Energy Technology Data Exchange (ETDEWEB)
Peteranderl, R.; Canganella, F.; Holzenburg, A.; Wiegel, J. [Univ. of Georgia, Athens, GA (United States)
1993-10-01
Autolysis was induced to form stable, cell wall-free cells of Clostridium thermohydrosulfuricum JW102 and Thermoanaerobacter ethanolicus JW200, using a complex medium containing glycine (0.4% wt/vol) and/or sucrose or glycerol (10% wt/vol) at an optimum temperature of 64{degrees}C. Autoplasts of both bacteria were grown as L-phase colonies on solid medium; more than 50% of these colonies regenerated to the walled form during prolonged incubation. The removal of the cell wall was confirmed by electron microscopy.
High ethanol producing derivatives of Thermoanaerobacter ethanolicus
Ljungdahl, L.G.; Carriera, L.H.
1983-05-24
Derivatives of the newly discovered microorganism Thermoanaerobacter ethanolicus which under anaerobic and thermophilic conditions continuously ferment substrates such as starch, cellobiose, glucose, xylose and other sugars to produce recoverable amounts of ethanol solving the problem of fermentations yielding low concentrations of ethanol using the parent strain of the microorganism Thermoanaerobacter ethanolicus are disclosed. These new derivatives are ethanol tolerant up to 10% (v/v) ethanol during fermentation. The process includes the use of an aqueous fermentation medium, containing the substrate at a substrate concentration greater than 1% (w/v).
Karume, Ibrahim; Musa, Musa M.; Bsharat, Odey; Takahashi, Masateru; Hamdan, Samir; El Ali, Bassam
2016-01-01
The immobilization of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase (TeSADH) using sol–gel method enables its use to racemize enantiopure alcohols in organic media. Here, we report the racemization of enantiopure phenyl
Musa, Musa M.
2013-01-01
Controlled racemization of enantiopure phenyl-ring-containing secondary alcohols is achieved in this study using W110A secondary alcohol dehydrogenase from Thermoanaerobacter ethanolicus (W110A TeSADH) and in the presence of the reduced and oxidized forms of its cofactor nicotinamide-adenine dinucleotide. Racemization of both enantiomers of alcohols accepted by W110A TeSADH, not only with low, but also with reasonably high, enantiomeric discrimination is achieved by this method. Furthermore, the high tolerance of TeSADH to organic solvents allows TeSADH-catalyzed racemization to be conducted in media containing up to 50% (v/v) of organic solvents. © 2013 The Royal Society of Chemistry.
Karume, Ibrahim
2016-10-04
The immobilization of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase (TeSADH) using sol–gel method enables its use to racemize enantiopure alcohols in organic media. Here, we report the racemization of enantiopure phenyl-ring-containing secondary alcohols using xerogel-immobilized W110A TeSADH in hexane rather than the aqueous medium required by the enzyme. We further showed that this racemization approach in organic solvent was compatible with Candida antarctica lipase B (CALB)-catalyzed kinetic resolution. This compatibility, therefore, allowed a dual enzymatic dynamic kinetic resolution of racemic alcohols using CALB-catalyzed kinetic resolution and W110A TeSADH-catalyzed racemization of phenyl-ring-containing alcohols.
Zhou, Jilai; Shao, Xiongjun; Olson, Daniel G; Murphy, Sean Jean-Loup; Tian, Liang; Lynd, Lee R
2017-05-01
Thermoanaerobacter ethanolicus is a promising candidate for biofuel production due to the broad range of substrates it can utilize and its high ethanol yield compared to other thermophilic bacteria, such as Clostridium thermocellum. Three alcohol dehydrogenases, AdhA, AdhB and AdhE, play key roles in ethanol formation. To study their physiological roles during ethanol formation, we deleted them separately and in combination. Previously, it has been thought that both AdhB and AdhE were bifunctional alcohol dehydrogenases. Here we show that AdhE has primarily acetyl-CoA reduction activity (ALDH) and almost no acetaldehyde reduction (ADH) activity, whereas AdhB has no ALDH activity and but high ADH activity. We found that AdhA and AdhB have similar patterns of activity. Interestingly, although deletion of both adhA and adhB reduced ethanol production, a single deletion of either one actually increased ethanol yields by 60-70%.
International Nuclear Information System (INIS)
Watanabe, L.; Arni, R.K.
1996-01-01
Full text. Ethanol fermentations from Saccharomyces sp. are used in industrial ethanol production and are performed at mesophilic temperatures where final ethanol concentrations must exceed 4% (v/v) to make the process industrially economic. In addition, distillation is required to recover ethanol. Thermophilic fermentations are very attractive since they enable separation of ethanol from continuous cultures at process temperature and reduced pressure. Two different ethanol-production pathways have been identified for thermophilic bacteria; type I from Clostridium thermocellum, which contains only NADH-linked primary-alcohol dehydrogeneases, and type II from Thermoanaerobacter brockii which in addition include NADPH-linked secondary-alcohol dehydrogenases. The thermophilic anaerobic bacterium T ethanolicus 39E produces ethanol as the major end product from starch, pentose and herose substrates. The 2 Adh has a lower catalytic efficiency for the oxidation of 1 alcohols, including ethanol, than for the oxidation of secondary (2) alcohols or the reduction of ketones or aldehydes and possesses a significant acetyl-CoA reductive thioesterase activity. Large single crystals (0.7 x 0.3 x 0.3 mn) of this enzyme have been obtained at 40 0 C and diffraction data to 2.7 A resolution has been collected (R merge = 10.44%). Attempts are currently underway to obtain higher resolution data and a search for heavy atom derivatives is currently underway. The crystals belong to the space group P2 1 2 1 2 with cell constants of a a= 170.0 A, b=125.7 A and c=80.5 A. The asymmetric unit contains a tetramer as in the case of the crystals of the secondary alcohol dehydrogenase from Thermoanaerobacter brockii with a V M of 2.85 A 3 /Da. (author)
Liu, Zhi-Qiang; Zheng, Wei; Huang, Jian-Feng; Jin, Li-Qun; Jia, Dong-Xu; Zhou, Hai-Yan; Xu, Jian-Miao; Liao, Cheng-Jun; Cheng, Xin-Ping; Mao, Bao-Xing; Zheng, Yu-Guo
2015-08-01
High fructose corn syrup (HFCS) is an alternative of liquid sweetener to sucrose that is isomerized by commercial glucose isomerase (GI). One-step production of 55 % HFCS by thermostable GI has been drawn more and more attentions. In this study, a new hyperthermophilic GI from Thermoanaerobacter ethanolicus CCSD1 (TEGI) was identified by genome mining, and then a 1317 bp fragment encoding the TEGI was synthesized and expressed in Escherichia coli BL21(DE3). To improve the activity of TEGI, two amino acid residues, Trp139 and Val186, around the active site and substrate-binding pocket based on the structural analysis and molecular docking were selected for site-directed mutagenesis. The specific activity of mutant TEGI-W139F/V186T was 2.3-fold and the value of k cat/K m was 1.86-fold as compared to the wild type TEGI, respectively. Thermostability of mutant TEGI-W139F/V186T at 90 °C for 24 h showed 1.21-fold extension than that of wild type TEGI. During the isomerization of glucose to fructose, the yield of fructose could maintain above 55.4 % by mutant TEGI-W139F/V186T as compared to 53.8 % by wild type TEGI at 90 °C. This study paved foundation for the production of 55 % HFCS using the thermostable TEGI.
NCBI nr-aa BLAST: CBRC-EEUR-01-0292 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-EEUR-01-0292 ref|ZP_01453909.1| Abortive infection protein [Thermoanaerobacter... ethanolicus X514] gb|EAU58431.1| Abortive infection protein [Thermoanaerobacter ethanolicus X514] ZP_01453909.1 0.40 36% ...
Anaerobic thermophilic culture-system
Energy Technology Data Exchange (ETDEWEB)
Ljungdahl, L G; Wiegel, J K.W.
1981-04-14
A mixed culture system of Thermoanaerobacter ethanolicus and Clostridium thermocellum is employed for anaerobic, thermophilic ethanol fermentation of cellulose. By cellulase action, monosaccharides are formed which inhibit the growth of C. thermocellum, but are fermented by T. ethanolicus. Thus, at a regulated pH-value of 7.5, this mixed culture system of micro organisms results in a cellulose fermentation with a considerably higher ethanol yield.
GPM GROUND VALIDATION JOSS-WALDVOGEL DISDROMETER (JW) NSSTC V1
National Aeronautics and Space Administration — The GPM Ground Validation Joss-Waldvogel Disdrometer (JW) NSSTC dataset was collected by the Joss-Waldvogel (JW) disdrometer, which is an impact-type...
Balk, Melike
2009-08-23
A novel anaerobic, thermophilic, Gram-positive, spore-forming, and sugar-fermenting bacterium (strain TLO) was isolated from a geothermal spring in Ayaş, Turkey. The cells were straight to curved rods, 0.4-0.6 microm in diameter and 3.5-10 microm in length. Spores were terminal and round. The temperature range for growth was 40-80 degrees C, with an optimum at 70 degrees C. The pH optimum was between 6.3 and 6.8. Strain TLO has the capability to ferment a wide variety of mono-, di-, and polysaccharides and proteinaceous substrates, producing mainly lactate, next to acetate, ethanol, alanine, H(2), and CO(2). Remarkably, the bacterium was able to grow in an atmosphere of up to 25% of CO as sole electron donor. CO oxidation was coupled to H(2) and CO(2) formation. The G + C content of the genomic DNA was 35.1 mol%. Based on 16S rRNA gene sequence analysis and the DNA-DNA hybridization data, this bacterium is most closely related to Thermoanaerobacter thermohydrosulfuricus and Thermoanaerobacter siderophilus (99% similarity for both). However, strain TLO differs from Thermoanaerobacter thermohydrosulfuricus in important aspects, such as CO-utilization and lipid composition. These differences led us to propose that strain TLO represents a subspecies of Thermoanaerobacter thermohydrosulfuricus, and we therefore name it Thermoanaerobacter thermohydrosulfuricus subsp. carboxydovorans.
Balk, Melike; Heilig, Hans G H J; van Eekert, Miriam H A; Stams, Alfons J M; Rijpstra, Irene C; Sinninghe-Damsté , Jaap S; de Vos, Willem M; Kengen, Servé W M
2009-01-01
A novel anaerobic, thermophilic, Gram-positive, spore-forming, and sugar-fermenting bacterium (strain TLO) was isolated from a geothermal spring in Ayaş, Turkey. The cells were straight to curved rods, 0.4-0.6 microm in diameter and 3.5-10 microm in length. Spores were terminal and round. The temperature range for growth was 40-80 degrees C, with an optimum at 70 degrees C. The pH optimum was between 6.3 and 6.8. Strain TLO has the capability to ferment a wide variety of mono-, di-, and polysaccharides and proteinaceous substrates, producing mainly lactate, next to acetate, ethanol, alanine, H(2), and CO(2). Remarkably, the bacterium was able to grow in an atmosphere of up to 25% of CO as sole electron donor. CO oxidation was coupled to H(2) and CO(2) formation. The G + C content of the genomic DNA was 35.1 mol%. Based on 16S rRNA gene sequence analysis and the DNA-DNA hybridization data, this bacterium is most closely related to Thermoanaerobacter thermohydrosulfuricus and Thermoanaerobacter siderophilus (99% similarity for both). However, strain TLO differs from Thermoanaerobacter thermohydrosulfuricus in important aspects, such as CO-utilization and lipid composition. These differences led us to propose that strain TLO represents a subspecies of Thermoanaerobacter thermohydrosulfuricus, and we therefore name it Thermoanaerobacter thermohydrosulfuricus subsp. carboxydovorans.
Deracemization of Secondary Alcohols by using a Single Alcohol Dehydrogenase
Karume, Ibrahim
2016-03-01
© 2016 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim. We developed a single-enzyme-mediated two-step approach for deracemization of secondary alcohols. A single mutant of Thermoanaerobacter ethanolicus secondary alcohol dehydrogenase enables the nonstereoselective oxidation of racemic alcohols to ketones, followed by a stereoselective reduction process. Varying the amounts of acetone and 2-propanol cosubstrates controls the stereoselectivities of the consecutive oxidation and reduction reactions, respectively. We used one enzyme to accomplish the deracemization of secondary alcohols with up to >99% ee and >99.5% recovery in one pot and without the need to isolate the prochiral ketone intermediate.
Accelerated damage studies of titanate ceramics containing simulated PW-4b and JW-A waste
International Nuclear Information System (INIS)
Hart, K.P.; Vance, E.R.; Lumpkin, G.R.; Mitamura, H.; Matsumoto, S.; Banba, T.
1999-01-01
Ceramic waste forms are affected by radiation damage, primarily arising from aloha-decay processes that can lead to volume expansion and amorphization of the component crystalline phases. The understanding of the extent and impact of these effects on the overall durability of the waste form is critical to the prediction of their long-term performance under repository conditions. Since 1985 ANSTO and JAERI have carried out joint studies on the use of 244 Cm to simulate alpha-radiation damage in ceramic waste forms. These studies have focussed on synroc formulations doped with simulated PW-4b and JW-A wastes. The studies have established the relationship between density change and irradiation levels for Synroc containing JW-A and PW-4b wastes. The storage of samples at 200 C halves the rate of decrease in the density of the samples compared to that measured at room temperature. This effect is consistent with that found for natural samples where the amorphization of natural samples stored under crustal conditions is lower, by factors between 2 and 4, than that measured for samples from accelerated doping experiments stored at room temperature. (J.P.N.)
76 FR 18754 - J-W Pipeline Company; Notice of Motion for Extension of Rate Case Filing Deadline
2011-04-05
... DEPARTMENT OF ENERGY Federal Energy Regulatory Commission [Docket No. PR09-6-003] J-W Pipeline...-W Pipeline Company (J-W) filed a request for an extension consistent with the Commission's revised... extend the cycle for such reviews from three to five years.\\1\\ Therefore, J-W requests that the date for...
Directory of Open Access Journals (Sweden)
Fransisca Andreani
2012-01-01
Full Text Available Customer Relationship Management (CRM merupakan salah satu strategi untuk mempertahankan pelanggan. Dengan terjalinnya hubungan yang erat diharapkan pelanggan menjadi loyal pada perusahaan. Penelitian ini bertujuan untuk mengetahui pengaruh CRM terhadap loyalitas pelanggan di Hotel JW Marriott Surabaya dengan teknik analisis regresi linier berganda. Hasil penelitian menunjukkan bahwa CRM yang meliputi financial benefits, social benefits dan structural ties berpengaruh positif dan signifikan terhadap loyalitas pelanggan Hotel JW Marriott Surabaya. Faktor yang berpengaruh dominan terhadap loyalitas pelanggan Hotel JW Marriott Surabaya adalah structural ties.
Occurrence and Detection of Thermoanaerobacterium and Thermoanaerobacter in Canned Food
Directory of Open Access Journals (Sweden)
Christian Dotzauer
2002-01-01
Full Text Available In order to determine the reason for loss of vacuum in canned food, obligately anaerobic, spore forming thermophilic organisms were isolated from shelf-stable canned food containing vegetables, noodles and potatoes as main ingredients. Thermophilic bacteria from 44 canned food samples that had been stored under anaerobic conditions at 37 °C for at least 7 days were isolated. In addition, organic fertilizer used for the cultivation of some of the foods’ ingredients was examined and anaerobic, thermophilic bacteria could also be isolated from this source. Identification of bacterial strains was carried out by partial and complete 16S-rRNA-gene sequencing. Some of the obtained gene sequences showed a high level of similarity to existing 16S-rRNA gene sequences towards strains of the genera Thermoanaerobacter, Thermoanaerobium and Thermoanaerobacterium respectively, which have not yet been reported to be of importance as food spoilers. In the course of identification of these thermophilic bacteria we developed genera specific PCR-based approaches for detecting isolates belonging to the genera Thermoanaeroacterium and Thermoanaerobacter. Direct capturing of free DNA from contaminated samples using oligonucleotides coupled with paramagentic beads allowed the reduction of the detection time to six hours with a lower limit of 104 cells/mL.
Musa, Musa M.; Phillips, Robert S.; Laivenieks, Maris; Vieille, Claire; Takahashi, Masateru; Hamdan, Samir
2013-01-01
, the high tolerance of TeSADH to organic solvents allows TeSADH-catalyzed racemization to be conducted in media containing up to 50% (v/v) of organic solvents. © 2013 The Royal Society of Chemistry.
Yi, Yanglei; Zhang, Zhenhua; Zhao, Fan; Liu, Huan; Yu, Lijun; Zha, Jiwei; Wang, Gaoxue
2018-04-24
This study evaluated the probiotic potential of B. velezensis JW through experimental and genomic analysis approaches. Strain JW showed antimicrobial activity against a broad range of fish pathogenic bacteria including Aeromonas hydrophila, Aeromonas salmonicida, Lactococcus garvieae, Streptococcus agalactiae, and Vibrio Parahemolyticus. Fish (Carassius auratus) were fed with the diets containing 0 (control), 10 7 , and 10 9 cfu/g of B. velezensis JW for 4 weeks. Various immune parameters were examined at 1, 2, 3, and 4 weeks of post-feeding. Results showed that JW supplemented diets significantly increased acid phosphatase (ACP), alkaline phosphatase (AKP), and glutathione peroxidase (GSH-PX) activity. The mRNA expression of immune-related genes in the head kidney of C. auratus was measured. Among them, the interferon gamma gene (IFN- γ) and tumor necrosis factor-α (TNF-α) showed higher expression after 3 and 4 weeks of feeding (P velezensis JW has the potential to be developed as a probiotic agent in aquaculture. Copyright © 2018. Published by Elsevier Ltd.
Kwon, Jae Won; Kim, Shin Duk
2014-01-01
Bacillus subtilis JW-1 was isolated from rhizosphere soil as a potential biocontrol agent of bacterial wilt caused by Ralstonia solanacearum. Seed treatment followed by a soil drench application with this strain resulted in >80% reduction in bacterial wilt disease compared with that in the untreated control under greenhouse conditions. The antibacterial compound produced by strain JW-1 was purified by bioactivity-guided fractionation. Based on mass spectroscopy and nuclear magnetic resonance spectral data ((1)H, (13)C, (1)H-(1)H correlation spectroscopies, rotating frame nuclear Overhauser effect spectroscopy, and heteronuclear multiple-bond correlation spectroscopy), the structure of this compound was elucidated as a cyclic lipopeptide composed of a heptapeptide (Gln-Leu-Leu-Val-Asp-Leu-Leu) bonded to a β-hydroxy-iso-hexadecanoic acid arranged in a lactone ring system.
DEFF Research Database (Denmark)
Yao, Shuo; Just Mikkelsen, Marie
2010-01-01
Thermoanaerobacter mathranii contains four genes, adhA, adhB, bdhA and adhE, predicted to code for alcohol dehydrogenases involved in ethanol metabolism. These alcohol dehydrogenases were characterized as NADP(H)-dependent primary alcohol dehydrogenase (AdhA), secondary alcohol dehydrogenase (Adh....... Overexpressions of AdhE in strain BG1E1 with xylose as a substrate facilitate the production of ethanol at an increased yield. Copyright © 2010 S. Karger AG, Basel...
Bsharat, Odey; Musa, Musa M.; Vieille, Claire; Oladepo, Sulayman; Takahashi, Masateru; Hamdan, Samir
2017-01-01
Ketones bearing two bulky substituents, named bulky-bulky ketones, were successfully reduced to their corresponding optically enriched alcohols by using various mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Substituted 2-tetralones, in particular, were reduced to 2-tetralols with high conversion and high enantioselectivity. The pharmacological importance of substituted 2-tetralols as key drug-building blocks makes our biocatalytic reduction method a highly essential tool. We showed that changing the position of the substituent on the aromatic ring of 2-tetralones impacts their binding affinity and the reaction maximum catalytic rate. Docking studies with several TeSADH mutants explain how the position of the substituent on the tetralone influences the binding orientation of substituted 2-tetralones and their reaction stereoselectivity.
Bsharat, Odey
2017-01-30
Ketones bearing two bulky substituents, named bulky-bulky ketones, were successfully reduced to their corresponding optically enriched alcohols by using various mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Substituted 2-tetralones, in particular, were reduced to 2-tetralols with high conversion and high enantioselectivity. The pharmacological importance of substituted 2-tetralols as key drug-building blocks makes our biocatalytic reduction method a highly essential tool. We showed that changing the position of the substituent on the aromatic ring of 2-tetralones impacts their binding affinity and the reaction maximum catalytic rate. Docking studies with several TeSADH mutants explain how the position of the substituent on the tetralone influences the binding orientation of substituted 2-tetralones and their reaction stereoselectivity.
Andersen, Rasmus Lund; Jensen, Karen Møller; Mikkelsen, Marie Just
2015-01-01
Lignocellosic ethanol production is now at a stage where commercial or semi-commercial plants are coming online and, provided cost effective production can be achieved, lignocellulosic ethanol will become an important part of the world bio economy. However, challenges are still to be overcome throughout the process and particularly for the fermentation of the complex sugar mixtures resulting from the hydrolysis of hemicellulose. Here we describe the continuous fermentation of glucose, xylose and arabinose from non-detoxified pretreated wheat straw, birch, corn cob, sugar cane bagasse, cardboard, mixed bio waste, oil palm empty fruit bunch and frond, sugar cane syrup and sugar cane molasses using the anaerobic, thermophilic bacterium Thermoanaerobacter Pentocrobe 411. All fermentations resulted in close to maximum theoretical ethanol yields of 0.47–0.49 g/g (based on glucose, xylose, and arabinose), volumetric ethanol productivities of 1.2–2.7 g/L/h and a total sugar conversion of 90–99% including glucose, xylose and arabinose. The results solidify the potential of Thermoanaerobacter strains as candidates for lignocellulose bioconversion. PMID:26295944
Zhang, G.; Dong, H.; Kim, J.; Eberl, D.D.
2007-01-01
The illitization process of Fe-rich smectite (nontronite NAu-2) promoted by microbial reduction of structural Fe3+ was investigated by using a thermophilic metal-reducing bacterium, Thermoanaerobacter ethanolicus, isolated from the deep subsurface. T. ethanolicus was incubated with lactate as the sole electron donor and structural Fe3+ in nontronite as the sole electron acceptor, and anthraquinone-2, 6-disulfonate (AQDS) as an electron shuttle in a growth medium (pH 6.2 and 9.2, 65 ??C) with or without an external supply of Al and K sources. With an external supply of Al and K, the extent of reduction of Fe3+ in NAu-2 was 43.7 and 40.4% at pH 6.2 and 9.2, respectively. X-ray diffraction and scanning and transmission electron microscopy revealed formation of discrete illite at pH 9.2 with external Al and K sources, while mixed layers of illite/smectite or highly charged smectite were detected under other conditions. The morphology of biogenic illite evolved from lath and flake to pseudo-hexagonal shape. An external supply of Al and K under alkaline conditions enhances the smectite-illite reaction during microbial Fe3+ reduction of smectite. Biogenic SiO2 was observed as a result of bioreduction under all conditions. The microbially promoted smectite-illite reaction proceeds via dissolution of smectite and precipitation of illite. Thermophilic iron reducing bacteria have a significant role in promoting the smectite to illite reaction under conditions common in sedimentary basins.
A Genetic System for the Thermophilic Acetogenic Bacterium Thermoanaerobacter kivui.
Basen, Mirko; Geiger, Irina; Henke, Laura; Müller, Volker
2018-02-01
Thermoanaerobacter kivui is one of the very few thermophilic acetogenic microorganisms. It grows optimally at 66°C on sugars but also lithotrophically with H 2 + CO 2 or with CO, producing acetate as the major product. While a genome-derived model of acetogenesis has been developed, only a few physiological or biochemical experiments regarding the function of important enzymes in carbon and energy metabolism have been carried out. To address this issue, we developed a method for targeted markerless gene deletions and for integration of genes into the genome of T. kivui The strain naturally took up plasmid DNA in the exponential growth phase, with a transformation frequency of up to 3.9 × 10 -6 A nonreplicating plasmid and selection with 5-fluoroorotate was used to delete the gene encoding the orotate phosphoribosyltransferase ( pyrE ), resulting in a Δ pyrE uracil-auxotrophic strain, TKV002. Reintroduction of pyrE on a plasmid or insertion of pyrE into different loci within the genome restored growth without uracil. We subsequently studied fructose metabolism in T. kivui The gene fruK (TKV_c23150) encoding 1-phosphofructosekinase (1-PFK) was deleted, using pyrE as a selective marker via two single homologous recombination events. The resulting Δ fruK strain, TKV003, did not grow on fructose; however, growth on glucose (or on mannose) was unaffected. The combination of pyrE as a selective marker and the natural competence of the strain for DNA uptake will be the basis for future studies on CO 2 reduction and energy conservation and their regulation in this thermophilic acetogenic bacterium. IMPORTANCE Acetogenic bacteria are currently the focus of research toward biotechnological applications due to their potential for de novo synthesis of carbon compounds such as acetate, butyrate, or ethanol from H 2 + CO 2 or from synthesis gas. Based on available genome sequences and on biochemical experiments, acetogens differ in their energy metabolism. Thus, there is an
High ethanol tolerance of the thermophilic anaerobic ethanol producer Thermoanaerobacter BG1L1
DEFF Research Database (Denmark)
Georgieva, Tania I.; Mikkelsen, Marie Just; Ahring, Birgitte Kiær
2007-01-01
The low ethanol tolerance of thermophilic anaerobic bacteria, generally less than 2% (v/v) ethanol, is one of the main limiting factors for their potential use for second generation fuel ethanol production. In this work, the tolerance of thermophilic anaerobic bacterium Thermoanaerobacter BG 1L1...... to exogenously added ethanol was studied in a continuous immobilized reactor system at a growth temperature of 70 degrees C. Ethanol tolerance was evaluated based on inhibition of fermentative performance e.g.. inhibition of substrate conversion. At the highest ethanol concentration tested (8.3% v/v), the strain...... was able to convert 42% of the xylose initially present, indicating that this ethanol concentration is not the upper limit tolerated by the strain. Long-term strain adaptation to high ethanol concentrations (6 - 8.3%) resulted in an improvement of xylose conversion by 25% at an ethanol concentration of 5...
Musa, Musa M.; Bsharat, Odey; Karume, Ibrahim; Vieille, Claire; Takahashi, Masateru; Hamdan, Samir
2017-01-01
Here, we report the asymmetric reduction of selected phenyl-ring-containing ketones by various single and dual site mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Further expanding the size of the substrate binding pocket in the mutant W110A/I86A not only allowed substrates of the single mutants W110A and I86A to be accommodated within the expanded active site, but also expanded the enzyme's substrate range to ketones bearing two sterically demanding groups (bulky-bulky ketones), which are not substrates for TeSADH single mutants. We also report the regio- and enantioselective reduction of diketones using W110A/I86A TeSADH and single TeSADH mutants. The double mutant exhibited dual stereopreference generating the Prelog products most of the time and the anti-Prelog products in a few cases.
