are observed in comparison to NBT-6BT. The composite with 0.1 mole ratio of ZnO exhibits the highest Qm of 320 with d33 = 125 pC/N and Kp = 0.29. A one-to-one correspondence between the increase in Qm and the decrease in the domain wall mobility is established from the ac field dependence of permittivity, in the framework of the Rayleigh law. A further increase in ZnO content beyond a mole ratio of 0.1 reduces Qm, but retains it at a higher level, as compared to NBT-6BT. The results are explained based on the poling-induced strain incompatibility between the matrix and the hard ZnO phase. This composite approach is therefore considered a generic hardening concept and can be extended to other ferroelectric systems.

  1. MAR flow mapping of Analytical Chemistry Operations (Preliminary Report)

    International Nuclear Information System (INIS)

    Barr, Mary E.; Farish, Thomas J.

    2012-01-01

    The recently released Supplemental Directive, NA-1 SD 1027, updates the radionuclide threshold values in DOE-STD-1027-92 CN1 to reflect the use of modern parameters for dose conversion factors and breathing rates. The directive also corrects several arithmetic errors within the original standard. The result is a roughly four-fold increase in the amount of weapons-grade nuclear material allowed within a designated radiological facility. Radiological laboratory space within the recently constructed Radiological Laboratory Office and Utility Building (RLUOB) is slated to house selected analytical chemistry support activities in addition to small-scale actinide R and D activities. RLUOB is within the same facility operations envelope as TA-55. Consolidation of analytical chemistry activities to RLUOB and PF-4 offers operational efficiency improvements relative to the current pre-CMRR plans of dividing these activities between RLUOB, PF-4, and CMR. RLUOB is considered a Radiological Facility under STD-1027 - 'Facilities that do not meet or exceed Category 3 threshold criteria but still possess some amount of radioactive material may be considered Radiological Facilities.' The supplemental directive essentially increases the allowable material-at-risk (MAR) within radiological facilities from 8.4 g to 38.6 g for 239 Pu. This increase in allowable MAR provides a unique opportunity to establish additional analytical chemistry support functions in RLUOB without negatively impacting either R and D activities or facility operations. Individual radiological facilities are tasked to determine MAR limits (up to the Category 3 thresholds) appropriate to their operational conditions. This study presents parameters that impact establishing MAR limits for RLUOB and an assessment of how various analytical chemistry support functions could operate within the established MAR limits.

  2. Synthesis, structural and spectroscopic properties of acentric triple molybdate Cs2NaBi(MoO4)3

    International Nuclear Information System (INIS)

    Savina, A.A.; Atuchin, V.V.; Solodovnikov, S.F.; Solodovnikova, Z.A.; Krylov, A.S.; Maximovskiy, E.A.; Molokeev, M.S.; Oreshonkov, A.S; Pugachev, A.M.

    2015-01-01

    New ternary molybdate Cs 2 NaBi(MoO 4 ) 3 is synthesized in the system Na 2 MoO 4 –Cs 2 MoO 4 –Bi 2 (MoO 4 ) 3 . The structure of Cs 2 NaBi(MoO 4 ) 3 of a new type is determined in noncentrosymmetric space group R3c, a=10.6435(2), c=40.9524(7) Å, V=4017.71(13) Å 3 , Z=12 in anisotropic approximation for all atoms taking into account racemic twinning. The structure is completely ordered, Mo atoms are tetrahedrally coordinated, Bi(1) and Bi(2) atoms are in octahedra, and Na(1) and Na(2) atoms have a distorted trigonal prismatic coordination. The Cs(1) and Cs(2) atoms are in the framework cavities with coordination numbers 12 and 10, respectively. No phase transitions were found in Cs 2 NaBi(MoO 4 ) 3 up to the melting point at 826 K. The compound shows an SHG signal, I 2w /I 2w (SiO 2 )=5 estimated by the powder method. The vibrational properties are evaluated by Raman spectroscopy, and 26 narrow lines are measured. - Graphical abstract: - Highlights: • The crystal structure of Cs 2 NaBi(MoO 4 ) 3 is defined. • The molybdate Cs 2 NaBi(MoO 4 ) 3 is stable up to melting point at 826 K. • Vibrational properties of Cs 2 NaBi(MoO 4 ) 3 are evaluated by Raman spectroscopy

  3. Novel sulfonated poly(ether ether ketone ketone)s for direct methanol fuel cells usage: Synthesis, water uptake, methanol diffusion coefficient and proton conductivity

    Energy Technology Data Exchange (ETDEWEB)

    Zhang, Gang; Fu, Tiezhu; Shao, Ke; Zhao, Chengji; Na, Hui [Alan G. MacDiarmid Institute, College of Chemistry, Jilin University, Changchun 130012 (China); Li, Xianfeng [Centre for Surface Chemistry and Catalysis, Faculty of Bioengineering Sciences, Katholieke Universiteit Leuven Kasteelpark Arenberg 23, 3001 Leuven (Belgium); Zhang, Hong [Department of Chemistry, Northeast Normal University, Changchun 130024 (China)

    2009-04-15

    A novel series of sulfonated poly(ether ether ketone ketone)s (SPEEKKs) with different degrees of sulfonation (Ds) were synthesized from 1,3-bis(3-sodium sulfonate-4-fluorobenzoyl)benzene (1,3-SFBB-Na), 1,3-bis(4-fluorobenzoyl)benzene (1,3-FBB) and 3,3',5,5'-tetramethyl-4,4'-biphenol (TMBP) by aromatic nucleophilic polycondensation. The chemical structures of SPEEKKs were confirmed by FT-IR spectroscopy and the Ds values of the polymers were calculated by {sup 1}H NMR and titration methods, respectively. The thermal stabilities of the SPEEKKs in acid and sodium forms were characterized by thermogravimetric analysis (TGA), which showed that SPEEKKs had excellent thermal properties at high temperatures. All the SPEEKK polymers were easily solution cast into tough membranes. Water uptakes, proton conductivities and methanol diffusion coefficients of the SPEEKK membranes were measured. Water uptake increased with Ds and temperature. Compared to Nafion, the SPEEKK-60, -70 and -80 membranes showed higher proton conductivities at 80 C, while the other SPEEKK membranes showed relatively lower proton conductivities. This may be due to the different distribution of ion-conducting domains in membrane. However, these membranes showed lower methanol diffusions in the range of 8.32 x 10{sup -9} to 1.14 x 10{sup -7} cm{sup 2} s{sup -1} compared with that of Nafion (2 x 10{sup -6} cm{sup 2} s{sup -1}) at the same temperature. The membranes also showed excellent mechanical properties (with a Young's modulus > 1 GPa and a tensile strength > 40 MPa). These results indicate that the SPEEKK membranes are promising materials for use in direct methanol fuel cell (DMFC) applications. (author)

  4. High cell density cultivation of Pseudomonas putida KT2440 using glucose without the need for oxygen enriched air supply.

    Science.gov (United States)

    Davis, Reeta; Duane, Gearoid; Kenny, Shane T; Cerrone, Federico; Guzik, Maciej W; Babu, Ramesh P; Casey, Eoin; O'Connor, Kevin E

    2015-04-01

    High Cell Density (HCD) cultivation of bacteria is essential for the majority of industrial processes to achieve high volumetric productivity (g L(-1) h(-1) ) of a bioproduct of interest. This study developed a fed batch bioprocess using glucose as sole carbon and energy source for the HCD of the well described biocatalyst Pseudomonas putida KT2440 without the supply of oxygen enriched air. Growth kinetics data from batch fermentations were used for building a bioprocess model and designing feeding strategies. An exponential followed by linearly increasing feeding strategy of glucose was found to be effective in maintaining biomass productivity while also delaying the onset of dissolved oxygen (supplied via compressed air) limitation. A final cell dry weight (CDW) of 102 g L(-1) was achieved in 33 h with a biomass productivity of 3.1 g L(-1) h(-1) which are the highest ever reported values for P. putida strains using glucose without the supply of pure oxygen or oxygen enriched air. The usefulness of the biomass as a biocatalyst was demonstrated through the production of the biodegradable polymer polyhydroxyalkanoate (PHA). When nonanoic acid (NA) was supplied to the glucose grown cells of P. putida KT2440, it accumulated 32% of CDW as PHA in 11 h (2.85 g L(-1) h(-1) ) resulting in a total of 0.56 kg of PHA in 18 L with a yield of 0.56 g PHA g NA(-1) . © 2014 Wiley Periodicals, Inc.

  5. Molecular identification of waterborne free living amoebae (Acanthamoeba, Naegleria and Vermamoeba) isolated from municipal drinking water and environmental sources, Semnan province, north half of Iran.

    Science.gov (United States)

    Javanmard, Ehsan; Niyyati, Maryam; Lorenzo-Morales, Jacob; Lasjerdi, Zohreh; Behniafar, Hamed; Mirjalali, Hamed

    2017-12-01

    The present study tested 80 samples of municipal, geothermal and recreational water samples for the occurrence of waterborne free living amoebae (FLA) including Acanthamoeba, Balamuthia mandrillaris, Vahlkampfiids and Vermamoeba in Semnan province, North half of Iran. Four sets of primers including JDP1,2 primers, ITS1,2 primers (Vahlkampfiids), 16S rRNABal primers (Balamuthia mandrillaris) and NA1,2 primers (Vermamoeba) were used to confirm the morphological identification. From the 80 water samples tested in the present study, 16 (20%) were positive for the outgrowth of free living amoebae based on the morphological page key. Out of the 34 municipal water samples, 7 (20.6%) were positive for outgrowth of Free living amoeba, belonging to Vermamoeba, Naegleria and Acanthamoeba using molecular tools. Three out of the six investigated hot springs were also contaminated with Naegleria spp. Sequencing of the ITS1,2 region of the Vahlkampfiid isolates revealed the highest homology with N. gruberi (2 isolates), N. australiensis (1 isolate) and N. pagei (3 isolates). This is the first report of N. gruberi in the country. Using morphological and molecular analysis, Balamuthia mandrillaris was undetected in all the water samples. The present study further confirmed the occurrence of potentially pathogenic waterborne free living amoebae in habitats with high human activity. It is of utmost importance that more studies are conducted to evaluate the niches of B. mandrillaris and N. fowleri in Iran and worldwide. Such investigations regarding the relevance of FLA as a hazard to humans, should be brought to the notice of the health authorities. Copyright © 2017. Published by Elsevier Inc.

  6. Application of Lichtenstein Method in Primary Inguinal Hernia by Under Experienced Surgeons

    Directory of Open Access Journals (Sweden)

    Serkan Yilmaz

    2016-01-01

    Full Text Available Aim: Lichtenstein technique is a mostly used inguinal hernia repair that provides important advantages to patient. Complication and recurrence rates are low for surgeons and it is an easy way to learn and apply. We have explained our results of Lichtenstein method which was applied by our assistant surgeons in order to emphasize that it can be used as a start method in repair of primer inguinal hernia. Material and Method: 154 patients that were operated with Lichtenstein method by our assistant surgeons after being diagnosed with primer inguinal hernia in Ižzmir Training Research Hospital between February 2008 and February 2011 were included in the study. For all patients, spinal anaesthesia was used as anaesthesia technic. Preoperatif sefazolin Na 1 gr. iv. was injected. The patients were followed 21 months (8-43 months in average. Patients started oral feeding in the operation evening and were allowed mobilisation. Results: 149 of the patients were male and 5 were female and age average was 53,5 (18-83. In 85 patients right inguinal hernia, in 65 patients left inguinal hernia and in 4 patients bilateral inguinal hernia were diagnosed. In exploration, it was detected that there were direct hernia in 62 patients, indirect hernia in 85 patients, pantaloon hernia in 3 patients, bilateral direct hernia in 4 patients. Average stay in hospital was 1,8 days postoperative. Early complications were seen 4,5 % as infection (n=4 , seroma (n=1 , urinary retention (n=1 and scrotal edema (n=1. Late term complications were seen 6,4 % as neuralgia (n=10. Mesh reaction and recurrence weren%u2019t detected in any of the patients. Discussion: In our study, Lichtenstein method were applied especially by our underexperienced surgeons. The fact that complication rate was low and no recurrence occured support its easy learning and application. We suggest its usage as a starting method in surgery education and primary inguinal hernia repair.

  7. Caracterização de demandas judiciais de fornecimento de medicamentos "essenciais" no Estado do Rio de Janeiro, Brasil Characterization of lawsuits for the supply of "essential" medicines in the State of Rio de Janeiro, Brazil

    Directory of Open Access Journals (Sweden)

    Vera Lúcia Edais Pepe

    2010-03-01

    Full Text Available O reconhecimento do direito à saúde possui duas repercussões práticas: a responsabilidade ética e legal do poder público em assegurar atenção integral à saúde da população, e a possibilidade de o cidadão reivindicar judicialmente o cumprimento desta obrigação estatal. Este estudo objetivou pesquisar as demandas de medicamentos considerados essenciais nas decisões da 2ª instância do Tribunal de Justiça do Estado do Rio de Janeiro, Brasil, em 2006. Foram analisados 185 processos e em três casos o pedido foi negado. Os tempos medianos entre início da ação e decisão liminar, sentença na 1a instância, e acórdão na 2ª instância, foram de 7, 239 e 478 dias, respectivamente. Em 98 processos o medicamento pode ser identificado e em 80,6% havia solicitação de ao menos um medicamento não pertencente aos elencos oficiais. Isto sugere que, além de problemas relacionados à aquisição, distribuição e dispensação de itens listados, os não selecionados em listas oficiais foram também grande motivação da demanda. Os medicamentos mais solicitados foram os dos sistemas cardiovascular e nervoso central.Recognition of the right to health raises two practical issues: the government's ethical and legal duty to ensure comprehensive health care and citizens' recourse to legal action to guarantee this right. This study focused on lawsuits to demand "essential" medicines, filed at the State Court of Appeals in Rio de Janeiro, Brazil, in 2006. One hundred and eighty-five suits were examined, and the claims were granted in all but three cases. Median times between filing the suit, the injunction, first ruling, and appellate ruling were 7, 239, and 478 days respectively. In 80.6% of the 98 suits in which the specific medicines could be identified, at least one drug did not belong to any publicly funded list of medicines. This could indicate that lawsuits demanding "essential" drugs were motivated not only by problems in procurement

  8. Composição físico-química, microbiológica e rendimento do filé de tilápia tailandesa (Oreochromis niloticus Physicochemical and microbiological composition and yield of thai-style tilapia fillets (Oreochromis niloticus

    Directory of Open Access Journals (Sweden)

    Marcia Regina Simões

    2007-09-01

    Full Text Available Foram determinados o rendimento do filé e a composição físico-química da tilápia quanto ao teor de umidade, proteína, cinza, lipídeos e atividade de água. Para as análises, foram utilizados 19 exemplares de tilápia com peso médio e comprimento de 989,6 g e 38,9 cm, respectivamente. Os peixes foram pesados, medidos (comprimento, largura e espessura e após a filetagem calculou-se o rendimento. Foi realizada a determinação da composição físico-química, que apresentou teores de: 77,13% de umidade; 2,60% lipídios; 19,30% proteína; 1,09% cinza; e atividade de água de 0,983. As relações de peso filé/peixe e peixe/resíduo apresentaram boas correlações lineares. Foi realizada também a análise microbiológica do peixe in natura; a matéria-prima estava dentro dos limites exigidos pela legislação brasileira, portanto apta para o processamento e/ou consumo.The fillet yield of Thai-style tilapia and its physicochemical composition, including moisture content, protein, ash lipids and water activity, were determined. The analysis involved 19 specimens of tilapia with average weight and length of 989.6 g and 38.9 cm, respectively. The fish were weighed, measured (length, width and thickness, filleted, and the yield was calculated. The chemical composition presented the following contents: 77.13% moisture, 2.60% lipids, 19.30% protein, 1.09% ash, and 0.983 water activity. The fillet/fish to fish/residue weight ratios presented good linear correlations. The raw fish was also subjected to a microbiological analysis, which indicated that it met the safety limits established by Brazilian legislation and was therefore safe for processing and consumption.

  9. Signal detection to identify serious adverse events (neuropsychiatric events in travelers taking mefloquine for chemoprophylaxis of malaria

    Directory of Open Access Journals (Sweden)

    Naing C

    2012-08-01

    Full Text Available Cho Naing,1,3 Kyan Aung,1 Syed Imran Ahmed,2 Joon Wah Mak31School of Medical Sciences, 2School of Pharmacy and Health Sciences, 3School of Postgraduate Studies and Research, International Medical University, Kuala Lumpur, MalaysiaBackground: For all medications, there is a trade-off between benefits and potential for harm. It is important for patient safety to detect drug-event combinations and analyze by appropriate statistical methods. Mefloquine is used as chemoprophylaxis for travelers going to regions with known chloroquine-resistant Plasmodium falciparum malaria. As such, there is a concern about serious adverse events associated with mefloquine chemoprophylaxis. The objective of the present study was to assess whether any signal would be detected for the serious adverse events of mefloquine, based on data in clinicoepidemiological studies.Materials and methods: We extracted data on adverse events related to mefloquine chemoprophylaxis from the two published datasets. Disproportionality reporting of adverse events such as neuropsychiatric events and other adverse events was presented in the 2 × 2 contingency table. Reporting odds ratio and corresponding 95% confidence interval [CI] data-mining algorithm was applied for the signal detection. The safety signals are considered significant when the ROR estimates and the lower limits of the corresponding 95% CI are ≥2.Results: Two datasets addressing adverse events of mefloquine chemoprophylaxis (one from a published article and one from a Cochrane systematic review were included for analyses. Reporting odds ratio 1.58, 95% CI: 1.49–1.68 based on published data in the selected article, and 1.195, 95% CI: 0.94–1.44 based on data in the selected Cochrane review. Overall, in both datasets, the reporting odds ratio values of lower 95% CI were less than 2.Conclusion: Based on available data, findings suggested that signals for serious adverse events pertinent to neuropsychiatric event were

  10. Tigecycline Susceptibility Trends Among Pathogens Isolated from Complicated Skin and Soft-Tissue Infections in North and Latin America: 2012–2016

    Science.gov (United States)

    Hoban, Daryl; Renteria, Martha; Leister-Tebbe, Heidi; Sahm, Dan

    2017-01-01

    Abstract Background The Tigecycline Evaluation Surveillance Trial (TEST) monitors the activity of tigecycline and other antimicrobials against clinically-relevant pathogens collected globally. This study reports the activity of tigecycline (TGC) against Gram-positive and Gram-negative isolates collected in North and Latin America from patients with complicated skin and soft-tissue infections (CSSTI). Methods Hospital sites from North America (NA) and Latin America (LA) collected non-duplicate clinical Gram-positive and -negative isolates from various complicated skin and skin structure infection sources during 2012–2016. Organism identification and antibiotic susceptibility (S) testing was performed by the local laboratories. Susceptibility testing was determined using the broth microdilution method according to CLSI guidelines and categorical interpretation of results was done using CLSI or FDA (tigecycline) breakpoint criteria where appropriate. Cefoxitin disk testing was performed for all S. aureus to determine methicillin susceptibility (i.e., MRSA and MSSA). Results The table provides %S and MIC90 data for TGC against CSSTI isolates Region, n, %S, MIC 90 (µg/ml) North America Latin America Organism n %S MIC 90 n %S MIC 90 S. aureus 2270 100 0.12 310 100 0.25 Enterobacter spp. 925 96.4 1 159 92.5 2 P. aeruginosa 758 na* > 8 165 na > 8 E. coli 716 99.9 0.25 241 100 0.25 Enterococcus spp. 691 99.3 0.12 135 100 0.12 S. agalactiae 503 100 0.12 58 100 0.06 K. pneumoniae 471 94.9 2 152 91.5 2 S. marcescens 347 96.8 2 67 97.0 2 A. baumannii 310 na* 2 97 na 1 K. oxytoca 204 99.0 0.5 15 100 1 *na = not applicable or no breakpoints available for this species. Conclusion Based on %S and MIC90 data TGC exhibited potent activity against isolates of all organism groups from complicated skin and soft-tissue infections, regardless of the geographic region. However, given the potential many of these organisms have for developing resistance, continued and careful

  11. Rigorous vectorial modeling for polarized illumination and projection pupil in OPC

    Science.gov (United States)