Musa, Musa M.
2017-12-14
Here, we report the asymmetric reduction of selected phenyl-ring-containing ketones by various single and dual site mutants of Thermoanaerobacter pseudoethanolicus secondary alcohol dehydrogenase (TeSADH). Further expanding the size of the substrate binding pocket in the mutant W110A/I86A not only allowed substrates of the single mutants W110A and I86A to be accommodated within the expanded active site, but also expanded the enzyme\\'s substrate range to ketones bearing two sterically demanding groups (bulky-bulky ketones), which are not substrates for TeSADH single mutants. We also report the regio- and enantioselective reduction of diketones using W110A/I86A TeSADH and single TeSADH mutants. The double mutant exhibited dual stereopreference generating the Prelog products most of the time and the anti-Prelog products in a few cases.
DEFF Research Database (Denmark)
Klinke, Helene Bendstrup; Thomsen, A.B.; Ahring, Birgitte Kiær
2001-01-01
Alkaline wet oxidation (WO) (using water, 6.5 g/l sodium carbonate, and 12 bar oxygen at 195 degreesC) was used for pre-treating wheat straw (60 g/l), resulting in a hemicellulose-rich hydrolysate and a cellulose-rich solid fraction. The hydrolysate consisted of soluble hemicellulose (9 g....../l), aliphatic carboxylic acids (6 g/l), phenols (0.27 g/l or 1.7 mM), and 2-furoic acid (0.007 g/l). The wet-oxidized wheat straw hydrolysate caused no inhibition of ethanol yield by the anaerobic thermophilic bacterium Thermoanaerobacter mathranii. Nine phenols and 2-furoic acid, identified to be present...
DEFF Research Database (Denmark)
Dabrowski, Slawomir; Brillowska-Dabrowska, Anna; Ahring, Birgitte Kiær
2013-01-01
Apurinic/apyrimidinic (AP) sites in DNA are considered to be highly mutagenic and must be corrected to preserve genetic integrity, especially at high temperatures. The gene encoding a homologue of AP exonuclease was cloned from the thermophilic anaerobic bacterium Thermoanaerobacter tengcongensis......) of fully active and soluble His6-tagged Tte AP enzyme with His6-tag on C-terminal end was obtained in Escherichia coli Rosetta (DE3) pLysS. The active enzyme was purified up to 98% homogeneity in one chromatographic step using metal-affinity chromatography on Ni(2+)-IDA-Sepharose resin. The yield was 90 mg......, pH 8.0 and at low Mg2+ concentration (0.5 mM). Higher Mg2+ concentration (> 1 mM) enhanced 3'-5' exonuclease activity and at Mg2+ concentration > 2.0 mM 3' nuclease activity was observed. Because of the endonuclease activity of Tte AP exonuclease, the enzyme was applied in PCR amplification of long...
Zhang, G.; Dong, H.; Jiang, H.; Kukkadapu, R.K.; Kim, J.; Eberl, D.; Xu, Z.
2009-01-01
Iron-reducing and oxidizing microorganisms gain energy through reduction or oxidation of iron, and by doing so play an important role in the geochemical cycling of iron. This study was undertaken to investigate mineral transformations associated with microbial reduction of Fe3+ and oxidation of Fe2+ in solid minerals. A fluid sample from the 2450 m depth of the Chinese Continental Scientific Drilling project was collected, and Fe3+-reducing and Fe2+-oxidizing microorganisms were enriched. The enrichment cultures displayed reduction of Fe3+ in nontronite and ferric citrate, and oxidation of Fe2+ in vivianite, siderite, and monosulfide (FeS). Additional experiments verified that the iron reduction and oxidation was biological. Oxidation of FeS resulted in the formation of goethite, lepidocrocite, and ferrihydrite as products. Although our molecular microbiological analyses detected Thermoan-aerobacter ethanolicus as a predominant organism in the enrichment culture, Fe3+ reduction and Fe2+ oxidation may be accomplished by a consortia of organisms. Our results have important environmental and ecological implications for iron redox cycling in solid minerals in natural environments, where iron mineral transformations may be related to the mobility and solubility of inorganic and organic contaminants.
DEFF Research Database (Denmark)
Klinke, H.B.; Thomsen, A.B.; Ahring, B.K.
2001-01-01
Alkaline wet oxidation (WO) (using water, 6.5 g/l sodium carbonate, and 12 bar oxygen at 195 degreesC) was used for pre-treating wheat straw (60 g/l), resulting in a hemicellulose-rich hydrolysate and a cellulose-rich solid fraction. The hydrolysate consisted of soluble hemicellulose (9 g....../l), aliphatic carboxylic acids (6 g/l), phenols (0.27 g/l or 1.7 mM), and 2-furoic acid (0.007 g/l). The wet-oxidized wheat straw hydrolysate caused no inhibition of ethanol yield by the anaerobic thermophilic bacterium Thermoanaerobacter mathranii. Nine phenols and 2-furoic acid, identified to be present...
Energy Technology Data Exchange (ETDEWEB)
Gao, Jinlan; Li, Xiaolu [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China); Feng, Yue; Zhang, Bo [Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China); Miao, Shiying [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Wang, Linfang, E-mail: lfwangz@yahoo.com [State Key Laboratory of Medical Molecular Biology, Institute of Basic Medical Sciences, Chinese Academy of Medical Sciences, Peking Union Medical College, Tsinghua University, Beijing 100005, People' s Republic of China (China); Wang, Na, E-mail: nawang@tsinghua.edu.cn [Tsinghua-Peking Joint Center for Life Sciences, Center for Structural Biology, School of Life Sciences, Tsinghua University, Beijing 100084, People' s Republic of China (China)
2012-06-22
Highlights: Black-Right-Pointing-Pointer We truncated the signal peptide of OppA{sub TTE0054} to make it express in Escherichia coli as a soluble protein. Black-Right-Pointing-Pointer Crystals of OppA{sub TTE0054} were grown by sitting-drop vapor diffusion method. Black-Right-Pointing-Pointer The crystal of OppA{sub TTE0054} diffracted to 2.25 A. -- Abstract: Di- and oligopeptide- binding protein OppAs play important roles in solute and nutrient uptake, sporulation, biofilm formation, cell wall muropeptides recycling, peptide-dependent quorum-sensing responses, adherence to host cells, and a variety of other biological processes. Soluble OppA from Thermoanaerobacter tengcongensis was expressed in Escherichia coli. The protein was found to be >95% pure with SDS-PAGE after a series of purification steps and the purity was further verified by mass spectrometry. The protein was crystallized using the sitting-drop vapour-diffusion method with PEG 400 as the precipitant. Crystal diffraction extended to 2.25 A. The crystal belonged to space group C222{sub 1}, with unit-cell parameters of a = 69.395, b = 199.572, c = 131.673 A, and {alpha} = {beta} = {gamma} = 90 Degree-Sign .
Directory of Open Access Journals (Sweden)
Subrata Pal
2014-01-01
Full Text Available Thermoanaerobacter indiensis BSB-33 has been earlier shown to reduce Fe(III and Cr(VI anaerobically at 60°C optimally. Further, the Gram-positive thermophilic bacterium contains Cr(VI reduction activity in both the membrane and cytoplasm. The soluble fraction prepared from T. indiensis cells grown at 60°C was found to contain the majority of Fe(III reduction activity of the microorganism and produced four distinct bands in nondenaturing Fe(III reductase activity gel. Proteins from each of these bands were partially purified by chromatography and identified by mass spectrometry (MS with the help of T. indiensis proteome sequences. Two paralogous dihydrolipoamide dehydrogenases (LPDs, thioredoxin reductase (Trx, NADP(H-nitrite reductase (Ntr, and thioredoxin disulfide reductase (Tdr were determined to be responsible for Fe(III reductase activity. Amino acid sequence and three-dimensional (3D structural similarity analyses of the T. indiensis Fe(III reductases were carried out with Cr(VI reducing proteins from other bacteria. The two LPDs and Tdr showed very significant sequence and structural identity, respectively, with Cr(VI reducing dihydrolipoamide dehydrogenase from Thermus scotoductus and thioredoxin disulfide reductase from Desulfovibrio desulfuricans. It appears that in addition to their iron reducing activity T. indiensis LPDs and Tdr are possibly involved in Cr(VI reduction as well.
DEFF Research Database (Denmark)
Sittijunda, Sureewan; Tomás, Ana Faria; Reungsang, Alissara
2013-01-01
The newly isolated extreme thermophilic ethanologen Thermoanaerobacter pentosaceus was immobilized in different support materials in order to improve its ethanol production ability. In batch fermentation, a maximum ethanol yield of 1.36 mol mol-1 consumed sugars was obtained by T. pentosaceus...... occurred at an HRT of 6 h. The maximum ethanol yield and concentration, 1.50 mol mol-1 consumed sugars and 12.4 g l-1, were obtained with an HRT of 12 h. The latter represented an improvement of 60 % in relation to previously obtained results. This indicates that immobilization of T. pentosaceus...... immobilized on rapeseed straw. Additionally, immobilized T. pentosaceus’ ethanol production was improved by 11 % in comparison to free cells. In continuous mode, it was shown that hydraulic retention time (HRT) affected ethanol yield, and a dramatic shift from ethanol to acetate and lactate production...
DEFF Research Database (Denmark)
Georgieva, Tania I.; Mikkelsen, Marie Just; Ahring, Birgitte Kiær
2008-01-01
was not detoxified, ethanol yield in a range of 0.39-0.42 g/g was obtained. Overall, sugar efficiency to ethanol was 68-76%. The reactor was operated continuously for approximately 143 days, and no contamination was seen without the use of any agent for preventing bacterial infections. The tested microorganism has......Thermophilic ethanol fermentation of wet-exploded wheat straw hydrolysate was investigated in a continuous immobilized reactor system. The experiments were carried out in a lab-scale fluidized bed reactor (FBR) at 70C. Undetoxified wheat straw hydrolysate was used (3-12% dry matter), corresponding...... to sugar mixtures of glucose and xylose ranging from 12 to 41 g/l. The organism, thermophilic anaerobic bacterium Thermoanaerobacter BG1L1, exhibited significant resistance to high levels of acetic acid (up to 10 g/l) and other metabolic inhibitors present in the hydrolysate. Although the hydrolysate...
DEFF Research Database (Denmark)
Tomás, Ana Faria; Karagöz, Pınar; Karakashev, Dimitar Borisov
2013-01-01
from the liquid fraction of pretreated rapeseed straw, without any dilution or need for additives. However, when the hydrolysate was used undiluted the ethanol yield was only 37% compared to yield of the control, in which pure sugars in synthetic medium were used. The decrease of ethanol yield...... showed that the two strains together could achieve up to 85% of the theoretical ethanol yield based on the sugar composition of the rapeseed straw, which was 14% and 50% higher compared to the yield with the yeast or the bacteria alone, respectively. Biotechnol. Bioeng. © 2012 Wiley Periodicals, Inc.......The newly isolated extreme thermophile Thermoanaerobacter pentosaceus was used for ethanol production from alkaline-peroxide pretreated rapeseed straw (PRS). Both the liquid and solid fractions of PRS were used. T. pentosaceus was able to metabolize the typical process inhibitors present...
Metabolic engineering of ethanol production in Thermoanaerobacter mathranii
Energy Technology Data Exchange (ETDEWEB)
Shou Yao
2010-11-15
Strain BG1 is a xylanolytic, thermophilic, anaerobic, Gram-positive bacterium originally isolated from an Icelandic hot spring. The strain belongs to the species Thermoanaerobacter mathranii. The strain ferments glucose, xylose, arabinose, galactose and mannose simultaneously and produces ethanol, acetate, lactate, CO{sub 2}, and H2 as fermentation end-products. As a potential ethanol producer from lignocellulosic biomass, tailor-made BG1 strain with the metabolism redirected to produce ethanol is needed. Metabolic engineering of T. mathranii BG1 is therefore necessary to improve ethanol production. Strain BG1 contains four alcohol dehydrogenase (ADH) encoding genes. They are adhA, adhB, bdhA and adhE encoding primary alcohol dehydrogenase, secondary alcohol dehydrogenase, butanol dehydrogenase and bifunctional alcohol/acetaldehyde dehydrogenase, respectively. The presence in an organism of multiple alcohol dehydrogenases with overlapping specificities makes the determination of the specific role of each ADH difficult. Deletion of each individual adh gene in the strain revealed that the adhE deficient mutant strain fails to produce ethanol as the fermentation product. The bifunctional alcohol/acetaldehyde dehydrogenase, AdhE, is therefore proposed responsible for ethanol production in T. mathranii BG1, by catalyzing sequential NADH-dependent reductions of acetyl-CoA to acetaldehyde and then to ethanol under fermentative conditions. Moreover, AdhE was conditionally expressed from a xylose-induced promoter in a recombinant strain (BG1E1) with a concomitant deletion of a lactate dehydrogenase. Over-expression of AdhE in strain BG1E1 with xylose as a substrate facilitates the production of ethanol at an increased yield. With a cofactor-dependent ethanol production pathway in T. mathranii BG1, it may become crucial to regenerate cofactor to increase the ethanol yield. Feeding the cells with a more reduced carbon source, such as mannitol, was shown to increase ethanol
Energy Technology Data Exchange (ETDEWEB)
Liebschner, Dorothee [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); Brzezinski, Krzysztof [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); University of Bialystok, 15-399 Bialystok (Poland); Dauter, Miroslawa [Argonne National Laboratory, Argonne, IL 60439 (United States); Dauter, Zbigniew, E-mail: dauter@anl.gov [National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States); Nowak, Marta; Kur, Józef; Olszewski, Marcin, E-mail: dauter@anl.gov [Gdansk University of Technology, 80-952 Gdansk (Poland); National Cancer Institute, Argonne National Laboratory, Argonne, IL 60439 (United States)
2012-12-01
The N-terminal domain of the PriB protein from the thermophilic bacterium T. tengcongensis (TtePriB) was expressed and its crystal structure has been solved at the atomic resolution of 1.09 Å by direct methods. PriB is one of the components of the bacterial primosome, which catalyzes the reactivation of stalled replication forks at sites of DNA damage. The N-terminal domain of the PriB protein from the thermophilic bacterium Thermoanaerobacter tengcongensis (TtePriB) was expressed and its crystal structure was solved at the atomic resolution of 1.09 Å by direct methods. The protein chain, which encompasses the first 104 residues of the full 220-residue protein, adopts the characteristic oligonucleotide/oligosaccharide-binding (OB) structure consisting of a five-stranded β-barrel filled with hydrophobic residues and equipped with four loops extending from the barrel. In the crystal two protomers dimerize, forming a six-stranded antiparallel β-sheet. The structure of the N-terminal OB domain of T. tengcongensis shows significant differences compared with mesophile PriBs. While in all other known structures of PriB a dimer is formed by two identical OB domains in separate chains, TtePriB contains two consecutive OB domains in one chain. However, sequence comparison of both the N-terminal and the C-terminal domains of TtePriB suggests that they have analogous structures and that the natural protein possesses a structure similar to a dimer of two N-terminal domains.
Barlow, Peter W
2012-09-01
Certain phenomena in Nature which might logically be regarded as indicating biosemiotic communication, with signal, receptor and interpretant, may, in fact, indicate no such thing. Instead, the respective phenomenological observations may point to an underlying system that JW von Goethe termed an "Urphänomen". From such Primal Phenomena emerge derived phenomena, or "Types", which are made substantial by processes that uniquely define Life and Living. Biosemiosis arises and takes place within the derived Types. Examples of Primal Phenomena and their derivatives are taken from recent observations on the putative influence of the lunisolar gravitational force upon animal and plant behavior, and from some aspects of plant development that show connection with Goethe's idea of the 'Urpflanze'.
Jessen, Jan Eric; Orlygsson, Johann
2012-01-01
Thermophilic bacteria have gained increased attention as candidates for bioethanol production from lignocellulosic biomass. This study investigated ethanol production by Thermoanaerobacter strain J1 from hydrolysates made from lignocellulosic biomass in batch cultures. The effect of increased initial glucose concentration and the partial pressure of hydrogen on end product formation were examined. The strain showed a broad substrate spectrum, and high ethanol yields were observed on glucose (1.70 mol/mol) and xylose (1.25 mol/mol). Ethanol yields were, however, dramatically lowered by adding thiosulfate or by cocultivating strain J1 with a hydrogenotrophic methanogen with acetate becoming the major end product. Ethanol production from 4.5 g/L of lignocellulosic biomass hydrolysates (grass, hemp stem, wheat straw, newspaper, and cellulose) pretreated with acid or alkali and the enzymes Celluclast and Novozymes 188 was investigated. The highest ethanol yields were obtained on cellulose (7.5 mM·g(-1)) but the lowest on straw (0.8 mM·g(-1)). Chemical pretreatment increased ethanol yields substantially from lignocellulosic biomass but not from cellulose. The largest increase was on straw hydrolysates where ethanol production increased from 0.8 mM·g(-1) to 3.3 mM·g(-1) using alkali-pretreated biomass. The highest ethanol yields on lignocellulosic hydrolysates were observed with hemp hydrolysates pretreated with acid, 4.2 mM·g(-1).
Jørgensen, F; Hansen, O C; Stougaard, P
2004-06-01
The ability to convert D-galactose into D-tagatose was compared among a number of bacterial L-arabinose isomerases ( araA). One of the most efficient enzymes, from the anaerobic thermophilic bacterium Thermoanaerobacter mathranii, was produced heterologously in Escherichia coli and characterised. Amino acid sequence comparisons indicated that this enzyme is only distantly related to the group of previously known araA sequences in which the sequence similarity is evident. The substrate specificity and the Michaelis-Menten constants of the enzyme determined with L-arabinose, D-galactose and D-fucose also indicated that this enzyme is an unusual, versatile L-arabinose isomerase which is able to isomerise structurally related sugars. The enzyme was immobilised and used for production of D-tagatose at 65 degrees C. Starting from a 30% solution of D-galactose, the yield of D-tagatose was 42% and no sugars other than D-tagatose and D-galactose were detected. Direct conversion of lactose to D-tagatose in a single reactor was demonstrated using a thermostable beta-galactosidase together with the thermostable L-arabinose isomerase. The two enzymes were also successfully combined with a commercially available glucose isomerase for conversion of lactose into a sweetening mixture comprising lactose, glucose, galactose, fructose and tagatose.
Directory of Open Access Journals (Sweden)
Jan Eric Jessen
2012-01-01
Full Text Available Thermophilic bacteria have gained increased attention as candidates for bioethanol production from lignocellulosic biomass. This study investigated ethanol production by Thermoanaerobacter strain J1 from hydrolysates made from lignocellulosic biomass in batch cultures. The effect of increased initial glucose concentration and the partial pressure of hydrogen on end product formation were examined. The strain showed a broad substrate spectrum, and high ethanol yields were observed on glucose (1.70 mol/mol and xylose (1.25 mol/mol. Ethanol yields were, however, dramatically lowered by adding thiosulfate or by cocultivating strain J1 with a hydrogenotrophic methanogen with acetate becoming the major end product. Ethanol production from 4.5 g/L of lignocellulosic biomass hydrolysates (grass, hemp stem, wheat straw, newspaper, and cellulose pretreated with acid or alkali and the enzymes Celluclast and Novozymes 188 was investigated. The highest ethanol yields were obtained on cellulose (7.5 mM·g−1 but the lowest on straw (0.8 mM·g−1. Chemical pretreatment increased ethanol yields substantially from lignocellulosic biomass but not from cellulose. The largest increase was on straw hydrolysates where ethanol production increased from 0.8 mM·g−1 to 3.3 mM·g−1 using alkali-pretreated biomass. The highest ethanol yields on lignocellulosic hydrolysates were observed with hemp hydrolysates pretreated with acid, 4.2 mM·g−1.
NCBI nr-aa BLAST: CBRC-XTRO-01-0902 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-XTRO-01-0902 ref|NP_622433.1| hypothetical protein TTE0780 [Thermoanaerobacter... tengcongensis MB4] gb|AAM24037.1| hypothetical protein TTE0780 [Thermoanaerobacter tengcongensis MB4] NP_622433.1 4.7 28% ...
NCBI nr-aa BLAST: CBRC-TTRU-01-0941 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-TTRU-01-0941 ref|ZP_05380337.1| Na+/Picotransporter [Thermoanaerobacter mathranii subsp. math...ranii str. A3] gb|EET63018.1| Na+/Picotransporter [Thermoanaerobacter mathranii subsp. mathranii str. A3] ZP_05380337.1 0.013 23% ...
International Nuclear Information System (INIS)
Wu, Liyou; Yi, T.Y.; Van Nostrand, Joy; Zhou, Jizhong
2010-01-01
Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site (Hanford Reach of the Columbia River (HRCR), 11 strains), Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.
Energy Technology Data Exchange (ETDEWEB)
Wu, Liyou; Yi, T. Y.; Van Nostrand, Joy; Zhou, Jizhong
2010-05-17
Phylogenetic analyses were done for the Shewanella strains isolated from Baltic Sea (38 strains), US DOE Hanford Uranium bioremediation site [Hanford Reach of the Columbia River (HRCR), 11 strains], Pacific Ocean and Hawaiian sediments (8 strains), and strains from other resources (16 strains) with three out group strains, Rhodopseudomonas palustris, Clostridium cellulolyticum, and Thermoanaerobacter ethanolicus X514, using DNA relatedness derived from WCGA-based DNA-DNA hybridizations, sequence similarities of 16S rRNA gene and gyrB gene, and sequence similarities of 6 loci of Shewanella genome selected from a shared gene list of the Shewanella strains with whole genome sequenced based on the average nucleotide identity of them (ANI). The phylogenetic trees based on 16S rRNA and gyrB gene sequences, and DNA relatedness derived from WCGA hybridizations of the tested Shewanella strains share exactly the same sub-clusters with very few exceptions, in which the strains were basically grouped by species. However, the phylogenetic analysis based on DNA relatedness derived from WCGA hybridizations dramatically increased the differentiation resolution at species and strains level within Shewanella genus. When the tree based on DNA relatedness derived from WCGA hybridizations was compared to the tree based on the combined sequences of the selected functional genes (6 loci), we found that the resolutions of both methods are similar, but the clustering of the tree based on DNA relatedness derived from WMGA hybridizations was clearer. These results indicate that WCGA-based DNA-DNA hybridization is an idea alternative of conventional DNA-DNA hybridization methods and it is superior to the phylogenetics methods based on sequence similarities of single genes. Detailed analysis is being performed for the re-classification of the strains examined.
Effect of dietary vitamin D3 supplementation on meat quality of ...
African Journals Online (AJOL)
student
Karges K, Brooks JC, Gill DR, Breazile JE, Owens FN and Morgan JB. (2001). Effect of ... Vitamin D3 and papaya leaf on meat quality of spent laying hens. Agric. J. 6(4): 197-200 ... Edn. SAS Institute, Inc., North Caroline, USA. Savell JW, Smith ...
NCBI nr-aa BLAST: CBRC-DNOV-01-1963 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DNOV-01-1963 ref|NP_622305.1| ABC-type nitrate/sulfonate/taurine/bicarbonate t...ransport systems, permease components [Thermoanaerobacter tengcongensis MB4] gb|AAM23909.1| ABC-type nitrate/sulfonate/taurine/bicarb...onate transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_622305.1 0.013 26% ...
Directory of Open Access Journals (Sweden)
Bo Liu
Full Text Available BACKGROUND: Although cold shock responses and the roles of cold shock proteins in microorganisms containing multiple cold shock protein genes have been well characterized, related studies on bacteria possessing a single cold shock protein gene have not been reported. Thermoanaerobacter tengcongensis MB4, a thermophile harboring only one known cold shock protein gene (TtescpC, can survive from 50° to 80 °C, but has poor natural competence under cold shock at 50 °C. We therefore examined cold shock responses and their effect on natural competence in this bacterium. RESULTS: The transcriptomes of T. tengcongensis before and after cold shock were analyzed by RNA-seq and over 1200 differentially expressed genes were successfully identified. These genes were involved in a wide range of biological processes, including modulation of DNA replication, recombination, and repair; energy metabolism; production of cold shock protein; synthesis of branched amino acids and branched-chain fatty acids; and sporulation. RNA-seq analysis also suggested that T. tengcongensis initiates cell wall and membrane remodeling processes, flagellar assembly, and sporulation in response to low temperature. Expression profiles of TtecspC and failed attempts to produce a TtecspC knockout strain confirmed the essential role of TteCspC in the cold shock response, and also suggested a role of this protein in survival at optimum growth temperature. Repression of genes encoding ComEA and ComEC and low energy metabolism levels in cold-shocked cells are the likely basis of poor natural competence at low temperature. CONCLUSION: Our study demonstrated changes in global gene expression under cold shock and identified several candidate genes related to cold shock in T. tengcongensis. At the same time, the relationship between cold shock response and poor natural competence at low temperature was preliminarily elucidated. These findings provide a foundation for future studies on genetic
Production of Bioethanol From Lignocellulosic Biomass Using Thermophilic Anaerobic Bacteria
DEFF Research Database (Denmark)
Georgieva, Tania I.
2006-01-01
and xylose and to tolerate the inhibitory compounds present in lignocellulosic hydrolysates is therefore apparent. Several thermophilic anaerobic xylan degrading bacteria from our culture collection (EMB group at BioCentrum-DTU) have been screened for a potential ethanol producer from hemicellulose...... hydrolysates, and out of the screening test, one particular strain (A10) was selected for the best performance. The strain was morphologically and physiologically characterized as Thermoanaerobacter mathranii strain A10. Unlike other thermophilic anaerobic bacteria, the wild-type strain Thermoanaerobacter...... Thermoanaerobacter BG1L1 was further studied. The experiments were carried out in a continuous immobilized reactor system (a fluidized bed reactor), which is likely to be the process design configuration for xylose fermentation in a Danish biorefinery concept for production of fuel ethanol. The immobilization...
Alterations in CD200-CD200R1 System during EAE Already Manifest at Presymptomatic Stages
Directory of Open Access Journals (Sweden)
Tony Valente
2017-05-01
Full Text Available In the brain of patients with multiple sclerosis, activated microglia/macrophages appear in active lesions and in normal appearing white matter. However, whether they play a beneficial or a detrimental role in the development of the pathology remains a controversial issue. The production of pro-inflammatory molecules by chronically activated microglial cells is suggested to contribute to the progression of neurodegenerative processes in neurological disease. In the healthy brain, neurons control glial activation through several inhibitory mechanisms, such as the CD200-CD200R1 interaction. Therefore, we studied whether alterations in the CD200-CD200R1 system might underlie the neuroinflammation in an experimental autoimmune encephalomyelitis (EAE model of multiple sclerosis. We determined the time course of CD200 and CD200R1 expression in the brain and spinal cord of an EAE mouse model from presymptomatic to late symptomatic stages. We also assessed the correlation with associated glial activation, inflammatory response and EAE severity. Alterations in CD200 and CD200R1 expression were mainly observed in spinal cord regions in the EAE model, mostly a decrease in CD200 and an increase in CD200R1 expression. A decrease in the expression of the mRNA encoding a full CD200 protein was detected before the onset of clinical signs, and remained thereafter. A decrease in CD200 protein expression was observed from the onset of clinical signs. By contrast, CD200R1 expression increased at EAE onset, when a glial reaction associated with the production of pro- and anti-inflammatory markers occurred, and continued to be elevated during the pathology. Moreover, the magnitude of the alterations correlated with severity of the EAE mainly in spinal cord. These results suggest that neuronal-microglial communication through CD200-CD200R1 interaction is compromised in EAE. The early decreases in CD200 expression in EAE suggest that this downregulation might also
Hanford 200 Areas Development Plan
Energy Technology Data Exchange (ETDEWEB)
Rinne, C.A.; Daly, K.S.
1993-08-01
The purpose of the Hanford 200 Areas Development Plan (Development Plan) is to guide the physical development of the 200 Areas (which refers to the 200 East Area, 200 West Area, and 200 Area Corridor, located between the 200 East and 200 West Areas) in accordance with US Department of Energy (DOE) Order 4320.lB (DOE 1991a) by performing the following: Establishing a land-use plan and setting land-use categories that meet the needs of existing and proposed activities. Coordinating existing, 5-year, and long-range development plans and guiding growth in accordance with those plans. Establishing development guidelines to encourage cost-effective development and minimize conflicts between adjacent activities. Identifying site development issues that need further analysis. Integrating program plans with development plans to ensure a logical progression of development. Coordinate DOE plans with other agencies [(i.e., Washington State Department of Ecology (Ecology) and US Environmental Protection Agency (EPA)]. Being a support document to the Hanford Site Development Plan (DOE-RL 1990a) (parent document) and providing technical site information relative to the 200 Areas.
Hanford 200 Areas Development Plan
International Nuclear Information System (INIS)
Rinne, C.A.; Daly, K.S.
1993-08-01
The purpose of the Hanford 200 Areas Development Plan (Development Plan) is to guide the physical development of the 200 Areas (which refers to the 200 East Area, 200 West Area, and 200 Area Corridor, located between the 200 East and 200 West Areas) in accordance with US Department of Energy (DOE) Order 4320.lB (DOE 1991a) by performing the following: Establishing a land-use plan and setting land-use categories that meet the needs of existing and proposed activities. Coordinating existing, 5-year, and long-range development plans and guiding growth in accordance with those plans. Establishing development guidelines to encourage cost-effective development and minimize conflicts between adjacent activities. Identifying site development issues that need further analysis. Integrating program plans with development plans to ensure a logical progression of development. Coordinate DOE plans with other agencies [(i.e., Washington State Department of Ecology (Ecology) and US Environmental Protection Agency (EPA)]. Being a support document to the Hanford Site Development Plan (DOE-RL 1990a) (parent document) and providing technical site information relative to the 200 Areas
Catch tanks inhibitor addition 200-East and 200-West Areas
International Nuclear Information System (INIS)
Palit, A.N.
1996-01-01
Reported is the study of 11 catch tanks in the 200-East Area and the 7 catch tanks in the 200-West Area listed as active. The location, capacity, material of construction, annual total accumulation, annual rain intrusion, waste transfer rate, and access for chemical injection in these tanks are documented. The present and future utilization and isolation plans for the catch tanks are established
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Application. 54.200 Section 54.200 Judicial Administration DEPARTMENT OF JUSTICE (CONTINUED) NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 54.200 Application...
ORF Sequence: NC_003869 [GENIUS II[Archive
Lifescience Database Archive (English)
Full Text Available [Thermoanaerobacter tengcongensis MB4] MNQIIECVPNVSEGRDQEKISELIKEVVSTEGVKLLDYSSDKDHNRTVITFVGDKEGVKEAAFKLIKK...ASEIIDMRYHKGEHPRIGAVDVVPFVPVKNVTMEECVQIARELGERVGKELNIPVYLYEEAATTPERKNLENIRRGEYEGFFEKIKQPEWKPDFGPSEMNPKSGAIVI
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Application. 200.602 Section 200.602 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT... Programs or Activities Conducted by the Securities and Exchange Commission § 200.602 Application. This...
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Purpose. 200.550 Section 200.550 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Regulations Pertaining to the Protection of the Environment § 200...
2010-10-01
... 49 Transportation 4 2010-10-01 2010-10-01 false Publication. 200.13 Section 200.13 Transportation Other Regulations Relating to Transportation (Continued) FEDERAL RAILROAD ADMINISTRATION, DEPARTMENT OF TRANSPORTATION INFORMAL RULES OF PRACTICE FOR PASSENGER SERVICE § 200.13 Publication. (a) General notice of any...
2010-04-01
... 21 Food and Drugs 4 2010-04-01 2010-04-01 false Prescription drugs; reminder advertisements and reminder labeling to provide price information to consumers. 200.200 Section 200.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) DRUGS: GENERAL GENERAL Prescription Drug Consumer Price Listing §...
2010-10-01
... 44 Emergency Management and Assistance 1 2010-10-01 2010-10-01 false Application. 19.200 Section 19.200 Emergency Management and Assistance FEDERAL EMERGENCY MANAGEMENT AGENCY, DEPARTMENT OF... RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 19.200 Application. Except as provided in §§ 19.205...
14 CFR 1253.200 - Application.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Application. 1253.200 Section 1253.200 Aeronautics and Space NATIONAL AERONAUTICS AND SPACE ADMINISTRATION NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 1253.200 Application...
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Authority. 200.50 Section 200.50 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.50 Authority. The Canons of Ethics for...
Zhang, Fang; Yang, Jing-Hua; Dai, Kun; Chen, Yun; Li, Qiu-Rong; Gao, Fa-Ming; Zeng, Raymond J
2016-02-01
The microbial community compositions of a chemostat enriched in a thermophilic (55 °C) mixed culture fermentation (MCF) for hydrogen production under different operational conditions were revealed in this work by integrating denaturing gradient gel electrophoresis (DGGE), Illumina Miseq high-throughput sequencing, and 16S rRNA clone library sequencing. The results showed that the community structure of the enriched cultures was relatively simple. Clones close to the genera of Thermoanaerobacter and/or Bacillus mainly dominated the bacteria. And homoacetogens and archaea were washed out and not detected even by Illumina Miseq high-throughput sequencing which supported the benefit for hydrogen production. On the other hand, the results revealed that the metabolic shift was clearly associated with the change of dominated bacterial groups. The effects of hydrogen partial pressure (PH2) and pH from 4.0 to 5.5 on the microbial compositions were not notable and Thermoanaerobacter was dominant, thus, the metabolites were also not changed. While Bacillus, Thermoanaerobacter and Propionispora hippei dominated the bacteria communities at neutral pH, or Bacillus and Thermoanaerobacter dominated at high influent glucose concentrations, consequently the main metabolites shifted to acetate, ethanol, propionate, or lactate. Thereby, the effect of microbial composition on the metabolite distribution and shift shall be considered when modeling thermophilic MCF in the future.
2010-10-01
... 43 Public Lands: Interior 1 2010-10-01 2010-10-01 false Application. 41.200 Section 41.200 Public Lands: Interior Office of the Secretary of the Interior NONDISCRIMINATION ON THE BASIS OF SEX IN EDUCATION PROGRAMS OR ACTIVITIES RECEIVING FEDERAL FINANCIAL ASSISTANCE Coverage § 41.200 Application...
2010-04-01
... furnish advisory services in connection with the financing or construction of a project and the related... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Definitions. 200.215 Section 200... Participation Review and Clearance Procedure § 200.215 Definitions. (a) Affiliate. Any person or business...
15 CFR 200.106 - Publications.
2010-01-01
... 15 Commerce and Foreign Trade 1 2010-01-01 2010-01-01 false Publications. 200.106 Section 200.106... FEES § 200.106 Publications. Publications provide the primary means of communicating the results of the... issues some fifteen categories of publications including three periodicals, ten non-periodicals series...
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Authority. 200.605 Section 200.605... GENERAL INTRODUCTION TO FHA PROGRAMS Affirmative Fair Housing Marketing Regulations § 200.605 Authority. The regulations in this subpart are issued pursuant to the authority to issue regulations granted to...
45 CFR 2555.200 - Application.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Application. 2555.200 Section 2555.200 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE... Coverage § 2555.200 Application. Except as provided in §§ 2555.205 through 2555.235(a), these Title IX...
A Critical Role for CD200R Signaling in Limiting the Growth and Metastasis of CD200+ Melanoma.
Liu, Jin-Qing; Talebian, Fatemeh; Wu, Lisha; Liu, Zhihao; Li, Ming-Song; Wu, Laichu; Zhu, Jianmin; Markowitz, Joseph; Carson, William E; Basu, Sujit; Bai, Xue-Feng
2016-08-15
CD200 is a cell surface glycoprotein that functions through engaging CD200R on cells of the myeloid lineage and inhibits their functions. Expression of CD200 was implicated in a variety of human cancer cells, including melanoma cells; however, its roles in tumor growth and immunity are not clearly understood. In this study, we used CD200R-deficient mice and the B16 tumor model to evaluate this issue. We found that CD200R-deficient mice exhibited accelerated growth of CD200(+), but not CD200(-), B16 tumors. Strikingly, CD200R-deficient mice receiving CD200(+) B16 cells i.v. exhibited massive tumor growth in multiple organs, including liver, lung, kidney, and peritoneal cavity, whereas the growth of the same tumors in wild-type mice was limited. CD200(+) tumors grown in CD200R-deficient mice contained higher numbers of CD11b(+)Ly6C(+) myeloid cells, exhibited increased expression of VEGF and HIF1α genes with increased angiogenesis, and showed significantly reduced infiltration of CD4(+) and CD8(+) T cells, presumably as the result of reduced expression of T cell chemokines, such as CXCL9 and CXCL16. The liver from CD200R-deficient mice, under metastatic growth of CD200(+) tumors, contained significantly increased numbers of CD11b(+)Gr1(-) myeloid cells and Foxp3(+) regulatory T cells and reduced numbers of NK cells. Liver T cells also had a reduced capacity to produce IFN-γ or TNF-α. Taken together, we revealed a critical role for CD200R signaling in limiting the growth and metastasis of CD200(+) tumors. Thus, targeting CD200R signaling may potentially interfere with the metastatic growth of CD200(+) tumors, like melanoma. Copyright © 2016 by The American Association of Immunologists, Inc.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Yogurt. 131.200 Section 131.200 Food and Drugs... CONSUMPTION MILK AND CREAM Requirements for Specific Standardized Milk and Cream § 131.200 Yogurt. (a) Description. Yogurt is the food produced by culturing one or more of the optional dairy ingredients specified...
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Application. 3.200 Section 3.200 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development... Coverage § 3.200 Application. Except as provided in §§ 3.205 through 3.235(a), these Title IX regulations...
Directory of Open Access Journals (Sweden)
Joanne L Attema
Full Text Available The miR-200b~200a~429 gene cluster is a key regulator of EMT and cancer metastasis, however the transcription-based mechanisms controlling its expression during this process are not well understood. We have analyzed the miR-200b~200a~429 locus for epigenetic modifications in breast epithelial and mesenchymal cell lines using chromatin immunoprecipitation assays and DNA methylation analysis. We discovered a novel enhancer located approximately 5.1kb upstream of the miR-200b~200a~429 transcriptional start site. This region was associated with the active enhancer chromatin signature comprising H3K4me1, H3K27ac, RNA polymerase II and CpG dinucleotide hypomethylation. Luciferase reporter assays revealed the upstream enhancer stimulated the transcription of the miR-200b~200a~429 minimal promoter region approximately 27-fold in breast epithelial cells. Furthermore, we found that a region of the enhancer was transcribed, producing a short, GC-rich, mainly nuclear, non-polyadenylated RNA transcript designated miR-200b eRNA. Over-expression of miR-200b eRNA had little effect on miR-200b~200a~429 promoter activity and its production did not correlate with miR-200b~200a~429 gene expression. While additional investigations of miR-200b eRNA function will be necessary, it is possible that miR-200b eRNA may be involved in the regulation of miR-200b~200a~429 gene expression and silencing. Taken together, these findings reveal the presence of a novel enhancer, which contributes to miR-200b~200a~429 transcriptional regulation in epithelial cells.
Tropism and infectivity of duck-derived egg drop syndrome virus in chickens.
Directory of Open Access Journals (Sweden)
Min Kang
Full Text Available Egg drop syndrome virus (EDSV can markedly decrease egg production in laying hens. Duck is the natural host of EDSV. EDSV derived from ducks abrogate egg drop in laying hens. We have previously confirmed that duck-derived EDSVs have a variety of replication activities in chick embryo liver (CEL cells. However, it is currently unclear whether duck-derived EDSV could display tropism and adaptation in laying hens. This study assessed whether duck-derived EDSV can adapt to laying hens, and estimated the inducing factors. Complete genome sequences of duck-derived EDSVs (D11-JW-012, D11-JW-017, and D11-JW-032 isolates with various replication efficiency in CEL cells and C10-GY-001 isolate causing disease in laying hens were analyzed to find their differences. Phylogenetic analysis of complete genome sequence revealed that C10-GY-001, D11-JW-032, and strain 127 virus as vaccine were clustered into the same group, with D11-JW-012 and D11-JW-017 clustered in another group. Comparison between D11-JW-012 isolate that poorly replicated and D11-JW-017 isolate that replicated well in CEL cells in same cluster revealed six amino acid differences on IVa2, DNA polymerase, endopeptidase, and DNA-binding protein. These amino acids might be key candidates enhancing cellular tropism in chicken. When the pathogenicities of these isolates in laying hens were compared, D11-JW-032 showed severe signs similar to 127 virus, D11-JW-017 showed intermediate signs, while D11-JW-012 showed almost no sign. Eleven amino acids differed between D11-JW-032 and D11-JW-017, and 17 amino acids were different between D11-JW-032 and D11-JW-012. These results suggest that EDSVs derived from ducks have various pathogenicities in laying hens. Key amino acid candidates might have altered their affinity to tropism of laying hens, causing difference pathogenicities.
Directory of Open Access Journals (Sweden)
Rodrigo Amado Santos
2015-12-01
Full Text Available Human capital should be seen as one of the most valuable assets to hotel businesses that aim for offering excellence, hospitality, efficiency and helpfulness to their business segment. In this sense, this paper has as main objective the exposure of principles and values that support the logic of workers’ capacity and training process in hotel ambience, seen here as a fundamental precept to structure a service and a treatment based on excellence values. Exposed it, this academic research has its methodological foundation on quantitative and qualitative analysis presented by a case study - JW Marriott Rio de Janeiro - seeking to exhibit an evaluation of training policies and their effects on excellence in service, in order to demonstrate how their guidelines reflect on hotel business operational and managerial results. Thus, the sample universe, guided by the perception of 26 workers on organizational training activities, allowed the following considerations: (1 there is, through different departments of this organization, the recognition of the importance of this process and its inferences on organizational results, conditioning to ensuring excellence of services; (2 the logic, the frequency and the commitment to the values presented by this guidelines allow a greater security and reliability on human resource, encouraging its proactivity. Finally, it will be discussed how such issues need to be seen as competitive advantages, able of offering its employees a "know how" essential for satisfaction, enchantment and loyalty of a hotel demand.
Superhigh-resolution 200ppi series TFT-LCDs; Chokoseisai 200ppi ekisho display series
Energy Technology Data Exchange (ETDEWEB)
Kawamata, K.; Hirai, H. [Toshiba Corp., Tokyo (Japan)
2000-02-01
We have developed a 202 pixels per inch (ppi) thin-film transistor liquid crystal display (TFT-LCD) using low-temperature polycrystalline silicon (LTPS) technology. The superhigh resolution of 202 ppi offers the same image quality as printed matter such as magazines. The 200 ppi series TFT-LCDs are expected to support further developments in such areas as electronic books (e-books) and personal digital-picture viewers. Our lineup of 200 ppi TFT-LCDs includes a 4-inch display with VGA resolution, which is suitable for palmtop-size applications, and a 6.3-inch display with XGA resolution, which is suitable for typical photograph or paperback book-size applications. Larger size LCDs with 200 ppi resolution will be developed. (author)
200 GW for Germany; 200 Gigawatt fuer Deutschland
Energy Technology Data Exchange (ETDEWEB)
Fuhs, Michael; Enkhardt, Sandra
2012-11-01
200 GW of solar power, i.e. seven times as much as today: Is that a realistic goal, or is it just propaganda for a lobby intending to make a good life for manufacturers and fitters? There is much to suggest that it may be a socially relevant goal.
Olshove, Vincent; Berndsen, Nicole; Sivarajan, Veena; Nawathe, Pooja; Phillips, Alistair
2018-04-01
Cardiac surgery on Jehovah's Witnesses (JW) can be challenging, given the desire to avoid blood products. Establishment of a blood conservation program involving the pre-, intra- and post-operative stages for all patients may lead to a minimized need for blood transfusion in all patients. Pre-operatively, all JW patients were treated with high dose erythropoietin 500 IU/kg twice a week. JW patients were compared to matching non-JW patients from the congenital cardiac database, two per JW to serve as control. Blood use, ventilation time, bypass time, pre-operative hematocrit, first in intensive care unit (ICU) and at discharge and 24 hour chest drainage were compared. Pre-operative huddle, operating room huddle and post-operative bedside handoff were done with the congenital cardiac surgeon, perfusionist, anesthesiologist and intensive care team in all patients for goal alignment. Five JW patients (mean weight 24.4 ± 25.0 Kg, range 6.3 - 60 Kg) were compared to 10 non-JW patients (weight 22.0 ± 22.8 Kg, range 6.2 - 67.8 Kg). There was no difference in bypass, cross-clamp, time to extubation (0.8 vs. 2.1 hours), peak inotrope score (2.0 vs. 2.3) or chest drainage. No JW patient received a blood product compared to 40% of non-JW. The pre-operative hematocrit (Hct) was statistically greater for the JW patients (46.1 ± 3.3% vs. 36.3 ± 4.7%, pconservation techniques across the continuum of care allowed bloodless surgery for JW and non-JW patients alike. Blood conservation is a team sport and to make significant strides requires participation and input by all care providers.
24 CFR 200.73 - Property development.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Property development. 200.73 Section 200.73 Housing and Urban Development Regulations Relating to Housing and Urban Development... Continuing Eligibility Requirements for Existing Projects Property Requirements § 200.73 Property development...
Single-step ethanol production from lignocellulose using novel extremely thermophilic bacteria.
Svetlitchnyi, Vitali A; Kensch, Oliver; Falkenhan, Doris A; Korseska, Svenja G; Lippert, Nadine; Prinz, Melanie; Sassi, Jamaleddine; Schickor, Anke; Curvers, Simon
2013-02-28
Consolidated bioprocessing (CBP) of lignocellulosic biomass to ethanol using thermophilic bacteria provides a promising solution for efficient lignocellulose conversion without the need for additional cellulolytic enzymes. Most studies on the thermophilic CBP concentrate on co-cultivation of the thermophilic cellulolytic bacterium Clostridium thermocellum with non-cellulolytic thermophilic anaerobes at temperatures of 55°C-60°C. We have specifically screened for cellulolytic bacteria growing at temperatures >70°C to enable direct conversion of lignocellulosic materials into ethanol. Seven new strains of extremely thermophilic anaerobic cellulolytic bacteria of the genus Caldicellulosiruptor and eight new strains of extremely thermophilic xylanolytic/saccharolytic bacteria of the genus Thermoanaerobacter isolated from environmental samples exhibited fast growth at 72°C, extensive lignocellulose degradation and high yield ethanol production on cellulose and pretreated lignocellulosic biomass. Monocultures of Caldicellulosiruptor strains degraded up to 89-97% of the cellulose and hemicellulose polymers in pretreated biomass and produced up to 72 mM ethanol on cellulose without addition of exogenous enzymes. In dual co-cultures of Caldicellulosiruptor strains with Thermoanaerobacter strains the ethanol concentrations rose 2- to 8.2-fold compared to cellulolytic monocultures. A co-culture of Caldicellulosiruptor DIB 087C and Thermoanaerobacter DIB 097X was particularly effective in the conversion of cellulose to ethanol, ethanol comprising 34.8 mol% of the total organic products. In contrast, a co-culture of Caldicellulosiruptor saccharolyticus DSM 8903 and Thermoanaerobacter mathranii subsp. mathranii DSM 11426 produced only low amounts of ethanol. The newly discovered Caldicellulosiruptor sp. strain DIB 004C was capable of producing unexpectedly large amounts of ethanol from lignocellulose in fermentors. The established co-cultures of new Caldicellulosiruptor
24 CFR 200.47 - Firm commitments.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Firm commitments. 200.47 Section 200.47 Housing and Urban Development Regulations Relating to Housing and Urban Development (Continued... Eligibility Requirements for Existing Projects Commitment Applications § 200.47 Firm commitments. A valid firm...
17 CFR 200.735-16 - Delegation.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Delegation. 200.735-16 Section 200.735-16 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT... Former Members and Employees of the Commission § 200.735-16 Delegation. Any official responsibility...
7 CFR 3052.200 - Audit requirements.
2010-01-01
... 7 Agriculture 15 2010-01-01 2010-01-01 false Audit requirements. 3052.200 Section 3052.200 Agriculture Regulations of the Department of Agriculture (Continued) OFFICE OF THE CHIEF FINANCIAL OFFICER, DEPARTMENT OF AGRICULTURE AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 3052.200...
36 CFR 200.2 - Field organization.
2010-07-01
... 36 Parks, Forests, and Public Property 2 2010-07-01 2010-07-01 false Field organization. 200.2 Section 200.2 Parks, Forests, and Public Property FOREST SERVICE, DEPARTMENT OF AGRICULTURE ORGANIZATION, FUNCTIONS, AND PROCEDURES Organization § 200.2 Field organization. The field organization of the Forest...
24 CFR 200.83 - Interest rate.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Interest rate. 200.83 Section 200... Eligibility Requirements for Existing Projects Mortgage Provisions § 200.83 Interest rate. (a) The mortgage shall bear interest at the rate agreed upon by the mortgagee and the mortgagor. (b) Interest shall be...
Energy Technology Data Exchange (ETDEWEB)
Jincai, Li; Zuying, Gao; Baocheng, Xu; Junxiao, He [Institute of Nuclear Energy and Technology, Tsingua Univ., Beijing (China)
1997-09-01
The NHR-200 is a commercial 200-MW District Heating Reactor developed in China. It is designed on the basis of design, construction and four-year operating experience of the 5MW Experimental Heating Reactor (NHR-5). It has special safety features which are briefly described in this paper. Accident classification and safety criteria are also explained. Some typical and serious accidents are studied theoretically, and their results are detailed in this paper. They demonstrate the excellent safety characteristics of HR-200. (author). 4 refs, 9 figs, 1 tab.
Indian Academy of Sciences (India)
LeBozec et al 1989), give rise to bis(cyclohexadienyl) complexes even when one of the arenes is the sterically congested 1,3,5-triisopropylbenzene ligand (Neto and ... It is also noteworthy that Boekelheide (Swann et al 1986) has demonstrated that the action of the hydride source red-Al upon Ru(n-2:2) paracyclophane)(n-.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Welding. 179.200-10 Section 179.200-10... Specifications for Non-Pressure Tank Car Tanks (Classes DOT-111AW and 115AW) § 179.200-10 Welding. (a) All joints... W (IBR, see § 171.7 of this subchapter). Welding procedures, welders and fabricators shall be...
10 CFR 1021.200 - DOE planning.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false DOE planning. 1021.200 Section 1021.200 Energy DEPARTMENT... Decisionmaking § 1021.200 DOE planning. (a) DOE shall provide for adequate and timely NEPA review of DOE... accordance with 40 CFR 1501.2 and this section. In its planning for each proposal, DOE shall include adequate...
46 CFR 117.200 - Survival craft-general.
2010-10-01
... 46 Shipping 4 2010-10-01 2010-10-01 false Survival craft-general. 117.200 Section 117.200 Shipping... Number and Type of Survival Craft § 117.200 Survival craft—general. (a) Each survival craft required on a... craft they replace. (c) A summary of survival craft requirements is provided in Table 117.200(c). Table...
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Employment. 200.640 Section... Programs or Activities Conducted by the Securities and Exchange Commission § 200.640 Employment. No... employment under any program or activity conducted by the agency. The definitions, requirements, and...
2010-07-01
....200 Navigation and Navigable Waters COAST GUARD, DEPARTMENT OF HOMELAND SECURITY (CONTINUED) POLLUTION OIL OR HAZARDOUS MATERIAL POLLUTION PREVENTION REGULATIONS FOR VESSELS Vessel Equipment § 155.200... outside the Boundary Lines, as defined in 46 CFR part 7, in any ocean or the Gulf of Mexico; any tank...
2010-07-01
...) Children means— (1) Persons up through age 21 who are entitled to a free public education through grade 12... 34 Education 1 2010-07-01 2010-07-01 false Definitions. 200.103 Section 200.103 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...
2010-07-01
... 31 Money and Finance: Treasury 1 2010-07-01 2010-07-01 false Application. 28.200 Section 28.200 Money and Finance: Treasury Office of the Secretary of the Treasury NONDISCRIMINATION ON THE BASIS OF... Application. Except as provided in §§ 28.205 through 28.235(a), these Title IX regulations apply to every...
2011-11-28
... Model 737-100, -200, -300, -400, and -500 series airplanes, a one-time detailed inspection is added to... Information Initial Compliance Time (i) For all Model 737-100, -200, -200C, -300, -400, and -500 series... by paragraph (r) of this AD. If any fastener is missing, before further flight, repair using a method...
7 CFR 948.200 - Accounting and collections.
2010-01-01
... 7 Agriculture 8 2010-01-01 2010-01-01 false Accounting and collections. 948.200 Section 948.200 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Marketing... Accounting and Collections § 948.200 Accounting and collections. (a) Each handler's assessment account with...
24 CFR 92.200 - Private-public partnership.
2010-04-01
... 24 Housing and Urban Development 1 2010-04-01 2010-04-01 false Private-public partnership. 92.200 Section 92.200 Housing and Urban Development Office of the Secretary, Department of Housing and Urban Development HOME INVESTMENT PARTNERSHIPS PROGRAM Program Requirements § 92.200 Private-public partnership...
19 CFR 200.735-103 - Counseling service.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Counseling service. 200.735-103 Section 200.735-103 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT General Provisions § 200.735-103 Counseling service. (a) The Chairman shall appoint a Designated Agency...