    Zhang, Qiaolin; Song, Hua; Lucas, Kevin; Ward, Brian; Shiely, James

    2008-05-01

    High NA and Ultra-High NA (NA>1.0) applications for low k1 imaging strongly demand the adoption of polarized illumination as a resolution enhancement technology since proper illumination polarization configuration can greatly improve the image contrast hence pattern printing fidelity and the effectiveness of optical proximity correction (OPC). However, current OPC/RET modeling software can only model the light source polarization of simple types, such as TE, TM, X, Y, or sector polarization with relatively simple configuration. Realistic polarized light used in scanners is more complex than the aforementioned simple ones. As a result, simulation accuracy and quality of the OPC result will be compromised by the simplification of the light source polarization modeling in the traditional approach. With ever shrinking CD error budget in the manufacturing of IC's at advanced technology nodes, more accurate and comprehensive illumination source modeling for lithography simulations and OPC/RET is needed. On the other hand, for polarized illumination to be fully effective, ideally all the components in the optical lithography system should not alter the polarization state of light during its propagation from illuminator to wafer surface. In current OPC modeling tools, it is typically assumed that the amplitude and polarization state of the light do not change as it passes through the projection lens pupil, i.e. the polarization aberration of projection lens pupil is ignored. However, in reality, the projection lens pupil of the scanner does change the amplitude and the polarization state to some extent, and ignorance of projection pupil induced polarization state and amplitude changes will cause CD errors un-tolerable at the 45nm device generation and beyond. We developed an OPC-deployable modeling approach to model arbitrarily polarized light source and arbitrarily polarized projection lens pupil. Based on polarization state vector descriptions of a general illumination

  12. Estudo da estimulação elétrica nervosa transcutânea (TENS nível sensório para efeito de analgesia em pacientes com osteoartrose de joelho

    Directory of Open Access Journals (Sweden)

    Charles Ricardo Morgan

    Full Text Available INTRODUÇÃO: A osteoartrose de joelho (OAJ é uma das patologias que mais afetam o aparelho locomotor e interferem de forma considerável nas atividades da vida diária, acometendo os indivíduos em faixa etária variável e em diversos graus e níveis de dor articular. OBJETIVOS: Por causa da importância da articulação do joelho nas atividades locomotoras, os pacientes com osteoartrose de joelho sofrem com a limitação de movimento e rigidez articular. O objetivo do presente estudo foi avaliar o efeito da estimulação elétrica nervosa transcutânea (TENS nível sensório para tratamento de dor em pacientes com diagnóstico de osteoartrose de joelho, utilizando escalas de avaliação de dor. MÉTODOS: Foram estudados 10 pacientes com diagnóstico de osteoartrose de joelho, utilizando uma modalidade fisioterapêutica, a eletroterapia, especificamente a (TENS, com parâmetros de 80 Hz e 140 µs, com um total de 10 sessões, 30 minutos para cada sessão, o período total de tratamento compreendeu 4 semanas. Nesse total de 10 sessões, cada paciente foi entrevistado com um questionário na 1ª sessão, na 5ª e na 10ª sessão. Os formulários utilizados foram questionário da dor McGill - Melzack, escala Analógica visual da dor, escala numérica com expressão facial de sofrimento. RESULTADOS: O resultado com a TENS nível sensório para efeito de analgesia mostra que as diferenças foram estatisticamente significativas (p < 0,05 para escala Analógica visual da dor e o Questionário da Dor McGill. CONCLUSÃO: Nossos resultados sugerem que a TENS nível sensório reduz a dor e melhora a funcionalidade do joelho.

  13. Estudo de toxicologia clínica de um produto crioterápico em voluntários saudáveis do sexo masculino - doi:10.5020/18061230.2005.p57

    Directory of Open Access Journals (Sweden)

    Aline Kércia Alves Soares

    2012-01-01

    Full Text Available Gelomed® é uma emulsão congelada composta de salicilato de metila, cânfora e mentol com indicação para a terapia de processos inflamatórios, especialmente os determinados por traumatismos. A associação desses princípios ativos promove uma ação antiinflamatória tópica explicada por uma vasoconstrição inicial, seguida de resposta vasodilatadora reflexa. O desenho do estudo foi de um ensaio clínico não randomizado de modalidade de controle “bias” aberto. O projeto foi aprovado pelo comitê de ética em pesquisa da Universidade Federal do Ceará. Foram selecionados 25 voluntários saudáveis do sexo masculino, que receberam topicamente a aplicação de 50g de Gelomed® por 20min, duas vezes ao dia, durante 14 dias ininterruptos. Os voluntários foram incluídos no estudo somente quando considerados saudáveis após avaliação clínica, exame físico e exames laboratoriais que antecederam o estudo. As avaliações foram repetidas na 1ª e 2ª semanas e 7 dias após o fim da administração do medicamento. A formulação Gelomed® foi bem tolerada pelos voluntários, entretanto, eventos adversos foram relatados por 24% dos voluntários, somente dois desses eventos foram relacionados a formulação (prurido e dor no local da aplicação, todos de intensidade leve que cederam sem medicação adicional. Os exames clínicos, eletrocardiográficos e laboratoriais efetuados antes, durante e após o ensaio não evidenciaram sinais de toxicidade nos diversos órgãos e sistemas avaliados. O ensaio clínico de fase I confirmou segurança da formulação na amostra avaliada, permitindo que o produto possa ser empregado em populações maiores para determinação de sua eficácia terapêutica.

  14. Development of a certified reference material (NMIJ CRM 7512-a) for the determination of trace elements in milk powder.

    Science.gov (United States)

    Zhu, Yanbei; Narukawa, Tomohiro; Miyashita, Shin-ichi; Kuroiwa, Takayoshi; Inagaki, Kazumi; Chiba, Koichi; Hioki, Akiharu

    2013-01-01

    A certified reference material (CRM), NMIJ CRM 7512-a, was developed for the determination of trace elements in milk powder. At least three independent analytical methods were applied to characterize the certified value of each element; all of these analytical methods were based on microwave acid digestions and carried out using different analytical instruments. The certified value was given on a dry-mass basis, where the dry-mass correction factor was obtained by drying the sample at 65°C for 15 to 25 h. The certified values in the units of mass fractions for 13 elements were as follows: Ca, 8.65 (0.38) g kg(-1); Fe, 0.104 (0.007) g kg(-1); K, 8.41 (0.33) g kg(-1); Mg, 0.819 (0.024) g kg(-1); Na, 1.87 (0.09) g kg(-1); P, 5.62 (0.23) g kg(-1); Ba, 0.449 (0.013) mg kg(-1); Cu, 4.66 (0.23) mg kg(-1); Mn, 0.931 (0.032) mg kg(-1); Mo, 0.223 (0.012) mg kg(-1); Rb, 8.93 (0.31) mg kg(-1); Sr, 5.88 (0.20) mg kg(-1); and Zn, 41.3 (1.4) mg kg(-1), where the numbers in the parentheses are the expanded uncertainties with a coverage factor of 2. The expanded uncertainties were estimated considering the contribution of the analytical methods, the method-to-method variance, the sample homogeneity, the dry-mass correction factor, and the concentrations of the standard solutions for calibration. The concentrations of As (2.1 μg kg(-1)), Cd (0.2 μg kg(-1)), Cr (1.3 μg kg(-1)), Pb (0.3 μg kg(-1)), and Y (64 μg kg(-1)) were given as information values for the present CRM.

  15. Presymptomatic genetic analysis during pregnancy for vascular type Ehlers–Danlos syndrome

    Directory of Open Access Journals (Sweden)

    Naing BT

    2014-06-01

    Full Text Available Banyar Than Naing,1 Atsushi Watanabe,1,2 Shinji Tanigaki,3 Masae Ono,4 Mitsutoshi Iwashita,3 Takashi Shimada1,21Department of Biochemistry and Molecular Biology, Nippon Medical School, Tokyo, Japan; 2Division of Clinical Genetics, Nippon Medical School Hospital, Tokyo, Japan; 3Department of Obstetrics and Gynecology, Kyorin University School of Medicine, Tokyo, Japan; 4Department of Pediatrics, Kyorin University School of Medicine, Tokyo, JapanAbstract: The vascular type of Ehlers–Danlos syndrome (EDS, EDS type IV (Online Mendelian Inheritance in Man [MIM] #130050 is characterized by thin, translucent skin, easy bruising, and arterial, intestinal, and/or uterine fragility during pregnancy, which may lead to sudden death. It is an autosomal dominant inherited disorder caused by type III procollagen gene (COL3A1: MIM #120180 mutations. Approximately 50% of the COL3A1 mutations are inherited from an affected parent, and 50% are de novo mutations. Each child of an affected individual has a 50% chance of inheriting the mutation and developing the disorder. Pregnant women with vascular EDS are at an increased risk of uterine and arterial rupture during the peripartum period, with high maternal morbidity and mortality rates. We report the first case of an asymptomatic 35-year-old woman at a risk of complications of vascular EDS who underwent presymptomatic evaluation during pregnancy. The sequencing results of both her brother and mother had a one-base-pair deletion, resulting in Glutamate at position 730 changing to Lysine and causing a frame shift and premature termination codon at 61 amino acids from the mutation position (p. Glu730Lysfs*61 on exon 32 of COL3A1. This deletion caused frameshift, leading to a premature termination codon (TAG at 181 nucleotides downstream in exon 35, which could not be detected by previous total RNA (ribonucleic acid method. Thus, she was at risk of complications of vascular EDS, and diagnostic testing was employed

  16. Evolução da noção de conservação de quantidade e desempenho em matemática

    Directory of Open Access Journals (Sweden)

    Nelson Rosamilha

    Full Text Available Foram confrontadas nesta pesquisa a afirmação piagetiana de que o ensino da matemática deve basear-se no desenvolvimento das estruturas mentais da criança e a realidade do ensino dessa matéria na 1.ª série do primeiro grau. Estudou-se a relação existente entre a noção de conservação e o grau de desempenho em matemática. Constituíram a amostra 47 sujeitos da 1.ª série do 1.° grau (17 do sexo masc. e 30 do fem., nível sócio-econômico médio-inferior para baixo-superior, idade de 6 anos e meio a 11 anos, sem escolarização anterior. A avaliação do desempenho relativo ao domínio da noção de conservação foi feita através do teste de conservação de quantidades descontínuas, e a do desempenho em matemática, através da observação sistemática e de uma prova. O coeficiente de correlação de postos de Good man e Kruskal (1945 e 1963] mostrou relação significante a um nível de 1% para conservação e porcentagem de acertos na prova (g = 0,7 e a um nível de 5% para a conservação e conceitos atribuídos pelo professor (G = 0,44. A análise dos dados categorizados pela técnica de Grizzle, Starmer e Koch (1969 a um nível de 5% indicou apenas efeito do fator sexo sobre a noção de conservação. Os resultados obtidos estão de acordo com a teoria piagetiana que indica ser a noção de conservação uma condição necessária para a aprendizagem da matemática, embora não suficiente.

  17. High expression of HMGA2 predicts poor survival in patients with clear cell renal cell carcinoma

    Directory of Open Access Journals (Sweden)

    Na N

    2016-11-01

    Full Text Available Ning Na,1,* Tujie Si,2,* Zhengyu Huang,1,* Bin Miao,1 Liangqing Hong,1 Heng Li,1 Jiang Qiu,2 Jianguang Qiu3 1Department of Kidney Transplantation, The Third Affiliated Hospital of Sun Yat-sen University, 2Department of Organ Transplant, The First Affiliated Hospital of Sun Yat-sen University, 3Department of Urology, The Third Affiliated Hospital of Sun Yat-sen University, Guangzhou, People’s Republic of China *These authors contributed equally to this work Abstract: High-mobility group AT-hook 2 (HMGA2 is involved in a wide spectrum of biological processes and is upregulated in several tumors, but its role in renal carcinoma remains unclear. The aim of this study was to examine the expression of HMGA2 and its relationship to the overall survival (OS of patients with non-metastatic clear cell renal cell carcinoma (ccRCC following surgery. The expression of HMGA2 was evaluated retrospectively by immunohistochemistry (IHC in 162 patients with ccRCC who underwent nephrectomy in 2003 and 2004. An IHC analysis revealed that HMGA2 was expressed in the nuclei of tumor cells in 146 (90.1% patients with ccRCC. The level of HMGA2 was positively correlated with tumor size, lymph node metastasis, and Fuhrman Grade. A Kaplan–Meier analysis with log-rank test found that patients with high HMGA2 expression had a poor outcome and that patients with low HMGA2 expression had better survival. Cox regression analysis showed that HMGA2 expression could serve as an independent prognostic factor for ccRCC patients. The efficacy of the following prognostic models was improved when HMGA2 expression was added: tumor node metastasis stage, UCLA Integrated Scoring System, Mayo Clinic stage, size, grade, and necrosis score. In summary, this study showed that HMGA2 expression is an independent prognostic factor for OS in patients with ccRCC. HMGA2 was found to be a valuable biomarker for ccRCC progression. Keywords: renal carcinoma, high-mobility group protein A

  18. DIVERSIDADE GENÉTICA E SELEÇÃO DE INICIADORES ISSR EM UMA POPULAÇÃO NATURAL DE MANGABA (Hancornia speciosa Gomes (APOCYNACEAE

    Directory of Open Access Journals (Sweden)

    DANIEL FERREIRA DA COSTA

    2015-12-01

    Full Text Available RESUMO O conhecimento da diversidade genética de espécies nativas é de grande valia quando se objetiva o melhoramento e a conservação de populações naturais. Neste sentido, o objetivodeste trabalho foi selecionar iniciadores ISSR (inter repetições de sequências simples para Hancornia speciosa (Apocynaceae, assim como quantificar a variabilidade genética em uma população natural. Foramamostrados 15 indivíduos de uma população localizada em Natal-RN. Amostras de caule foram coletadas para a posterior extração do DNA. DNA. Para a seleção, 19 primers ISSR foram testados, dos quais seis foram eficientes, apresentando locos nítidos e em maior número (UBC 808; UBC 810; UBC 826; UBC 827; UBC 841 e UBC 842, totalizando 63 locos. Desses, apenas 30 (47,62% apresentaram polimorfismo. O valor de PIC (conteúdo de informações polimórficas para os primers selecionados atingiu a média de 0,37, variando de 0,26 a 0,44. A diversidade genética foi considerada baixa dentro da população, com o número de alelos observados (na =1,48, número de alelos efetivos (ne = 1,32, índice de diversidade de Nei (He = 0,18 e índice de Shannon (I = 0,26. Os padrões de diversidade alélica encontrados indicam a ocorrência de um gargalo populacional recente. A utilização de marcadores ISSR para Hancornia speciosa mostrou-se eficaz para a quantificação da diversidade genética dos indivíduos, servindo como aporte para estratégias e planos que visem à conservação e à manutenção da espécie.

  19. Gallium(III)-Containing, Sandwich-Type Heteropolytungstates: Synthesis, Solution Characterization, and Hydrolytic Studies toward Phosphoester and Phosphoanhydride Bond Cleavage.

    Science.gov (United States)

    Kandasamy, Balamurugan; Vanhaecht, Stef; Nkala, Fiona Marylyn; Beelen, Tessa; Bassil, Bassem S; Parac-Vogt, Tatjana N; Kortz, Ulrich

    2016-09-19

    The gallium(III)-containing heteropolytungstates [Ga4(H2O)10(β-XW9O33)2](6-) (X = As(III), 1; Sb(III), 2) were synthesized in aqueous acidic medium by reaction of Ga(3+) ions with the trilacunary, lone-pair-containing [XW9O33](9-). Polyanions 1 and 2 are isostructural and crystallized as the hydrated sodium salts Na6[Ga4(H2O)10(β-AsW9O33)2]·28H2O (Na-1) and Na6[Ga4(H2O)10(β-SbW9O33)2]·30H2O (Na-2) in the monoclinic space group P21/c, with unit cell parameters a = 16.0218(12) Å, b = 15.2044(10) Å, c = 20.0821(12) Å, and β = 95.82(0)°, as well as a = 16.0912(5) Å, b = 15.2178(5) Å, c = 20.1047(5) Å, and β = 96.2(0)°, respectively. The corresponding tellurium(IV) derivative [Ga4(H2O)10(β-TeW9O33)2](4-) (3) was also prepared, by direct reaction of sodium tungstate, tellurium(IV) oxide, and gallium nitrate. Polyanion 3 crystallized as the mixed rubidium/sodium salt Rb2Na2[Ga4(H2O)10(β-TeW9O33)2]·28H2O (RbNa-3) in the triclinic space group P1̅ with unit cell parameters a = 12.5629(15) Å, b = 13.2208(18) Å, c = 15.474(2) Å, α = 80.52(1)°, β = 84.37(1)°, and γ = 65.83(1)°. All polyanions 1-3 were characterized in the solid state by single-crystal XRD, FT-IR, TGA, and elemental analysis, and polyanion 2 was also characterized in solution by (183)W NMR and UV-vis spectroscopy. Polyanion 2 was used as a homogeneous catalyst toward adenosine triphosphate (ATP) and the DNA model substrate 4-nitrophenylphosphate, monitored by (1)H and (31)P NMR spectroscopy. The encapsulated gallium(III) centers in 2 promote the Lewis acidic synergistic activation of the hydrolysis of ATP and DNA model substrates at a higher rate in near-physiological conditions. A strong interaction of 2 with the P-O bond of ATP was evidenced by changes in chemical shift values and line broadening of the (31)P nucleus in ATP upon addition of the polyanion.

  20. β-1,3 Glucanases e quitinases: aplicação na lise de leveduras e inibição de fungos β-1,3 glucanases and chitinases: application in the yeast cell lysis and fungi inhibition

    Directory of Open Access Journals (Sweden)

    Luciana Francisco Fleuri

    2008-08-01

    Full Text Available Objetivou-se, no presente trabalho, a aplicação de β-1,3 glucanases e quitinases da linhagem Cellulosimicrobium cellulans 191 na lise de leveduras e inibição de fungos, respectivamente. O delineamento experimental mostrou que as melhores condições para a lise de Saccharomyces cerevisiae KL-88 pela β-1,3 glucanase foi pH 6,5 e 35ºC. As células de leveduras incubadas por 10 h em frascos sem agitação mostraram-se mais susceptíveis à lise pela ação da enzima. Foi obtido maior lise da levedura quando a suspensão de células foi submetida ao tratamento com β-1,3 glucanase e cisteína 1mM. A enzima invertase intracelular ou ligada à célula de S. cerevisiae KL-88 e K. marxianus NCYC 587 foi extraída após tratamento da suspensão celular com β-1,3 glucanase, sendo que o tratamento prévio das leveduras com a enzima aumentou a susceptibilidade das células à lise com ultra-som. A preparação de quitinase foi capaz de formar halos de inibição de alguns fungos.The aim of this work was the application of β-1,3 glucanases and chitinases by Cellulosimicrobium cellulans 191 strain on yeast cell lysis and fungi inhibition, respectively. The experimental design study showed that the best conditions to Saccharomyces cerevisiae KL-88 lysis by β-1,3 glucanase extract were pH 6,5 and 35ºC. This study also demonstrated that the yeast cells were more susceptible to lysis after 10 h of cultivation in flasks without agitation. Lysis activity was increased when S. cerevisiae KL-88 cell suspension was treated with β-1,3 glucanase and cystein 1mM. The enzyme invertase of S. cerevisiae KL-88 and Kluyveromyces marxianus NCYC 587 was extracted after treatment of cell suspension with β-1,3 glucanase and the previous treatment of yeasts with the enzyme, increased the susceptibility to lysis when ultrasonic treatment was used. The chitinase presented growth inhibition halos for some of the fungi.

  1. Antipseudomonal activity of piperacillin/tazobactam: more than a decade of experience from the SENTRY Antimicrobial Surveillance Program (1997-2007).

    Science.gov (United States)

    Jones, Ronald N; Stilwell, Matthew G; Rhomberg, Paul R; Sader, Helio S

    2009-11-01

    We evaluated the susceptibility rates for piperacillin/tazobactam tested against Pseudomonas aeruginosa isolates from the Asia-Pacific (APAC), Europe (EU), Latin America (LA), and North America (NA) for 1997 to 2007. A total of 25 460 isolates were tested originating from APAC (4441), EU (7695), LA (4277), and NA (9047). All testing was performed by reference broth microdilution methods. The samples were collected from >110 medical centers and samples averaging >30 nations/year. For this analysis, results from 1997 to 2007, 1997 to 1999, 2005 to 2007, APAC, EU, LA, and NA were assessed against several broad-spectrum beta-lactams, including cefepime, ceftazidime, imipenem, meropenem, and piperacillin alone, for a total of 12 agents overall. Using P. aeruginosa breakpoints ( imipenem (79.7%) > piperacillin (79.5%) > cefepime (77.5%) > ceftazidime (75.8%). Other non-beta-lactam activity results were ciprofloxacin at only 71.5% susceptible, but tobramycin and polymyxin B had higher susceptibility rates (81.0% and 99.5%, respectively). Trends toward piperacillin/tazobactam resistance were noted between 1997 to 1999 and 2000 to 2007 in APAC (-11.6% susceptibility), NA (-4.0%), and EU (-2.3%). LA susceptibility rates were lowest overall but actually increased recently by +2.9% (current rate, 79.4% susceptible). For beta-lactamase inhibitor combinations, susceptibility rates were higher for piperacillin/tazobactam when compared in all regions with piperacillin alone (+2.6-7.1%) and greatest for LA isolates. In contrast, ticarcillin/clavulanate susceptibility rates were lower than ticarcillin tested alone in NA (-1.5%, antagonism), and this agent only inhibited 70.3% of isolates worldwide. In conclusion, piperacillin/tazobactam remained a very active beta-lactam when tested in vitro against clinical isolates of P. aeruginosa found in the SENTRY Program (1997-2007). Trends toward slightly decreased susceptibility were noted in all regions over the last decade (except LA

  2. 3 Tesla (23)Na magnetic resonance imaging during aerobic and anaerobic exercise.

    Science.gov (United States)

    Hammon, Matthias; Grossmann, Susan; Linz, Peter; Kopp, Christoph; Dahlmann, Anke; Janka, Rolf; Cavallaro, Alexander; Uder, Michael; Titze, Jens

    2015-09-01

    The aim of the work described here was to determine the feasibility of monitoring Na(+) concentration and distribution in muscle/skin during aerobic/anaerobic exercise with (23)Na magnetic resonance imaging (MRI). The Na(+) concentration and water content of muscle/skin of the left lower leg of six healthy subjects (mean age, 26 years; range, 22-30 years; three men and three women) were assessed before and after aerobic/anaerobic cycle ergometry and during recovery with 3-T (23)Na/(1)H MRI. (23)Na MRI was performed with a custom-made knee coil. A gradient echo sequence with an acquisition time of 3.25 minutes, echo time of 2.07 ms, repetition time of 100 ms, and spatial resolution of 3 × 3 × 30 mm(3) was applied. Phantoms with increasing sodium concentration served for quantification via linear extrapolation. Blood values were determined by blood gas analysis. The concentration of Na(+) significantly increased during anaerobic exercise in all muscle compartments except the medial gastrocnemius muscle, whereas no significant change was observed in most muscle compartments during aerobic exercise (only the soleus muscle exhibited a significant increase in Na(+) concentration during aerobic exercise: 1.6 ± 1.5 mmol/kg, 4.5%, P = .046). During anaerobic exercise, the mean Na(+) concentration of the triceps surae and the whole leg increased by 9.0% (3.1 ± 2.1 mmol/kg, P = .016) and 6.5% (2.2 ± 1.3 mmol/kg, P exercise. Na(+) concentration significantly decreased during recovery after anaerobic and aerobic exercise in all muscle compartments except the soleus. The Na(+) concentration of the skin did not significantly change during anaerobic/aerobic exercise. Sodium(23) MRI allows reliable and noninvasive visualization and quantification of Na(+) concentration and distribution in muscle and skin during exercise. (23)Na MRI can be used to gain new insights into Na(+) homeostasis, presumably leading to better comprehension of pathophysiology. Copyright © 2015 AUR

  3. A Mössbauer and FTIR study of synthetic amphiboles along the magnesioriebeckite ferri-clinoholmquistite join

    Science.gov (United States)

    della Ventura, Giancarlo; Redhammer, Günther J.; Iezzi, Gianluca; Hawthorne, Frank C.; Papin, Arnaud; Robert, Jean-Louis

    2005-06-01

    A series of amphiboles along the magnesioriebeckite—□Na2Mg3Fe3+ 2Si8O22(OH)2 ferri-clinoholmquistite—□Li2Mg3Fe3+ 2Si8O22(OH)2 - join, defined by the BLiB Na-1 exchange vector, were hydrothermally synthesized at 700°C, 0.4 GPa, NNO + 1 redox conditions. Powder XRD and SEM-EDAX showed a very high (> 90%) amphibole yield for all samples. X-ray patterns were indexed in the C2/m space group; refined cell-parameters show a linear decrease of a and β as a function of chemistry. IR spectra in the OH-stretching region show four main and rather sharp bands; these are assigned to Mg and Fe2+ at M(1,3), and indicate that the obtained amphiboles depart from the nominal octahedral composition (M1,3Mg3). The IR spectra also show that there is an increasing filling-up of the A-site for increasing Na in the system (increasing solid-solution toward, arfvedsonite). Mössbauer spectra show four well-defined quadrupole doublets which are assigned to Fe3+ at M2 and to Fe2+ at M1, M3 and M4, respectively. The Fe3+/Fe2+ content derived from fitted peak areas show variable Fe3+ concentration along the series. Mössbauer spectra also show a distinct alteration of 57Fe hyperfine parameters with changing Na Li at M4. The most evident variation is observed for the quadrupole splitting of Fe3+ at M2, which increases by ≈50% from ferri-clinoholmquistite to magnesio-riebeckite; this suggest that the M2 octahedron in ferri-clinoholmquistite is much closer to the ideal geometry than the M2 octahedron in magnesio-riebeckite. Mössbauer spectra show also a well-defined increase in the Fe2+ quadrupole splitting of the M1 and M3 octahedra, which is attributed to the Na Li distribution at the B-sites.

  4. Comparative Transcriptome Analysis of Male and Female Conelets and Development of Microsatellite Markers in Pinus bungeana, an Endemic Conifer in China

    Directory of Open Access Journals (Sweden)

    Dong Duan

    2017-12-01

    Full Text Available The sex determination in gymnosperms is still poorly characterized due to the lack of genomic/transcriptome resources and useful molecular genetic markers. To enhance our understanding of the molecular mechanisms of the determination of sexual recognition of reproductive structures in conifers, the transcriptome of male and female conelets were characterized in a Chinese endemic conifer species, Pinus bungeana Zucc. ex Endl. The 39.62 Gb high-throughput sequencing reads were obtained from two kinds of sexual conelets. After de novo assembly of the obtained reads, 85,305 unigenes were identified, 53,944 (63.23% of which were annotated with public databases. A total of 12,073 differentially expressed genes were detected between the two types of sexes in P. bungeana, and 5766 (47.76% of them were up-regulated in females. The Kyoto Encyclopedia of Genes and Genomes (KEGG enriched analysis suggested that some of the genes were significantly associated with the sex determination process of P. bungeana, such as those involved in tryptophan metabolism, zeatin biosynthesis, and cysteine and methionine metabolism, and the phenylpropanoid biosynthesis pathways. Meanwhile, some important plant hormone pathways (e.g., the gibberellin (GA pathway, carotenoid biosynthesis, and brassinosteroid biosynthesis (BR pathway that affected sexual determination were also induced in P. bungeana. In addition, 8791 expressed sequence tag-simple sequence repeats (EST-SSRs from 7859 unigenes were detected in P. bungeana. The most abundant repeat types were dinucleotides (1926, followed by trinucleotides (1711. The dominant classes of the sequence repeat were A/T (4942 in mononucleotides and AT/AT (1283 in dinucleotides. Among these EST-SSRs, 84 pairs of primers were randomly selected for the characterization of potential molecular genetic markers. Finally, 19 polymorphic EST-SSR primers were characterized. We found low to moderate levels of genetic diversity (NA = 1.754; HO

  5. Enhancement of spatial resolution of terahertz imaging systems based on terajet generation by dielectric cube

    Directory of Open Access Journals (Sweden)

    Hai Huy Nguyen Pham

    2017-05-01

    Full Text Available The terahertz (THz, 0.1–10 THz region has been attracting tremendous research interest owing to its potential in practical applications such as biomedical, material inspection, and nondestructive imaging. Those applications require enhancing the spatial resolution at a specific frequency of interest. A variety of resolution-enhancement techniques have been proposed, such as near-field scanning probes, surface plasmons, and aspheric lenses. Here, we demonstrate for the first time that a mesoscale dielectric cube can be exploited as a novel resolution enhancer by simply placing it at the focused imaging point of a continuous wave THz imaging system. The operating principle of this enhancer is based on the generation—by the dielectric cuboid—of the so-called terajet, a photonic jet in the THz region. A subwavelength hotspot is obtained by placing a Teflon cube, with a 1.46 refractive index, at the imaging point of the imaging system, regardless of the numerical aperture (NA. The generated terajet at 125 GHz is experimentally characterized, using our unique THz-wave visualization system. The full width at half maximum (FWHM of the hotspot obtained by placing the enhancer at the focal point of a mirror with a measured NA of 0.55 is approximately 0.55λ, which is even better than the FWHM obtained by a conventional focusing device with the ideal maximum numerical aperture (NA = 1 in air. Nondestructive subwavelength-resolution imaging demonstrations of a Suica integrated circuit card, which is used as a common fare card for trains in Japan, and an aluminum plate with 0.63λ trenches are presented. The amplitude and phase images obtained with the enhancer at 125 GHz can clearly resolve both the air-trenches on the aluminum plate and the card’s inner electronic circuitry, whereas the images obtained without the enhancer are blurred because of insufficient resolution. An increase of the image contrast by a factor of 4.4 was also obtained using

  6. Effects of impurity and composition profiles on electrical characteristics of GaAsSb/InGaAs hetero-junction vertical tunnel field effect transistors

    Science.gov (United States)

    Gotow, Takahiro; Mitsuhara, Manabu; Hoshi, Takuya; Sugiyama, Hiroki; Takenaka, Mitsuru; Takagi, Shinichi

    2017-11-01

    We fabricated and characterized GaAs0.51Sb0.49/In0.53Ga0.47As hetero-junction vertical tunnel field effect transistors (TFETs) on InP substrates in order to examine the effects of the structural characteristics of GaAsSb/InGaAs hetero-structures on the electrical properties of the TFETs. The operation of the fabricated GaAs0.51Sb0.49/In0.53Ga0.47As TFET was confirmed with the ION/IOFF ratio of ˜102 over VG swing of 1.25 V at 297 K. This ION/IOFF ratio was improved up to ˜104 at 20 K, thanks to the suppression of the leakage current in the source junction. The secondary ion mass spectrometry analyses for the present hetero-structures have revealed that the concentration of the p-type dopant (Be) atoms, doped in the GaAsSb source regions, decreases in the InGaAs channel regions at an inverse slope of ˜11 nm/dec. Also, the scanning transmission electron microscope-energy dispersive X-ray spectroscopy has shown that group III and V compositions change abruptly in a region within 10 nm from the interface between the Be-doped GaAsSb source and the undoped InGaAs channel. We performed the 2-dimensional device simulation based on the device structure and the experimentally obtained composition and impurity profiles, and we found that the composition profile had little effect on the S.S. values. The device simulation also revealed that both the optimization of the concentration and the profile of the p-type doping of GaAsSb, and thinning of the effective oxide thickness (EOT) of the gate stacks could effectively improve the inherent S.S. values of the present GaAs0.51Sb0.49/In0.53Ga0.47As hetero-junction vertical TFETs. When 1.0 nm EOT and NA = 1 × 1020 cm-3 are used under the present impurity abruptness, S.S. < 40 mV/dec. can be achieved for the vertical GaAsSb/InGaAs TFETs, which is promising for an ultralow power switching device.

  7. Energy harvesting for microsystems

    Energy Technology Data Exchange (ETDEWEB)

    Ruichao Xu

    2012-05-15

    The purpose of this project is to design and fabricate piezoelectric energy harvesters based on integration of Pb(ZrxTi1-x)O3 (PZT) thick film technology and silicon microtechnology. The fabrication processes are carried out in close collaboration with Meggitt Sensing Systems (MSS) who has the unique expertise to screen print piezoelectric thick film layers, thus all screen printing steps are done by MSS while the silicon micromachining is carried out at Danchip facility at DTU. The presented energy harvesters are all based on using piezoelectric thick film operating in the 31-mode to generate power when strained. Three archetypes of the numerous fabricated energy harvesters will be presented in detail, they represent three major milestones in this project. The first energy harvester archetype has an unimorph cantilever beam, which consists of a 20 {mu}m silicon layer and 10-30 {mu}m screen printed PZT layer, anchored on a silicon frame at one end and attached to a silicon proof mass at the other. Electrodes will cover both side of the PZT layer, so the harvested energy can be collected electrically. The second archetype has a bimorph cantilever beam, which consists of two 15-35 {mu}m PZT layers, anchored on a silicon frame at the one end and attached to a silicon proof mass at the other. Electrodes are deposited below, between and above the two PZT layers. The root mean square (RMS) power output measured on this type of harvesters is as high as 37.1{mu}W at 1 g. The third archetype is similar to the first one, the screen printed PZT layer is replaced by a lead free piezoelectric material, (KxNa1-x)NbO3 (KNN). Some of the major challenges encountered during the development processes are bad adhesion, fragile structures and short circuiting through the PZT layer. All of which have being fully or partially solved in this project. The final energy harvesters are designed to be used in an energy harvester powered wireless sensing system. (Author)

  8. Avaliação do efeito da esplenectomia e auto-implante esplênico sobre algumas funções de monócitos em crianças com esquistossomose mansônica Evaluation of the effect of splenectomy with autologous spleen tissue implantation in some monocyte functions in children with hepatosplenic schistosomiasis mansoni

    Directory of Open Access Journals (Sweden)

    Carlos T. Brandt

    2005-02-01

    Full Text Available Investigamos em portadores de esquistossomose hepatoesplênica após esplenectomia com ou sem auto-implante esplênico: índice de aderência, produção de superóxido (SP e de TNF-alfa em monócitos, tratados ou não com tuftsina. Avaliamos três grupos: voluntários sadios CG (grupo controle (n=12; esplenectomizados com auto-implante AG (n=18 e esplenectomizados sem auto-implante WAG (n=9. Índice de aderência e TNF-alfa não diferiram entre os grupos. SP foi semelhante em CG e AG na 1ª hora após estimulação celular. SP foi maior em todos intervalos de tempo nos grupos CG e AG, comparados ao WAG. O tratamento com tuftsina recuperou o padrão de normalidade de SP em AG, com aumento da 1ª para a 2ª hora nos níveis do CG. O tratamento com tuftsina não alterou SP em WAG, permanecendo reduzida em todos intervalos. O auto-implante esplênico parece recuperar e manter os parâmetros imunológicos avaliados, que têm participação importante na resposta do hospedeiro às infecções.Adherence index, superoxide and TNF-alpha production in monocytes, with or without tuftsin treatment, were investigated in hepatosplenic schistosomiasis mansoni bearers with splenectomy with or without autologous implantation of spleen tissue. Three groups were evaluated: Healthy volunteers control group (CG (n=12; Splenectomy with seft auto-transplant AG (n=18 and Splenectomy without auto-transplant WAG (n=9. Adherence index and TNF-alpha did not differ among the groups. Superoxide production was similar in CG and AG, in the 1st hour after cell stimulation. SP was larger in each hour time in CG and AG groups as compared WAS group. TT recovered normal pattern of SP in AG comparable with levels found in CG, with increase from the 1st to 2nd hour. However, TT did not alter SP in WAG, which remained reduced in all time points. Autologous implantation of spleen tissue seems to contribute for recovery and maintenance of the evaluated immunological reactions, which

  9. Efeito da adição de glutationa peroxidase e cisteína ao diluidor de congelação do sêmen equino

    Directory of Open Access Journals (Sweden)

    L.O. Barros

    2013-04-01

    Full Text Available Foram utilizados ejaculados (n=25 de garanhões para avaliar o efeito de glutationa peroxidase (GPx e cisteína na viabilidade de espermatozoides congelados. O sêmen foi diluído em Botu Crio, com antioxidantes, e foram formados os grupos: G1, Controle; G2, 1U GPx ; G3, 5U GPx; G4, 0,5mM cisteína; G5, 1mM cisteína. Depois foi envasado em palhetas (0,5mL e congelado. Após descongelação, 37°C por 30 segundos, alíquotas foram analisadas quanto à integridade de membrana plasmática (IMP e acrossoma (IAc, potencial de membrana mitocondrial (PMM e cinética, nos tempos zero (T0 e 60 minutos (T60. GPx 5U e cisteína 0,5mM determinaram maior (P<0,05 IAc em T0 do que em T60. Cisteína 1mM resultou em maior (P<0,05 IAc em T60 do que GPx 1 e 5U e cisteína 0,5mM. O PMM de um garanhão no T60 foi mais alto (P<0,05 do que o de dois garanhões. VCL e VAP foram maiores (P<0,05 no T0 do que no T60 do grupo controle, e um garanhão apresentou, em geral, valores cinéticos mais altos (P<0,05 do que os demais. Conclui-se que a adição de glutationa peroxidase, nas concentrações de 1U e 5U, e de cisteína, nas concentrações de 0,5mM e 1mM, não interferem na integridade de espermatozoides criopreservados de equinos, mas preservam os parâmetros cinéticos de VCL e VAP após 60 minutos de incubação. Ressalta-se, ainda, que o garanhão tem uma forte influência nas características espermáticas pós-congelação.

  10. Effect of fluoridated varnish and silver diamine fluoride solution on enamel demineralization: pH-cycling study Efeito do verniz fluoretado e da solução de diamino fluoreto de prata na desmineralização do esmalte: estudo utilizando modelo de ciclagem de pH

    Directory of Open Access Journals (Sweden)

    Alberto Carlos Botazzo Delbem

    2006-04-01

    Full Text Available OBJECTIVE: In the present investigation, the anticariogenic effect of fluoride released by two products commonly applied in infants was evaluated. METHODS: Bovine sound enamel blocks were randomly allocated to each one of the treatment groups: control (C, varnish (V and diamine silver fluoride solution (D. The blocks were submitted to pH cycles in an oven at 37ºC. Next, surface and cross-sectional microhardness were assessed to calculate the percentage loss of surface microhardness (%SML and the mineral loss (deltaZ. The fluoride present in enamel was also determined. RESULTS: F/Px10-3 (ANOVA, pOBJETIVOS: Este trabalho avaliou o efeito anticariogênico do flúor liberado por dois produtos comumente aplicados em crianças. MÉTODOS: Para isto, utilizaram-se blocos de esmalte de dentes bovinos distribuídos aleatoriamente em três grupos de tratamento: controle (C, verniz fluoretado (V e solução de diamino fluoreto de prata (D. Os blocos foram submetidos à ciclagem de pH a 37ºC. Após, realizou-se o teste de microdureza de superfície (para o cálculo da % da perda de microdureza de superfície - %SML e em secção longitudinal do esmalte (% de alteração da área mineral - %deltaZ e a determinação do flúor presente no esmalte (F/P x 10-3. RESULTADOS: As concentrações de flúor (ANOVA, p<0,05 na 1ª camada do esmalte, antes da ciclagem de pH, foram (C, V e D: 1,6ª; 21,6b e 4,0c. Os resultados de %SML (Kruskal-Wallis, p<0.05 foram: -64,0ª, -45,2b e -53,1c. Os valores de %deltaZ (ANOVA, p<0.05 foram: -18,7ª, -7,7b e -17,3ª. CONCLUSÃO: Os dados sugerem que o flúor liberado pelo verniz apresentou maior interação com o esmalte promovendo menor perda mineral quando comparado à solução de diamino de prata.