24 CFR 200.36 - Financial reporting requirements.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Financial reporting requirements. 200.36 Section 200.36 Housing and Urban Development Regulations Relating to Housing and Urban... Regulations § 200.36 Financial reporting requirements. The mortgagor must comply with the financial reporting...
45 CFR 149.200 - Use of reimbursements.
2010-10-01
... 45 Public Welfare 1 2010-10-01 2010-10-01 false Use of reimbursements. 149.200 Section 149.200 Public Welfare DEPARTMENT OF HEALTH AND HUMAN SERVICES REQUIREMENTS RELATING TO HEALTH CARE ACCESS REQUIREMENTS FOR THE EARLY RETIREE REINSURANCE PROGRAM Use of Reimbursements § 149.200 Use of reimbursements...
42 CFR 403.200 - Basis and scope.
2010-10-01
... 42 Public Health 2 2010-10-01 2010-10-01 false Basis and scope. 403.200 Section 403.200 Public... PROVISIONS SPECIAL PROGRAMS AND PROJECTS Medicare Supplemental Policies § 403.200 Basis and scope. (a... intent of that section is to enable Medicare beneficiaries to identify Medicare supplemental policies...
1997-1998 Annual Review of the 200 West and 200 East area performance assessments
International Nuclear Information System (INIS)
WOOD, M.I.
1999-01-01
An annual review of the 200 West and 200 East Area Performance Assessment (PA) analyses for fiscal year 1998 was completed. Burial ground disposal operations were found to be compliant with performance objectives in DOE Order 5820.2A. Other newly generated information and analyses relevant to PA assumptions and results were summarized. This report was initially submitted to the Department of Energy-Richland Office (DOE-RL) as a letter report in October, 1998
21 CFR 73.200 - Synthetic iron oxide.
2010-04-01
... 21 Food and Drugs 1 2010-04-01 2010-04-01 false Synthetic iron oxide. 73.200 Section 73.200 Food... COLOR ADDITIVES EXEMPT FROM CERTIFICATION Foods § 73.200 Synthetic iron oxide. (a) Identity. (1) The color additive synthetic iron oxide consists of any one or any combination of synthetically prepared...
46 CFR 180.200 - Survival craft-general.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Survival craft-general. 180.200 Section 180.200 Shipping...) LIFESAVING EQUIPMENT AND ARRANGEMENTS Number and Type of Survival Craft § 180.200 Survival craft—general. (a) Each survival craft required on a vessel by this part must meet one of the following: (1) For an...
21 CFR 137.200 - Whole wheat flour.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Whole wheat flour. 137.200 Section 137.200 Food... Flours and Related Products § 137.200 Whole wheat flour. (a) Whole wheat flour, graham flour, entire wheat flour is the food prepared by so grinding cleaned wheat, other than durum wheat and red durum...
12 CFR 563.200 - Conflicts of interest.
2010-01-01
... 12 Banks and Banking 5 2010-01-01 2010-01-01 false Conflicts of interest. 563.200 Section 563.200...-OPERATIONS Reporting and Bonding § 563.200 Conflicts of interest. If you are a director, officer, or employee..., or those of others with whom you have a personal or business relationship, at the expense of the...
Directory of Open Access Journals (Sweden)
Siddappa N Byrareddy
Full Text Available Lectin-like molecules and their receptors are cell surface molecules that have been shown to play a role in either facilitating infection or serving as transporters of HIV/SIV in vivo. The role of these lectin-like molecules in the pathogenesis of HIV/SIV infection continues to be defined. In efforts to gain further insight on the potential role of these lectin-like molecules, our laboratory generated monoclonal antibodies (mAb against the human analogs of rhesus macaque CD200, CD200R and Mincle, since the rhesus macaques are accepted as the most reliable animal model to study human HIV infection. The characterization of the cell lineages from the blood and various tissues of rhesus macaques that express these lectin-like molecules are described herein. Among the mononuclear cells, the cells of the myeloid lineage of rhesus macaques are the predominant cell lineages that express readily detectable levels of CD200, CD200R and Mincle that is similar to the expression of Siglec-1 and Siglec-3 reported by our laboratory earlier. Subset analysis revealed that a higher frequency of the CD14+/CD16- subset from normal rhesus macaques express CD200, CD200R and Mincle. Differences in the frequencies and density of expression of these molecules by the gated population of CD14+ cells from various tissues are noted with PBMC and bone marrow expressing the highest and the mononuclear cells isolated from the colon and ileum expressing the lowest levels. While a significant frequency of pDCs and mDCs express Siglec-1/Siglec-3, a much lower frequency expresses CD200, CD200R and Mincle in PBMCs from rhesus macaques. The mAb against CD200 and CD200R but not Mincle appear to inhibit the infection of macrophage tropic SIV/SHIV in vitro. We conclude that these mAbs may have potential to be used as adjunctive therapeutic agents to control/inhibit SIV/HIV infection.
Summary of the 200x200 GeV μ+-μ- collider working group
International Nuclear Information System (INIS)
Neuffer, D.; Whittum, D.; Bombade, P.; Cline, D.; Jackson, G.; McIntyre, P.; Peters, G.; Sasaki, M.; Summers, D.; Yokoya, K.
1996-01-01
We report the discussions and some preliminary results from the sessions of the 200x200 GeV μ + -μ - Collider working group. The physics motivation for such a open-quote open-quote medium-energy close-quote close-quote collider is discussed. Possible parameters for such a system are described, and compared with higher-energy systems. Relatively-high luminosities (L∼10 33 cm -2 s -1 ) appear possible. Modifications of existing facilities to obtain medium-energy μ + -μ - collisions are discussed. Other discussion topics (μ-p colliders, low-energy μ sources, etc.) are summarized. copyright 1995 American Institute of Physics
17 CFR 200.506 - Derivative classification.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Derivative classification. 200.506 Section 200.506 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Classification and Declassification of National Security...
200-BP-5 operable unit treatability test report
Energy Technology Data Exchange (ETDEWEB)
NONE
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites.
200-BP-5 operable unit treatability test report
International Nuclear Information System (INIS)
1996-04-01
The 200-BP-5 Operable Unit was established in response to recommendations presented in the 200 East Groundwater Aggregate Area Management Study Report (AAMSR) (DOE-RL 1993a). Recognizing different approaches to remediation, the groundwater AAMSR recommended separating groundwater from source and vadose zone operable units and subdividing 200 East Area groundwater into two operable units. The division between the 200-BP-5 and 200-PO-1 Operable Units was based principally on source operable unit boundaries and distribution of groundwater plumes derived from either B Plant or Plutonium/Uranium Extraction (PUREX) Plant liquid waste disposal sites
17 CFR 200.71 - Fiduciary relationships.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Fiduciary relationships. 200...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.71 Fiduciary relationships. A... are involved in questions to be determined by him. Such relationships would include trustees...
14 CFR 1251.200 - Discrimination prohibited.
2010-01-01
... 14 Aeronautics and Space 5 2010-01-01 2010-01-01 false Discrimination prohibited. 1251.200 Section... OF HANDICAP Employment Practices § 1251.200 Discrimination prohibited. (a) General. (1) No qualified handicapped person shall, on the basis of handicap, be subjected to discrimination in employment under any...
17 CFR 200.505 - Original classification.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Original classification. 200... Information and Material § 200.505 Original classification. (a) No Commission Member or employee has the authority to classify any information on an original basis. (b) If a Commission employee originates...
CCNA routing and switching review guide exams 100-101, 200-101, and 200-120
Lammle, Todd
2013-01-01
Todd Lammle's focused, concise review guide, updated for the latest CCNA exams CCNA is one of the most sought after certifications for IT professionals. If you're preparing for the CCNA Routing and Switching certification, this Sybex review guide offers the best quick review available. Organized by exam objective, it's the perfect supplement to other learning tools, including the Sybex CCNA Routing and Switching Study Guide (ISBN: 9781118749616). All exam topics from exams 100-101, 200-101, and 200-120 are thoroughly covered, and additional study materials including bonus exams, electronic f
17 CFR 200.64 - Judicial review.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Judicial review. 200.64... AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.64 Judicial review. The Congress has provided for review by the courts of the decisions and orders by this Commission. Members should recognize...
34 CFR 200.71 - LEA eligibility.
2010-07-01
... least five percent of the LEA's total population ages 5 to 17 years, inclusive. (d) Education finance... 34 Education 1 2010-07-01 2010-07-01 false LEA eligibility. 200.71 Section 200.71 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION...
ISABELLE: a 200 + 200 GeV colliding beam facility
International Nuclear Information System (INIS)
Courant, E.D.
1977-01-01
Plans are under way for the construction of a pair of intersecting storage rings providing for colliding beams of protons of energy at least 200 GeV. The rings (circumference 2.62 km) will contain superconducting magnets constructed with braided Nb--Ti filamentary wire, with a peak field of 4.0 T corresponding to an energy of 200 GeV. A current of 10 A of protons will be injected at 29 GeV from the existing AGS accelerator at Brookhaven, using the energy stacking technique similar to that employed at the CERN ISR; subsequently the stored beam will be accelerated gradually in the storage rings. Six intersection areas will be provided for experiments. They are designed to provide flexibility in beam characteristics for different experiments. The maximum luminosity at full energy is expected to be 1.0 x 10 33 cm -2 s -1 , at 29 GeV it will be approximately 10 32 cm -2 s -1 . Recent work with prototype magnets indicates that fields of 5.0 T can be produced. This has led to an alternative design of somewhat larger rings (circumference 3.77 km) that should be capable of providing colliding beams at 400 + 400 GeV
29 CFR 99.200 - Audit requirements.
2010-07-01
... 29 Labor 1 2010-07-01 2010-07-01 true Audit requirements. 99.200 Section 99.200 Labor Office of the Secretary of Labor AUDITS OF STATES, LOCAL GOVERNMENTS, AND NON-PROFIT ORGANIZATIONS Audits § 99.... Guidance on determining Federal awards expended is provided in § 99.205. (b) Single audit. Non-Federal...
17 CFR 200.70 - Business promotions.
2010-04-01
... AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.70 Business promotions. A member must not engage in any other business, employment or vocation while in office, nor may he ever use the... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Business promotions. 200.70...
200 area effluent treatment facility opertaional test report
International Nuclear Information System (INIS)
Crane, A.F.
1995-01-01
This document reports the results of the 200 Area Effluent Treatment Facility (200 Area ETF) operational testing activities. These Operational testing activities demonstrated that the functional, operational and design requirements of the 200 Area ETF have been met and identified open items which require retesting
45 CFR 604.200 - Agency and legislative liaison.
2010-10-01
... 45 Public Welfare 3 2010-10-01 2010-10-01 false Agency and legislative liaison. 604.200 Section 604.200 Public Welfare Regulations Relating to Public Welfare (Continued) NATIONAL SCIENCE FOUNDATION NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 604.200 Agency and legislative liaison. (a...
CCNA routing and switching study guide exams 100-101, 200-101, and 200-120
Lammle, Todd
2013-01-01
Prepare for the new CCNA exams with this Todd Lammle study guide Cisco author, speaker, and trainer Todd Lammle is considered the authority on all things networking, and his books have sold almost a million copies worldwide. This all-purpose CCNA study guide methodically covers all the objectives of the ICND1 (100-101) and ICND2 (200-101) exams as well as providing additional insight for those taking CCNA Composite (200-120) exam. It thoroughly examines operation of IP data networks, LAN switching technologies, IP addressing (IPv4/IPv6), IP routing technologies, IP services, network device s
17 CFR 200.735-7 - Negotiation for employment.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Negotiation for employment. 200.735-7 Section 200.735-7 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Employees and Former Members and Employees of the Commission § 200.735-7 Negotiation for employment. (a) An...
45 CFR 1230.200 - Agency and legislative liaison.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Agency and legislative liaison. 1230.200 Section 1230.200 Public Welfare Regulations Relating to Public Welfare (Continued) CORPORATION FOR NATIONAL AND COMMUNITY SERVICE NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 1230.200 Agency and legislative...
Type QH-200 conveyor-belt nuclear scale
International Nuclear Information System (INIS)
Li Shuming; Dong Shiyuan; Li Furong; Wan Zemin
1991-01-01
Type QH-200 conveyor-belt nuclear scale is a reliable and on-line device that weighs solids mass flow continuously by γ-ray absorption and scattering. The operation principle and measuring method are described. And some factors influencing the accuracy are discussed. The full scale total weight of type QH-200 nuclear scale is 10 6 t. The result of calibration in the industrial field shows that the accuracy of QH-200 is better than ±1.0% for typical belt loading
41 CFR 102-117.200 - What is HAZMAT?
2010-07-01
... Shipping Hazardous Material (HAZMAT) § 102-117.200 What is HAZMAT? HAZMAT is a substance or material the... 41 Public Contracts and Property Management 3 2010-07-01 2010-07-01 false What is HAZMAT? 102-117.200 Section 102-117.200 Public Contracts and Property Management Federal Property Management...
34 CFR 200.12 - Single State accountability system.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Single State accountability system. 200.12 Section 200... Improving Basic Programs Operated by Local Educational Agencies State Accountability System § 200.12 Single State accountability system. (a)(1) Each State must demonstrate in its State plan that the State has...
34 CFR 200.6 - Inclusion of all students.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Inclusion of all students. 200.6 Section 200.6... Basic Programs Operated by Local Educational Agencies Standards and Assessments § 200.6 Inclusion of all...— (A) For each student with a disability, as defined under section 602(3) of the IDEA, appropriate...
12 CFR 411.200 - Agency and legislative liaison.
2010-01-01
... 12 Banks and Banking 4 2010-01-01 2010-01-01 false Agency and legislative liaison. 411.200 Section 411.200 Banks and Banking EXPORT-IMPORT BANK OF THE UNITED STATES NEW RESTRICTIONS ON LOBBYING Activities by Own Employees § 411.200 Agency and legislative liaison. (a) The prohibition on the use of...
African Journals Online (AJOL)
The preferred method for diagnosis of endometriosis is surgical visual inspection ... cause the varied appearance of the disease allows less-obvious lesions to be overlooked. Empiric use of .... Musculoskeletal causes (e.g., pelvic. Male factor ...
29 CFR 2530.200b-6 - Maritime industry.
2010-07-01
... 29 Labor 9 2010-07-01 2010-07-01 false Maritime industry. 2530.200b-6 Section 2530.200b-6 Labor... Provisions § 2530.200b-6 Maritime industry. (a) General. Sections 202(a)(3)(D), 203(b)(2)(D) and 204(b)(3)(E... provisions applicable to the maritime industry. In general, those provisions permit statutory standards...
2005-01-01
Hollandi lasteraamatute autorist ja illustraatorist Max Velthuijs'ist (1923-2005). H.C. Anderseni 200. sünniaastapäevale pühendatud lasteraamatunäitusest Rahvusraamatukogus. Eksponeeritakse ka Tiina Reinsalu akvarelle raamatule "Ööbik"
Waste site grouping for 200 Areas soil investigations
International Nuclear Information System (INIS)
1997-01-01
The purpose of this document is to identify logical waste site groups for characterization based on criteria established in the 200 Areas Soil Remediation Strategy (DOE-RL 1996a). Specific objectives of the document include the following: finalize waste site groups based on the approach and preliminary groupings identified in the 200 Areas Soil Remediation Strategy; prioritize the waste site groups based on criteria developed in the 200 Areas Soil Remediation Strategy; select representative site(s) that best represents typical and worse-case conditions for each waste group; develop conceptual models for each waste group. This document will serve as a technical baseline for implementing the 200 Areas Soil Remediation Strategy. The intent of the document is to provide a framework, based on waste site groups, for organizing soil characterization efforts in the 200 Areas and to present initial conceptual models
10 CFR 603.200 - Contracting officer responsibilities.
2010-01-01
....200 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS TECHNOLOGY INVESTMENT AGREEMENTS Appropriate Use of Technology Investment Agreements § 603.200 Contracting officer responsibilities... contracting officer's judgment that the use of a TIA could benefit the RD&D objectives in ways that likely...
7 CFR 1900.157-1900.200 - [Reserved
2010-01-01
... 7 Agriculture 12 2010-01-01 2010-01-01 false [Reserved] 1900.157-1900.200 Section 1900.157-1900... BUSINESS-COOPERATIVE SERVICE, RURAL UTILITIES SERVICE, AND FARM SERVICE AGENCY, DEPARTMENT OF AGRICULTURE... Assistance to Employees, Relatives, and Associates §§ 1900.157-1900.200 [Reserved] ...
International Nuclear Information System (INIS)
1996-10-01
This environmental assessment has been prepared to assess potential environmental impacts associated with the US Department of Energy's proposed action: the salvage/demolition of the 200 West Area, 200 East Area, and 300 Area Steam Plants and steam distribution piping. Impact information will be used by the US Department of Energy, Richland Operations Office Manager, to determine if the proposed action is a major federal action significantly affecting the quality of the human environment. If the proposed action is determined to be major and significant, an environmental impact statement will be prepared. If the proposed action is determined not to be major and significant, a Finding of No Significant Impact (FONSI) will be issued and the action can proceed. The proposed action involves the salvage and demolition of the 200 West Area, 200 East Are, and 300 Area steam plants and their associated steam distribution piping, equipment, and ancillary facilities. Activities include the salvaging and recycling of all materials, wastes, and equipment where feasible, with waste minimization efforts utilized
200 Area treated effluent disposal facility operational test report
International Nuclear Information System (INIS)
Crane, A.F.
1995-01-01
This document reports the results of the 200 Area Treated Effluent Disposal Facility (200 Area TEDF) operational testing activities. These completed operational testing activities demonstrated the functional, operational and design requirements of the 200 Area TEDF have been met
34 CFR 200.59 - Duties of paraprofessionals.
2010-07-01
...) Conducting parent involvement activities. (5) Providing instructional support in a library or media center... 34 Education 1 2010-07-01 2010-07-01 false Duties of paraprofessionals. 200.59 Section 200.59 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY...
34 CFR 200.18 - Annual measurable objectives.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Annual measurable objectives. 200.18 Section 200.18 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY EDUCATION, DEPARTMENT OF EDUCATION TITLE I-IMPROVING THE ACADEMIC ACHIEVEMENT OF THE DISADVANTAGED Improving...
49 CFR 613.200 - Statewide transportation planning and programming.
2010-10-01
... 49 Transportation 7 2010-10-01 2010-10-01 false Statewide transportation planning and programming. 613.200 Section 613.200 Transportation Other Regulations Relating to Transportation (Continued... Transportation Planning and Programming § 613.200 Statewide transportation planning and programming. The...
34 CFR 200.28 - Schoolwide program components.
2010-07-01
... instructional program. (c) Parental involvement. (1) A schoolwide program must involve parents in the planning... 34 Education 1 2010-07-01 2010-07-01 false Schoolwide program components. 200.28 Section 200.28 Education Regulations of the Offices of the Department of Education OFFICE OF ELEMENTARY AND SECONDARY...
34 CFR 200.44 - Public school choice.
2010-07-01
...) of this section, the LEA must— (i) Provide to parents of students eligible to transfer under..., DEPARTMENT OF EDUCATION TITLE I-IMPROVING THE ACADEMIC ACHIEVEMENT OF THE DISADVANTAGED Improving Basic... corrective action under § 200.33, or for restructuring under § 200.34, the LEA must provide all students...
17 CFR 200.507 - Declassification dates on derivative documents.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Declassification dates on derivative documents. 200.507 Section 200.507 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... of National Security Information and Material § 200.507 Declassification dates on derivative...
34 CFR 200.36 - Communication with parents.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Communication with parents. 200.36 Section 200.36... with parents. (a) Throughout the school improvement process, the State, LEA, or school must communicate with the parents of each child attending the school. (b) The State, LEA, or school must ensure that...
34 CFR 200.53 - LEA corrective action.
2010-07-01
... operated by the LEA to a higher-performing public school operated by another LEA in accordance with § 200... Programs Operated by Local Educational Agencies Lea and School Improvement § 200.53 LEA corrective action... SEA to identify an LEA for corrective action; and (ii) Any underlying staffing, curriculum, or other...
Strain typing with IS200 fingerprints in Salmonella abortusovis.
Schiaffino, A; Beuzón, C R; Uzzau, S; Leori, G; Cappuccinelli, P; Casadesús, J; Rubino, S
1996-07-01
A collection of Salmonella abortusovis isolates was examined for the presence of insertion element IS200. All proved to contain three or four copies of the element. One IS200 hybridization band of approximately 9 kb was found in all isolates, indicating that all S. abortusovis strains carry an IS200 element in similar or identical locations; this band can be potentially useful for serovar identification. S. abortusovis collection isolates from distinct geographic areas were highly polymorphic, suggesting that IS200 fingerprints might provide information on the geographic origin of S. abortusovis strains. Isolates obtained from the same geographic area (the island of Sardinia, Italy) were less polymorphic: all shared three constant IS200 hybridization bands, indicating that they derive from a single ancestor. Most strains analyzed contained an additional copy of IS200 in the variable region of the virulence plasmid. Certain Sardinian flocks proved to be infected by only one S. abortusovis strain, while others harbored two strains. Strain typing with IS200 fingerprints proved to be more reliable than plasmid analysis, because the latter yielded a high degree of polymorphism, even among isolates from the same flock.
Interaural attenuation for Sennheiser HDA 200 circumaural earphones.
Brännström, K Jonas; Lantz, Johannes
2010-06-01
Interaural attenuation (IA) was evaluated for pure tones (frequency range 125 to 16000 Hz) using Sennheiser HDA 200 circumaural earphones and Telephonics TDH-39P earphones in nine unilaterally deaf subjects. Audiometry was conducted in 1-dB steps using the manual ascending technique in accordance with ISO 8253-1. For all subjects and for all tested frequencies, the lowest IA value for HDA 200 was 42 dB. The present IA values for TDH-39P earphones closely resemble previously reported data. The findings show that the HDA 200 earphones provide more IA than the TDH-39P, especially at lower frequencies (HDA 200 earphones when the level at the test ear is more than 40 dB above the threshold of the non-test ear.
17 CFR 200.26a - Office of Information Technology.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Office of Information Technology. 200.26a Section 200.26a Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION... Organization § 200.26a Office of Information Technology. The Office of Information Technology is responsible...
17 CFR 200.61 - Impressions of influence.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Impressions of influence. 200...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.61 Impressions of influence. A... influence him, that any person unduly enjoys his favor or that he is affected in any way by the rank...
International Nuclear Information System (INIS)
1994-12-01
This safety assessment provides an analysis of the proposed pilot-scale treatability test activities to be and conducted within the 200 Area groundwater operable units on the Hanford Site. The 200-UP-1 and 200-ZP-1 operable units are located in the 200 West Area of the Hanford Site. These tests will evaluate an ion exchange (IX) water purification treatment system and granular activated carbon (GAC). A detailed engineering analysis of (GAC) adsorption for remediation of groundwater contamination. A detailed engineering analysis of the IX treatment system. The principal source of information for this assessment, states that the performance objective of the treatment systems is to remove 90% of the uranium and technetium-99 ( 99 Tc) from the extracted groundwater at the 200-UP-1 site. The performance objective for 200-ZP-1 is to remove 90% of the carbon tetrachloride (CCl 4 ), chloroform, and trichloroethylene (TCE) from the extracted groundwater
21 CFR 1404.200 - What is a covered transaction?
2010-04-01
... 21 Food and Drugs 9 2010-04-01 2010-04-01 false What is a covered transaction? 1404.200 Section 1404.200 Food and Drugs OFFICE OF NATIONAL DRUG CONTROL POLICY GOVERNMENTWIDE DEBARMENT AND SUSPENSION (NONPROCUREMENT) Covered Transactions § 1404.200 What is a covered transaction? A covered transaction is a...
40 CFR 246.200 - High-grade paper recovery.
2010-07-01
... 40 Protection of Environment 24 2010-07-01 2010-07-01 false High-grade paper recovery. 246.200 Section 246.200 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) SOLID WASTES SOURCE... paper recovery. ...
Analysis and modelling of engineering structures in frequency domain
International Nuclear Information System (INIS)
Ishtev, K.; Bonev, Z.; Petrov, P.; Philipov, P.
1987-01-01
This paper deals with some possible applications for modelling and analysis of engineering structures, basing on technique, mentioned above. The governing system of equations is written by using frequency domain approach since elemination technique has computational significance in this field. Modelling is made basing on the well known relationship Y(jw) = W(jw) * X(jw). Here X(jw) is a complex Fourier spectra associated with the imput signals being defined as earthquake, wind, hydrodynamic, control or other type of action. W(jw) is a matrix complex transfer function which reveals the correlation between input X und output Y spectra. Y (ja) represents a complex Fourier spectra of output signals. Input and output signals are both associated with master degrees of freedom, thus matrix transfer function is composed of elements in such a manner that solve unknown parameters are implemented implicitly. It is available an integration algorithm of 'condensed' system of equations. (orig./GL)
200-UP-2 Operable Unit technical baseline report
International Nuclear Information System (INIS)
Deford, D.H.
1991-02-01
This report is prepared in support of the development of a Remedial Investigation/Feasibility Study (RI/FS) Work Plan for the 200-UP-2 Operable Unit by EBASCO Environmental, Incorporated. It provides a technical baseline of the 200-UP-2 Operable Unit and results from an environmental investigation undertaken by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The 200-UP-2 Operable Unit Technical Baseline Report is based on review and evaluation of numerous Hanford Site current and historical reports, Hanford Site drawings and photographs and is supplemented with Hanford Site inspections and employee interviews. No field investigations or sampling were conducted. Each waste site in the 200-UP-2 Operable Unit is described separately. Close relationships between waste units, such as overflow from one to another, are also discussed. The 200-UP-2 Operable Unit consists of liquid-waste disposal sites in the vicinity of, and related to, U Plant operations in the 200 West Area of the Hanford Site. The ''U Plant'' refers to the 221-U Process Canyon Building, a chemical separations facility constructed during World War 2. It also includes the Uranium Oxide (UO 3 ) Plant, which was constructed at the same time and, like the 221-U Process Canyon Building, was later converted for other missions. Waste sites in the 200-UP-2 Operable Unit are associated with the U Plant Uranium Metal Recovery Program mission that occurred between 1952 and 1958 and the UO 3 Plant's ongoing uranium oxide mission and include one or more cribs, reverse wells, french drains, septic tanks and drain fields, trenches, catch tanks, settling tanks, diversion boxes, waste vaults, and the lines and encasements that connect them. 11 refs., 1 tab
7 CFR 57.200 - Records and related requirements.
2010-01-01
... 7 Agriculture 3 2010-01-01 2010-01-01 false Records and related requirements. 57.200 Section 57.200 Agriculture Regulations of the Department of Agriculture (Continued) AGRICULTURAL MARKETING SERVICE (Standards, Inspections, Marketing Practices), DEPARTMENT OF AGRICULTURE (CONTINUED) REGULATIONS...