  11. Transplante de células-tronco hematopoéticas e leucemia mieloide aguda: diretrizes brasileiras Hematopoietic stem cells transplantation and acute myeloid leukemia: Brazilian guidelines

    Directory of Open Access Journals (Sweden)

    Lucia Mariano R. Silla

    2010-05-01

    Full Text Available O objetivo deste trabalho foi definir diretrizes para a indicação do transplante de células-tronco hematopoéticas (TCTH no tratamento da leucemia mieloide aguda (LMA no Brasil. O papel do TCTH no tratamento da LMA foi discutido pelosautores e apresentado para a Sociedade Brasileira de Transplante de Medula Óssea na reunião sobre Diretrizes Brasileiras para o TCTH, que o ratificou. Este consenso foi baseado na revisão da literatura internacional e na experiência brasileira em TCTH para o tratamento da LMA. O tratamento ideal para leucemia mieloide aguda em primeira remissão completa (1RC ainda não está definido. Há consenso na indicação do TCTH alogênico, com condicionamento mieloablativo, para pacientes que apresentem alterações citogenéticas consideradas de alto risco. O TCTH alogênico não está indicado na 1RC para pacientes de baixo risco citogenético e, aparentemente, o TCTH alogênico, autólogo ou a quimioterapia de consolidação são equivalentes para os pacientes de risco intermediário.The objective of this work was to define guidelines for the indication of hematopoietic stem cells transplantation (HSCT in the treatment of acute myeloid leukemia (AML in Brazil. The role of HSCT in the treatment of AML was discussed by the authors and presented to the Brazilian Society of Bone Marrow Transplantation in a meeting to formulate and ratify the Brazilian Guidelines on HSCT. This consensus was based on a review of international publications and on the Brazilian experience in HSCT for the treatment of AML. The optimal treatment for AML in first complete remission (1CR has not been defined yet. There is consensus on the indication of allogeneic HSCT with myeloablative conditioning for patients who present high risk cytogenetic changes. Allogeneic HSCT is not indicated for low cytogenetic risk 1RC patients and, apparently, allogeneic and autologous HSCT and consolidation chemotherapy are similar for intermediate risk

  12. Health education with older adults: action research with primary care professionals.

    Science.gov (United States)

    Mendonça, Francielle Toniolo Nicodemos Furtado de; Santos, Álvaro da Silva; Buso, Ana Luisa Zanardo; Malaquias, Bruna Stephanie Sousa

    2017-01-01

    To assess the development and implementation of permanent education action. Quantitative-qualitative research based on action research in three phases (diagnosis of reality, implementation of activity and evaluation), performed with health professionals and managers of basic health units. The evaluation was on the perception of changes immediately following the activity and after 120 days. In the first phase, 110 professionals took part, 36.4% of whom indicated the existence of groups for older adults at work. In the second phase, 98 professionals participated, pointing out interferences of the group in the life of older adults, items of importance and facilitation in forming groups and developing reality-based activities. The third phase showed, in the quantitative analysis, positive impact of the training, and in the qualitative analysis, reassessment of groups, greater knowledge and confidence in managing groups and increased respect for older adults. Permanent education opens pathways for the construction of differentiated care for older adults based on respect and health promotion. Avaliar o desenvolvimento e implementação de uma ação de educação permanente. Pesquisa quantitativo-qualitativa baseada na pesquisa-ação em 3 fases (diagnóstico da realidade, implementação de atividade e avaliação), realizada com profissionais de saúde e gerentes de unidades básicas. A avaliação se deu pela percepção de mudanças imediatamente à atividade e após 120 dias. Na 1ª fase, participaram 110 profissionais, dos quais 36,4% apontaram a existência de grupos para idosos no trabalho. Na 2ª fase, participaram 98 profissionais, que apontaram interferências do grupo na vida do idoso, itens de importância e facilitação para construção de grupos e atividade baseada na realidade. A 3ª fase mostrou, na análise quantitativa, impacto positivo do treinamento; e, na qualitativa, releitura dos grupos e manejo com mais conhecimento, segurança e respeito ao

  13. An investigation of desalination by nanofiltration, reverse osmosis and integrated (hybrid NF/RO) membranes employed in brackish water treatment.

    Science.gov (United States)

    Talaeipour, M; Nouri, J; Hassani, A H; Mahvi, A H

    2017-01-01

    As an appropriate tool, membrane process is used for desalination of brackish water, in the production of drinking water. The present study aims to investigate desalination processes of brackish water of Qom Province in Iran. This study was carried out at the central laboratory of Water and Wastewater Company of the studied area. To this aim, membrane processes, including nanofiltration (NF) and reverse osmosis (RO), separately and also their hybrid process were applied. Moreover, water physical and chemical parameters, including salinity, total dissolved solids (TDS), electric conductivity (EC), Na +1 and Cl -1 were also measured. Afterward, the rejection percent of each parameter was investigated and compared using nanofiltration and reverse osmosis separately and also by their hybrid process. The treatment process was performed by Luna domestic desalination device, which its membrane was replaced by two NF90 and TW30 membranes for nanofiltration and reverse osmosis processes, respectively. All collected brackish water samples were fed through membranes NF90-2540, TW30-1821-100(RO) and Hybrid (NF/RO) which were installed on desalination household scale pilot (Luna water 100GPD). Then, to study the effects of pressure on permeable quality of membranes, the simulation software model ROSA was applied. Results showed that percent of the salinity rejection was recorded as 50.21%; 72.82 and 78.56% in NF, RO and hybrid processes, respectively. During the study, in order to simulate the performance of nanofiltartion, reverse osmosis and hybrid by pressure drive, reverse osmosis system analysis (ROSA) model was applied. The experiments were conducted at performance three methods of desalination to remove physic-chemical parameters as percentage of rejections in the pilot plant are: in the NF system the salinity 50.21, TDS 43.41, EC 43.62, Cl 21.1, Na 36.15, and in the RO membrane the salinity 72.02, TDS 60.26, EC 60.33, Cl 43.08, Na 54.41. Also in case of the rejection in

  14. The development and standardization of Self-assessment for Hearing Screening of the Elderly

    Directory of Open Access Journals (Sweden)

    Kim G

    2016-06-01

    Full Text Available Gibbeum Kim,1 Wondo Na,1 Gungu Kim,1 Woojae Han,2 Jinsook Kim2 1Department of Speech Pathology and Audiology, Hallym University Graduate School, Chuncheon, Republic of Korea; 2Division of Speech Pathology and Audiology, Research Institute of Audiology and Speech Pathology, College of Natural Sciences, Hallym Universtiy, Chuncheon, Republic of Korea Purpose: The present study aimed to develop and standardize a screening tool for elderly people who wish to check for themselves their level of hearing loss. Methods: The Self-assessment for Hearing Screening of the Elderly (SHSE consisted of 20 questions based on the characteristics of presbycusis using a five-point scale: seven questions covered general issues related to sensorineural hearing loss, seven covered hearing difficulty under distracting listening conditions, two covered hearing difficulty with fast-rated speech, and four covered the working memory function during communication. To standardize SHSE, 83 elderly participants took part in the study: 25 with normal hearing, and 22, 23, and 13 with mild, moderate, and moderate-to-severe sensorineural hearing loss, respectively, according to their hearing sensitivity. All were retested 3 weeks later using the same questionnaire to confirm its reliability. In addition, validity was assessed using various hearing tests such as a sentence test with background noise, a time-compressed speech test, and a digit span test. Results: SHSE and its subcategories showed good internal consistency. SHSE and its subcategories demonstrated high test–retest reliability. A high correlation was observed between the total scores and pure-tone thresholds, which indicated gradually increased SHSE scores of 42.24%, 55.27%, 66.61%, and 78.15% for normal hearing, mild, moderate, and moderate-to-severe groups, respectively. With regard to construct validity, SHSE showed a high negative correlation with speech perception scores in noise and a moderate negative

  15. Effects of hearing loss on speech recognition under distracting conditions and working memory in the elderly

    Directory of Open Access Journals (Sweden)

    Na W

    2017-08-01

    Full Text Available Wondo Na,1 Gibbeum Kim,1 Gungu Kim,1 Woojae Han,2 Jinsook Kim2 1Department of Speech Pathology and Audiology, Graduate School, 2Division of Speech Pathology and Audiology, Research Institute of Audiology and Speech Pathology, College of Natural Sciences, Hallym University, Chuncheon, Republic of Korea Purpose: The current study aimed to evaluate hearing-related changes in terms of speech-in-noise processing, fast-rate speech processing, and working memory; and to identify which of these three factors is significantly affected by age-related hearing loss.Methods: One hundred subjects aged 65–84 years participated in the study. They were classified into four groups ranging from normal hearing to moderate-to-severe hearing loss. All the participants were tested for speech perception in quiet and noisy conditions and for speech perception with time alteration in quiet conditions. Forward- and backward-digit span tests were also conducted to measure the participants’ working memory.Results: 1 As the level of background noise increased, speech perception scores systematically decreased in all the groups. This pattern was more noticeable in the three hearing-impaired groups than in the normal hearing group. 2 As the speech rate increased faster, speech perception scores decreased. A significant interaction was found between speed of speech and hearing loss. In particular, 30% of compressed sentences revealed a clear differentiation between moderate hearing loss and moderate-to-severe hearing loss. 3 Although all the groups showed a longer span on the forward-digit span test than the backward-digit span test, there was no significant difference as a function of hearing loss.Conclusion: The degree of hearing loss strongly affects the speech recognition of babble-masked and time-compressed speech in the elderly but does not affect the working memory. We expect these results to be applied to appropriate rehabilitation strategies for hearing

  16. Physico-chemical and optical properties of combustion-generated particles from coal-fired power plant, automobile and ship engine and charcoal kiln.

    Science.gov (United States)

    Kim, Hwajin

    2015-04-01

    Similarities and differences in physico-chemical and optical properties of combustion generated particles from various sources were investigated. Coal-fired power plant, charcoal kiln, automobile and ship engine were major sources, representing combustions of coal, biomass and two different types of diesel, respectively. Scanning electron microscopy (SEM), high resolution transmission electron microscopy (HRTEM) and energy-dispersive X-ray spectroscopy (EDX) equipped with both SEM and HRTEM were used for physico-chemical analysis. Light absorbing properties were assessed using a spectrometer equipped with an integrating sphere. Particles generated from different combustion sources and conditions demonstrate great variability in their morphology, structure and composition. From coal-fired power plant, both fly ash and flue gas were mostly composed of heterogeneously mixed mineral ash spheres, suggesting that the complete combustion was occurred releasing carbonaceous species out at high temperature (1200-1300 °C). Both automobile and ship exhausts from diesel combustions show typical features of soot: concentric circles comprised of closely-packed graphene layers. However, heavy fuel oil (HFO) combusted particles from ship exhaust demonstrate more complex compositions containing different morphology of particles other than soot, e.g., spherical shape of char particles composed of minerals and carbon. Even for the soot aggregates, particles from HFO burning have different chemical compositions; carbon is dominated but Ca (29.8%), S (28.7%), Na(1%), and Mg(1%) are contained, respectively which were not found from particles of automobile emission. This indicates that chemical compositions and burning conditions are significant to determine the fate of particles. Finally, from biomass burning, amorphous and droplet-like carbonaceous particles with no crystallite structure are observed and they are generally formed by the condensation of low volatile species at low

  17. Clinical predictors of abnormal esophageal pH monitoring in preterm infants Preditores clínicos para pHmetria esofágica anormal em prematuros

    Directory of Open Access Journals (Sweden)

    Maria Aparecida Mezzacappa

    2008-09-01

    Full Text Available BACKGROUND: Risk factors for gastroesophageal reflux disease in preterm neonates have not been yet clearly defined. AIM: To identify factors associated with increased esophageal acid exposition in preterm infants during the stay in the neonatal unit. METHODS: A case-control study in preterm infants who had undergone prolonged monitoring of distal esophageal pH, following clinical indication. Eighty-seven preterms with reflux index (percentage of total time of esophageal pHmetry >10% (cases and 87 unpaired preterms were selected with reflux index 10% in preterms were: vomiting, regurgitation, Apnea, female gender. The variables that were associated with a lower frequency of increased reflux index were: volume of enteral intake at the onset of symptoms >147 mL/kg/day, and postnatal corticoid use. CONCLUSIONS: Vomiting, regurgitation, apnea, female gender and acute respiratory distress during the first week of life were variables predictive of increased esophageal acid exposition in preterm infants with birthweight 10%.RACIONAL: Os fatores de risco para a doença pelo refluxo gastroesofágico em recém-nascidos prematuros não foram, até momento, claramente estabelecidos. OBJETIVO: Identificar fatores associados ao aumento da exposição ácida intra-esofágica em prematuros durante o período de internação em unidade neonatal. MÉTODOS: Realizou-se estudo de caso controle com prematuros que realizaram monitorização prolongada do pH esofágico por suspeita clínica de doença do refluxo. Foram selecionados 87 recém-nascidos com valor do índice de refluxo (percentual do tempo total do exame com pH abaixo de 4 >10% (casos e 87 recém-nascidos com índice de refluxo 10% foram: vômitos, regurgitações, apnéia, sexo feminino e insuficiência respiratória na 1ª semana de vida. As variáveis que se associaram a menor freqüência de índice de refluxo 147mL/kg/d e uso de corticóide pós-natal. CONCLUSÕES: Vômitos, regurgitações, apn

  18. La qualitá percepita: valutazione di un servizio di ristorazione ospedaliera attraverso il grado di soddisfazione degli utenti

    Directory of Open Access Journals (Sweden)

    L. De Paola

    2003-05-01

    Full Text Available

    Introduzione: un tema centrale nell’ambito della qualità in Sanità, è rappresentato dalla “customer satisfaction”, ossia dal gradimento dell’utente. Il servizio di ristorazione rientra nelle prestazioni alberghiere che caratterizzano un Ospedale e la cui efficacia può essere valutata mediante la rilevazione del grado di soddisfazione dell’utenza. Nell’Ospedale “S.M.d.P. degli Incurabili” (ASL NA 1 la preparazione e la consegna dei pasti è affidata in appalto ad una ditta esterna e la distribuzione del vitto ai pazienti a personale del reparto. Materiali e metodi: per misurare il grado di soddisfazione dei pazienti nei confronti del vitto ricevuto si è provveduto a somministrare, ad un campione random di 100 pazienti, un questionario elaborato sulla base di una ricerca bibliografica. Il questionario include una sezione anagrafica ed una sezione costituita da domande con risposte a carattere chiuso.

    Risultati: nel periodo Febbraio-Aprile 2002 sono stati intervistati 100 pazienti (66 donne e 34 uomini la maggior parte di età compresa tra 36 e 65 anni. Relativamente alla qualità del servizio, l’88% degli intervistati trova il vitto dell’Ospedale globalmente soddisfacente e solo l’8% scadente, l’82% trova il menu abbastanza vario, il 41% non consuma tutto il vitto che riceve ed il 21% mangia cibi preparati altrove. Riguardo alla gradevolezza degli alimenti, solo il 9% dei pazienti non apprezza la colazione, il 18.5% trova sgradevoli i primi piatti, il 13% i secondi piatti e il 10.5% i contorni.

    Conclusioni: il questionario è uno strumento utile per mettere in evidenza alcune insoddisfazioni dei pazienti e per conoscere le discordanze percepite tra il servizio erogato e le loro aspettative, al fine di poter garantire la corretta individuazione degli ambiti di intervento per il miglioramento del servizio stesso ed evitare il ripetersi di eventuali

  19. Synthesis, structure and electrochemical properties of LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F fluoride-phosphate

    Energy Technology Data Exchange (ETDEWEB)

    Fedotov, Stanislav S. [Department of Chemistry, Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Skoltech Center for Electrochemical Energy Storage, Skolkovo Institute of Science and Technology, 143026 Moscow (Russian Federation); Kuzovchikov, Sergey M.; Khasanova, Nellie R.; Drozhzhin, Oleg A.; Filimonov, Dmitriy S. [Department of Chemistry, Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Karakulina, Olesia M.; Hadermann, Joke [EMAT, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Abakumov, Artem M. [Department of Chemistry, Lomonosov Moscow State University, 119991 Moscow (Russian Federation); Skoltech Center for Electrochemical Energy Storage, Skolkovo Institute of Science and Technology, 143026 Moscow (Russian Federation); EMAT, University of Antwerp, Groenenborgerlaan 171, B-2020 Antwerp (Belgium); Antipov, Evgeny V. [Department of Chemistry, Lomonosov Moscow State University, 119991 Moscow (Russian Federation)

    2016-10-15

    LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F fluoride-phosphate was synthesized via conventional solid-state and novel freeze-drying routes. The crystal structure was refined based on neutron powder diffraction (NPD) data and validated by electron diffraction (ED) and high-resolution transmission electron microscopy (HRTEM). The alkali ions are ordered in LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F and the transition metals jointly occupy the same crystallographic sites. The oxidation state and oxygen coordination environment of the Fe atoms were verified by {sup 57}Fe Mössbauer spectroscopy. Electrochemical tests of the LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F cathode material demonstrated a reversible activity of the Fe{sup 3+}/Fe{sup 2+} redox couple at the electrode potential near 3.4 V and minor activity of the Co{sup 3+}/Co{sup 2+} redox couple over 5 V vs Li/Li{sup +}. The material exhibited the discharge capacity of more than 82% (theo.) regarding Fe{sup 3+}/Fe{sup 2+} in the 2.4÷4.6 V vs Li/Li{sup +} potential range. - Graphical abstract: The ball-polyhedral representation of the LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F crystal structure. The MO{sub 4}F{sub 2} units are depicted as blue octahedra, PO{sub 4} units as orange tetrahedra, sodium atoms are designated as yellow (Na1), lithium – red and brown (Li2, Li3 resp.), fluorine – green, oxygen – violet spheres. - Highlights: • Freeze-drying method was successfully applied to the synthesis of LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F. • The crystal structure of LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F was refined based on NPD and validated by ED and HRTEM. • LiNaCo{sub 0.5}Fe{sub 0.5}PO{sub 4}F demonstrated a reversible Li de/intercalation in the 2.5÷4.6 V vs Li/Li{sup +} range.

  20. Protein Adhesion and Ion Substitution (on/in)to Minerals

    Science.gov (United States)

    Charlet, L.; Fernandez Martinez, A.; Chapron, Y.; Sahai, N.; Cuello, G.; Brendle, J.; Marichal, C.

    2008-12-01

    Arsenic and pathogenic prion protein-scrapie (PrPsc) are important contaminants which may soil and water for decades, unless they are removed by sorption. Two sorption mechanisms will be discussed, namely the organics (Prp and single aminoacid) adsorption on clay and the arsenic substitution in gypsum. The elucidation of these contrasted mechanisms will be shown to request complementary molecular-mechanical simulations with experimental spectroscopic investigations. As first example, structural studies performed at ILL/ESRF on As-doped gypsum (CaSO4 2H2O) using neutron and X-ray diffraction data and EXAFS were performed to determine how As fits into the bulk of gypsum structure. The combined Rietveld analysis of neutron and X-ray diffraction data shows an expansion of the unit cell volume proportional to the As concentration within the samples. to-sulfate substitution mechanisms were used as simulation starting hypotheses. DFT-based simulations (Mulliken analysis) were used to interpret charge distribution and to show that among the possible mechanisms, a sulphate substitution by either protonated, or fully deprotonated, arsenate ion, only the protonated arsenate substitution could best fit the EXAFS data. In the second example, we used Molecular Dynamics to understand the mechanism of strong binding of the pathogenic PrP peptide with clay mineral surfaces. We modeled only the infectious moiety, PrP92-138, of the whole PrPsc structure, with explicitly solvating water molecules in contact with the cleavage plane of pyrophillite, as a model for montmorillonite without any cationic substitution. Partial residual negative charges on the cleavage plane were balanced with K+ ions. The peptide anchored to the clay surface via up to 10 hydrogen bonds from lysine and histidine residues to oxygen atoms of the siloxane cavities, and a total adsorption energy of 3465 KJ.mol-1 was obtained. Our results were compared to the one obtained by chemical and thermal analysis, 23Na, 1H

  1. Tourmalines from the siderite-quartz-sulphide hydrothermal veins, Gemeric unit, western Carpathians, Slovakia: crystal chemistry and evolution

    Science.gov (United States)

    Bačík, P.; Uher, P.; Dikej, J.; Puškelová, Ľ.