NCBI nr-aa BLAST: CBRC-OSAT-10-0002 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-OSAT-10-0002 ref|NP_623489.1| ABC-type dipeptide/oligopeptide/nickel transport systems...peptide/nickel transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_623489.1 1.9 30% ...
International Nuclear Information System (INIS)
Wellman, Dawn M.; Riley, Robert G.; Cordova, Elsa A.; Parker, Kent E.; Mitroshkov, Alexandre V.
2007-01-01
Kd values obtained on sediment samples from 200-UP-1 and 10-ZP-1 contribute to a larger Kd database that exists for other Hanford sediments, and contains significant desorption data for CCl4. Adsorption results presented here validate the use of a linear adsorption isotherm (Kd) to predict short contact time CCl4 adsorption to sediments in 200-UP-1 groundwater plume for a distinct ranges in CCl4 concentration. However, this does not imply that values of Kd will be constant if the groundwater chemical composition at 200-UP-1 changes with space or time. Additionally, results presented here suggest the potential significance of slower intraparticle diffusion on the long-term fate of CCl4 within the subsurface Hanford environment. Such behavior could afford prolonged desorption of CCl4 and serve as a long-term source of contaminant CCl4 to the aquifer. Further evaluation of possible bimodal sorption behavior for CCl4 and the mechanism of CCl4 sequestration should be the subject of future investigations to provide a thorough, mechanistic understanding of the retention and long-term fate of CCl4. Comparison of previous data with new results (e.g., from this study) will allow inferences to be made on how the 200-UP-1 Kd values for CCl4 may compare with sediments from other Hanford locations. This site-specific sorption data, when complemented by the chemical, geologic, mineralogic, hydrologic, and physical characterization data that are also being collected (see Sampling and Analysis Plan for the 200-UP-1 Groundwater Monitoring Well Network, DOE 2002) can be used to develop a robust, scientifically defensible data base to allow risk predictions to be generated and to aid in future remediation decisions for the 200-UP-1 and 200-ZP-1 operable units
2010-04-01
... INFORMATION AND REQUESTS Organization and Program Management General Organization § 200.29 Rules. The.... Where any such proposals presents a legal problem or is a matter of first impression, or involves a...
Manitoba Dept. of Education, Winnipeg.
Manitoba's curriculum guide for German 100, 200, and 300 is designed to (1) make teachers of these courses aware of the official policy concerning the nature, goals, and objectives of the courses and approved teaching materials, and (2) provide instructional guidelines. The guide provides information about three sets of teaching materials from…
2010-04-01
... Conventional Fuels or Chemicals of an Explosive or Flammable Nature § 51.200 Purpose. The purpose of this... store, handle, or process hazardous substances; (b) Alert those responsible for the siting of HUD...
200-UP-2 operable unit radiological surveys
International Nuclear Information System (INIS)
Wendling, M.A.
1994-01-01
This report summarizes and documents the results of the radiological surveys conducted from August 17 through December 16, 1993 over a partial area of the 200-UP-2 Operable Unit, 200-W Area, Hanford Site, Richland, Washington. In addition, this report explains the survey methodology of the Mobile Surface Contamination Monitor 11 (MSCM-II) and the Ultra Sonic Ranging And Data System (USRADS). The radiological survey of the 200-UP-2 Operable Unit was conducted by the Site Investigative Surveys/Environmental Restoration Health Physics Organization of the Westinghouse Hanford Company. The survey methodology for the majority of area was based on utilization of the MSCM-II or the USRADS for automated recording of the gross beta/gamma radiation levels at or near six (6) inches from the surface soil
49 CFR 179.200-11 - Postweld heat treatment.
2010-10-01
... 49 Transportation 2 2010-10-01 2010-10-01 false Postweld heat treatment. 179.200-11 Section 179.200-11 Transportation Other Regulations Relating to Transportation PIPELINE AND HAZARDOUS MATERIALS... Postweld heat treatment. When specified in § 179.201-1, after welding is complete, postweld heat treatment...
21 CFR 155.200 - Certain other canned vegetables.
2010-04-01
... 21 Food and Drugs 2 2010-04-01 2010-04-01 false Certain other canned vegetables. 155.200 Section 155.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) FOOD FOR HUMAN CONSUMPTION CANNED VEGETABLES Requirements for Specific Standardized Canned...
21 CFR 522.1660a - Oxytetracycline solution, 200 milligrams/milliliter.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Oxytetracycline solution, 200 milligrams... FORM NEW ANIMAL DRUGS § 522.1660a Oxytetracycline solution, 200 milligrams/milliliter. (a) Specifications. Each milliliter of sterile solution contains 200 milligrams of oxytetracycline base. (b) Sponsors...
Os 200 anos da pilha elétrica The 200 years of the electric pile
Directory of Open Access Journals (Sweden)
Aécio Pereira Chagas
2000-06-01
Full Text Available In celebration of the 200th anniversary of the electric pile, invented by Alessandro Volta, a synopsis of his letter to The Royal Society (London and of his biography is presented.
21 CFR 573.200 - Condensed animal protein hydrolysate.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Condensed animal protein hydrolysate. 573.200... ANIMALS Food Additive Listing § 573.200 Condensed animal protein hydrolysate. (a) Identity. The condensed animal protein hydrolysate is produced from the meat byproducts scraped from cured (salted) hides taken...
34 CFR 200.73 - Applicable hold-harmless provisions.
2010-07-01
... meet the eligibility requirements for a basic grant, targeted grant, or education finance incentive... Improving Basic Programs Operated by Local Educational Agencies Allocations to Leas § 200.73 Applicable hold... provided in § 200.100(d), an SEA must apply the hold-harmless requirement separately for basic grants...
21 CFR 522.1125 - Hemoglobin glutamer-200 (bovine).
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Hemoglobin glutamer-200 (bovine). 522.1125 Section... (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS IMPLANTATION OR INJECTABLE DOSAGE FORM NEW ANIMAL DRUGS § 522.1125 Hemoglobin glutamer-200 (bovine). (a) Specifications. Each 125 milliliter bag contains 13...
17 CFR 200.18 - Director of Division of Corporation Finance.
2010-04-01
... Corporation Finance. 200.18 Section 200.18 Commodity and Securities Exchanges SECURITIES AND EXCHANGE... General Organization § 200.18 Director of Division of Corporation Finance. The Director of the Division of Corporation Finance is responsible to the Commission for the administration of all matters (except those...
13 CFR 120.200 - What bonding requirements exist during construction?
2010-01-01
... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false What bonding requirements exist during construction? 120.200 Section 120.200 Business Credit and Assistance SMALL BUSINESS ADMINISTRATION BUSINESS LOANS Policies Specific to 7(a) Loans Bonding Requirements § 120.200 What bonding requirements...
State Waste Discharge Permit application: 200-W Powerhouse Ash Pit
Energy Technology Data Exchange (ETDEWEB)
Atencio, B.P.
1994-06-01
As part of the Hanford Federal Facility Agreement and Consent Order negotiations; the US Department of Energy, Richland Operations Office, the US Environmental Protection Agency, and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground on the Hanford Site which affect groundwater or have the potential to affect groundwater would be subject to permitting under the structure of Chapter 173-216 (or 173-218 where applicable) of the Washington Administrative Code, the State Waste Discharge Permit Program. This document constitutes the State Waste Discharge Permit application for the 200-W Powerhouse Ash Pit. The 200-W Powerhouse Ash Waste Water discharges to the 200-W Powerhouse Ash Pit via dedicated pipelines. The 200-W Powerhouse Ash Waste Water is the only discharge to the 200-W Powerhouse Ash Pit. The 200-W Powerhouse is a steam generation facility consisting of a coal-handling and preparation section and boilers.
State Waste Discharge Permit application: 200-E Powerhouse Ash Pit
Energy Technology Data Exchange (ETDEWEB)
Atencio, B.P.
1994-06-01
As part of the Hanford Federal Facility Agreement and Consent Order negotiations, the US Department and Energy, Richland Operations Office, the US Environmental Protection Agency, and the Washington State Department of Ecology agreed that liquid effluent discharges to the ground on the Hanford Site which affect groundwater or have the potential to affect groundwater would be subject to permitting under the structure of Chapter 173-216 (or 173-218 where applicable) of the Washington Administrative Code, the State Waste Discharge Permit Program. This document constitutes the State Waste Discharge Permit application for the 200-E Powerhouse Ash Pit. The 200-E Powerhouse Ash Waste Water discharges to the 200-E Powerhouse Ash Pit via dedicated pipelines. The 200-E Ash Waste Water is the only discharge to the 200-E Powerhouse Ash Pit. The 200-E Powerhouse is a steam generation facility consisting of a coal-handling and preparation section and boilers.
Mechanical and structural design of the 200 MW nuclear heating reactor (NHR-200)
International Nuclear Information System (INIS)
Dong Duo; He Shuyan; Shi Yongchang; Wu Honglin; Chang Huajian; Hang Yonglin; Chi Zongpo
1997-01-01
In this paper, some mechanical and structural design features of NHR-200 are briefly described focussing on: design and technical features of internals; a new type hydraulic control rod driven system; spent fuel storage around the active core; design and safety characteristics of pressure vessel; discussion on in-service inspection of pressure vessel. (author). 4 figs
Mechanical and structural design of the 200 MW nuclear heating reactor (NHR-200)
Energy Technology Data Exchange (ETDEWEB)
Duo, Dong; Shuyan, He; Yongchang, Shi; Honglin, Wu; Huajian, Chang; Yonglin, Hang; Zongpo, Chi [Institute of Nuclear Energy and Technology, Tsingua Univ., Beijing (China)
1997-09-01
In this paper, some mechanical and structural design features of NHR-200 are briefly described focussing on: design and technical features of internals; a new type hydraulic control rod driven system; spent fuel storage around the active core; design and safety characteristics of pressure vessel; discussion on in-service inspection of pressure vessel. (author). 4 figs.
20 CFR 401.200 - Blood donor locator service.
2010-04-01
... 20 Employees' Benefits 2 2010-04-01 2010-04-01 false Blood donor locator service. 401.200 Section... AND INFORMATION Disclosure of Official Records and Information § 401.200 Blood donor locator service... donors whose blood donations show that they are or may be infected with the human immunodeficiency virus...
NCBI nr-aa BLAST: CBRC-DMEL-02-0080 [SEVENS
Lifescience Database Archive (English)
Full Text Available CBRC-DMEL-02-0080 ref|NP_622419.1| Ribose/xylose/arabinose/galactoside ABC-type transport systems...inose/galactoside ABC-type transport systems, permease components [Thermoanaerobacter tengcongensis MB4] NP_622419.1 0.92 33% ...
24 CFR 200.926a - Residential building code comparison items.
2010-04-01
... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Residential building code comparison items. 200.926a Section 200.926a Housing and Urban Development Regulations Relating to Housing and... § 200.926a Residential building code comparison items. HUD will review each local and State code...
17 CFR 200.67 - Power to adopt rules.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Power to adopt rules. 200.67... AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.67 Power to adopt rules. In exercising... by the Congress imposes the obligation upon the members to adopt rules necessary to effectuate the...
17 CFR 200.21a - The Ethics Counsel.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false The Ethics Counsel. 200.21a...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General Organization § 200.21a The Ethics Counsel. (a) The Ethics Counsel within the Office of the General Counsel of the...
2010-04-01
... Federal land management agency, to the extent appropriate, to develop by rule safety, bridge, pavement, and congestion management systems for roads funded under the FLHP. ... MANAGEMENT SYSTEMS Fish and Wildlife Service Management Systems § 972.200 Purpose. The purpose of this...
Arbitrary waveform modulated pulse EPR at 200 GHz
Kaminker, Ilia; Barnes, Ryan; Han, Songi
2017-06-01
We report here on the implementation of arbitrary waveform generation (AWG) capabilities at ∼200 GHz into an Electron Paramagnetic Resonance (EPR) and Dynamic Nuclear Polarization (DNP) instrument platform operating at 7 T. This is achieved with the integration of a 1 GHz, 2 channel, digital to analog converter (DAC) board that enables the generation of coherent arbitrary waveforms at Ku-band frequencies with 1 ns resolution into an existing architecture of a solid state amplifier multiplier chain (AMC). This allows for the generation of arbitrary phase- and amplitude-modulated waveforms at 200 GHz with >150 mW power. We find that the non-linearity of the AMC poses significant difficulties in generating amplitude-modulated pulses at 200 GHz. We demonstrate that in the power-limited regime of ω1 10 MHz) spin manipulation in incoherent (inversion), as well as coherent (echo formation) experiments. Highlights include the improvement by one order of magnitude in inversion bandwidth compared to that of conventional rectangular pulses, as well as a factor of two in improvement in the refocused echo intensity at 200 GHz.
2010-04-01
... management agency, to the extent appropriate, to develop by rule safety, bridge, pavement, and congestion... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS HIGHWAYS FOREST SERVICE MANAGEMENT SYSTEMS Forest Highway Program Management Systems § 971.200 Purpose. The purpose of this subpart is to...
4 CFR 200.11 - Maintaining records of disclosure.
2010-01-01
... the Freedom of Information Act (5 U.S.C. 552). (b) An accounting of each disclosure shall be retained..., whichever is longer. (c) The Board shall make the accounting of disclosure of a record pertaining to an... 4 Accounts 1 2010-01-01 2010-01-01 false Maintaining records of disclosure. 200.11 Section 200.11...
Dynamic Behavior of Nano-Sized Particles in Novel Energetic Materials for Space Propulsion
2009-08-11
independent of direction); then I(rw,s) = Jwir^/ir, n • s > 0, (8) where Jw = enlb + pH (9) is the surface radiosity and the subscript w denotes a...of the surface radiosity yields G + 2q„ =4JW. (28) In addition to this relation, we require that the normal radiative heat flux is the sum of the...incident and reflected ( radiosity ) contributions: qn = Jw - H. (29) The incident radiation is eliminated in favor of the radiosity using (9) and the
Knocking Down Snrnp200 Initiates Demorphogenesis of Rod Photoreceptors in Zebrafish
Directory of Open Access Journals (Sweden)
Yuan Liu
2015-01-01
Full Text Available Purpose. The small nuclear ribonucleoprotein 200 kDa (SNRNP200 gene is a fundamental component for precursor message RNA (pre-mRNA splicing and has been implicated in the etiology of autosomal dominant retinitis pigmentosa (adRP. This study aims to determine the consequences of knocking down Snrnp200 in zebrafish. Methods. Expression of the Snrnp200 transcript in zebrafish was determined via whole mount in situ hybridization. Morpholino oligonucleotide (MO aiming to knock down the expression of Snrnp200 was injected into zebrafish embryos, followed by analyses of aberrant splicing and expression of the U4/U6-U5 tri-small nuclear ribonucleoproteins (snRNPs components and retina-specific transcripts. Systemic changes and retinal phenotypes were further characterized by histological study and immunofluorescence staining. Results. Snrnp200 was ubiquitously expressed in zebrafish. Knocking down Snrnp200 in zebrafish triggered aberrant splicing of the cbln1 gene, upregulation of other U4/U6-U5 tri-snRNP components, and downregulation of a panel of retina-specific transcripts. Systemic defects were found correlated with knockdown of Snrnp200 in zebrafish. Only demorphogenesis of rod photoreceptors was detected in the initial stage, mimicking the disease characteristics of RP. Conclusions. We conclude that knocking down Snrnp200 in zebrafish could alter regular splicing and expression of a panel of genes, which may eventually trigger rod defects.
Use of extremophilic bacteria for second generation bioethanol production
DEFF Research Database (Denmark)
Tomás, Ana Faria; Karakashev, Dimitar Borisov; Angelidaki, Irini
production from food crops, such as corn (starch) or sugar cane (sucrose) is already an established process, with the USA and Brazil supplying 86% of the market. The major challenge remains in the use of different waste sources – agricultural, forestry, animal and household waste - as a feedstock....... The recalcitrance of these materials and their diverse sugar composition make the industrial yeast strains currently used unsuitable for a second generation bioethanol production process. One of the alternative strategies is the use of extreme thermophilic microorganisms. Currently, selected members from the genera...... Clostridium, Thermoanaerobacter, Geobacillus and Thermoanaerobacterium are among the best candidates. A new strain of Thermoanaerobacter, closely related to T. italicus and T. mathranii, has achieved 0.43 gethanol/gxylose, which is 83% of the theoretical yield of ethanol based on xylose and the highest value...
24 CFR 200.620 - Requirements.
2010-04-01
... DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Affirmative Fair Housing Marketing Regulations § 200.620... minority outlets which are available in the housing market area. All advertising shall include either the Department-approved Equal Housing Opportunity logo or slogan or statement and all advertising depicting...
International Nuclear Information System (INIS)
TOSI, D.
2014-01-01
The Enriched Xenon Observatory (EXO) is an experimental program searching for neutrino-less double beta decay in xenon-136. The first stage of this program, EXO-200, has been in operation since early 2011. I present here the latest physics results from the experiment.
40 CFR 421.200 - Applicability: Description of the secondary mercury subcategory.
2010-07-01
... secondary mercury subcategory. 421.200 Section 421.200 Protection of Environment ENVIRONMENTAL PROTECTION AGENCY (CONTINUED) EFFLUENT GUIDELINES AND STANDARDS NONFERROUS METALS MANUFACTURING POINT SOURCE CATEGORY Secondary Mercury Subcategory § 421.200 Applicability: Description of the secondary mercury...
2010-04-01
... appropriate, to develop by rule safety, bridge, pavement, and congestion management systems for roads funded... HIGHWAY ADMINISTRATION, DEPARTMENT OF TRANSPORTATION FEDERAL LANDS HIGHWAYS MANAGEMENT SYSTEMS PERTAINING... Management Systems § 973.200 Purpose. The purpose of this subpart is to implement 23 U.S.C. 204 which...
2010-04-01
... Federal land management agency, to the extent appropriate, to develop by rule safety, bridge, pavement, and congestion management systems for roads funded under the FLHP. These management systems serve to... MANAGEMENT SYSTEMS National Park Service Management Systems § 970.200 Purpose. The purpose of this subpart is...
BAF200 is required for heart morphogenesis and coronary artery development.
Directory of Open Access Journals (Sweden)
Lingjuan He
Full Text Available ATP-dependent SWI/SNF chromatin remodeling complexes utilize ATP hydrolysis to non-covalently change nucleosome-DNA interactions and are essential in stem cell development, organogenesis, and tumorigenesis. Biochemical studies show that SWI/SNF in mammalian cells can be divided into two subcomplexes BAF and PBAF based on the subunit composition. ARID2 or BAF200 has been defined as an intrinsic subunit of PBAF complex. However, the function of BAF200 in vivo is not clear. To dissect the possible role of BAF200 in regulating embryogenesis and organ development, we generated BAF200 mutant mice and found they were embryonic lethal. BAF200 mutant embryos exhibited multiple cardiac defects including thin myocardium, ventricular septum defect, common atrioventricular valve, and double outlet right ventricle around E14.5. Moreover, we also detected reduced intramyocardial coronary arteries in BAF200 mutants, suggesting that BAF200 is required for proper migration and differentiation of subepicardial venous cells into arterial endothelial cells. Our work revealed that PBAF complex plays a critical role in heart morphogenesis and coronary artery angiogenesis.
2010-04-01
... GENERAL INTRODUCTION TO FHA PROGRAMS Affirmative Fair Housing Marketing Regulations § 200.610 Policy. It... condition in which individuals of similar income levels in the same housing market area have a like range of... programs shall pursue affirmative fair housing marketing policies in soliciting buyers and tenants, in...
2010-04-01
... ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.53 Preamble. (a) Members of the Securities and Exchange Commission are entrusted by various enactments of the Congress with powers and duties of... possible abuses and injustice which, if left unchecked, might jeopardize the strength of our economic...
17 CFR 200.1 - General statement and statutory authority.
2010-04-01
...) Investigation of securities frauds, manipulations, and other violations, and the imposition and enforcement of... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false General statement and statutory authority. 200.1 Section 200.1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE...
24 CFR 200.929a - Fair Housing Accessibility Guidelines.
2010-04-01
... Guidelines. 200.929a Section 200.929a Housing and Urban Development Regulations Relating to Housing and Urban... Fair Housing Accessibility Guidelines. Builders and developers may use the Department's Fair Housing Accessibility Guideline when designing or constructing covered multifamily dwelling units in order to comply...
2010-01-01
... Management; and, (h) Establish internal management controls to monitor NASA actions to assure compliance with... Wetlands Management § 1216.200 Scope. This subpart 1216.2 prescribes procedures to: (a) Avoid long- and... practicable alternative; (c) Reduce the risk of flood loss; (d) Minimize the impact of floods on human health...
17 CFR 200.20b - Director of Division of Investment Management.
2010-04-01
... Investment Management. 200.20b Section 200.20b Commodity and Securities Exchanges SECURITIES AND EXCHANGE... General Organization § 200.20b Director of Division of Investment Management. The Director of the Division of Investment Management is responsible to the Commission for the administration of the Commission's...
4 CFR 200.14 - Responsibility for maintaining adequate safeguards.
2010-01-01
... identifiable personal data and automated systems shall be adequately trained in the security and privacy of... the security and privacy of such records. (5) The disposal and destruction of identifiable personal....14 Section 200.14 Accounts RECOVERY ACCOUNTABILITY AND TRANSPARENCY BOARD PRIVACY ACT OF 1974 § 200...
MicroRNA-200b is downregulated in colon cancer budding cells
DEFF Research Database (Denmark)
Knudsen, Kirsten Nguyen; Lindebjerg, Jan; Nielsen, Boye Schnack
2017-01-01
BACKGROUND: The microRNA-200 (miR-200) family acts as a major suppressor of epithelial-mesenchymal transition (EMT). Impaired miR-200 expression may lead to EMT initiation and eventually cancer dissemination. The presence of tumor budding cells (TBC) is associated with metastasis and poor prognosis......, and molecular similarities to EMT indicate that these cells may reflect ongoing EMT. The aim of this study was to investigate the expression of miR-200b in budding cells of colon cancer and the relationship with the EMT-markers E-cadherin, β-catenin and laminin-5γ2. MATERIAL & METHODS: MiR-200b was investigated...... by in situ hybridization in 58 cases of stage II (n = 36) and III colon (n = 22) cancers with tumor budding. Expression of E-cadherin, β-catenin and laminin-5γ2 was examined by immunohistochemistry. A multiplex fluorescence assay combining miR-200b with cytokeratin and laminin-5γ2 was employed on a subset...
Neuromuscular Fatigue During 200 M Breaststroke
Directory of Open Access Journals (Sweden)
Ana Conceição
2014-03-01
Full Text Available The aims of this study were: i to analyze activation patterns of four upper limb muscles (duration of the active and non-active phase in each lap of 200m breaststroke, ii quantify neuromuscular fatigue, with kinematics and physiologic assessment. Surface electromyogram was collected for the biceps brachii, deltoid anterior, pectoralis major and triceps brachii of nine male swimmers performing a maximal 200m breaststroke trial. Swimming speed, SL, SR, SI decreased from the 1st to the 3rd lap. SR increased on the 4th lap (35.91 ± 2.99 stroke·min-1. Peak blood lactate was 13.02 ± 1.72 mmol·l-1 three minutes after the maximal trial. The EMG average rectified value (ARV increased at the end of the race for all selected muscles, but the deltoid anterior and pectoralis major in the 1st lap and for biceps brachii, deltoid anterior and triceps brachii in the 4th lap. The mean frequency of the power spectral density (MNF decreased at the 4th lap for all muscles. These findings suggest the occurrence of fatigue at the beginning of the 2nd lap in the 200m breaststroke trial, characterized by changes in kinematic parameters and selective changes in upper limb muscle action. There was a trend towards a non-linear fatigue state.
2010-10-01
... MISCELLANEOUS SYSTEMS AND EQUIPMENT Cooking and Heating § 184.200 General. Cooking and heating equipment must be suitable for marine use. Equipment designed and installed in accordance with American Boat and Yacht Council (ABYC) A-3, “Galley Stoves,” and A-7, “Boat Heating Systems,” or with National Fire Protection...
2010-04-01
... honey wine. Spirits may not be used in the production of the wine and a wine made from one agricultural... TREASURY LIQUORS WINE Production of Agricultural Wine § 24.200 General. Agricultural wine may be produced on bonded wine premises from suitable agricultural products other than the juice of fruit. Water or...
21 CFR 584.200 - Ethyl alcohol containing ethyl acetate.
2010-04-01
... 21 Food and Drugs 6 2010-04-01 2010-04-01 false Ethyl alcohol containing ethyl acetate. 584.200 Section 584.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT OF HEALTH AND HUMAN SERVICES (CONTINUED) ANIMAL DRUGS, FEEDS, AND RELATED PRODUCTS FOOD SUBSTANCES AFFIRMED AS GENERALLY RECOGNIZED AS...
200 North Aggregate Area source AAMS report
International Nuclear Information System (INIS)
1993-06-01
This report presents the results of an aggregate area management study (AAMS) for the 200 North Aggregate Area in the 200 Areas of the US Department of Energy (DOE) Hanford Site in Washington State. This scoping level study provides the basis for initiating Remedial Investigation/Feasibility Study (RI/FS) activities under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) or Resource Conservation and Recovery Act (RCRA) Facility Investigations (RFI) and Corrective Measures Studies (CMS) under RCRA. This report also integrates select RCRA treatment, storage, or disposal (TSD) closure activities with CERCLA and RCRA past practice investigations
200 North Aggregate Area source AAMS report
Energy Technology Data Exchange (ETDEWEB)
1993-06-01
This report presents the results of an aggregate area management study (AAMS) for the 200 North Aggregate Area in the 200 Areas of the US Department of Energy (DOE) Hanford Site in Washington State. This scoping level study provides the basis for initiating Remedial Investigation/Feasibility Study (RI/FS) activities under the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA) or Resource Conservation and Recovery Act (RCRA) Facility Investigations (RFI) and Corrective Measures Studies (CMS) under RCRA. This report also integrates select RCRA treatment, storage, or disposal (TSD) closure activities with CERCLA and RCRA past practice investigations.
Triggering at ISABELLE: the first 200 nanoseconds
International Nuclear Information System (INIS)
Abshire, G.; Kondo, K.; Sculli, J.; Johnson, R.A.; Morris, G.R.
1979-01-01
In a typical experiment, a certain small number of signals will come into an electronics trailer on cables that are as short as possible and have propagation velocities as high as possible. With these signals a fast decision will be made as to whether the rest of the information coming in on the slower, longer cables should be further processed or not. The typical length of time for this decision is 200 ns. In this paper, some of the problems arising during that first 200 ns are confronted, and some examples of attempts to solve those problems are given
OGJ200 scores solid financial, operating gains
International Nuclear Information System (INIS)
Beck, R.J.; Bell, L.
1997-01-01
For companies on the OGJ200 list of publicly traded oil and gas producing companies in the US, 1996 was a banner year. Almost all indicators of financial and operating performance increased from comparable measures of 1995. The paper discusses the industry, group operations, group changes, the top 20 companies, OGJ200 shares, and fast-growing companies. The paper tabulates total assets, total revenues, net income, stockholders' equity, capital and exploratory spending, worldwide liquid production, worldwide natural gas production, worldwide liquids and natural gas reserves, US liquids production and reserves, US natural gas production and reserves, and US natural gas wells drilled
19 CFR 200.735-110 - Indebtedness.
2010-04-01
... Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-110 Indebtedness..., reflect adversely on the Government as his employer. In the event of a dispute between an employee and an...
200 West Ash Pit Demolition Site closure plan
International Nuclear Information System (INIS)
1992-11-01
The Hanford Facility is owned by the US Government and operated by the US Department of Energy, Richland Field Office. Dangerous waste and mixed waste (containing both radioactive and dangerous components) are managed and produced on the Hanford Facility. Westinghouse Hanford Company is a major contractor to the US Department of Energy, Richland Field Office and serves as cooperator of the 200 West Ash Pit Demolition Site, the unit addressed in this closure plan. The 200 West Ash Pit Demolition Site Closure Plan consists of a Part A Permit Application (Revision 3) and a closure plan. An explanation of the Part A Permit Application revision is provided at the beginning of the Part A section. The closure plan consists of nine chapters and three appendices. This 200 West Ash Pit Demolition Site Closure Plan submittal contains information current as of October 15, 1992
29 CFR 1926.200 - Accident prevention signs and tags.
2010-07-01
... 29 Labor 8 2010-07-01 2010-07-01 false Accident prevention signs and tags. 1926.200 Section 1926..., DEPARTMENT OF LABOR (CONTINUED) SAFETY AND HEALTH REGULATIONS FOR CONSTRUCTION Signs, Signals, and Barricades § 1926.200 Accident prevention signs and tags. (a) General. Signs and symbols required by this subpart...
200 Irish students at CERN - virtually!
2003-01-01
On 6 October, 200 physics students from schools around Ireland paid a virtual visit to CERN and met several CERN scientists, with the help of the latest video conferencing technology using high-speed internet lines.
Gogol 200 : teatraliseeritud kirjandustund / Reet Kudu
Kudu, Reet, 1949-
2009-01-01
4. aprillil Tallinnas Vene Kultuurikeskuses toimunud teatriõhtust "200 aastat koos Nikolai Gogoliga", mille stsenarist on Lidia Golovataja ja režissöör Jevgeni Gaitšuk. Loe ka: Kes on geeniuse sõbrad?
A P + DEUTERON PROTON POLARIMETER AT 200 MEV.
Energy Technology Data Exchange (ETDEWEB)
HUANG,H.; ROSER,T.; ZELENSKI,A.; KURITA,K.; STEPHENSON,E.; TOOLE,R.
2002-06-02
There has been concern about the analyzing power of the p-Carbon polarimeter at the end of 200 MeV LINAC of BNL. A new polarimeter based on proton-deuteron scattering was installed and we have repeated the calibration of proton-Carbon scattering at 12 degrees and 200 MeV against proton-deuteron scattering. The result is consistent with the value of A=0.62 now used to measure the beam polarization at the end of the LINAC.
17 CFR 200.80b - Appendix B-SEC releases.
2010-04-01
...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Information and Requests § 200.80b Appendix B—SEC... purchased through the Superintendent of Documents as described in § 200.80c of this part. The Statistical... purchase through the Superintendent of Documents. [40 FR 1009, Jan. 6, 1975, as amended at 49 FR 12686, Mar...
13 CFR 108.200 - Adequate capital for NMVC Companies.
2010-01-01
... VENTURE CAPITAL (âNMVCâ) PROGRAM Qualifications for the NMVC Program Capitalizing A Nmvc Company § 108.200 Adequate capital for NMVC Companies. You must meet the requirements of §§ 108.200-108.230 in order to... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Adequate capital for NMVC...
FEASIBILITY STUDY REPORT FOR THE 200-ZP-1 GROUNDWATER OPERABLE UNIT
Energy Technology Data Exchange (ETDEWEB)
BYRNES ME
2008-07-18
The Hanford Site, managed by the U.S. Department of Energy (DOE), encompasses approximately 1,517 km{sup 2} (586 mi{sup 2}) in the Columbia Basin of south-central Washington State. In 1989, the U.S. Environmental Protection Agency (EPA) placed the 100, 200, 300, and 1100 Areas of the Hanford Site on the 40 Code of Federal Regulations (CFR) 300, 'National Oil and Hazardous Substances Pollution Contingency Plan' National Contingency Plan [NCPD], Appendix B, 'National Priorities List' (NPL), pursuant to the Comprehensive Environmental Response, Compensation, and Liability Act of 1980 (CERCLA). The 200 Areas NPL sites consist of the 200 West and 200 East Areas (Figure 1-1). The 200 Areas contain waste management facilities, inactive irradiated fuel reprocessing facilities, and the 200 North Area (formerly used for interim storage and staging of irradiated fuel). Several waste sites in the 600 Area, located near the 200 Areas, also are included in the 200 Areas NPL site. The 200 Areas NPL site is in a region referred to as the 'Central Plateau' and consists of approximately 700 waste sites, excluding sites assigned to the tank farm waste management areas (WMAs). The 200-ZP-1 Groundwater Operable Unit (OU) consists of the groundwater located under the northern portion of the 200 West Area. Waste sources that contributed to the 200-ZP-1 OU included cribs and trenches that received liquid and/or solid waste in the past from the Z Plant and T Plant aggregate areas, WMA-T, WMA-TX/TY, and the State-Approved Land Disposal Site (SALDS). This feasibility study (FS) for the 200-ZP-1 Groundwater OU was prepared in accordance with the requirements of CERCLA decision documents. These decision documents are part of the Administrative Record for the selection of remedial actions for each waste site and present the selected remedial actions that are chosen in accordance with CERCLA, as amended by the Superfund Amendments and Reauthorization Act of 1986
Oblate shapes of 200,202,204Hg
International Nuclear Information System (INIS)
Bockisch, A.; Bharuth-Ram, K.; Kleinfeld, A.M.; Lieb, K.P.
1979-01-01
Measurements of the reorientation effect for the first excited 2 + states in 200 , 202 , 204 Hg were performed by exploiting the dependence of the γ-ray yield on Q 2 + for different projectiles. For 200 Hg, a positive quadrupole moment of Q 2 = 0.96 +- 0.11 eb (for negative interference) or Q 2 = 1.11 +- 0.11 eb (for positive interference) was determined indicating an oblate shape. Small positive Q 2 values were also found for 202 Hg and 204 Hg. Nine B(E2) values for excitation of the 2 + , 2 + ' and 4 + states in 196-204 Hg were measured. (orig.) [de
Biologic agents in rheumatology: unmet issues after 200 trials and $200 billion sales.
Ioannidis, John P A; Karassa, Fotini B; Druyts, Eric; Thorlund, Kristian; Mills, Edward J
2013-11-01
Anti-TNF agents and other biologic therapies are widely prescribed for a variety of indications, with total sales that exceed $200 billion to date. In rheumatic diseases, biologic agents have now been studied in more than 200 randomized clinical trials and over 100 subsequent meta-analyses; however, the information obtained does not always meet the needs of patients and clinicians. In this Review, we discuss the current issues concerning the evidence derived from such studies: potential biases favouring positive results; a paucity of head-to-head comparisons between biologically active agents; overwhelming involvement of manufacturer sponsors in trials and in the synthesis of the evidence; the preference for trials with limited follow-up; and the potential for spurious findings on adverse events, leading to endless debates about malignancy risk. We debate the responsibilities of regulatory authorities, the pharmaceutical industry and academia in attempting to solve these shortcomings and challenges. We propose that improvements in the evidence regarding biologic treatments that are continually being added to the therapeutic armamentarium for rheumatic diseases might require revisiting the design and conduct of studies. For example, trials with long-term follow-up that are independent of the pharmaceutical industry, head-to-head comparisons of therapeutic agents and the use of rigorous clinical outcomes should be considered, and public availability of raw data endorsed.
miR-200–containing extracellular vesicles promote breast cancer cell metastasis
Le, Minh T.N.; Hamar, Peter; Guo, Changying; Basar, Emre; Perdigão-Henriques, Ricardo; Balaj, Leonora; Lieberman, Judy
2014-01-01
Metastasis is associated with poor prognosis in breast cancer patients. Not all cancer cells within a tumor are capable of metastasizing. The microRNA-200 (miR-200) family, which regulates the mesenchymal-to-epithelial transition, is enriched in the serum of patients with metastatic cancers. Ectopic expression of miR-200 can confer metastatic ability to poorly metastatic tumor cells in some settings. Here, we investigated whether metastatic capability could be transferred between metastatic and nonmetastatic cancer cells via extracellular vesicles. miR-200 was secreted in extracellular vesicles from metastatic murine and human breast cancer cell lines, and miR-200 levels were increased in sera of mice bearing metastatic tumors. In culture, murine and human metastatic breast cancer cell extracellular vesicles transferred miR-200 microRNAs to nonmetastatic cells, altering gene expression and promoting mesenchymal-to-epithelial transition. In murine cancer and human xenograft models, miR-200–expressing tumors and extracellular vesicles from these tumors promoted metastasis of otherwise weakly metastatic cells either nearby or at distant sites and conferred to these cells the ability to colonize distant tissues in a miR-200–dependent manner. Together, our results demonstrate that metastatic capability can be transferred by the uptake of extracellular vesicles. PMID:25401471
Preliminary Core Design Analysis of a 200MWth Pebble Bed-type VHTR
International Nuclear Information System (INIS)
Jo, Chang Keun; Noh, Jae Man
2007-01-01
This paper intends to suggest the preliminary core design analysis of a VHTR for a hydrogen production. The nuclear hydrogen system that utilizes the high temperature heat generated from the VHTR is a promising candidate for a cost effective, safe and clean supply of hydrogen in the age of hydrogen economy. Among two candidate VHTR cores, that is, a prismatic modular reactor (PMR) and a pebble bed-type reactor (PBR), we focus on the design of a 200MWth PBR (hereinafter PBR200) in this paper. Here, the 200MWth power is selected for a demonstration plant. The core configuration of the PBR200 is similar to the PBMR (Pebble Bed Modular Reactor, 400MWth) of South Africa, but the overall dimension of the reactor system is scaled-down. This paper is to suggest two candidate PBR200 cores. One is an annular core with an inner reflector (PBR200-CD1) which was presented at IWRES07, and the other is a cylindrical core without an inner reflector (PBR200-CD2)
2010-07-01
... FEDERAL PROPERTY MANAGEMENT REGULATIONS AVIATION, TRANSPORTATION, AND MOTOR VEHICLES 39-INTERAGENCY FLEET MANAGEMENT SYSTEMS 39.2-GSA Interagency Fleet Management System Services § 101-39.200 Scope. This subpart... Administration (GSA) Interagency Fleet Management System (IFMS). Local transportation services for Government...
Fluid limits for Bandwidth-Sharing Networks with Impatience.
Remerova, M.; Reed, J.; Zwart, A.P.
2014-01-01
Bandwidth-sharing networks as introduced by Roberts and Massoulié [Roberts JW, Massoulié L (1998) Bandwidth sharing and admission control for elastic traffic. Proc. ITC Specialist Seminar, Yokohama, Japan], Massoulié and Roberts [Massoulié L, Roberts JW (1999) Bandwidth sharing: Objectives and
76 FR 9349 - Jim Woodruff Project
2011-02-17
... DEPARTMENT OF ENERGY Southeastern Power Administration Jim Woodruff Project AGENCY: Southeastern Power Administration, DOE. ACTION: Notice of Proposed Rate Adjustment. SUMMARY: Southeastern proposes a new rate schedule JW-1-J to replace Wholesale Power Rate Schedules JW-1-I for a five-year period from...
200-UP-1 groundwater remedial design/remedial action work plan. Revision 1
International Nuclear Information System (INIS)
1997-07-01
This 200-UP-1 remedial design report presents the objective and rationale developed for the design and implementation of the selected interim remedial measure for the 200-UP-1 Operable Unit, located in the 200 West Area of the Hanford Site
200 Area Treated Effluent Disposal Facility operational test specification. Revision 2
International Nuclear Information System (INIS)
Crane, A.F.
1995-01-01
This document identifies the test specification and test requirements for the 200 Area Treated Effluent Disposal Facility (200 Area TEDF) operational testing activities. These operational testing activities, when completed, demonstrate the functional, operational and design requirements of the 200 Area TEDF have been met. The technical requirements for operational testing of the 200 Area TEDF are defined by the test requirements presented in Appendix A. These test requirements demonstrate the following: pump station No.1 and associated support equipment operate both automatically and manually; pump station No. 2 and associated support equipment operate both automatically and manually; water is transported through the collection and transfer lines to the disposal ponds with no detectable leakage; the disposal ponds accept flow from the transfer lines with all support equipment operating as designed; and the control systems operate and status the 200 Area TEDF including monitoring of appropriate generator discharge parameters
34 CFR 200.8 - Assessment reports.
2010-07-01
... assessments under § 200.2 measured against the State's student academic achievement standards; and (ii) Help parents, teachers, and principals to understand and address the specific academic needs of students; and...) Student reports. A State's academic assessment system must produce individual student interpretive...
41 CFR 301-71.200 - Who must review and sign travel claims?
2010-07-01
... travel claims? 301-71.200 Section 301-71.200 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 71-AGENCY TRAVEL ACCOUNTABILITY REQUIREMENTS Travel Claims for Reimbursement § 301-71.200 Who must review and sign travel claims...
Lifescience Database Archive (English)
Full Text Available 合データベースセンター) Photo: Takeru Nakazato (Database Center for Life Science) nakazato 2009/11/04 17:26:47 2010/01/14 20:11:35 ... ...Japanese tree frog Hyla japonica Hyla_japonica_L.png 200.png Takeru Nakazato (Database Center for Life Scien...ce) licensed under CC Attribution2.1 Japan ニホンアマガエル Hyla japonica 撮影:仲里猛留(ライフサイエンス統
Internal waves over the shelf in the western Bay of Bengal: A case study
Digital Repository Service at National Institute of Oceanography (India)
Joshi, M.; Rao, A.D.; Mohanty, S.; Pradhan, H.K.; Murty, V.S.N.; RamPrasad, K.V.S.
.csr.2005.04.011 Cooley JW, Tukey JW (1965) An algorithm for the machine calculation of complex fourier series. Math Comput 19:297–301 D’Asaro EA, Lien R-C, Henyey F (2007) High-frequency internal waves on the oregon continental shelf. J Phys Oceanogr 37...
24 CFR 200.1101 - Cross-reference.
2010-04-01
... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Social Security Numbers and Employer Identification Numbers; Applicants in Unassisted Programs § 200.1101 Cross-reference. The provisions in subpart B of part 5 of this title apply to Social Security Numbers and Employer Identification Numbers for...
24 CFR 200.1001 - Cross-reference.
2010-04-01
... URBAN DEVELOPMENT GENERAL INTRODUCTION TO FHA PROGRAMS Social Security Numbers and Employer Identification Numbers; Assistance Applicants and Participants § 200.1001 Cross-reference. The provisions in subpart B of part 5 of this title apply to Social Security Numbers and Employer Identification Numbers for...
24 CFR 200.100 - Insurance endorsement.
2010-04-01
... a commitment for insured advances, initial endorsement of the credit instrument shall occur before... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Insurance endorsement. 200.100... Endorsement Generally Applicable to Multifamily and Health Care Facility Mortgage Insurance Programs; and...
6 CFR 27.200 - Information regarding security risk for a chemical facility.
2010-01-01
... chemical facility. 27.200 Section 27.200 Domestic Security DEPARTMENT OF HOMELAND SECURITY, OFFICE OF THE SECRETARY CHEMICAL FACILITY ANTI-TERRORISM STANDARDS Chemical Facility Security Program § 27.200 Information regarding security risk for a chemical facility. (a) Information to determine security risk. In order to...
200-BP-5 operable unit Technical Baseline report
International Nuclear Information System (INIS)
Jacques, I.D.; Kent, S.K.
1991-10-01
This report supports development of a remedial investigation/feasibility study work plan for the 200-BP-5 operable unit. The report summarizes baseline information for waste sites and unplanned release sites located in the 200-BP-5 operable unit. The sites were investigated by the Technical Baseline Section of the Environmental Engineering Group, Westinghouse Hanford Company (Westinghouse Hanford). The investigation consisted of review and evaluation of current and historical Hanford Site reports, drawings, and photographs, and was supplemented with recent inspections of the Hanford Site and employee interviews. No field investigations or sampling were conducted
Super high precision 200 ppi liquid crystal display series; Chokoseido 200 ppi ekisho display series
Energy Technology Data Exchange (ETDEWEB)
NONE
2000-03-01
In mobile equipment, in demand is a high precision liquid crystal display (LCD) having the power of expression equivalent to printed materials like magazines because of the necessity of displaying a large amount of information on a easily potable small screen. In addition, with the spread and high-quality image of digital still cameras, it is strongly desired to display photographed digital image data in high quality. Toshiba Corp., by low temperature polysilicone (p-Si) technology, commercialized the liquid crystal display series of 200 ppi (pixels per inch) precision dealing with the rise of the high-precision high-image quality LCD market. The super high precision of 200 ppi enables the display of smooth beautiful animation comparable to printed sheets of magazines and photographs. The display series are suitable for the display of various information services such as electronic books and electronic photo-viewers including internet. The screen sizes lined up are No. 4 type VGA (640x480 pixels) of a small pocket notebook size and No. 6.3 type XGA (1,024x768 pixels) of a paperback size, with a larger screen to be furthered. (translated by NEDO)
38 CFR Appendix C to Part 200 - Actions Requiring Environmental Impact Statement
2010-07-01
... Environmental Impact Statement C Appendix C to Part 200 Pensions, Bonuses, and Veterans' Relief ARMED FORCES RETIREMENT HOME COMPLIANCE WITH THE NATIONAL ENVIRONMENTAL POLICY ACT Pt. 200, App. C Appendix C to Part 200—Actions Requiring Environmental Impact Statement The following actions are considered to be major Federal...
24 CFR 200.6 - Employer identification and social security numbers.
2010-04-01
... identification and social security numbers. The requirements set forth in 24 CFR part 5, regarding the disclosure and verification of social security numbers and employer identification numbers by applicants and... security numbers. 200.6 Section 200.6 Housing and Urban Development Regulations Relating to Housing and...
10 CFR 600.200 - Purpose and scope of this subpart.
2010-01-01
... 10 Energy 4 2010-01-01 2010-01-01 false Purpose and scope of this subpart. 600.200 Section 600.200 Energy DEPARTMENT OF ENERGY (CONTINUED) ASSISTANCE REGULATIONS FINANCIAL ASSISTANCE RULES Uniform Administrative Requirements for Grants and Cooperative Agreements to State and Local Governments General § 600...
17 CFR 200.610 - Self-evaluation.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Self-evaluation. 200.610...-evaluation. (a) The agency shall, by September 6, 1989, evaluate its current policies and practices, and the... handicaps or organizations representing individuals with handicaps, to participate in the self-evaluation...
Reinforcing Success: America’s Assistance to Indonesia Since 9/11
2011-05-24
2009, simultaneous bombings at the Jakarta‘s Ritz Carlton and JW Marriot hotels killed eight and wounded 50 others. The Government of Indonesia...response to the JW Marriot and Ritz - Carlton attacks. Under ATA, the U.S. also provided cyber training to Indonesian officials and their counterparts from
Safety objectives and design criteria for the NHR-200
International Nuclear Information System (INIS)
Xue Dazhi; Zheng Wenxiang
1997-01-01
The construction of a nuclear district heating reactor (NHR) demonstration plant with a thermal power of 200 MW has been decided for the northeast of China. To facilitate the design and licensability a set of design criteria were developed for the NHR, based on existing general criteria for NPP but amended with regard to the unique features of NHR-200. Some key points are discussed in this paper. (author). 7 refs
Safety objectives and design criteria for the NHR-200
Energy Technology Data Exchange (ETDEWEB)
Dazhi, Xue; Wenxiang, Zheng [Institute of Nuclear Energy and Technology, Tsingua Univ., Beijing (China)
1997-09-01
The construction of a nuclear district heating reactor (NHR) demonstration plant with a thermal power of 200 MW has been decided for the northeast of China. To facilitate the design and licensability a set of design criteria were developed for the NHR, based on existing general criteria for NPP but amended with regard to the unique features of NHR-200. Some key points are discussed in this paper. (author). 7 refs.
24 CFR 200.63 - Required deposits and letters of credit.
2010-04-01
... Commissioner for collection under the letter of credit. In the event a demand for payment thereunder is not... credit. 200.63 Section 200.63 Housing and Urban Development Regulations Relating to Housing and Urban... Required deposits and letters of credit. (a) Deposits. Where the Commissioner requires the mortgagor to...
34 CFR 200.80 - Migrant Education Even Start Program definition.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Migrant Education Even Start Program definition. 200.80... DISADVANTAGED Even Start Family Literacy Program § 200.80 Migrant Education Even Start Program definition. Eligible participants under the Migrant Education Even Start Program (MEES) must meet the definitions of a...
Energy Technology Data Exchange (ETDEWEB)
White, J.; Gilbert, J. A.; Hill, G.; Hill, E.; Huse, S. M.; Weightman, A. J.; Mahenthiralingam, E. (CLS-CI); (Organisms and Environment Division, Cardiff School of Biosciences, Cardiff University); (ECHA Microbiology Ltd.); (Josephine Bay Paul Centre for Comparative Molecular Biology and Evolution)
2011-07-01
Bacterial diversity in contaminated fuels has not been systematically investigated using cultivation-independent methods. The fuel industry relies on phenotypic cultivation-based contaminant identification, which may lack accuracy and neglect difficult-to-culture taxa. By the use of industry practice aerobic cultivation, 16S rRNA gene sequencing, and strain genotyping, a collection of 152 unique contaminant isolates from 54 fuel samples was assembled, and a dominance of Pseudomonas (21%), Burkholderia (7%), and Bacillus (7%) was demonstrated. Denaturing gradient gel electrophoresis (DGGE) of 15 samples revealed Proteobacteria and Firmicutes to be the most abundant phyla. When 16S rRNA V6 gene pyrosequencing of four selected fuel samples (indicated by 'JW') was performed, Betaproteobacteria (42.8%) and Gammaproteobacteria (30.6%) formed the largest proportion of reads; the most abundant genera were Marinobacter (15.4%; JW57), Achromobacter (41.6%; JW63), Burkholderia (80.7%; JW76), and Halomonas (66.2%; JW78), all of which were also observed by DGGE. However, the Clostridia (38.5%) and Deltaproteobacteria (11.1%) identified by pyrosequencing in sample JW57 were not observed by DGGE or aerobic culture. Genotyping revealed three instances where identical strains were found: (i) a Pseudomonas sp. strain recovered from 2 different diesel fuel tanks at a single industrial site; (ii) a Mangroveibacter sp. strain isolated from 3 biodiesel tanks at a single refinery site; and (iii) a Burkholderia vietnamiensis strain present in two unrelated automotive diesel samples. Overall, aerobic cultivation of fuel contaminants recovered isolates broadly representative of the phyla and classes present but lacked accuracy by overrepresenting members of certain groups such as Pseudomonas.
17 CFR 200.2 - Statutory functions.
2010-04-01
... AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management § 200.2 Statutory... imply approval of the issue by the Commission or insure investors against loss in their purchase, but... institute a court action to enjoin acts or practices of management involving, among other things, a breach...
38 CFR 52.200 - Physical environment.
2010-07-01
... 38 Pensions, Bonuses, and Veterans' Relief 2 2010-07-01 2010-07-01 false Physical environment. 52...) PER DIEM FOR ADULT DAY HEALTH CARE OF VETERANS IN STATE HOMES Standards § 52.200 Physical environment. The physical environment must be designed, constructed, equipped, and maintained to protect the health...
In-beam spectroscopy of 198Po and 200Po nuclei
International Nuclear Information System (INIS)
Maj, A.
1988-01-01
The main purpose of this thesis is to answer the question whether any signs of collectivity or deformation are evident in 198 Po and 200 Po nuclei, situated on the border of the predicted new region of oblate deformation. Bearing this in mind spectroscopic investigations were performed. The level schemes of 198 Po and 200 Po were established, transition rates were determined and g-factors of isomeric states and, for 200 Po, the quadrupole moment of the 8 + - state were measured. The experimental techniques are described and the methods of evaluating the obtained data are presented. 74 refs., 7 figs., 9 tabs. (M.F.W.)
19 CFR 200.735-104 - Disciplinary and other remedial action.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Disciplinary and other remedial action. 200.735... RESPONSIBILITIES AND CONDUCT General Provisions § 200.735-104 Disciplinary and other remedial action. (a) An employee who violates any of the regulations in this part may be disciplined. The disciplinary action may...
200 Area plateau inactive miscellaneous underground storage tanks locations
International Nuclear Information System (INIS)
Brevick, C.H.
1997-01-01
Fluor Daniel Northwest (FDNW) has been tasked by Lockheed Martin Hanford Corporation (LMHC) to incorporate current location data for 64 of the 200-Area plateau inactive miscellaneous underground storage tanks (IMUST) into the centralized mapping computer database for the Hanford facilities. The IMUST coordinate locations and tank names for the tanks currently assigned to the Hanford Site contractors are listed in Appendix A. The IMUST are inactive tanks installed in underground vaults or buried directly in the ground within the 200-East and 200-West Areas of the Hanford Site. The tanks are categorized as tanks with a capacity of less than 190,000 liters (50,000 gal). Some of the IMUST have been stabilized, pumped dry, filled with grout, or may contain an inventory or radioactive and/or hazardous materials. The IMUST have been out of service for at least 12 years
Design and initial characterization of the SC-200 proteomics standard mixture.