    2018-02-01

    Tourmaline is an important gangue mineral in a large number of Cretaceous siderite-quartz-sulphide hydrothermal veins in the Gemeric Unit, Slovak Ore Mountains, Slovakia, such as Dobšiná, Vlachovo, Rožňavské Bystré, Hnilčík, Rakovnica, Novoveská Huta, Gretla, Rudňany, and Bindt. In this study we combine by electron microprobe analysis, powder X-ray diffraction, Mössbauer and optical emission spectroscopy to determine the range of tourmaline compositions in the deposits and constrain the mechanisms of its precipitation. Selected samples from the mentioned deposits belong mostly to the alkali group, schorl to dravite series, rarely dominant X-site vacant foititic tourmaline (Vlachovo and Bindt) and oxy-dravite compositions (Hnilčík) were detected. Rim zones of some schorlitic tourmalines show high concentrations of Ti (up to 2.35 wt.% TiO2, 0.30 apfu; Rožňavské Bystré). The chemical composition is mostly controlled by alkali-deficient X □AlNa-1(Mg,Fe2+)-1 and proton-deficient AlO(Mg,Fe2+)-1(OH)-1 substitutions. Titanium is incorporated into the structure by Y Ti Y (Mg,Fe) Y Al-2, Y Ti Z Mg Y Al-1 Z Al-1, Y TiO( Y AlOH), and X Ca Y Ti Z MgO2 X □-1 Y,Z Al-2(OH)-2 substitutions. Along trace elements, Sr and V attain concentrations of 80-450 and 70-320 ppm, respectively. The unit-cell parameter a varies between 15.960 and 15.985 Å; variations in c are larger, between 7.177 and 7.236 Å indicating the presence of Fe3+ and Mg2+ at Z site. Mössbauer spectroscopy has shown variable Fe3+ proportions (0.17 -0.55 apfu) in all samples. The gathered dataset suggests some qualitative considerations on the mechanisms controlling tourmaline compositions at the regional scale. The highest Fe3+ concentrations occur in samples from Rudňany and Gretla in the external part of Gemeric unit, suggesting higher oxidation during longer transport of fluids. We propose that the determined XFe in the samples are correlated with the compositions of the host rocks, as

  2. Assessment of trace metal contamination in stream sediments of the Tuul River, Mongolia

    Science.gov (United States)

    Dalai, B.

    2011-12-01

    Thirty four sediment samples were collected in Ulaanbaatar basin, along the Tuul River which is the main source of water for the capital city Ulaanbaatar, Mongolia. The catchment can be divided three parts (upper, middle, and lower) according to the extent of urbanization. The upper part of the river basin is comparatively less affected by human activity and it can be represent the natural background condition. The middle part is the urban area of Ulaanbaatar and lower part extends SW of the end of the urban area mostly used for agriculture and farming activity. The present study focused on the levels of potentially toxic metals such as As, Pb, Zn, Cu, Ni and Cr in order to assess the extent of environmental pollution and to discuss the origin of these contaminants in sediments of the Tuul River using X-ray fluorescence analyses. Metal concentrations in the sediments are discussed by comparison with average Upper Continental Crust values (UCC) and ecological risk assessment by reference to sediment quality guidelines (SQG). The results showed thet average abundances of metals are measurable contrast between upper, middle and lower parts of the river. The Upper part and its surrounding area's sediment signature indicated that more depletion comparatively other parts (Pb, Zn, Cu, Ni and Cr), whereas enrichment sign did not detect. However, among the Upper part sediments, two samples (NA1 and NA2) enriched with trace metals which sampled from Nalaikh area were significantly affected by coal mining activity. Most metals are (As, Pb, Zn, Cu and Ni) higher in the middle part (within the city) than the upper and lower part due to the urban activities. The small tributaries such as Selbe, Uliastai, Gachuurt and Tolgoit were significantly affected by urban activities and highest values are detected from them. Lower part significantly enriched with Cr (av 98 ppm). Highest concentration of Cr (183 ppm) was at Shuvuu which is receiving point of domestic and industrial

  3. Infusão contínua de lidocaína em diferentes taxas no controle de arritmias induzidas pela administração de adrenalina em cães anestesiados com isofluorano

    Directory of Open Access Journals (Sweden)

    R. Thiesen

    2012-02-01

    Full Text Available Avaliaram-se os efeitos da infusão de diferentes doses de lidocaína sobre o ritmo cardíaco, em cães anestesiados com isofluorano que receberam doses crescentes de adrenalina. Foram utilizados 10 cães, cada qual anestesiado quatro vezes, respeitando-se um intervalo de duas semanas. A indução anestésica foi realizada com propofol, 8mg/kg, e a manutenção com isofluorano a 1,5 CAM. Os animais foram distribuídos em quatro grupos, que receberam bolus de lidocaína, 1mg/kg, seguido pela infusão de lidocaína nas taxas de 50μg/kg/h (G50, 100μg/kg/h (G100 e 200μg/kg/h (G200. O grupo-controle (GC recebeu bolus e infusão de NaCl a 0,9%. As variáveis foram mensuradas 30 minutos após a indução, e em seguida, iniciadas as infusões. Após 10 minutos do princípio dos tratamentos, colheram-se novamente os dados e iniciou-se a infusão de adrenalina, 1μg/kg/min. Em intervalos de 10 minutos, realizou-se nova colheita de dados e acrescentou-se 1μg/kg/min na taxa de infusão de adrenalina, até atingir 5μg/kg/min. Comparativamente ao GC, ocorreu redução do aparecimento de batimentos de origem não sinusal e bloqueios atrioventriculares de segundo grau nos grupos tratados com lidocaína. Concluiu-se que a associação de lidocaína à anestesia com isofluorano diminuiu o aparecimento de irregularidades no ritmo cardíaco.

  4. Acompanhamento sistematizado da hiperbilirrubinemia em recém-nascidos com 35 a 37 semanas de idade gestacional

    Directory of Open Access Journals (Sweden)

    Elizabete Punaro

    2011-08-01

    Full Text Available OBJETIVOS: Identificar os resultados do acompanhamento da bilirrubinemia na primeira semana de vida em uma coorte de recém-nascidos (RNs de 35(0/7 a 37(6/7 semanas de idade gestacional e estabelecer fatores de risco para reinternação para fototerapia pós-alta hospitalar (bilirrubinemia total > 18 mg/dL. MÉTODOS: Estudo de coorte retrospectivo em hospital público universitário. Os recém-nascidos tiveram acompanhamento da bilirrubina total plasmática ou transcutânea pré- e pós-alta da enfermaria de alojamento conjunto para avaliação da necessidade de fototerapia. Foi empregada uma abordagem sistematizada, utilizando-se os percentis de risco de uma curva de referência. RESULTADOS: Foram estudados 392 RNs. Uma consulta ambulatorial foi necessária em 61,7% dos RNs. Tiveram valores máximos de bilirrubinemia total > 20 mg/dL 34 RNs (8,7%, e três RNs (0,8% apresentaram bilirrubinemia total entre 25-30 mg/dL. Fototerapia foi indicada após alta em 74 RNs (18,9%. Os fatores de risco foram a perda de peso do nascimento até o primeiro retorno e os percentis à alta acima do P40. A bilirrubinemia total à alta acima do P95 foi associada ao maior risco de reinternação [RR = 49,5 (6,6-370,3]. A perda de peso até o primeiro retorno foi o único preditor clínico independente [RR = 1,16 (1,04-1,17]. CONCLUSÃO: A abordagem sistematizada da bilirrubinemia na 1ª semana foi efetiva na prevenção de hiperbilirrubinemias perigosas. O suporte à amamentação e a alta hospitalar após a estabilização da perda de peso podem ser medidas preventivas da reinternação por hiperbilirrubinemia

  5. Technological quality and agroindustrial yield of sugarcane subject to zinc fertilizationQualidade tecnológica e produtividade agroindustrial de cana-de-açúcar submetida a adubação com zinco

    Directory of Open Access Journals (Sweden)

    Marcelo Carvalho Minhoto Teixeira Filho

    2013-09-01

    trabalho foi avaliar o efeito de doses e fontes de zinco aplicadas no sulco de plantio, na qualidade tecnológica e produtividade agroindustrial da cana-de açúcar (cana-planta e 1ª cana-soca cultivada num solo de textura arenosa com baixo teor de Zn, na região Noroeste paulista. O experimento foi realizado num ARGISSOLO VERMELHO Eutroférrico, em área agrícola administrada pela Usina Vale do Paraná Açúcar e Álcool, em Suzanápolis - SP. O delineamento experimental utilizado na cana-planta e na 1ª cana-soca foi o de blocos ao acaso, com quatro repetições, num esquema fatorial (5x3, com cinco doses de zinco (0; 2,5; 5,0; 7,5 e 10,0 kg ha-1 e três fontes de zinco (FTE, quelato de Zn e sulfato de Zn aplicadas no sulco de plantio. Na 1ª cana-soca, houve maiores porcentagens de POL da cana, POL do caldo e pureza do caldo quando do uso do quelato e sulfato de Zn, e maior porcentagem de AR do caldo para o FTE e sulfato de Zn. A produtividade agroindustrial da cana-de-açúcar não foi afetada pelo aumento das doses de zinco. Baseado nos indicadores de qualidade tecnológica (POL, brix e ATR da 1ª cana-soca, seria interessante a aplicação de 4,0 a 5,0 kg ha-1 de Zn no sulco de plantio, na forma de quelato ou sulfato de Zn.

  6. Alterações hematológicas provocadas pelo ultra-som de 1MHz na forma contínua aplicadas no tratamento da fase aguda de lesão muscular iatrogênica em ratos Hematological changes produced by 1MHz continuous ultrasound, applied during the acute phase of iatrogenic muscle injury in rats

    Directory of Open Access Journals (Sweden)

    RDM Plentz

    2008-12-01

    Full Text Available CONTEXTUALIZAÇÃO: A literatura demonstra o efeito benéfico da terapia ultra-sônica de baixa intensidade sobre o processo de cicatrização de vários tecidos. OBJETIVO: Avaliar o efeito do ultra-som contínuo (USC sobre a dinâmica hematológica do processo inflamatório agudo de lesão muscular iatrogênica. MÉTODOS: Foram utilizados 16 ratos da raça Wistar (350 a 400g, divididos em grupo controle (GC=8 e grupo experimental (G1=8, submetidos à incisão cirúrgica na face lateral do membro posterior direito, onde o músculo bíceps femoral foi lesionado transversalmente. O USC (1MHz foi aplicado sobre o local da lesão a uma intensidade de 0,4W/cm², durante três minutos, na 1ª, 8ª e 24ª hora após a lesão. Nestes períodos, foram realizadas as coletas de sangue por punção venosa do plexo retroorbital para as análises sangüíneas das séries brancas e vermelhas. RESULTADOS: O USC diminui 8% dos eritrócitos na primeira coleta (9,9±0,1 versus 7,8±0,1; x10(5/mm³, pBACKGROUND: The literature shows the beneficial effects of low-intensity ultrasound therapy on the healing process of several biological tissues. OBJECTIVE: To evaluate the effects of continuous ultrasound (CUS on the hematological dynamics of an acute inflammatory process in iatrogenic muscle injuries. METHODS: Sixteen Wistar rats (350 to 400g were divided into a control group (CG=8 and an experimental group (G1=8. The rats were submitted to a surgical incision on the lateral aspect of the right hind limb, in which the biceps femoris muscle was transversally injured. The CUS (1MHz was applied to the injury site at an intensity of 0.4W/cm², for three minutes, in 1, 8 and 24 hour after the injury. At these times, blood was drawn by venipuncture of the retroorbital plexus, for analysis of red and white blood cells. RESULTS: The CUS reduced erythrocytes in 8% at the first blood collection (9.9±0.1 versus 7.8±0.1; x10(5/mm³; p<0.001; it doubled the number of segmented

  7. Effects on growth after hypertension portal induced in young rats Efeitos da hipertensão portal sobre o crescimento de ratos jovens

    Directory of Open Access Journals (Sweden)

    Luiz Eduardo Correia Miranda

    2004-03-01

    ária, o hematócrito e as provas de função hepática. Ao final do experimento, a pressão portal foi medida por via transesplênica. RESULTADOS/CONCLUSÃO: Ratos do grupo hipertensão portal apresentaram atraso de crescimento na 1ª semana após a cirurgia, recuperando o seu ritmo de crescimento nas semanas seguintes. Ao final das 5 semanas, não houve diferenças entre os animais. Não houve diferenças com relação às provas bioquímicas e hematológicas, nem com relação ao ganho de massa magra. Esses resultados são evidência contra a hipótese de que hipertensão portal induzida nas fases iniciais da vida desses animais possa provocar atraso de seu crescimento.

  8. Avaliação de características da carcaça e da qualidade da carne de queixada (Tayassu pecari [Link, 1795] Evaluation of carcass characteristics and meat quality of white-lipped peccary (Tayassu pecari [Link, 1795

    Directory of Open Access Journals (Sweden)

    Eduardo Mendes Ramos

    2009-01-01

    Full Text Available No presente trabalho, propôs-se avaliar os parâmetros de qualidade na carcaça e carne de queixadas adultas. Um total de quatro queixadas (três machos e uma fêmea, com peso vivo (PV médio de 29,47 ± 3,45 kg, foi abatido, determinado o rendimento de carcaça quente (RCQ, e avaliada a área do olho do lombo (AOL, gordura de marmoreio (GM, espessura da gordura de cobertura (EGC, pH, perda de peso por cozimento (PPC, concentração de pigmentos heme totais (PHT e composição centesimal no músculo Longissimus dorsi (LD. O RCQ em relação ao PV foi de 53,80%, assemelhando-se aos índices observados em bovinos e búfalos, sendo encontrada uma quebra de peso de 3,22% após refrigeração. O pH médio final, após 24 horas, foi de 5,54, dentro da faixa considerada normal para carnes suínas. Os valores médios obtidos para AOL (14,44 cm² e EGC (3,75 mm indicam um bom desenvolvimento muscular e uma menor proporção de gordura na carcaça, também evidenciada pela existência de traços de GM e pelo baixo conteúdo de lipídeos observados no lombo. De forma geral, o lombo apresentou composição média de 74,59% de umidade, 20,25% de proteína, 1,08% de lipídeos e 1,17% de cinzas, muito similares aos observados em animais convencionais. Os dados médios de PHT (69,49 ppm e PPC (13,68% demonstram a qualidade da carne de queixada, uma vez que refletem no favorecimento da cor vermelha do produto final e em uma baixa perda de peso do corte, durante o preparo.This work was carried out to evaluate carcass and meat quality attributes of adult white-lipped peccaries. A total of four white-lipped peccaries (three males and one female, with average of live weights (LW of 29.47 ± 3.45 kg, were slaughtered and evaluated for hot carcass dressing (HCD, ribeye area (REA, rib fat thickness (RFT, intramuscular fat (marbling, pH, cook loss (CL, total haem pigments (THP and proximate composition of Longissimus dorsi (LD. The HCD in relation to LW was of 53

  9. Efeito do cozimento por extrusão na estabilidade oxidativa de produtos de moagem de aveia Extrusion cooking effects on oxidative stability of oat coarse milling product

    Directory of Open Access Journals (Sweden)

    Luiz Carlos Gutkoski

    1999-01-01

    Full Text Available O objetivo do presente trabalho foi estudar os efeitos de umidade e de temperatura de extrusão na estabilidade oxidativa de produtos de aveia (Avena sativa L.. Cariopses de aveia foram moídas em moinho de rolos Brabender e obtidas frações de granulometrias superior e inferior a 532 mim. A fração de granulometria superior a 532 mm, de alto teor de proteínas, lipídios e fibra alimentar, foi condicionada na umidade desejada (15,5-25,5% e extrusada em extrusor de laboratório Brabender monorosca. As condições usadas na extrusão foram taxa de compressão de 3:1, rotação de 100 rpm, matriz de 6 mm de diâmetro e temperaturas entre 77,6 e 162,4°C nas 2ª e 3ª zonas e de 80°C na 1ª zona. O material extrusado foi seco em estufa, moído, acondicionado em sacos de plástico e utilizado periodicamente nas determinações de peróxidos e de n-hexanal. O óleo da fração estudada apresentou quantidade relativamente alta de ácidos graxos insaturados (79,47%, sendo linoléico o principal representante. Independentemente do conteúdo inicial de umidade, todos os produtos extrusados em temperaturas inferiores a 120°C apresentaram baixa rancidez oxidativa, ou seja, essas temperaturas se mostraram adequadas ao processamento de aveia.The objective of the present research was to study the effects of extrusion cooking on oxidative stability of oat (Avena sativa L. milling product. The dehulled grains were ground in a Brabender Quadrumat Senior mill and separated in two fractions, coarse over 532 mm and fine less than 532 mum. The coarse fraction, with higher amount of crude protein, lipids and dietary fiber content was conditioned to moisture levels (15.5-25.5% and extruded in a Brabender single-screw laboratory extruder (C/D= 20:1. The extrusion conditions were compression ratio of 3:1, screw speed of 100 rpm, a die of 6 mm in diameter and temperatures between 77.6 and 162.4°C in the 2nd and 3rd zones while the 1st zone was maintained at 80

  10. Modelación por homología de la proteína Luxs de Porphyromonas gingivalis cepa W83 Modelling by homology of Luxs protein in Porphyromonas gingivalis strain W83

    Directory of Open Access Journals (Sweden)

    A Díaz Caballero

    2012-12-01

    Full Text Available Antecedentes: En las proteínas no se logra siempre su cristalización, de buen tamaño y de buena calidad para someterla a difracción de rayos X. De tal manera que se abre un campo para el desarrollo de estudios teóricos moleculares y proteínicos, que permiten la representación de las moléculas en tres dimensiones, proporcionando una información espacial para estudiar la interacción entre ligandos y receptores macromoleculares. Materialesy Métodos: Estudio In silico, a partir del análisis de secuencias primarias de seis diferentes proteínas LuxS cristalizadas de diversas bacterias, se seleccionó la proteína 1J6X del Helicobacter pylori, por su similaridad con la secuencia de la proteína LuxS en Porphyromonas gingivalis (P. gingivalis cepa W83, para producir un modelo por homología de esta proteína, utilizando los programas Sybyl y MOE. Se realizó un acoplamiento con el ligando natural para evaluar la reproducibilidad del modelo en un ambiente biológico. Resultados: Se desarrolló el modelado de la proteína LuxS de P. gingivalis cepa W83, que permite el acercamiento a una estructura que se propone, por la interacción entre la proteína y su ligando natural. El modelo generado con recursos computacionales logró una correcta estructura molecular que aceptó la realización de diversos cálculos. El acoplamiento demostró una cavidad donde se logran diversas posiciones del ligando con buenos resultados. Conclusiones: Se obtuvo un modelo 3D para la proteína LuxS en la P. gingivalis cepa W83 validado por diferentes métodos computacionales con una adecuada reproducibilidad biológica por medio del acoplamiento molecular.Background: Crystallization is not always achieved for all proteins in a good size and a good quality for X-ray diffraction. So that condition opens a field for the development of theoretical molecular and protein studies allowing the representation of the molecules in 3D, providing spatial information to study

  11. Utilização de diferentes programas de restrição alimentar na fase de crescimento de matrizes avícolas tipo corte e seus efeitos na fase de produção Broiler breeding performance influenced by feeding programs during the growing period

    Directory of Open Access Journals (Sweden)

    Neventon Santi Vieira

    1995-01-01

    Full Text Available Matrizes avícolas tipo corte necessitam de rigoroso controle de peso nas fases de recria e produção, para que tenham um desenvolvimento adequado e conseqüentemente, espressem seu máximo potencial produtivo. Objetivando avaliar o efeito de diferentes programas de arraçoamento na fase de recria sobre parâmetros produtivos de matrizes avícolas tipo corte, conduziu-se este experimento no Setor de Avicultura do Departamento de Zootecnia da Universidade Federal de Santa Maria/RS. O delineamento experimental foi inteiramente casualizado, constituído de 3 tratamentos com 4 repetições e, a unidade experimental foi de 67 aves. Na 1ª e 2ª semana de idade as aves receberam alimento à vontade, na 3ª e 4ª semana o arraçoamento foi diário controlado. Na fase de recria (5ª a 20ª semana de idade as aves foram submetidas aos tratamentos: T1: 5ª a 14ª semana = "Sip-a-Day"; 15ª a 17ª = 2 dias sim/1 dia não e da 18ª a 20ª semana, arraçoamento diário controlado; T2: 5ª a 8ª semana = "Skip-a-Day", 9ª a 16ª = 48-57-63 h de intervalo entre arraçoamentos. e da 17ª a 20ª semana = 2 dias sim/1 dia não; T3, 5ª a 20ª semana de idade = 48-57-63 h de intervalo entre arraçoamentos. Os resultados obtidos mostram que, o aumento do intervalo de arraçoamento (48-57-63h na fase de crescimento das aves, não afeta negativamente a performance produtiva das aves, podendo ser utilizado durante a fase de recria, tendo ainda por vantagem, a redução com os custos de mão de obra, pois as aves não são arraçoadas nos finais de semana.The body weight of broiler breeders must be rigorously controled during the growing and production periods in order to get on adequate development, and consequently to show his maximum potential of production. An experiment was conducted at the Poultry Section of the Animal Science Department of the Federal University of Santa Maria/RS, to evaluate the effect of different feeding programs during the growing period on

  12. Survey on the use of psychotropic drugs by twelve military police units in the municipalities of Goiânia and Aparecida de Goiânia, state of Goiás, Brazil Pesquisa sobre uso de drogas psicotrópicas em 12 unidades da Polícia Militar nos municípios de Goiânia e Aparecida de Goiânia, Estado de Goiás, Brasil

    Directory of Open Access Journals (Sweden)

    Sérgio Henrique Nascente Costa

    2010-12-01

    uso foi: 1 qualquer época da vida: tabaco - 39,9%, álcool - 87,8%, maconha - 8,1%, cocaína - 1,8%, estimulantes - 7,2%, solventes - 10,0%, sedativos, ansiolíticos e antidepressivos - 6,8%, LSD - 0,5%, Bentyl® - 0,5%; esteroides anabolizantes - 5,4%; 2 último ano: tabaco - 15,4%, álcool - 72,9%, estimulantes - 6,3%, solventes - 0,5%, sedativos, ansiolíticos e antidepressivos - 3,7%; 3 último mês: tabaco - 14,5%, álcool - 57,5%, estimulantes - 5,0%, solventes - 0,5, sedativos, ansiolíticos e antidepressivos - 3,7%. CONCLUSÃO: A alta prevalência do uso de drogas psicotrópicas por membros da Polícia Militar de duas cidades do Estado de Goiás, Brasil, pode ser considerada um fator importante com potencial influência sobre as atividades de trabalho.