Bauman, Andrew; Higdon, Roger; Rapson, Sean; Loiue, Brenton; Hogan, Jason; Stacy, Robin; Napuli, Alberto; Guo, Wenjin; van Voorhis, Wesley; Roach, Jared; Lu, Vincent; Landorf, Elizabeth; Stewart, Elizabeth; Kolker, Natali; Collart, Frank; Myler, Peter; van Belle, Gerald; Kolker, Eugene
2011-01-01
High-throughput (HTP) proteomics studies generate large amounts of data. Interpretation of these data requires effective approaches to distinguish noise from biological signal, particularly as instrument and computational capacity increase and studies become more complex. Resolving this issue requires validated and reproducible methods and models, which in turn requires complex experimental and computational standards. The absence of appropriate standards and data sets for validating experimental and computational workflows hinders the development of HTP proteomics methods. Most protein standards are simple mixtures of proteins or peptides, or undercharacterized reference standards in which the identity and concentration of the constituent proteins is unknown. The Seattle Children's 200 (SC-200) proposed proteomics standard mixture is the next step toward developing realistic, fully characterized HTP proteomics standards. The SC-200 exhibits a unique modular design to extend its functionality, and consists of 200 proteins of known identities and molar concentrations from 6 microbial genomes, distributed into 10 molar concentration tiers spanning a 1,000-fold range. We describe the SC-200's design, potential uses, and initial characterization. We identified 84% of SC-200 proteins with an LTQ-Orbitrap and 65% with an LTQ-Velos (false discovery rate = 1% for both). There were obvious trends in success rate, sequence coverage, and spectral counts with protein concentration; however, protein identification, sequence coverage, and spectral counts vary greatly within concentration levels.
Phase 1 remedial investigation report for 200-BP-1 operable unit
International Nuclear Information System (INIS)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit
Circulating microRNA-200 Family as Diagnostic Marker in Hepatocellular Carcinoma.
Directory of Open Access Journals (Sweden)
Sameer A Dhayat
Full Text Available In this clinical study, we aimed to evaluate the role of circulating microRNA-200 family as a non-invasive tool to identify patients with cirrhosis-associated hepatocellular carcinoma (HCC.Prognosis of HCC remains poor with increasing incidence worldwide, mainly related to liver cirrhosis. So far, no reliable molecular targets exist for early detection of HCC at surgically manageable stages. Recently, we identified members of the microRNA-200 family as potential diagnostic markers of cirrhosis-associated HCC in patient tissue samples. Their value as circulating biomarkers for HCC remained undefined.Blood samples and clinicopathological data of consecutive patients with liver diseases were collected prospectively. Expression of the microRNA-200 family was investigated by qRT-PCR in blood serum samples of 22 HCC patients with and without cirrhosis. Serum samples of patients with non-cancerous chronic liver cirrhosis (n = 22 and of healthy volunteers (n = 15 served as controls.MicroRNA-141 and microRNA-200a were significantly downregulated in blood serum of patients with HCC compared to liver cirrhosis (p<0.007 and healthy controls (p<0.002. MicroRNA-141 and microRNA-200a could well discriminate patients with cirrhosis-associated HCC from healthy volunteers with area under the receiver-operating characteristic curve (AUC values of 0.85 and 0.82, respectively. Additionally, both microRNAs could differentiate between HCC and non-cancerous liver cirrhosis with a fair accuracy.Circulating microRNA-200 family members are significantly deregulated in patients with HCC and liver cirrhosis. Further studies are necessary to confirm the diagnostic value of the microRNA-200 family as accurate serum marker for cirrhosis-associated HCC.
200 Area Effluent Treatment Facility: Delisting petition
International Nuclear Information System (INIS)
1993-08-01
Waste water has been generated for over 40 years as a result of operations conducted on the Hanford Site. This waste water previously was discharged to cribs, ponds, or ditches. An example of such waste water includes process condensate that might have been in contact with dangerous waste or mixed waste (containing both radioactive and dangerous components). This petition presents the treatment technologies that are designed into the 200 Area Effluent Treatment Facility to eliminate the dangerous characteristics of the waste and to delist the effluent in accordance with the requirements found in 40 Code of Federal Regulations 260.20 and 260.22. The purpose of this petition is to demonstrate that the 242-A Evaporator process condensate will be treated adequately so that the effluent from the 200 Area Effluent Treatment Facility will no longer require management as a regulated dangerous waste. This demonstration was performed by use of a surrogate (synthetic) waste, designed by the US Department of Energy, Richland Operations Office to include species that represent all organic and inorganic constituents (but not radionuclide species) expected to be found on the Hanford Site. Thus, the surrogate will encompass not only the expected 242-A Evaporator process condensate characteristics, but those of other potential 200 Area Effluent Treatment Facility waste streams and additional 40 CFR Appendix VIII constituents
200 West Groundwater Aggregate Area management study report
International Nuclear Information System (INIS)
1993-01-01
This report presents the results of an aggregate area management study (AAMS) for the 200 West Groundwater Aggregate Area in the 200 Areas of the US Department of Energy (DOE) Hanford Site in Washington State. This scoping level study provides the basis for initiating Remedial Investigation/Feasibility Study (RI/FS) activities under the Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) or Resource Conservation and Recovery Act (RCRA), Facility Investigations (Rlq) and Corrective Measures Studies (CMS) under RCRA. This report also integrates select RCRA treatment, storage or disposal (TSD) closure activities with CERCLA and RCRA past practice investigations
200 Areas soil remediation strategy -- Environmental Restoration Program
International Nuclear Information System (INIS)
1996-09-01
The remediation and waste management activities in the 200 Areas of the Hanford Site (located in Richland, Washington) currently range from remediating groundwater, remediating source units (contaminated soils), decontaminating and decommissioning of buildings and structures, maintaining facilities, managing transuranic, low-level and mixed waste, and operating tank farms that store high-level waste. This strategy focuses on the assessment and remediation of soil that resulted from the discharge of liquids and solids from processing facilities to the ground (e.g., ponds, ditches, cribs, burial grounds) in the 200 Areas and addresses only those waste sites assigned to the Environmental Restoration Program
miR-200b mediates post-transcriptional repression of ZFHX1B
DEFF Research Database (Denmark)
Christoffersen, Nanna Rønbjerg; Silahtaroglu, Asli; Ørom, Ulf Lupo Andersson
2007-01-01
of E-cadherin. We show that Zfhx1b and miR-200b are regionally coexpressed in the adult mouse brain and that miR-200b represses the expression of Zfhx1b via multiple sequence elements present in the 3'-untranslated region. Overexpression of miR-200b leads to repression of endogenous ZFHX1B...
34 CFR 200.42 - Corrective action.
2010-07-01
... action; and (ii) Any underlying staffing, curriculum, or other problems in the school; (2) Is designed to... provide all students enrolled in the school with the option to transfer to another public school in... Programs Operated by Local Educational Agencies Lea and School Improvement § 200.42 Corrective action. (a...
2009-10-16
simultaneous July 17, 2009 bombings of the J.W. Marriot and Ritz - Carlton hotels in Jakarta. The bombings were the first successful anti-Western terrorist attack...simultaneous bombings of the J.W. Marriot and Ritz - Carlton hotels in Jakarta killed nine and injured more than 50, including 6 Americans. The bombings
17 CFR 200.62 - Ex parte communications.
2010-04-01
...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200.62 Ex parte communications. All... course of such proceeding. A member shall at all times comply with the Commission's Code of Behavior...
17 CFR 200.27 - The Regional Directors.
2010-04-01
... programs within his or her geographic region as set forth in § 200.11(b), subject to review, on enforcement... Carolina, Puerto Rico, South Carolina, Tennessee, Virgin Islands, Virginia, and West Virginia; the Regional...
Economic Analyses and Potential Market of the 200MW Nuclear Heating Reactor
International Nuclear Information System (INIS)
Wang, Yongqing; Wang, Guiying
1992-01-01
Based on the 5MW experimental nuclear heating reactor, Intent has developed a 200MW demonstration nuclear heating reactor. Owing to its simplified systems and low operating parameters, the NCR-200 has preferable investment in comparison with that of a nuclear power plant. The pre-feasibility studies for several cities in Northern China have shown that the heat cost of a NCR-200 can be competitive with a coal fired heating plant. As a safe, clean and economic heat source, the NCR could pose a large market in replacement of coal for heating. The R and D work performed up to now has demonstrated that the NCR-200 operating under the present parameters can supply low pressure steam for industrial process and co-generation to enhance it economic benefit. The NCR-200 could also serve a heat source for air condition by using Li Br refrigerator, this application is very interesting to some cities in Central and Southern China. The applications of the NCR in oil recovery by injecting hot water and transportation are very promising for some oil fields in North China. In addition, the study on sea water desalination using the NCR-200 is being carried out at present under international cooperation. All of these will expansion the possible application of the NCR. The paper presents the economic analysis and the potential market of the NCR-200
34 CFR 200.90 - Program definitions.
2010-07-01
... Intervention Programs for Children and Youth Who are Neglected, Delinquent, or At-Risk of Dropping Out § 200.90... average length of stay in the institution of at least 30 days. Institution for neglected children and...) in an institution or a community day program for neglected or delinquent children that consists of...
Contacting graphene in a 200 mm wafer silicon technology environment
Lisker, Marco; Lukosius, Mindaugas; Kitzmann, Julia; Fraschke, Mirko; Wolansky, Dirk; Schulze, Sebastian; Lupina, Grzegorz; Mai, Andreas
2018-06-01
Two different approaches for contacting graphene in a 200 mm wafer silicon technology environment were tested. The key is the opportunity to create a thin SiN passivation layer on top of the graphene protecting it from the damage by plasma processes. The first approach uses pure Ni contacts with a thickness of 200 nm. For the second attempt, Ni is used as the contact metal which substitutes the Ti compared to a standard contact hole filling process. Accordingly, the contact hole filling of this "stacked via" approach is Ni/TiN/W. We demonstrate that the second "stacked Via" is beneficial and shows contact resistances of a wafer scale process with values below 200 Ohm μm.
Site-specific waste management instruction - 200-ZP-1 pump-and-treat system
International Nuclear Information System (INIS)
Hopkins, G.G.
1997-01-01
This Site-Specific Waste Management Instruction (SSWMI) provides guidance for managing waste generated from operation of the 200-ZP-1 Pump-and-Treat (P and T) System, located just north of the Plutonium Finishing Plant in the 200 West Area. The construction and implementation of the 200-ZP-1 P and T System are an integral part of the 200-ZP-1 interim remedial measure activities. The goal of the interim remedial measure activities is to reduce further migration of carbon tetrachloride (CCl 4 ), chloroform, and trichloroethylene (TCE) in the groundwater of the 200 West Area. The P and T system is designed to initiate hydraulic containment of the contaminant mass in the high-concentration portion of the CCl 4 plume. The P and T contaminant removal mechanism consists of a combination of air stripping and vapor-phase granular activated carbon (GAC) adsorption technologies
34 CFR 200.52 - LEA improvement.
2010-07-01
....50(d), the LEA must develop or revise an LEA improvement plan. (2) The LEA must consult with parents... through 200.20; (v) Address— (A) The fundamental teaching and learning needs in the schools of the LEA... section 1120A of the ESEA; and (viii) Include strategies to promote effective parental involvement in the...
24 CFR 200.948 - Building product standards and certification program for carpet cushion.
2010-04-01
... Minimum Property Standards § 200.948 Building product standards and certification program for carpet... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Building product standards and certification program for carpet cushion. 200.948 Section 200.948 Housing and Urban Development Regulations...
Design features of Beijing Shijingshan 3 x 200 MW cogeneration plant
International Nuclear Information System (INIS)
Li, T.X.; Ou, Y.Z.
1991-01-01
This paper describes the design feature of Beijing Shijingshan 3 x 200 MW Cogeneration Plant. The design optimized the scheme and system of 200 MW units for heating. The cogeneration plant has achieved comprehensive economic benefit in energy saving and environmental pollution reduction
Directory of Open Access Journals (Sweden)
Ruth T. McVey
1965-10-01
Full Text Available - J.W. Schoorl, R.G. Crocombe, “Communal cash cropping among the Orokaiva”, New Guinea Research Bulletin Number 4. May 1964. Published by the New Guinea Research Unit, Australian National University, Canberra. 53 p. - J.W. Schoorl, R.C. White, “Social Accounts of the Monetary Sector of the Territory of Papua and New Guinea, 1956/1956 to 1960/1961”, New Guinea Research Bulletin, Number 3, Jan. 1964. Published by the New Guinea Research Unit, Australian National University, Canberra. 105 p. - J.W. Schoorl, R.G. Crocombe, “Land, Work and Productivity at Inonda”, New Guinea Research Bulletin Number 2. August 1963. Published by the New Guinea Research Unit, Australian National University, Canberra. 109 p., G.R. Hogbin (eds. - J.W. Schoorl, R.G. Crocombe, “The Erap Mechanical Farming Project”, New Guinea Research Unit Bulletins Number 1, April 1963. Published by the New Guinea Research Unit, Australian National University, Canberra., G.R. Hogbin (eds. - W.F. Wertheim, Ruth T. McVey, Indonesia. Human Relations Area Files, Inc. New Haven 1963. 600 pp.
14 CFR 221.200 - Content and explanation of abbreviations, reference marks and symbols.
2010-01-01
..., reference marks and symbols. 221.200 Section 221.200 Aeronautics and Space OFFICE OF THE SECRETARY... § 221.200 Content and explanation of abbreviations, reference marks and symbols. (a) Content. The format..., reference marks and symbols. Abbreviations, reference marks and symbols which are used in the tariff shall...
48 CFR 51.200 - Scope of subpart.
2010-10-01
... Section 51.200 Federal Acquisition Regulations System FEDERAL ACQUISITION REGULATION CONTRACT MANAGEMENT USE OF GOVERNMENT SOURCES BY CONTRACTORS Contractor Use of Interagency Fleet Management System (IFMS... of interagency fleet management system (IFMS) vehicles and related services. In this subpart, the...
EFFICACY OF IMIDACLOPRID (CONFIDOR 200 SL AGAINST APHIDS INFESTING WHEAT CROP
Directory of Open Access Journals (Sweden)
N Joshi
2010-02-01
Full Text Available Imidacloprid (Confidor 200 SL was evaluated either alone or with a fungicide (Tilt 0.01% against wheat aphids. There were seven different treatments, including an untreated control. All the treatments were replicated three times in a similar field environment. Population of wheat aphids was recorded on randomly selected five plants in each plot at different intervals, both before and after the spraying. Confidor 200 SL @ 400 ml/ha treatment was found most effective against wheat aphids. However, mixing of Confidor 200 SL @ 100 ml/ha with Tilt @ 0.01 %, was found significantly least effective for wheat aphids control.
SRP engineering and design history, Vol III, 200 F and H Areas
International Nuclear Information System (INIS)
Banick, C.J.
2000-01-01
This volume combines the record of events relating to the development of design for both the 200-F and H Areas. Chronologically, the definition of plant facilities was first established for the 200-F Area. The second area, 200-H, was projected initially to be a supplementary plutonium separations facility. This history explains the differences in character and capacity of the manufacturing facilities in both areas as production requirements and experience with separations processes advanced
SRP engineering and design history, Vol III, 200 F and H Areas
Energy Technology Data Exchange (ETDEWEB)
Banick, C.J.
2000-04-17
This volume combines the record of events relating to the development of design for both the 200-F and H Areas. Chronologically, the definition of plant facilities was first established for the 200-F Area. The second area, 200-H, was projected initially to be a supplementary plutonium separations facility. This history explains the differences in character and capacity of the manufacturing facilities in both areas as production requirements and experience with separations processes advanced.
Investigation of radioactivity-induced backgrounds in EXO-200
Energy Technology Data Exchange (ETDEWEB)
Albert, J. B.; Auty, D. J.; Barbeau, P. S.; Beck, D.; Belov, V.; Benitez-Medina, C.; Breidenbach, M.; Brunner, T.; Burenkov, A.; Cao, G. F.; Chambers, C.; Cleveland, B.; Coon, M.; Craycraft, A.; Daniels, T.; Danilov, M.; Daugherty, S. J.; Davis, C. G.; Davis, J.; Delaquis, S.; Der Mesrobian-Kabakian, A.; DeVoe, R.; Didberidze, T.; Dolgolenko, A.; Dolinski, M. J.; Dunford, M.; Fairbank, W.; Farine, J.; Feldmeier, W.; Fierlinger, P.; Fudenberg, D.; Giroux, G.; Gornea, R.; Graham, K.; Gratta, G.; Hall, C.; Herrin, S.; Hughes, M.; Jewell, M. J.; Jiang, X. S.; Johnson, A.; Johnson, T. N.; Johnston, S.; Karelin, A.; Kaufman, L. J.; Killick, R.; Koffas, T.; Kravitz, S.; Kuchenkov, A.; Kumar, K. S.; Leonard, D. S.; Licciardi, C.; Lin, Y. H.; Ling, J.; MacLellan, R.; Marino, M. G.; Mong, B.; Moore, D.; Nelson, R.; Odian, A.; Ostrovskiy, I.; Piepke, A.; Pocar, A.; Prescott, C. Y.; Rivas, A.; Rowson, P. C.; Russell, J. J.; Schubert, A.; Sinclair, D.; Smith, E.; Stekhanov, V.; Tarka, M.; Tolba, T.; Tsang, R.; Twelker, K.; Vuilleumier, J. -L.; Waite, A.; Walton, J.; Walton, T.; Weber, M.; Wen, L. J.; Wichoski, U.; Wood, J.; Yang, L.; Yen, Y. -R.; Zeldovich, O. Ya.
2015-07-15
The search for neutrinoless double-beta decay ( 0 ν β β ) requires extremely low background and a good understanding of their sources and their influence on the rate in the region of parameter space relevant to the 0 ν β β signal. We report on studies of various β and γ backgrounds in the liquid-xenon-based EXO- 200 0 ν β β experiment. With this work we try to better understand the location and strength of specific background sources and compare the conclusions to radioassay results taken before and during detector construction. Finally, we discuss the implications of these studies for EXO-200 as well as for the next-generation, tonne-scale nEXO detector.
34 CFR 200.78 - Allocation of funds to school attendance areas and schools.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Allocation of funds to school attendance areas and schools. 200.78 Section 200.78 Education Regulations of the Offices of the Department of Education OFFICE... for the Within-District Allocation of Lea Program Funds § 200.78 Allocation of funds to school...
Economic analysis of process steam and electricity generation by a 200 MW NHR
International Nuclear Information System (INIS)
Tian Li; Wang Yongqing
2000-01-01
New applications for low temperature nuclear heating reactors should be developed using economic analysis. This paper compares and analyzes the economics of the generation 1.5 MPa process steam and electricity by a 200 MW nuclear heating reactor (NHR-200) for industrial development. The project is very attractive economically with an internal rate of return of 19.61%, a net present worth (discount rate 10%) of 765 million yuan RMB and a capital recovery or payback period of about 5 years after construction is completed. Compared with only using the NHR-200 for in winter heating, the economic of process steam and electricity generation by NHR-200 are much better. In addition, the NHR-200 will significantly improve environmental pollution in cities and reduce the transport of coal from north to south in China
Test Results of a 200 W Class Hall Thruster
Jacobson, David; Jankovsky, Robert S.
1999-01-01
The performance of a 200 W class Hall thruster was evaluated. Performance measurements were taken at power levels between 90 W and 250 W. At the nominal 200 W design point, the measured thrust was 11.3 mN. and the specific impulse was 1170 s excluding cathode flow in the calculation. A laboratory model 3 mm diameter hollow cathode was used for all testing. The engine was operated on laboratory power supplies in addition to a breadboard power processing unit fabricated from commercially available DC to DC converters.
Readiness evaluation report for operation of the 200-ZP-1 pump-and-treat system
International Nuclear Information System (INIS)
Lehrschall, R. R.
1996-07-01
The 200-ZP-1 Readiness Evaluation Team has completed a readiness evaluation (RE) of the 200-ZP-1 Interim Remedial Measure. During the RE process, other Environmental Restoration Contractor and Hanford Site project activities were assessed (i.e., using lessons learned reviews) for applicability to the 200-ZP-1 RE. Nine additional areas were discovered to be applicable to the 200-ZP-1 IRM and were incorporated into the RE process as functional readiness requirements. The goal of the 200-ZP-1 Operable Unit IRM is to reduce further migration of the carbon tetrachloride, chloroform, and trichloroethylene in the groundwater of the 200 West Area. The IRM treatment system has been designed to initiate hydraulic containment of the contaminant mass in the high-concentration portion of the CCl 4 plume
20 CFR 200.9 - Selection of members of Actuarial Advisory Committee.
2010-04-01
... 20 Employees' Benefits 1 2010-04-01 2010-04-01 false Selection of members of Actuarial Advisory Committee. 200.9 Section 200.9 Employees' Benefits RAILROAD RETIREMENT BOARD GENERAL ADMINISTRATION GENERAL... railroad subject to the Interstate Commerce Act which own or control more than 50 percent of the total...
24 CFR 200.225 - Approvals by Area Managers for limited partners.
2010-04-01
... previous projects covered by these regulations has been as a limited partner. All other certificates must... limited partners. 200.225 Section 200.225 Housing and Urban Development Regulations Relating to Housing... by Area Managers for limited partners. The Area Manager of the HUD Area Office where the certificate...
200 area liquid effluent facility quality assurance program plan. Revision 1
International Nuclear Information System (INIS)
Sullivan, N.J.
1995-01-01
Direct revision of Supporting Document WHC-SD-LEF-QAPP-001, Rev. 0. 200 Area Liquid Effluent Facilities Quality Assurance Program Plan. Incorporates changes to references in tables. Revises test to incorporate WHC-SD-LEF-CSCM-001, Computer Software Configuration Management Plan for 200 East/West Liquid Effluent Facilities
Seizures in E200K familial and sporadic Creutzfeldt-Jakob disease.
Appel, S; Chapman, J; Cohen, O S; Rosenmann, H; Nitsan, Z; Blatt, I
2015-03-01
Although seizures (other than myoclonus) are frequently reported in Creutzfeldt-Jakob disease (CJD), their frequency, clinical manifestations, and effect on the disease course is unknown. To characterize the frequency of seizures in E200K familial and sporadic CJD, to describe its semiology, EEG and MRI findings. In this retrospective study, we reviewed all patients with CJD who were seen in the Sheba Medical Center between the years 2003-2012 and underwent clinical evaluation, genetic testing, EEG and MRI studies. The diagnosis of seizures was carried out based on documentation of episodes consistent with seizures or episode of unresponsiveness correlated with ictal activity in EEG. Sixty-four probable patients with CJD were included in the study, 57 (89%) with E200K familial (fCJD) and 7 (11%) with sporadic (sCJD). Seizures occurred in 8 patients: 3 of 7 (43%) in patients with sCJD compared to 5/57 (9%) in patients with E200K fCJD (P = 0.04, chi-square test). Two of E200K fCJD patients with seizures had other non-prion etiologies for seizures (brain metastasis, known history of temporal lobe epilepsy which started 44 years before the diagnosis of CJD). Seizures occurred late in the course of the disease with an average of 12 days between the onset of seizures and death. Seizures in E200K fCJD were infrequent and occurred late in the disease course. This difference suggests that E200K fCJD represents a separate subtype of the disease with distinct clinical characteristics. © 2014 John Wiley & Sons A/S. Published by John Wiley & Sons Ltd.
17 CFR 200.17 - Chief Management Analyst.
2010-04-01
...) Organizational structures and delegations of authority; (d) Management information systems and concepts; and (e... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Chief Management Analyst. 200...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General Organization...
International Nuclear Information System (INIS)
Knepp, A. J.
1999-01-01
The 200 Areas Remedial Investigation/Feasibility Study Implementation Plan - Environmental Restoration Program (Implementation Plan) addresses approximately 700 soil waste sites (and associated structures such as pipelines) resulting from the discharge of liquids and solids from processing facilities to the ground (e.g., ponds, ditches, cribs,burial grounds) in the 200 Areas and assigned to the Environmental Restoration Program. The Implementation Plan outlines the framework for implementing assessment activities in the 200 Areas to ensure consistency in documentation, level of characterization, and decision making. The Implementation Plan also consolidates background information and other typical work plan materials, to serve as a single referenceable source for this type of information
CD200-expressing human basal cell carcinoma cells initiate tumor growth.
Colmont, Chantal S; Benketah, Antisar; Reed, Simon H; Hawk, Nga V; Telford, William G; Ohyama, Manabu; Udey, Mark C; Yee, Carole L; Vogel, Jonathan C; Patel, Girish K
2013-01-22
Smoothened antagonists directly target the genetic basis of human basal cell carcinoma (BCC), the most common of all cancers. These drugs inhibit BCC growth, but they are not curative. Although BCC cells are monomorphic, immunofluorescence microscopy reveals a complex hierarchical pattern of growth with inward differentiation along hair follicle lineages. Most BCC cells express the transcription factor KLF4 and are committed to terminal differentiation. A small CD200(+) CD45(-) BCC subpopulation that represents 1.63 ± 1.11% of all BCC cells resides in small clusters at the tumor periphery. By using reproducible in vivo xenograft growth assays, we determined that tumor initiating cell frequencies approximate one per 1.5 million unsorted BCC cells. The CD200(+) CD45(-) BCC subpopulation recreated BCC tumor growth in vivo with typical histological architecture and expression of sonic hedgehog-regulated genes. Reproducible in vivo BCC growth was achieved with as few as 10,000 CD200(+) CD45(-) cells, representing ~1,500-fold enrichment. CD200(-) CD45(-) BCC cells were unable to form tumors. These findings establish a platform to study the effects of Smoothened antagonists on BCC tumor initiating cell and also suggest that currently available anti-CD200 therapy be considered, either as monotherapy or an adjunct to Smoothened antagonists, in the treatment of inoperable BCC.
17 CFR 200.554 - Public availability of information.
2010-04-01
... ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Regulations Pertaining to the Protection of the Environment § 200.554 Public availability of information. (a) Any environmental assessment or impact statement...
34 CFR 200.86 - Use of MEP funds in schoolwide projects.
2010-07-01
... 34 Education 1 2010-07-01 2010-07-01 false Use of MEP funds in schoolwide projects. 200.86 Section... SECONDARY EDUCATION, DEPARTMENT OF EDUCATION TITLE I-IMPROVING THE ACADEMIC ACHIEVEMENT OF THE DISADVANTAGED Migrant Education Program § 200.86 Use of MEP funds in schoolwide projects. Funds available under part C...
Small passenger car transmission test-Chevrolet 200 transmission
Bujold, M. P.
1980-01-01
The small passenger car transmission was tested to supply electric vehicle manufacturers with technical information regarding the performance of commerically available transmissions which would enable them to design a more energy efficient vehicle. With this information the manufacturers could estimate vehicle driving range as well as speed and torque requirements for specific road load performance characteristics. A 1979 Chevrolet Model 200 automatic transmission was tested per a passenger car automatic transmission test code (SAE J651b) which required drive performance, coast performance, and no load test conditions. The transmission attained maximum efficiencies in the mid-eighty percent range for both drive performance tests and coast performance tests. Torque, speed and efficiency curves map the complete performance characteristics for Chevrolet Model 200 transmission.