  13. Comunicação educativa do enfermeiro na promoção da saúde sexual do escolar Comunicación educativa del enfermero en la promoción de la salud sexual para escolares: ETS-SIDA Educative communication between nurses and students about STD/AIDS

    Directory of Open Access Journals (Sweden)

    Maria Alice F. Colli Oliveira

    1997-07-01

    Full Text Available A escola é o espaço crucial para o desenvolvimento de conhecimentos e habilidades junto aos seus integrantes e comun idade, visando a garantia de mudanças de comportamento. E, particularmente, por existir carência de informações aos alunos sobre sexualidade e DST-HIV/AIDS, dificultando resolução de seus problemas, procuramos pesquisar escolares das 3 séries do 2º grau, de uma cidade próxima de Ribeirão Preto - SP. Visamos identificar seus problemas, executando e avaliando ações educativas conjuntas sobre os problemas levantados. Os resultados evidenciaram que esses alunos relacionam a AIDS à fatalidade e temeridade, talvez influenciados pelas mensagens emitidas na 1ª década da história desta doença, enquanto hoje, a tendência é trabalhar conhecimentos atualizados e habilidades voltados à não discriminação e à solidariedade, em razão da existência já eminente do doente / doença, na sociedade. Conceituam a AIDS como doença do sexo e prevenível, porém revelando desinformação em outros aspectos básicos da temática, justificando necessidade de ações educativas. Portanto, sugerimos que os enfermeiros trabalhem efetivamente esta questão no cotidiano do escolar, tendo em vista sua saúde sexual e integral.lA escuela es el espacio crucial para el desarrollo de conocimientos y habilidades para la garantizar cambios de comportamiento. Por existir carencia de informaciones a los alunnos sobre sexualidad y EST - HIV/SIDA, dificultando la resolución de sus problemas, buscamos investigar escolares de los 3os años de escolaridad, de una ciudad próxima de Ribeirão Preto - SP. Intentamos identificar sus problemas, ejecutando y evaluando acciones educativas conjuntas acerca de los problemas encontrados. Los resultados evidenciaron que esos alunnos relacionan el SIDA a la fatalidad y temeridad, talves influenciados por los mensages emitidos en la 1ª década de la historia de la enfermedad, mientras hoy, la tendencia es

  14. Aspectos relacionados à fadiga durante o ciclismo: uma abordagem biomecânica Aspects related with fatigue during cycling: a biomechanical approach

    Directory of Open Access Journals (Sweden)

    Fernando Diefenthaeler

    2008-10-01

    Full Text Available A fadiga muscular pode ser definida como a incapacidade funcional na manutenção de um nível esperado de força. As competições de ciclismo, especialmente provas de estrada, apresentam como característica longa duração e altas intensidades. Tais características resultam na instauração do processo de fadiga, que pode estar associado a mecanismos e fatores metabólicos que afetam os músculos (fadiga periférica e o sistema nervoso central (fadiga central. O objetivo deste trabalho é fazer uma revisão sobre aspectos relacionados com as mudanças na técnica de pedalada e na atividade elétrica dos músculos envolvidos nesse movimento durante o processo de fadiga. Alguns desses aspectos têm sido reportados na literatura e podem ter repercussão na (1 magnitude, direção e sentido de aplicação das forças no pedal; no (2 padrão de ativação muscular; na (3 geração de força e, conseqüentemente, no (4 desempenho do ciclista. No entanto, poucos estudos associam a fadiga muscular ao comportamento das forças aplicadas no pedal e ao padrão da ativação muscular. Os resultados dos estudos revisados demonstram a incapacidade dos ciclistas em manter a força desejada, perda da técnica de pedalada e mudança nos padrões de ativação elétrica sob condições de fadiga.Muscular fatigue can be defined as functional inability to maintain a desired force output. During cycling competition, especially road races, cyclists are required to exercise for extended duration at high intensities. These features often result in fatigue, which can be associated with metabolic mechanisms and factors affecting both muscles (peripheral fatigue and the central nervous system (central fatigue. The aim of this study is to review aspects related to alterations in the pedaling technique and electrical activation of the muscles during a fatiguing exercise bout. Some of these alterations have been reported in the literature and can reflect on the (1

  15. O envolvimento paterno e o desenvolvimento social de crianças iniciando as atividades escolares La participación paterna y el desarrollo social de niños iniciando las actividades escolares Father involvement and the social development of children in the school-entry transition stage

    Directory of Open Access Journals (Sweden)

    Fabiana Cia

    2009-03-01

    Full Text Available Este estudo relacionou indicadores do envolvimento paterno com indicadores de desenvolvimento social dos filhos. Participaram 97 pares de pais e mães (com filhos na 1ª ou 2ª série e 20 professoras. Para avaliar o envolvimento paterno, pais e mães responderam à Avaliação do bem-estar pessoal e familiar e do relacionamento pai-filho - Versão Paterna, e para avaliar o desenvolvimento social das crianças, os pais, as mães e as professoras preencheram o Social Skills Rating System-SSRS. Quanto maior a freqüência de comunicação entre pai e filho e de participação do pai nos cuidados e nas atividades escolares, culturais e de lazer do filho, menor o índice de hiperatividade e de problemas de comportamento e mais adequado o repertório de habilidades sociais das crianças. Os resultados indicam a provável importância do envolvimento positivo do pai para o desenvolvimento social dos filhos e os prováveis benefícios de programas para promover envolvimento paterno.En este estudio se han relacionado indicadores de la participación paterna con los de desarrollo social de los hijos y participaron 97 padres y madres (con hijos en el primero o en el segundo grado y 20 profesoras. Para evaluar la participación paterna, padres y madres respondieron a la Evaluación del bienestar personal y familiar y del reracionamiento padre-hijo - Versión Paterna y para evaluar el desarrollo social de los niños, padres, madres y profesoras completaron el Social Skills Rating System-SSRS. Cuanto mayor es la frecuencia de comunicación entre padre e hijo, de la participación del padre en los cuidados y en las actividades escolares, culturales y de ocio del hijo, menor es el índice de hiperactividad, problemas de comportamiento y mayor es el repertorio de destrezas sociales de los niños. Los resultados indican la probable importancia de la participación positiva del padre para el desarrollo social de los hijos.This study aimed to examine the

  16. Teenage pregnancy: use of drugs in the third trimester and prevalence of psychiatric disorders Gravidez na adolescência: uso de drogas no terceiro trimestre e prevalência de transtornos psiquiátricos

    Directory of Open Access Journals (Sweden)

    Sandro Sendin Mitsuhiro

    2006-06-01

    a escola, 90,4% estão desempregadas e 92,5% são financeiramente dependentes, 6% usaram drogas durante o terceiro trimestre da gravidez (maconha: 4%, cocaína: 1,7%, ambos: 0,3% e 27,6% tiveram ao menos um transtorno psiquiátrico. Os diagnósticos mais freqüentes foram: depressão (12,9%, transtorno de estresse pós-traumático (10,0% e ansiedade (5,6%. DISCUSSÃO: Famílias desestruturadas, evasão escolar, desemprego e baixa capacitação profissional são fatores que contribuem para a manutenção desta situação socioeconômica desfavorável, cenário no qual são elementos importantes a alta prevalência de uso de cocaína e maconha no 3º trimestre da gravidez e de transtornos psiquiátricos.

  17. Effects induced after the use of maxillary protraction appliances: a literature review Efeitos induzidos após uso de aparelhos para tração reversa da maxila: uma revisão de literatura

    Directory of Open Access Journals (Sweden)

    Adanai de Brito Freire

    2012-08-01

    Full Text Available OBJECTIVE: The present literature review, examined the effects of maxillary protraction in patients treated with different types of facial masks. METHODS: The review searched for relevant articles, including randomized controlled trials, controlled clinical trials and uncontrolled trials. Comparisons were made between eight different types of facial masks: Delaire; Grummons; Petit; Turley; Batista; "Sky Hook"; Nanda and Türbinger. Following aspects were evaluated: a the type of anchorage; the origin, direction and magnitude of forces and b the relevant results of following skeletal and dental measurements: angular (SNA and SNB, linear (AFAI; vertical angles (SN.GoGn, FMA; dental (IMPA and linear (1-NA, 1-NB. CONCLUSION: The results showed that there was no uniformity in the choice of anchorage type and form of application of forces between the facial masks examined, but there were similarities in skeletal and dental aspects: Anterior displacement of the maxillary complex (increase in SNA ; anterior displacement of the upper anterior teeth (increase of 1-NA, the lingual inclination of mandibular incisors (decrease of 1-NB, down and back rotation of the mandible (increase AFAI, SN.GoGn, FMA, decrease in SNB.OBJETIVO: o presente trabalho de revisão de literatura consistiu em realizar um estudo comparativo entre diversos modelos de máscaras faciais em relação às suas influências dentárias e esqueléticas e suas implicações sobre a altura facial inferior. MÉTODOS: optou-se pela busca de artigos relevantes, abrangendo estudos randomizados controlados, ensaios clínicos controlados e não-controlados, incluídos de acordo com critérios de elegibilidade. Foi realizada a comparação entre oito diferentes modelos de máscaras faciais: Delaire, Grummons, Petit, Turley, Batista, Sky Hook, Nanda e Tübinger. Foram coletados: a o tipo de ancoragem, a origem, direção e magnitude das forças entre as máscaras faciais; e b os resultados

  18. Expresión diferencial de proteínas cardiacas en ratas diabéticas tipo Sprague-Dawley Differential heart protein expression in diabetic type Sprague-Dawley rats

    Directory of Open Access Journals (Sweden)

    Richard Southgate

    Full Text Available Se purificaron proteínas cardiacas a partir de ratas diabéticas y sanas de tipo Sprague-Dawley. Las proteínas fueron fraccionadas por medio de gel de electroforesis de dos dimensiones (2D-PAGE. La separación resultante fue visualizada por tinción con Coomassie azul. Luego de ser convertidas en imagen digital, las proteínas del grupo diabético y del grupo control fueron comparadas y correlacionadas para determinar los niveles de expresión diferenciada. Sesenta de las ciento ochenta proteínas en el gel fueron removidas y digeridas en fragmentos pequeños de péptidos, los cuales se analizaron por medio de espectrometría de masas para determinar la estructura primaria de los péptidos resultantes (secuencia de los aminoácidos. Esta información se registró en una base de datos (http://www.ncbi.nlm.nih.gov/ para determinar la identidad de las proteínas precedentes a los péptidos. Se determinó la identidad de las proteínas expresadas diferencialmente en el tejido cardiaco de ambos grupos; se encontraron varias proteínas expresadas en diferentes niveles a los normales cuando se analizaron los corazones de ratas diabéticas, incluyendo fosfatasa de tiroxina (PTP, Q60998, receptores de lipoproteínas de muy baja densidad (VLDL-R, P98156, perioxidasa de glutation (PHGPx, O70325, transferasa de serina hidroxilamina (SHMT, P50431, adenylyl cyclasa proteína 1 asociada (CAP1, P40124 y teletonina (TELT, O70548.Cardiac proteins were isolated from diabetic and wild type Sprague-Dawley rats, then fractionated by two dimensional gel electrophoresis (2D-PAGE using isoelectric focusing and molecular weight. The resulting protein spots were stained to facilitate detection. After being converted into a digital image, the proteins on the diabetic and wild type gels were matched to each other then compared to determine levels of expression. Sixty of the one hundred and eighty proteins on the gel were removed and digested to produce peptide fragments

  19. PREPUBLICATION: From structure topology to chemical composition. XXIII. Revision of the crystal structure and chemical formula of zvyaginite, a seidozerite-supergroup mineral from the Lovozero alkaline massif, Kola peninsula, Russia

    KAUST Repository

    Sokolova, E.

    2017-04-02

    The crystal structure and chemical formula of zvyaginite, ideally Na2ZnTiNb2(Si2O7)2O2(OH)2 (H2O)4, a lamprophyllite-group mineral of the seidozerite supergroup from the type locality, Mt. Malyi Punkaruaiv, Lovozero alkaline massif, Kola Peninsula, Russia have been revised. The crystal structure was refined with a new origin in space group C⎯1, a = 10.769(2), b = 14.276(3), c = 12.101(2) Å, α = 105.45(3), β = 95.17(3), γ = 90.04(3)°, V = 1785.3(3.2) Å3, R1 = 9.23%. The electron-microprobe analysis gave the following empirical formula [calculated on 22 (O + F)]:(Na0.75Ca0.09K0.04��1.12)Σ2 (Na1.12Zn0.88Mn0.17Fe2+0.04��0.79)Σ3(Nb1.68Ti1.25Al0.07)Σ3 (Si4.03O14)O2 [(OH)1.11F0.89]Σ2(H2O)4, Z = 4. Electron-diffraction patterns have prominent streaking along c* and HRTEM images show an intergrowth of crystalline zvyaginite with two distinct phases, both of which are partially amorphous. The crystal structure of zvyaginite is an array of TS (Titanium Silicate) blocks connected via hydrogen bonds between H2O groups. The TS block consists of HOH sheets (H = heteropolyhedral, O = octahedral) parallel to (001). In the O sheet, the [6]MO(1,4,5) sites are occupied mainly by Ti, Zn and Na and the [6]MO(2,3) sites are occupied by Na at less than 50%. In the H sheet, the [6]MH(1,2) sites are occupied mainly by Nb and the [8]AP(1) and [8]AP(2) sites are occupied mainly by Na and ��. The MH and AP polyhedra and Si2O7 groups constitute the H sheet. The ideal structural formula is Na��Nb2NaZn��Ti(Si2O7)2O2(OH)2(H2O)4. Zvyaginite is a Zn-bearing and Na-poor analogue of epistolite, ideally (Na��)Nb2Na3Ti(Si2O7)2O2(OH)2(H2O)4. Epistolite and zvyaginite are related by the following substitution in the O sheet of the TS-block: (Na+2)epi ↔ Zn2+ zvy + ��zvy. The doubling of the t1 and t2 translations of zvyaginite relative to those of epistolite is due to the order of Zn and Na along a (t1) and b (t2) in the O sheet of zvyaginite.

  20. Substitution of amalgam restorations: participative training to standardize criteria Substituição de restaurações de amálgama: um treinamento participativo para padronização de critérios

    Directory of Open Access Journals (Sweden)

    Elaine Toledo Pitanga Fernandes

    2004-09-01

    ções de amálgama. Cinco professores da disciplina de Clínica Integrada do Curso de Odontologia da Universidade Vale do Rio Doce (UNIVALE avaliaram através de exame visual e radiográfico 28 dentes permanentes extraídos contendo restaurações de amálgama. Na 1ª fase deste estudo, os examinadores avaliaram os dentes conforme seus critérios individuais para substituição ou permanência das restaurações. Na 2ª fase, os examinadores participaram de um programa de treinamento objetivando padronizar os critérios de avaliação. Na 3ª fase, logo após o treinamento, reavaliaram os dentes com critérios já padronizados. Na 4ª fase, cinco meses após o treinamento, repetiram-se os procedimentos da 3ª fase. Para cada restauração, os examinadores registravam em formulário próprio a principal razão para considerá-la satisfatória, com necessidade de substituição total, com necessidade de substituição parcial ou com necessidade de acabamento/polimento. Após a participação no programa de treinamento, o grupo de examinadores apresentou uma redução estatisticamente significante ("sign test": Z = 0,4989, p = 0,0022 na indicação de substituição das restaurações, resultado que se manteve, mesmo decorridos cinco meses após o treinamento. É possível organizar e implementar um programa de treinamento participativo para padronização de critérios na avaliação de restaurações de amálgama e obter resultados satisfatórios com impacto na prática clínica.

  1. Incidência de mortalidade por câncer no Rio Grande do Sul, Brasil Cancer: incidente and mortality in Rio Grande do Sul - Brazil

    Directory of Open Access Journals (Sweden)

    Lucio Borges Barcelos

    1983-10-01

    Full Text Available Apresenta-se estudo dos casos e óbitos de câncer notificados à Unidade de Informática da Secretaria da Saúde e do Meio Ambiente do do Rio Grande do Sul, Brasil no ano de 1979. A distribuição etária da morbimortalidade apresentou tendência, acentuadamente crescente com a idade. No sexo masculino, as localizações anatômicas de maior mortalidade, em ordem decrescente, foram: traquéia, brônquios e pulmão; estômago; esôfago; próstata e leucemias. Na incidência repetiram-se as mesmas localizações com introdução da pele em segundo lugar e saída das leucemias. No sexo feminino, mama; estômago; útero, outras localizações especificadas e as não especificadas; traquéia, brônquios e pulmão; e colo do útero, foram as cinco primeiras localizações de maior mortalidade. As neoplasias malignas da mama foram as que apresentaram maior incidência. Seguiram-se as neoplasias malignas da pele, do colo do útero, das outras localizações especificadas e as não especificadas do útero e do estômago. A distribuição geográfica mostrou uma morbimortalidade maior na 1ª, 3ª, 7ª, 10ª e 13ª Delegacia Regional de Saúde, em regiões caracterizadas ou por um elevado índice de industrialização ou pela existência de grandes propriedades rurais onde é praticada a pecuária extensiva. Uma vez feita a padronização, as neoplasias malignas de esôfago e laringe, apresentaram-se com coeficientes elevados, superando, no caso do esôfago, os coeficientes de outros países.A study of the incidence of, and deaths from, cancer as reported to the Welfare Ministry of Rio Grande do Sul State, Brazil, in 1979, is presented. The distribution of morbimortality showed an accentuated increase with age. In males the anatomic sites associated with higher mortality were (in decreasing order: trachea, bronchi and lungs, stomach, esophagus, prostate and leukemias. In incidence related to the same sites, however, skin cancer moved into second place and

  2. Compositional limits and analogs of monoclinic triple-chain silicates

    Science.gov (United States)

    Jenkins, David M.; Gilleaudeau, Geoffrey J.; Kawa, Cynthia; Dibiase, Jaclyn M.; Fokin, Maria

    2012-08-01

    Growing recognition of triple-chain silicates in nature has prompted experimental research into the conditions under which they can form and the extent of solid solution that is feasible for some key chemical substitutions. Experiments were done primarily in the range of 0.1-0.5 GPa and 200-850 °C for durations of 18-1,034 h. A wide range of bulk compositions were explored in this study that can be classified broadly into two groups: those that are Na free and involve various possible chemical substitutions into jimthompsonite (Mg10Si12O32(OH)4), and those that are Na bearing and involve chemical substitutions into the ideal end-member Na4Mg8Si12O32(OH)4. Numerous attempts to synthesize jimthompsonite or clinojimthompsonite were unsuccessful despite the type of starting material used (reagent oxides, magnesite + SiO2, talc + enstatite, or anthophyllite). Similarly, the chemical substitutions of F- for OH-, Mn2+, Ca2+, or Fe2+ for Mg2+, and 2Li+ for Mg2+ and a vacancy were unsuccessful at nucleating triple-chain silicates. Conversely, nearly pure yields of monoclinic triple-chain silicate could be made at temperatures of 440-630 °C and 0.2 GPa from the composition Na4Mg8Si12O32(OH)4, as found in previous studies, though its composition is most likely depleted in Na as evidenced by electron microprobe and FTIR analysis. Pure yields of triple-chain silicate were also obtained for the F-analog composition Na4Mg8Si12O32F4 at 550-750 °C and 0.2-0.5 GPa if a flux consisting of Na-halide salt and water in a 2:1 ratio by weight was used. In addition, limited chemical substitution could be documented for the substitutions of 2 Na+ for Na+ + H+ and of Mg2+ + vacancy for 2Na+. For the former, the Na content appears to be limited to 2.5 cations giving the ideal composition of Na2.5Mg8Si12O30.5(OH)5.5, while for the latter substitution the Na content may go as low as 1.1 cations giving the composition Na1.1Mg9.4Si12O31.9(OH)4.1 based on a fixed number of Si cations. Further

  3. Atividade Ovariana em Fêmeas Bovinas da Raça Holandesa e Mestiças Holandês x Zebu, Durante Dois Ciclos Estrais Normais Consecutivos

    Directory of Open Access Journals (Sweden)

    Alves Nadja Gomes

    2002-01-01

    Full Text Available Foram utilizadas 25 fêmeas, distribuídas de acordo com o grau de sangue Holandês x Zebu nos grupos: I = 1/2 Holandês x Zebu; II = 3/4 Holandês x Zebu; III= 15/16 Holandês x Zebu; IV= Holandês--PB¾PC; e V= 7/8 Holandês x Zebu. Após o segundo estro natural pós-parto, esses animais foram monitorados por exames ultra-sonográficos diários por dois ciclos estrais consecutivos, para verificar a atividade ovariana quanto à dinâmica folicular e à atividade do corpo lúteo. O período interovulatório médio foi de 22,08±2,46 dias, sendo de 21,76±3,33 e 21,94±2,90 dias no primeiro e no segundo ciclo estral, respectivamente, não havendo diferença entre os grupos estudados. Observou-se o crescimento de uma (6%, duas (78% e três (16% ondas foliculares durante o ciclo estral, com a predominância de duas ondas foliculares. O período interovulatório dos ciclos com três ondas mostrou-se mais longo (25,33±4,37 dias, em comparação com uma (16,0±3,6 dias e duas (21,83±1,77 dias ondas foliculares. A duração das ondas foliculares para ciclos estrais com três ondas de crescimento folicular foi de 11,0±3,69; 7,17±1,60; e 8,5±1,52 dias na 1ª, 2ª e 3ª ondas, respectivamente, e de 11,15±1,65 e 12,07±2,32 dias nos ciclos estrais com duas ondas foliculares. Os dias de maior concentração plasmática de progesterona no 1º e 2º ciclos estrais foram, respectivamente, de 13,6±3,0 (7,29±4,3 ng/mL e 11,8±3,4 (5,6±2,0 ng/mL dias, não se mostrando diferentes entre os grupamentos genéticos e ciclos estrais estudados. Pelas análises dos dados, pode-se concluir que os diferentes grupamentos genéticos apresentaram o mesmo comportamento na dinâmica folicular e que as concentrações de progesterona, embora diferentes em números absolutos entre os grupamentos, mostraram-se indicativas de atividade luteal normal.

  4. Efeito do método de abate e do sexo sobre a qualidade da carne de capivara (Hydrochaeris hydrochaeris Effect of slaughter method and gender on the meat quality of capybara (Hydrochaeris hydrochaeris L. 1766

    Directory of Open Access Journals (Sweden)

    Sandra H. I. Oda

    2004-09-01

    Full Text Available O presente trabalho teve como objetivo avaliar o efeito de dois métodos de abate (MA e do sexo sobre a qualidade de carne de capivaras. Os métodos de abate avaliados foram o humanitário (MH e por tiro (MT, sendo utilizados 2 lotes de 10 animais, um deles contendo 5 machos e 5 fêmeas e outro com 8 machos e 2 fêmeas, nos quais foram avaliados os valores de pH na 1ª, 3ª, 5ª, 7ª, 9ª, 11ª e 24ª horas após o abate e a perda de peso por cozimento (PPC, a cor e a força de cisalhamento (FC, em porções do músculo longissimus dorsi, retiradas entre a 10ª e 12ª vértebras. Os resultados obtidos indicaram que as médias de pH não foram influenciadas pelo MA e pelo sexo. Os valores médios foram: 6,24; 6,05; 6,01; 6,01; 6,03; 6,04 e 5,96 às 1, 3, 5, 7, 9, 11 e 24 horas, respectivamente. Em relação à cor, o MT apresentou valor de L* (32,40 superior (PThe aim of this study was to assess the effect of two slaughter methods (SM and the gender on the quality of capybara meat. The slaughter methods assessed were the humanitarian (HM and by head-shot (HS. Two lots of 10 animals were used, one of them containing 5 males and 5 females and the other containing 8 males and 2 females. Values of pH of the longissimus dorsi muscle (between the vertebras 10th and 12th after 1, 3, 5, 7, 9, 11 and 24h post mortem (p. m., color (L, a e b, weight losses by cooking (WLC and shear force (SF were assessed on samples obtained at these points. The results indicated that pH means were not influenced by both SM and sex. The medium values were: 6.24; 6.05; 6.01; 6.01; 6.03; 6.04 and 5.96 at 1, 3, 5, 7, 9, 11 and 24 hours respectively. That demonstrated that in those encourage the installation of the rigor mortis superficial with reduced extension glicolitic. Regarding the color, HS presented higher L* (32.40 values (P<0,05 than HM (29.59, and the effect of gender on this parameter was not observed. On the other color parameters and on WLC no differences among

  5. As diferenças de gênero na velhice Las diferencias de género en la vejez Gender differences in the oldness

    Directory of Open Access Journals (Sweden)

    Maria do Livramento Fortes Figueiredo

    2007-08-01

    Full Text Available Estudo de natureza qualitativa que teve como objeto investigar as questões de gênero presentes e determinantes da saúde e da qualidade de vida das pessoas que envelhecem. Os sujeitos foram 20(vinte idosos do Programa Terceira Idade em Ação PTIA. A entrevista semi-estruturada foi utilizada como técnica de coleta de dados. Das falas emergiram informações que responderam as inquietações da investigação e possibilitaram a formulação de três categorias de analises. Na 1ª destacou-se a baixa auto-estima vivenciada pelos homens ao envelhecerem, já na 2ª evidenciou-se à autonomia e a liberdade conquistada pelas mulheres idosas, e na 3ª o aprendizado ocorrido entre as mulheres idosas que se inseriram no PTIA. Concluindo-se que existe influência das questões de gênero na saúde e qualidade de vida na velhice.Estudio de naturaleza cualitativa que tuvo como objetivo investigar las cuestiones de género presentes y determinantes de la salud y de la calidad de vida de las personas ancianas. Los sujetos fueron 20 (veinte ancianos del programa Terceira Idade em Ação - PTIA. La entrevista semiestructurada fue utilizada como técnica de recolección de datos. De las declaraciones emergieran informaciones que respondieran las inquietudes de la investigación y hicieron posible la formulación de tres categorías de análisis. En la primera se destacó la baja autoestima vivida por los hombres cuando son ancianos, ya en la segunda se demostró la autonomía y la libertad conquistada por las mujeres mayores, y en la tercera el aprendizaje ocurrido entre las mujeres ancianas que se insirieron en PTIA. Concluyéndose que hay influencia de las cuestiones de género en la salud y calidad de vida en la mayoridad.Qualitative study that aimed at investigatiing present and decisive gender subjects of health and elder people's life quality. The subjects were 20 (twenty seniors of the Programa Terceira Idade em Ação PTIA. The semi

  6. Elaboração de empanado a partir da corvina (Micropogonias furnieri Preparation of breaded whitemouth croaker (Micropogonias furnieri

    Directory of Open Access Journals (Sweden)

    Marlice Bonacina

    2007-09-01

    Full Text Available O trabalho teve por objetivo elaborar empanado a partir da corvina (Micropogonias furnieri. Os pescados foram medidos, pesados, avaliados quanto ao frescor através do pH e bases voláteis totais (BVT e determinada sua composição proximal. As corvinas apresentaram um tamanho e peso médio de 28,0 cm e 268,3 g, respectivamente. O pH e as concentrações de N-BVT dos exemplares utilizados encontraram-se dentro dos limites indicados pela legislação brasileira. A composição proximal da corvina foi 78,7% de umidade, 18,8% de proteína, 1,2% de cinza e 1,1% de gordura. A partir de testes preliminares definiu-se a formulação base, a qual se utilizou para determinar o tempo de pré-fritura do produto, que foi de 30 segundos. Para definir a formulação final do produto, foi realizado um planejamento fatorial completo 2³, com triplicata dos pontos centrais, variando-se o tempo de lavagem do músculo (0; 15 e 30 segundos, concentração de lactato de sódio (0; 0,8 e 1,6% e de leite em pó (0; 1 e 2%. As variáveis respostas foram a CRA, umidade, proteína e gordura, bem como a qualidade geral sensorial e os atributos de aparência, crocância, textura e sabor. Através dos resultados, foi possível verificar que o tempo de lavagem do músculo foi o fator de maior influência nas características sensoriais do produto, enquanto que para as características físico-químicas observou-se que estas foram influenciadas pelos três fatores estudados. Dessa forma, a formulação selecionada foi a submetida à condição de: 30 segundos de lavagem do músculo, 2% de leite em pó e ausência de lactato de sódio.This study involved the preparation of breaded whitemouth croaker (Micropogonias furnieri. The fish were measured and weighed, their freshness was evaluated based on pH and total volatile bases (TVB, and their proximal composition was analyzed. The average size and weight were 28.0 cm and 268.3 g, respectively. The specimens’ pH and

  7. Variations in Os isotope ratios of pyrrhotite as a result of water-rock and magma-rock interaction: Constraints from Virginia Formation-Duluth Complex contact zones

    Science.gov (United States)

    Williams, Curtis D.; Ripley, Edward M.; Li, Chusi

    2010-08-01

    Os isotope ratios in pyrrhotite-bearing pelitic rocks of the ˜1.85 Ga Virginia Formation are variable, with perturbations linked to the emplacement of the ˜1.1 Ga Duluth Complex. Pyrrhotite in footwall rocks of the contact aureole show evidence for a mixing event at 1.1 Ga involving a low 187Os/ 188Os fluid. However, because rocks with perturbed pyrrhotite Os isotope ratios occur 1½ km or more from the Duluth Complex, the fluid is unlikely to have been of magmatic origin. Fluid inclusions in layer-parallel quartz veins provide evidence of the involvement of a boiling fluid at temperatures between ˜300 and 400 °C. Analyses of fluid inclusions via LA-ICP-MS show that the fluids contain up to 1.7 wt% Na, 1.1 wt% K, 4330 ppm Fe, 2275 ppm Zn, and 415 ppm Mg. The veins also contain pyrite or pyrrhotite, plus minor amounts of chalcopyrite, bornite, pentlandite, and sphalerite. The Re-Os isotopic ratios of pyrite from the veins indicate that they crystallized from low 187Os/ 188Os fluids (pyrite to pyrrhotite, and where time-integrated water-rock ratios in the aureole were high enough to provide a supply of Os. Troctolitic and gabbroic rocks of the Partridge River Intrusion, Duluth Complex, are characterized by Os isotope ratios that are indicative of variable degrees of crustal contamination ( γOs values of ˜0-543). Xenoliths of carbonaceous and sulfidic pelitic rocks of the Virginia Formation found in the igneous rocks provide evidence that Os was released by organic matter and pyrite in the sedimentary rocks and assimilated by mantle-derived magma. However, residual pyrrhotite produced as a result of pyrite breakdown in the xenoliths is characterized by 187Os/ 188Os ratios that are much lower than anticipated and similar to those of pyrrhotite in the contact aureole. The Os exchange and addition shown by pyrrhotite in the xenoliths highlight an unusual cycle of Re-Os liberation during devolatilization, kerogen maturation, and pyrite to pyrrhotite conversion

  8. Uso de drogas psicotrópicas por estudantes: prevalência e fatores sociais associados Use of psychotropics drugs among students: prevalence and associated social factors

    Directory of Open Access Journals (Sweden)

    Meire Soldera

    2004-04-01

    Full Text Available OBJETIVO: Determinar a prevalência do uso pesado de drogas por estudantes de primeiro e segundo graus em uma amostra de escolas públicas e particulares, e identificar fatores demográficos, psicológicos e socioculturais associados. MÉTODOS: Trata-se de um estudo transversal com uma técnica de amostragem do tipo intencional comparando-se escolas públicas de áreas periféricas e centrais e escolas particulares. Foi utilizado um questionário anônimo de autopreenchimento. A amostra foi constituída por 2.287 estudantes de primeiro e segundo graus da cidade de Campinas, SP, no ano de 1998. Considerou-se uso pesado, o uso de drogas em 20 dias ou mais nos 30 dias que antecederam a pesquisa. Para análise estatística, utilizou-se a análise de regressão logística politômica - modelo logito, visando identificar fatores que influenciem este modo de usar drogas. RESULTADOS: O uso pesado de drogas lícitas e ilícitas foi de: álcool (11,9%, tabaco (11,7%, maconha (4,4%, solventes (1,8%, cocaína (1,4%, medicamentos (1,1%, ecstasy (0,7%. O uso pesado foi maior entre os estudantes da escola pública central, do período noturno, que trabalhavam, pertencentes aos níveis socioeconômicos A e B, e cuja educação religiosa na infância foi pouco intensa. CONCLUSÕES: Maior disponibilidade de dinheiro e padrões específicos de socialização foram identificados como fatores associados ao uso pesado de drogas em estudantes.OBJECTIVE: To determine the prevalence of the heavy use of drugs among elementary and high school students in a sample of public and private schools, and to identify associated demographic, psychological, cultural and social factors. METHODS: This report describes a cross-sectional study using an intention-type sampling technique that compared public schools in central and peripheral areas and private schools. An anonymous self-administered questionnaire was applied. The sample consisted of 2,287 elementary and high school

  9. Consumo de substâncias psicoativas por adolescentes escolares de Ribeirão Preto, SP (Brasil. I - Prevalência do consumo por sexo, idade e tipo de substância

    Directory of Open Access Journals (Sweden)

    Gilson M. Muza

    1997-02-01

    Full Text Available INTRODUÇÃO: A preocupação suscitada quanto ao consumo de substâncias psicoativas pelos adolescentes tem mobilizado grandes esforços em todo o mundo na produção de conhecimento sobre este fenômeno. Decidiu-se estudar as taxas de prevalência de consumo de substâncias psicoativas de uso lícito e ilícito, sua distribuição por idade, sexo e a idade da primeira experiência com essas substâncias, entre adolescentes escolares do Município de Ribeirão Preto, SP, Brasil. MATERIAL DE MÉTODO: Um questionário devidamente adaptado e submetido a um teste de confiabilidade foi auto-aplicado a uma amostra proporcional de 1.025 adolescentes matriculados na oitava série do primeiro grau e primeiro, segundo e terceiro anos do segundo grau, das escolas públicas e privadas do município estudado. O questionário continha questões sobre o uso de dez classes de substâncias psicoativas, questões demográficas e informações de validação, além de questões de percepção e comportamento intrínseco ao consumo de drogas. RESULTADOS: Da amostra 88,9% consumiram bebidas alcoólicas alguma vez na vida; 37,7% utilizaram o tabaco; 31,1% os solventes; 10,5% os medicamentos; 6,8% a maconha; 2,7% a cocaína; 1,6% os alucinógenos e 0,3% consumiu alguma substância a base de opiácios. As taxas de consumo cresceram com a idade, para todas as substâncias; no entanto, o uso de tabaco e de substâncias ilícitas mostrou uma desaceleração nos anos que compreendem o final da adolescência. Verificou-se que os meninos consumiram mais do que as meninas, exceto para os medicamentos, com as meninas consumindo barbitúricos, anfetaminas e tranqüilizantes em proporções semelhantes ou maiores que os meninos. A idade da primeira experiência mostrou que o acesso às substâncias psicoativas ocorreu em idades bastante precoces. CONCLUSÕES: As substâncias psicoativas, sejam lícitas ou ilícitas, são freqüentemente experimentadas na adolescência, tanto

  10. Avaliação de diferentes programas de restrição alimentar na recria de matrizes avícolas tipo corte Evaluation of different feeding programs for broiler breeder females during the rearing period

    Directory of Open Access Journals (Sweden)

    Neventon Santi Vieira

    1995-01-01

    Full Text Available Para matrizes avícolas tipo corte o manejo de alimentação é de extrema importância, principalmente durante a fase de recria, período no qual a ave está desenvolvendo sua estrutura corporal. A resposta em termos de produção destas aves, depende da maneira como foram recriadas. Com o objetivo de avaliar diferentes programas de arraçoamento na recria de matrizes avícolas tipo corte, sobre o peso corporal, uniformidade de peso corporal e viabilidade criatória, conduziu-se este experimento no Setor de Avicultura do Departamento de Zootecnia da UFSM. O delineamento experimental foi inteiramente casualizado, constituído de 3 tratamentos com 4 repetições, tendo cada unidade experimental 67 aves. Na 1ª e 2ª semana de idade as aves foram alimentadas à vontade, na 3ª e 4ª semanas o arraçoamento foi diário controlado. Durante a fase de recria (5ª a 20ª semana de idade, as aves foram submetidas aos tratamentos (programas de arraçoamento: T1: 5ª a 14ª semana = dia sim, dia não ("Skip-a-Day"; 15ª a 17ª = 2 dias sim/1 dia não e da 18ª a 20ª semana, arraçoamento diário controlado; T2: 5ª a 8ª semana = dia sim, dia não ("Skip-a-Day", 9ª a 16ª = método 48-57-63h e da 17ª a 20ª semana = 2 dias sim/1 dia não; T3: 5ª a 20ª semana de idade = 48-57-63h de intervalo entre arraçoamentos. Os resultados obtidos mostraram que, pode-se recriar matrizes com maior intervalo entre arraçoamentos (48-57-63 horas, sem haver comprometimento dos parâmetros avaliados neste trabalho, e ainda com a vantagem de não ser necessário o arraçoamento nos finais de semana, reduzindo os custos com mão de obra.Feeding management is estremely important for broiler breeders, mainly during the rearing period, when the birds develop their corporal structure. The production performance of the hens depends on the conditions they were grown. An experiment was done at the Poultry Section of the Animal Science Department of the Federal University of

  11. Estimativa do filocrono em calêndula Estimating the phyllochron in calendula

    Directory of Open Access Journals (Sweden)

    Jana Koefender

    2008-08-01

    Full Text Available O objetivo deste trabalho foi estimar o filocrono em plantas de calêndula (Calendula officinalis L. cultivadas em diferentes épocas de semeaduras. Realizaram-se três épocas de semeaduras: 06/04/2005, 23/06/2005 e 03/10/2006, no interior de uma estufa plástica com área de 240m2, instalada no campus da Universidade Federal de Santa Maria, UFSM. A semeadura foi realizada em vasos plásticos com capacidade volumétrica para cinco litros. O delineamento experimental foi inteiramente casualizado com 320 vasos em cada época, sendo distribuído em quatro fileiras de 80 vasos cada. Em uma planta de oito vasos de cada quatro fileiras, fez-se a contagem, semanalmente, do número de folhas emergidas da haste principal e na primeira haste lateral. Os dados do número de folhas foram correlacionados com a soma térmica diária acumulada, considerando-se uma temperatura base de 8°C. Constatou-se que o filocrono variou com a época de semeadura, sendo o menor valor igual 15,9°C dia folha-1, obtido na 2ª época de semeadura e o maior, igual a 24,5°C dia folha-1, na 1ª época na haste principal e 48,9°C dia folha-1 na semeadura de outubro na primeira haste lateral.The objective of this study was to estimate the phyllochron in calendula (Calendula officinalis L. grown in different sowing dates. Three sowing dates (06/04/2005, 23/06/2005 and 03/10/2006 were performed inside a 240m2 plastic greenhouse at the Campus of the Federal University of Santa Maria, RS, Brazil. Sowing was in five liter plastic pots. The experimental design was a completely randomized with 320 pots on each sowing date and rows with 80 pots. The number of leaves in the main stem and oi the first lateral branch was counted on a weekly basis in one plant of eight pots. The number of leaves data was regressed against accumulated thermal time, assuming a base temperature of 8oC. The main stem phyllochron varied with sowing date, with the lowest value (15.9°C day leaf -1 obtained on

  12. Evaluación del Residuo del Cultivo de Agaricus bisporus como Alimento de Vacas Lecheras en Lactancia Media / Evaluation of the Agaricus bisporus Spent Compost as Feed of Dairy Cows in Mid Lactation

    Directory of Open Access Journals (Sweden)

    Juan Miguel Gómez Urrego

    2014-06-01

    Full Text Available Resumen. Se evaluó el potencial del residuo del cultivo de la seta Agaricus bisporus como materia prima para la alimentación de vacas lecheras en segundo tercio de lactancia. Para esto, se sustituyó 10% del concentrado comercial por el residuo (sin turba y se evaluó su efecto en la producción, el balance nutricional de las vacas y el costo final del concentrado. El diseño experimental fue un cross-over o de intercambio con medidas repetidas en eltiempo. Cada periodo experimental tuvo una duración de 14 días. Se utilizaron dos grupos de animales, uno con 4 vacas Holstein y otro con 4 vacas cruzadas Holstein x BON. En promedio, las vacas tenían 117 ± 18,6 días en leche, 2,6 ± 0,9 partos, 529,5 ± 52,9 kg peso vivo y una producción de leche/día de 15,42 ± 2,6 L. El tratamiento experimental redujo los nutrientes digeribles totales de la dieta total en 2%. No hubo diferencias estadísticas en el balance nutricional de las vacas a causa del tratamiento experimental. Tampoco hubo diferencia estadística en cuanto a la producción de leche (14,4 L y calidad composicional (% de grasa:3,86; % de proteína: 3,5; relación grasa: proteína: 1,11. El análisis de costos mostró que al incluirse en el concentrado un 10% del residuo de A. bisporus (Champiñosa se obtenía una reducción en los costos de alimentación de $403 pesos colombianos/vaca/día. / Abstract. This study evaluated the potential of the growth bed of the mushroom Agaricus bisporus as a feed for mid lactation dairy cows. We replaced 10% of commercial concentrate with the residue (peat removed and assessed its effect on milk production, nutritional balance of the cows and final cost of the concentrate. The experimental design was a cross-over or change-over with repeated measurements. Each experimental period lasted 14 days. Two groups of animals, one with four Holstein cows and one with four crossbred Holstein x BON cows were used. On average, cows had 117

  13. Efeito do óleo de eucalipto (Corymbia citriodora no controle do carrapato bovino Effect of eucalyptus oil (Corymbia citriodora on the control of cattle ticks

    Directory of Open Access Journals (Sweden)

    Clair Jorge Olivo

    2013-02-01

    Full Text Available Esta pesquisa foi conduzida com o objetivo de avaliar o efeito in vitro e in vivo do óleo de eucalipto (Corymbia citriodora sobre o carrapato bovino (Rhipicephalus (Boophilus microplus. Na experimentação in vitro, foi utilizado o grupo controle negativo e oito concentrações de óleo de eucalipto (0,5; 1; 2; 5; 10; 20; 50; 100%, em fêmeas ingurgitadas de carrapato. A eficácia de controle foi de 0; 30,5; 75,5; 91; 100; 100; 100; 100 e 100%, respectivamente. Para a experimentação in vivo, foram constituídos três grupos (controle negativo; óleo de eucalipto a 3,5% - nível estimado mediante análise de regressão, correspondendo a 95% de eficácia de controle do carrapato da pesquisa in vitro e amitraz a 0,025%, com dezoito vacas da raça Holandesa. Antes (média dos dias -3, -2,-1 e após a aplicação do produto (1, 2, 3, 5, 7, 10, 14, 21dias, foram contadas fêmeas ingurgitadas de carrapato. A eficácia de controle foi de 0; 96,4 e 69%, respectivamente, 21 dias após o tratamento. Na 1ª e na 2ª ordenha após a aplicação dos tratamentos, foram avaliadas variáveis fisiológicas e coletadas amostras de leite para avaliar as propriedades organolépticas no leite e no iogurte (controle negativo x tratamento fitoterápico. O teste de aceitação sensorial do leite e das variáveis fisiológicas avaliadas foram similares entre os tratamentos.This research was aimed at evaluating in vitro and in vivo effects of eucalyptus (Corymbia citriodora oil on cattle ticks (Rhipicephalus (Boophilus microplus. Negative control group and eight concentrations of eucalyptus oil (0.5; 1; 2; 5; 10; 20; 50; 100%, were used on in vitro trials with engorged female ticks. The efficacy of control ticks was 0; 30.5; 75.5; 91; 100; 100; 100; 100 and 100%, respectively. At the in vivo trial eighteen Holstein cows were allocated to three groups (negative control, eucalyptus oil at 3.5% - level estimated by regression analysis, accounting for 95% efficacy of

  14. Production of cheese goat milk, “Camponês” kind, with different levels of lactic ferment Produção de queijo de leite de cabra, tipo "Camponês", com diferentes níveis de fermento lático

    Directory of Open Access Journals (Sweden)

    Maria José Baptista Barbosa

    2008-06-01

    15 dias. Foram feitas análises microbiológicas e físico-químicas do leite e do queijo, s foram medidos os tempos de coagulação e volume de soro. À medida que se aumenta o teor de fermento lático diminui o tempo de coagulação e o volume de soro, e aumentou o rendimento e o teor de umidade. Tanto o leite de cabra como o queijo apresentaram ótima qualidade sanitária, e a Análise Sensorial mostrou uma preferência pelos queijos feitos com 1,0 e 2,0% de fermento lático. O leite de cabra apresentou 3,6% de gordura, 3,3% de proteína, 1,0338 g/cm3 de densidade e 19°D de acidez. O queijo apresentou de gordura, de proteína. Palavras-chave: Streptococcus lactis, Streptococcus cremoris, tempo de coagulação, umidade, gordura, proteína.

  15. Mie light scattering calculations for an Indian age-related nuclear cataract with a high density of multilamellar bodies.

    Science.gov (United States)

    Gilliland, Kurt O; Johnsen, Sonke; Metlapally, Sangeetha; Costello, M Joseph; Ramamurthy, Balasubramanya; Krishna, Pravin V; Balasubramanian, Dorairajan

    2008-03-24

    Multilamellar bodies (MLBs) are lipid-coated spheres (1-4 microm in diameter) found with greater frequency in the nuclear region of human age-related cataracts compared with human transparent lenses. Mie light scattering calculations have demonstrated that MLBs are potential sources of forward light scattering in human age-related nuclear cataracts due to their shape, size, frequency, and cytoplasmic contents, which often differ in refractive index from their surroundings. Previous studies have used data from several non-serial tissue sections viewed by light microscopy to extrapolate a volume and have assumed that MLBs are random in distribution. Currently, confocal microscopy is being used to examine actual tissue volumes from age-related nuclear cataracts and transparent lenses collected in India to confirm MLB shape, size, frequency, and randomness. These data allow Mie scattering calculations to be done with directly observed MLBs in intact tissue. Whole Indian donor lenses and Indian lens nuclei after extracapsular cataract extraction were immersion-fixed in 10% formalin for 24 h and in 4% paraformaldehyde for 24 h before sectioning with a Vibratome. The 160 microm thick sections were stained for 24 h in the lipid dye DiI (1,1'-dilinoleyl-3,3,3',3' tetramethylindocarbocyanine, 4-chlorobenzenesulfonate), washed, stabilized in Permount under coverslips and examined with a Zeiss LSM 510 confocal microscope. Individual volumes of tissue (each typically 500,000 microm(3)) were examined using a plan-apochromat 63X oil (NA=1.4) lens. Other lenses were prepared for electron microscopy and histological examination using previously described procedures. Analysis of tissue volumes within Indian age-related nuclear cataracts and transparent lenses has confirmed that most MLBs are 1-4 microm in diameter and typically spherical with some occurring as doublets or in clusters. Most Indian cataracts and transparent lenses are similar to samples obtained in the United States

  16. Políticas públicas para o controle da anemia ferropriva Public policies to control iron deficiency in Brazil

    Directory of Open Access Journals (Sweden)

    Sophia C. Szarfarc

    2010-06-01

    Full Text Available A anemia por deficiência de ferro configura um problema epidemiológico da maior relevância atuando nos gastos públicos de saúde, nas consequências sociais do aumento de riscos no período gestacional, na redução da produtividade e, ainda, nas consequências, em longo prazo, do desenvolvimento mental. Algumas datas marcam o envolvimento do governo brasileiro em busca de alternativas de controle da deficiência marcial: 1977 - 1ª Reunião do Ministério da Saúde (INAN, com especialistas nacionais e internacionais, para discutir perspectivas e intervenções para o controle da anemia; 1982/83 - distribuição de suplemento de ferro para a clientela do Programa de Atenção à Gestante e dosagem de hemoglobina na 1ª consulta; 1992 - assinatura de compromisso brasileiro de reduzir em 1/3 a prevalência de anemia em gestantes; 1994 - implantação do Programa de Leite Vivaleite, no estado de São Paulo, fornecendo leite fortificado com ferro a famílias com crianças até 6 anos e renda inferior a dois salários mínimos; 2002/junho 2004 - fortificação das farinhas de trigo e de milho com ferro; 2005 - programa de suplementação de ferro a lactentes; 2009/março - divulgação do resultado do levantamento de prevalência de anemia em mulheres (15-49 anos e crianças (6 - 59 meses no Brasil; 2009/agosto - foi reeditada a Portaria no 1793/GM/agosto/2009 do Ministério da Saúde, instituindo a Comissão Interinstitucional para implementação, acompanhamento e monitorização das ações de fortificação das farinhas de trigo e milho e seus subprodutos.Iron deficiency anemia is a vast epidemiologic problem evidenced by health public spending, the social consequences of increased risk in pregnancy, low production, and also by long term consequences of cognitive development. Some points in time highlight the involvement of the Brazilian government: 1977 - 1st Health Minister Meeting (INAN, with international and national specialists to

  17. Montane wetland water chemistry, Uinta Mountains, Utah

    Science.gov (United States)

    Severson, K. S.; Matyjasik, M.; Ford, R. L.; Hernandez, M. W.; Welsh, S. B.; Summers, S.; Bartholomew, L. M.

    2009-12-01

    This study attempts to determine the relationship between surface and groundwater chemistry and wetland characteristics within the Reader Lakes watershed, Uinta Mountains. The dominant rock type in the study area is quartz sandstone of the Hades Pass formation, Unita Mountain Group (Middle Proterozoic). Minor amounts of interbedded arkose and illite-bearing shale are also present. Water chemistry data have been collected from more than one hundred locations during the 2008 and 2009 summer seasons. The Reader Creek watershed is approximately 9.8 km long and about 3.5 km wide in the central portion of the basin. Direct precipitation is the primary source of groundwater recharge and the area is typically covered by snow from November until May. Four distinct wetland complexes, designated as the upper, middle, lower and the sloping fen, constitute the major wetland environments in the study area. The chemistry of the melt water from the high-elevation snowfield is affected by weathering of incorporated atmospheric dust and surface rocks. Total dissolved solids in both years were between 7 and 9 mg/L. Major anions include HCO3 (averaging 4.0 mg/L), SO4 (1.3 mg/L), NO3 (0.9 mg/L), Cl (0.8 mg/L), F (0.07 mg/L), PO4 (0.03 mg/L), and Br(0.015 mg/L). Major cations include Na (1.1 mg/L), Ca (1.0 mg/L), K (0.28 mg/L), and Mg (0.15 mg/L). Groundwater concentrations in the lower meadow, as measured in piezomters, are distinctly different, with the following maximum concentrations of anions: HCO3 (36.7 mg/L), SO4 (5.0 mg/L), Cl (3.4 mg/L), NO3 (0.9 mg/L), PO4 (0.28 mg/L), F (0.23 mg/L), Br (0.12 mg/L), and cations: Ca (22 mg/L), Na (4.6 mg/L), Mg (3.4 mg/L), and K (1.8 mg/L)- with a maximum value of 83 mg/L for total dissolved solids. Waters in Reader Creek, the main trunk channel, are typically sodium-potassium and sodium -potassium bicarbonate, with some calcium-bicarbonate, mostly in the middle part of the watershed. Groundwater from springs is sodium-potassium in the upper

  18. Universe Clinopyroxene barometer -recalibrations on the results of the orthopyroxene thermobarometry and experimental results and applications to the clinopyroxene geotherms

    Science.gov (United States)

    Ashchepkov, I. V.

    2009-04-01

    The internal exchange of Jd-Di components on clinopyroxene allow to calibrate the universal clinopyroxene thermobarometer (Ashchepkov, 2001; 2002; 2003) based on experimental data for different systems including peridotitic, eclogitic and igneous which are represented by the augite cumulates as well as salites from the basic granulates from low crust. The equation to the peridotitic system was calibrated on the results of the othopyroxene thermobarometry (Brey. Kohler,1990- McGregor,1974). Modifications allow receiving the better agreement with the orthopyroxene estimates and results of polymineral thermobarometry (Brey, Kohler, 1990) as well as the clinopyroxene thermobarometry (Nimis, Taylor, 2000). The following equation allows working with the peridotite of the mantle lithosphere beneath cratons (30-80) kbar. P(Ash2009)=0.32 (1-0.2*Na/Al+0.012*Fe/Na)*Kd^(3/4)*ToK/(1+Fe)-35*ln(1273/ToK)*(Al+Ti+2.5Na+1.5Fe3+)+(0.9-CaO)*10+Na20/Al2O3*ToK /200 with the second iteration P=(0.0000002* P4 +0.000002+P^3-0.0027*P^2+1.2241*P) Checking of the HP experiments (Brey et al 2008, Walter, 1998; Falloon, Green, 1989; Dasgupta et al., 2007 etc.) it show the precision close to those of the best barometers (McGregor, 1974) ~5-7 but much more wider compositional range including metasomatic associations and The equation for the Al - rich assemblages allow to obtain the pressure estimates fro the megacrystalls and Al - rich peridotitic clinopyroxenes from the mantle xenoliths carried by alkaline basalts: P(Ash2009)=0.035*Kd*ToK(1+2.44Fe)-50.2 ln(1273/ToK) (Al+Ti+Na) Together with the clinopyroxene thermometer (Nimis, Taylor, 2000) it produces the TP estimates very close to those obtained with (Brey, Kohler, 1990) and values of experiments for the melting of basalts. The meagacrystalls show the polybaric origin and their range of estimated pressure corresponds well to determined for mantle peridotites and pyroxenites. The clinopyroxene geotherms for S. Africa (Boyd, Nixon, 1974

  19. Efeito hipolipidêmico do suco de camu-camu em ratos

    Directory of Open Access Journals (Sweden)

    Maíra Cássia Schwertz

    2012-02-01

    Full Text Available OBJETIVO: Este estudo teve como objetivo avaliar o potencial hipolipidêmico do suco de camu-camu (Myrciaria dubia (Kunth McVaugh em ratos dislipidêmicos. MÉTODOS: Foram utilizados 72 ratos (Rattus norvegicus var. albinus machos adultos da linhagem Wistar, com peso médio de 200g. O experimento foi dividido em duas fases: indução da dislipidemia e tratamento. Para indução da dislipidemia, todos os ratos receberam ração hiperlipídica (ração comercial adicionada a 10,0% de banha suína, 1,0% colesterol e 0,1% de ácido cólico durante 21 dias. Na fase de tratamento, 40 ratos dislipidêmicos foram divididos aleatoriamente em 5 grupos (n=8, sendo 3 deles submetidos a tratamento com diferentes concentrações de suco de camu-camu (0,4mL.kg-1, 4,0mL.kg-1 e 10mL.kg-1 por 14 dias, 1 grupo submetido a tratamento com quercetina (10mL.kg-1 e 1 grupo hiperlidêmico. Estes dois últimos foram mantidos como parâmetro, ao lado do grupo basal. Para avaliar o efeito modulador do suco de camu-camu no perfil lipídico dos ratos, foram verificadas as concentrações de triacilgliceróis, colesterol total, lipoproteína de alta intensidade e lipoproteína de baixa intensidade, no plasma, assim como os níveis de colesterol fecal e hepático. Também foram observados o controle da ingestão de ração e a avaliação da massa corporal. RESULTADOS: As diferentes doses de suco de camu-camu e de quercetina apresentaram efeitos moduladores do perfil lipídico, ou seja, redução de triacilgliceróis, colesterol total, excreção fecal de colesterol, bem como redução do colesterol hepático. Salienta-se que os melhores resultados foram obtidos com a concentração de 10mL.kg-1. Em relação à massa corporal, os ratos que receberam essa concentração de suco de camu e quercetina mantiveram peso significativamente inferior ao obervado nos demais tratamentos, tanto no início quanto ao final da intervenção. Resultado similar foi observado quanto ao consumo

  20. Projeto jovem doutor bauru: capacitação de estudantes do ensino médio em saúde auditiva Young doctor Bauru project: training of high school students in hearing health

    Directory of Open Access Journals (Sweden)

    Wanderléia Quinhoeiro Blasca

    2013-01-01

    Full Text Available OBJETIVO: elaborar um programa de capacitação para alunos do ensino médio sobre o tema saúde auditiva. MÉTODO: 14 estudantes do ensino médio de duas escolas da rede pública participaram do programa de capacitação. O programa foi dividido em 3 etapas: atividade presencial, tutoração on line e atividade prática. Na 1ª etapa, os participantes frequentaram uma aula expositiva ministrada pelos tutores. Na 2ª etapa os participantes tiveram acesso a um tutor eletrônico baseado na Internet, o Cybertutor. Na 3ª etapa foram elaboradas atividades práticas, proporcionando aos alunos a construção e multiplicação do aprendizado. Para avaliar o material educacional on line os participantes responderam um questionário de avaliação sobre o Cybertutor no término do programa de capacitação. RESULTADOS: 100% dos participantes realizaram as 3 etapas do programa de capacitação. Seguindo a proposta do Projeto Jovem Doutor, os alunos foram intitulados "Jovens Doutores" e multiplicaram o conhecimento adquirido sobre saúde auditiva, através de uma feira expositiva, em suas respectivas escolas. Os dados do questionário de avaliação sobre o Cybertutor indicam que a maioria dos participantes apresentou opinião positiva, demostrando um alto índice aprovação do Cybertutor. CONCLUSÃO: este programa de capacitação em saúde auditiva favoreceu o aprendizado nesta temática para a população proposta. Iniciativas de educação em saúde, como o Projeto Jovem Doutor, além de proporcionar a multiplicação do conhecimento, possibilitou também a integração dos alunos participantes com a Universidade e da Universidade para com a comunidade, constituindo uma rede de aprendizagem colaborativa.PURPOSE: to develop a training program for high school students on hearing health. METHOD: 14 high school students from two public schools participated in the training program. The program was divided into three stages: classroom activities, online