Preliminary results of Linear Induction Accelerator LIA-200
Energy Technology Data Exchange (ETDEWEB)
Sharma, Archana; Senthil, K; Kumar, D D Praveen; Mitra, S; Sharma, V; Patel, A; Sharma, D K; Rehim, R; Kolge, T S; Saroj, P C; Acharya, S; Amitava, Roy; Rakhee, M; Nagesh, K V; Chakravarthy, D P, E-mail: aroy@barc.gov.i, E-mail: arsharma@barc.gov.i [Accelerator and Pulse Power Division, Bhabha Atomic Research Centre, Trombay, Mumbai 400 085 (India)
2010-05-15
Repetitive Pulsed Power Technology is being developed keeping in mind the potential applications of this technology in material modifications, disinfections of water, timber, and food pasteurization etc. BARC has indigenously developed a Linear Induction Accelerator (LIA-200) rated for 200 kV, 4 kA, 100 ns, 10 Hz. The satisfactory performance of all the sub-systems including solid state power modulator, amorphous core based pulsed transformers, magnetic switches, water capacitors, water pulse- forming line, induction adder and field-emission diode have been demonstrated. This paper presents some design details and operational results of this pulsed power system. It also highlights the need for further research and development to build reliable and economic high-average power systems for industrial applications.
RAM R-200 - A Portable Ruggedized Radiation Monitoring System
International Nuclear Information System (INIS)
Wengrowicz, U.; Mazor, T.; Assido, H.; Kadmon, Y.; Tirosh, D.; Shani, G.
1999-01-01
RAM R-200, a new generation of ruggedized portable radiation-monitoring systems, is presented. The system which is a result of interdisciplinary research, was developed at the NRCN in collaboration with Ben-Gurion University. It consists of RAM R-200 - a portable radiation meter, and a variety of external probes for wide range gamma radiation fields and beta-gamma contamination detection and measurement. The meter or each one of the external probes can be used as a portable system or a stand-alone radiation measurement station. All the system's components were specially designed to meet severe environmental conditions
200 Area Liquid Effluent Facilities -- Quality assurance program plan
International Nuclear Information System (INIS)
Fernandez, L.
1995-01-01
This Quality Assurance Program Plan (QAPP) describes the quality assurance and management controls used by the 200 Area Liquid Effluent Facilities (LEF) to perform its activities in accordance with DOE Order 5700.6C. The 200 Area LEF consists of the following facilities: Effluent Treatment Facility (ETF); Treated Effluent Disposal Facility (TEDF); Liquid Effluent Retention facility (LERF); and Truck Loading Facility -- (Project W291). The intent is to ensure that all activities such as collection of effluents, treatment, concentration of secondary wastes, verification, sampling and disposal of treated effluents and solids related with the LEF operations, conform to established requirements
broadband, low sidelobe, zero height, slotted circular disk antenna
African Journals Online (AJOL)
of argument rr where J? = jwµ.(
19 CFR 200.735-117 - Supplementary statements.
2010-04-01
... under this section, each employee shall at all times avoid acquiring a financial interest that could... CONDUCT Provisions Governing Statements of Employment and Financial Interests § 200.735-117 Supplementary... and financial interests shall be reported in a supplementary statement as of June 30 each year. If no...
Directory of Open Access Journals (Sweden)
Remzi YILDIRIM
1998-01-01
Full Text Available In this study, dynamic stability analysis of semiconductor laser diodes with external optical feedback has been realized. In the analysis the frequency response of the transfer function of laser diode H jw( , the transfer m function of laser diode with external optical feedback TF jw( , and optical feedback transfer function m K jw( obtained from small signal equations has been m accomplished using Nyquist stability analysis in complex domain. The effect of optical feedback on the stability of the system has been introduced and to bring the laser diode to stable condition the working critical boundary range of dampig frequency and reflection power constant (R has been determined. In the study the reflection power has been taken as ( .
Results of open heart surgery in Jehovah's Witness patients. Single centre experience.
Juraszek, Andrzej; Kołsut, Piotr; Szymański, Jarosław; Kuriata, Jarosław; Kuśmierski, Krzysztof; Sitkowska-Rysiak, Ewa; Jasińska, Małgorzata; Kuśmierczyk, Mariusz
2017-09-01
Evaluation the results in patients from the religious community of Jehovah's Witness (JW) undergoing open heart surgery at our institution. Between September 2011 and March 2015, 21 patients with a religious background of the JW church underwent open heart surgery at our institution performed by the same surgical team. Mean age was 68.43 ±8.93 years. There were 13 (61.9%) female patients. Recombinant human erythropoietin was administered to every patient with a hemoglobin value open heart surgery in JW were very good, including combined procedures. The decrease of hematocrit serum levels significantly characterizing the postoperative period was highly acceptable in this series. Nevertheless, the number of sternum wound infections was a limiting factor for prompt postoperative recovery.
Simulated HLLW compositions for cold test of waste management development
International Nuclear Information System (INIS)
Banba, Tsunetaka; Kimura, Hideo; Kamizono, Hiroshi; Tashiro, Shingo
1982-07-01
Three grades of simulated high-level liquid waste (HLLW)-JW-A, JW-B, and JW-C - were proposed to be used respectively according to stages of various cold tests for safety assessment of HLW management. The composition of HLLW was estimated taking into account the spectrum of fission products and actinides, waste volume, corrosion products, and chemical additives. One of conditions, the spectrum of fission products and actinides of LWR spent fuels, was calculated by DCHAIN-code. Fuel burn-up of 28,000 MWD/tUO 2 and 33,000 MWD/tUO 2 were adopted as normal and maximum values of Japanese LWR power plants. The other conditions were estimated using the data obtained at Marcoule plant in France. (author)
Spaulding, A. P., Jr.
1979-01-01
The preliminary design criteria of the MP1-200 wind turbine are given along with a brief description of the wind turbine generator. Performance and operational experience and cost factors are included. Recommendations for additional research are listed.
Triaxiality in the even-mass Hg isotopes: A discontinuity at 200Hg
International Nuclear Information System (INIS)
Morrison, I.; Spear, R.H.
1981-01-01
The mass dependence of excitation energies of the 2 + 1 , 2 + 2 , and 4 + 1 states of the even-mass Hg isotopes, and of some related B(E2) values, shows a marked discontinuity at 200 Hg. Analysis of B(E2;0 + 1 →2 + 1 ) values in terms of an extended interacting boson approximation model suggests that this discontinuity is due to a change in the proton and neutron distributions at 200 Hg. Apart from 200 Hg, the data favor γ-soft models rather than the rigid triaxial-rotor model
International Nuclear Information System (INIS)
Xue Dazhi; Li Jicai; Chang Dafeng
1997-01-01
Nuclear heating application has received a wide attention in China due to the favourable economic and environmental aspects. The Nuclear Heating Plant NHR-200 is seen to provide the required energy for district heating, industrial processes and seawater desalination for many sites in China and possibly abroad. The paper summarizes the technical description of the plant and give its main characteristics related to the integral design approach. (author)
The functionality of canoeists specializing in competitive distance 200 meters.
Directory of Open Access Journals (Sweden)
Guo Penchen
2011-09-01
Full Text Available The article shows the importance of reactive properties to realize the potential of canoeist of south-east Asia specializing in the 200 meters established on a specialized focus of the training process sprinter. The parameters of functionality of athletes based on integrated aerobic and anaerobic ensure competitive distance of 200 m. They are based on assessing level of aerobic power and capacity of energy supply and properties of the cardiorespiratory system in actively increasing metabolic acidosis.
Feasibility study report for the 200-BP-1 operable unit
Energy Technology Data Exchange (ETDEWEB)
1993-06-01
This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9{times}10{sup {minus}5}.
Feasibility study report for the 200-BP-1 operable unit
International Nuclear Information System (INIS)
1993-06-01
This feasibility study examines a range of alternatives and provides recommendations for selecting a preferred alternative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965--1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area, groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-levels of contamination with cesium-137, radium-226, strontium-90, thorium-228, and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9x10 -5
Feasibility study report for the 200-BP-1 operable unit
International Nuclear Information System (INIS)
1994-01-01
This feasibility study (FS) examines a range of alternatives and provides recommendations for selecting a preferred altemative for remediating contamination at the 200-BP-1 operable unit. The 200-BP-1 operable unit is located in the center of the Hanford Site along the northern boundary of the 200 East Area. The 241-BY Tank Farm is located immediately to the south of the operable unit. 200-BP-1 is a source operable unit with contaminated soils associated primarily with nine inactive cribs (known as the 216-B cribs). These cribs were used for disposal of low-level radioactive liquid waste from U Plant uranium recovery operations, and waste storage tank condensate from the adjacent 241-BY Tank Farm. The cribs used for disposal of U Plant waste were in operation from 1955--1965, and the cribs used for disposal of tank condensate were in operation from 1965-1975. In addition to the cribs, four unplanned releases of radioactive materials have occurred within the operable unit. Contaminated surface soils associated with the unplanned releases have been consolidated over the cribs and covered with clean soil to reduce contaminant migration and exposure. Discharge of wastes to the cribs has resulted in soil and groundwater contamination. The groundwater is being addressed as part of the 200 East Aggregate Area groundwater operable unit. Contaminated soils at the site can be categorized by the types of contaminants, their distribution in the soil column, and the risk posed by the various potential exposure pathways. Below the clean soil cover, the near surface soils contain low-:levels of contamination with cesium-137, radium-226, strontium-90, thorium-228 and uranium. The lifetime incremental cancer risk associated with these soils if they were exposed at the surface is 9 x 10 5
Inhibition of CD200R1 expression by C/EBP beta in reactive microglial cells
Directory of Open Access Journals (Sweden)
Dentesano Guido
2012-07-01
Full Text Available Abstract Background In physiological conditions, it is postulated that neurons control microglial reactivity through a series of inhibitory mechanisms, involving either cell contact-dependent, soluble-factor-dependent or neurotransmitter-associated pathways. In the current study, we focus on CD200R1, a microglial receptor involved in one of these cell contact-dependent mechanisms. CD200R1 activation by its ligand, CD200 (mainly expressed by neurons in the central nervous system,is postulated to inhibit the pro-inflammatory phenotype of microglial cells, while alterations in CD200-CD200R1 signalling potentiate this phenotype. Little is known about the regulation of CD200R1 expression in microglia or possible alterations in the presence of pro-inflammatory stimuli. Methods Murine primary microglial cultures, mixed glial cultures from wild-type and CCAAT/enhancer binding protein β (C/EBPβ-deficient mice, and the BV2 murine cell line overexpressing C/EBPβ were used to study the involvement of C/EBPβ transcription factor in the regulation of CD200R1 expression in response to a proinflammatory stimulus (lipopolysaccharide (LPS. Binding of C/EBPβ to the CD200R1 promoter was determined by quantitative chromatin immunoprecipitation (qChIP. The involvement of histone deacetylase 1 in the control of CD200R1 expression by C/EBPβ was also determined by co-immunoprecipitation and qChIP. Results LPS treatment induced a decrease in CD200R1 mRNA and protein expression in microglial cells, an effect that was not observed in the absence of C/EBPβ. C/EBPβ overexpression in BV2 cells resulted in a decrease in basal CD200R1 mRNA and protein expression. In addition, C/EBPβ binding to the CD200R1 promoter was observed in LPS-treated but not in control glial cells, and also in control BV2 cells overexpressing C/EBPβ. Finally, we observed that histone deacetylase 1 co-immunoprecipitated with C/EBPβ and showed binding to a C/EBPβ consensus sequence of the CD
Thermal-hydraulic design of the 200 MW NHR
International Nuclear Information System (INIS)
Li Jincai; Gao Zuying; Xu Baocheng; He Junxiao
1997-01-01
The thermal hydraulic design of the 200-MW Nuclear Heating Reactor (NHR), design criteria, design methods, important characteristics and some development results are presented in this paper. (author). 5 refs, 8 figs, 2 tabs
Thermal-hydraulic design of the 200 MW NHR
Energy Technology Data Exchange (ETDEWEB)
Jincai, Li; Zuying, Gao; Baocheng, Xu; Junxiao, He [Institute of Nuclear Energy and Technology, Tsingua Univ., Beijing (China)
1997-09-01
The thermal hydraulic design of the 200-MW Nuclear Heating Reactor (NHR), design criteria, design methods, important characteristics and some development results are presented in this paper. (author). 5 refs, 8 figs, 2 tabs.
Conceptual design report, 200 Area sanitary sewer system: Project 96L-EWL-116
International Nuclear Information System (INIS)
Pursley, D.L.
1994-01-01
Project L-116 will install an integrated sanitary sewer system in the 200 Area. This new system will connect existing sewer systems for facilities that have a foreseeable future, provide capacity and routing for future facilities, and install new septic sewer systems for existing facilities that cannot be feasibly connected to the new sewer system and have a mission that will extend beyond the year 2000. Project L-116 will construct a sanitary sewer collection, treatment, and disposal system for facilities in the 200-East and -West Areas and adjacent areas located on the 200 Area plateau. The existing septic systems will be abandoned or decommissioned in accordance with applicable Washington State and local codes and regulations. The conceptual design for the sanitary sewer system is designed around population forecasts of 5,000 people for 200-West Area and 9,000 people for 200-East Area. The definitive design will be based on the latest forecast populations at the time definitive design is initiated
21 CFR 201.200 - Disclosure of drug efficacy study evaluations in labeling and advertising.
2010-04-01
... labeling and advertising. 201.200 Section 201.200 Food and Drugs FOOD AND DRUG ADMINISTRATION, DEPARTMENT... Efficacy Study § 201.200 Disclosure of drug efficacy study evaluations in labeling and advertising. (a)(1... bringing to the attention of the prescribers of prescription items the conclusions of the expert panels...
12 CFR 550.200 - Must I review a prospective account before I accept it?
2010-01-01
... accept it? 550.200 Section 550.200 Banks and Banking OFFICE OF THRIFT SUPERVISION, DEPARTMENT OF THE... § 550.200 Must I review a prospective account before I accept it? Before accepting a prospective fiduciary account, you must review it to determine whether you can properly administer the account. ...
29 CFR 780.200 - Inclusion of forestry or lumbering operations in agriculture is limited.
2010-07-01
... 29 Labor 3 2010-07-01 2010-07-01 false Inclusion of forestry or lumbering operations in agriculture is limited. 780.200 Section 780.200 Labor Regulations Relating to Labor (Continued) WAGE AND HOUR... Lumbering Operations § 780.200 Inclusion of forestry or lumbering operations in agriculture is limited...
200 000 kroonine viga Reformierakonna aruandes / Tarmo Vahter
Vahter, Tarmo, 1970-
2008-01-01
Reformierakonna aruande kohaselt maksis Riigikogu liige Jaanus Rahumägi 200 000 krooni reklaamfirmale Droom. J. Rahumäe väitel ei ole ta firmale maksnud sentigi. Vt. samas intervjuud Jaanus Rahumäega
Leach testing of SYNROC and glass samples at 85 and 200/degree/C
International Nuclear Information System (INIS)
Oversby, V.M.; Ringwood, A.E.
1981-01-01
Leach tests were conducted on 0.5 g disc samples of SYNROC and two glass types using distilled water at 85 and 200/degree/C. No leaching was detected for SYNROC at either temperature. Thus, the upper limit on leach rate for SYNROC is <0.005 g/m/sup 2/d. Waste glass PNL 76-68 had leach rates of 1.4 g/m/sup 2/ d at 85/degree/C and 8.9 g/m/sup 2/ d at 200/degree/C, while 73-1 glass frit had a leach rate of 41 g/m/sup 2/ d at 200/degree/C. The leach tests were repeated in the presence of rock powders. Again, no leaching was measurable for SYNROC. PNL 76-68 glass had leach rates between 4 and 23 g/m/sup 2/ d at 200/degree/C and 73-1 frit leached at rates between 29 and 176 g/m/sup 2/ d at 200/degree/C. Tests were also conducted on crushed glass samples (PNL 76-68, 100-200 /mu/m size fraction). Bulk leach rates were calculated based on measurement of Ca, Cs, and U in the leach solutions. The results of the leach tests show that SYNROC is several orders of magnitude more resistant to leaching than glass
17 CFR 200.41 - Quorum of the Commission.
2010-04-01
...; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Disposition of Commission Business § 200.41 Quorum of the... office; and provided further that on any matter of business as to which the number of members in office...
Directory of Open Access Journals (Sweden)
Juan Carlos Quintana Díaz
2005-12-01
Full Text Available Se realizó un estudio clínico y radiográfico pre y posoperatorio en 4 pacientes con fracturas del suelo orbitario reparadas con hidroxiapatita HAP-200. En ninguno de los pacientes se encontró reacción adversa ante este material implantalógico y sí muy buena tolerancia y adaptabilidad, lo que nos reafirmó su alta biocompatibilidad, por lo que lo recomendamos en el tratamiento de esta afección.A pre- and postoperative clinical and X-ray study was conducted in 4 patients with orbital floor fractures repaired with HAP-200hydroxyapatite. . No adverse reaction to this material was observed in any of the patients, who showed a good tolerance and adaptability that confirmed its high biocompatibility and make it recommendable for treating this affection.
The JHP 200-MeV proton linear accelerator
Energy Technology Data Exchange (ETDEWEB)
Kato, Takao [National Lab. for High Energy Physics, Tsukuba, Ibaraki (Japan)
1997-11-01
A 200-MeV proton linear accelerator for the Japanese Hadron Project (JHP) has been designed. It consists of a 3-MeV radio-frequency quadrupole linac (RFQ), a 50-MeV drift tube linac (DTL) and a 200-MeV separated-type drift tube linac (SDTL). A frequency of 324 MHz has been chosen for all of the rf structures. A peak current of 30 mA (H{sup -} ions) of 400 {mu}sec pulse duration will be accelerated at a repetition rate of 25 Hz. A future upgrade plan up to 400 MeV is also presented, in which annular-coupled structures (ACS) of 972 MHz are used in an energy range of above 150 or 200 MeV. One of the design features is its high performance for a beam-loss problem during acceleration. It can be achieved by separating the transition point in the transverse motion from that of the longitudinal motion. The transverse transition at a rather low-energy range decreases the effects of space-charge, while the longitudinal transition at a rather high-energy range decreases the effects of nonlinear problems related to acceleration in the ACS. Coupled envelope equations and equipartitioning theory are used for the focusing design. The adoption of the SDTL structure improves both the effective shunt impedance and difficulties in fabricating drift tubes with focusing magnets. An accurate beam-simulation code on a parallel supercomputer was used for confirming any beam-loss problem during acceleration. (author)
Spliceosome SNRNP200 Promotes Viral RNA Sensing and IRF3 Activation of Antiviral Response.
Directory of Open Access Journals (Sweden)
Nicolas Tremblay
2016-07-01
Full Text Available Spliceosomal SNRNP200 is a Ski2-like RNA helicase that is associated with retinitis pigmentosa 33 (RP33. Here we found that SNRNP200 promotes viral RNA sensing and IRF3 activation through the ability of its amino-terminal Sec63 domain (Sec63-1 to bind RNA and to interact with TBK1. We show that SNRNP200 relocalizes into TBK1-containing cytoplasmic structures upon infection, in contrast to the RP33-associated S1087L mutant, which is also unable to rescue antiviral response of SNRNP200 knockdown cells. This functional rescue correlates with the Sec63-1-mediated binding of viral RNA. The hindered IFN-β production of knockdown cells was further confirmed in peripheral blood cells of RP33 patients bearing missense mutation in SNRNP200 upon infection with Sendai virus (SeV. This work identifies a novel immunoregulatory role of the spliceosomal SNRNP200 helicase as an RNA sensor and TBK1 adaptor for the activation of IRF3-mediated antiviral innate response.
Triggering at Isabelle; the first 200 nanoseconds
International Nuclear Information System (INIS)
Abshire, G.; Kondo, K.; Sculli, J.; Johnson, R.A.; Morris, G.R.
1978-07-01
At full luminosity of ISABELLE and with an anticipated pp total cross section of 60 mb, there will be, on the average, one interaction every 70 ns. At the other end of the spectrum, it will probably take about 10 ms to store a complete event onto magnetic tape. In between these two extremes comes a triggering scheme which must select the one event out of 14,285,714 that is of interest to the experimenter. In a typical experiment, a certain small number of signals will come into an electronics trailer on cables that are as short as possible and have propagation velocities as high as possible. With these signals a fast decision will be made as to whether the rest of the information coming in on the slower, longer cables should be further processed or not. The typical length of time for this decision is 200 ns. Some of the problems arising during that first 200 ns are considered, and some examples of attempts to solve those problems are given
Strangeness production in p+Pb reactions at 200 GeV/c
International Nuclear Information System (INIS)
Greiner, D.E.; Andersen, E.; Blaes, R.; Cherney, M.; Cruz, B. de la; Fernandez, C.; Garabatos, C.; Garzon, J.A.; Geist, W.M.; Gruhn, C.R.; Hafidouni, M.; Hrubec, J.; Jones, P.G.; Judd, E.G.; Kuipers, J.P.M.; Ladrem, M.; Ladron de Guevara, P.; Loevhoeiden, G.; MacNaughton, J.; Mosquera, J.; Natkaniec, Z.; Nelson, J.M.; Neuhofer, G.; Perez de los Heros, C.; Plo, M.; Porth, P.; Powell, B.; Ramil, A.; Rohringer, H.; Sakrejda, I.; Thorsteinsen, T.F.; Traxler, J.; Voltolini, C.; Wozniak, K.; Yanez, A.; Zybert, R.
1994-01-01
The production of the strange particles Λ, anti Λ and K S 0 in p+Pb collisions at 200 GeV/c has been measured using the NA36 TPC. Rapidity distributions and multiplicity dependences are presented and compared to model calculations. Reinteractions in the target are important to describe the observed spectra. Inverse slopes T∼200 MeV are extracted from the transverse mass distributions. (orig.)
GMA200 ATEGG Digital Controls Demonstration.
1979-10-01
radial and axial loads into the air inlet housing and forward frame. c. Combustor/Diffuser The GMA200 combustor/diffuser section consists of an annular...transition flow path of a turbofan engine. 6 IT U’~ --sa b. Compressor A six-stage axial flow compressor assembly consists of subassemblies of the...savings in the highly loaded , high speed unit. The blade is cooled by the application of a variety of cooling techniques including a film-cooled leading
Phase 1 remedial investigation report for 200-BP-1 operable unit. Volume 1
Energy Technology Data Exchange (ETDEWEB)
1993-09-01
The US Department of Energy (DOE) Hanford Site, in Washington State is organized into numerically designated operational areas including the 100, 200, 300, 400, 600, and 1100 Areas. The US Environmental Protection Agency (EPA), in November 1989 included the 200 Areas of the Hanford Site on the National Priority List (NPL) under the Comprehensive Environmental Response, Compensation and Liability Act of 1980 (CERCLA). Inclusion on the NPL initiated the remedial investigation (RD process for the 200-BP-1 operable unit. These efforts are being addressed through the Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989) which was negotiated and approved by the DOE, the EPA, and the State of Washington Department of Ecology (Ecology) in May 1989. This agreement, known as the Tri-Party Agreement, governs all CERCLA efforts at Hanford. In March of 1990, the Department of Energy, Richland Operations (DOE-RL) issued a Remedial Investigation/Feasibility Study (RI/FS) work plan (DOE-RL 1990a) for the 200-BP-1 operable unit. The work plan initiated the first phase of site characterization activities associated with the 200-BP-1 operable unit. The purpose of the 200-BP-1 operable unit RI is to gather and develop the necessary information to adequately understand the risks to human health and the environment posed by the site and to support the development and analysis of remedial alternatives during the FS. The RI analysis will, in turn, be used by Tri-Party Agreement signatories to make a risk-management-based selection of remedies for the releases of hazardous substances that have occurred from the 200-BP-1 operable unit.
29 CFR 541.200 - General rule for administrative employees.
2010-07-01
... REGULATIONS DEFINING AND DELIMITING THE EXEMPTIONS FOR EXECUTIVE, ADMINISTRATIVE, PROFESSIONAL, COMPUTER AND OUTSIDE SALES EMPLOYEES Administrative Employees § 541.200 General rule for administrative employees. (a...
Liu, Xiao-le; Chen, Guang-Hui; Wang, Xiu-Jun; Li, Peng; Song, Yi-Bing; Li, Rui-Yan
2017-11-15
The adsorption capacities of a heterometallic metal-organic framework (CPM-200-In/Mg) to VOCs (HCHO, C 2 H 4 , CH 4 , C 2 H 2 , C 3 H 8 , C 2 H 6 , C 2 H 3 Cl, C 2 H 2 Cl 2 , CH 2 Cl 2 and CHCl 3 ) and some inorganic gas molecules (HCN, SO 2 , NO, CO 2 , CO, H 2 S and NH 3 ), as well as its selectivity in ternary mixture systems of natural gas and post-combustion flue gas are theoretically explored at the grand canonical Monte Carlo (GCMC) and density functional theory (DFT) levels. It is shown that CPM-200-In/Mg is suitable for the adsorption of VOCs, particularly for HCHO (up to 0.39 g g -1 at 298 K and 1 bar), and the adsorption capacities of some inorganic gas molecules such as SO 2 , H 2 S and CO 2 match well with the sequence of their polarizability (SO 2 > H 2 S > CO 2 ). The large adsorption capacities of HCN and HCHO in the framework result from the strong interaction between adsorbates and metal centers, based on analyzing the radial distribution functions (RDF). Comparing C 2 H 4 and CH 4 molecules interacting with CPM-200-In/Mg by VDW interaction, we speculate that the high adsorption capacities of their chlorine derivatives in the framework could be due to the existence of halogen bonding or strong electrostatic and VDW interactions. It is found that the basic groups, including -NH 2 , -N and -OH, can effectively improve both the adsorption capacities and selectivity of CPM-200-In/Mg for harmful gases. Note that the adsorption capacity of CPM-200-In/Mg-NH 2 (site 2) (245 cm 3 g -1 ) for CO 2 exceeded that of MOF-74-Mg (228 cm 3 g -1 ) at 273 K and 1 bar and that for HCHO can reach 0.41 g g -1 , which is almost twice that of 438-MOF and nearly 45 times of that in active carbon. Moreover, for natural gas mixtures, the decarburization and desulfurization abilities of CPM-200-In/Mg-NH 2 (site 2) have exceeded those of the MOF-74 series, while for post-combustion flue gas mixtures, the desulfurization ability of CPM-200-In/Mg-NH 2 (site 2) is still
Directory of Open Access Journals (Sweden)
Neeta Bala Tannan
2018-01-01
Full Text Available AKAP200 is a Drosophila melanogaster member of the "A Kinase Associated Protein" family of scaffolding proteins, known for their role in the spatial and temporal regulation of Protein Kinase A (PKA in multiple signaling contexts. Here, we demonstrate an unexpected function of AKAP200 in promoting Notch protein stability. In Drosophila, AKAP200 loss-of-function (LOF mutants show phenotypes that resemble Notch LOF defects, including eye patterning and sensory organ specification defects. Through genetic interactions, we demonstrate that AKAP200 interacts positively with Notch in both the eye and the thorax. We further show that AKAP200 is part of a physical complex with Notch. Biochemical studies reveal that AKAP200 stabilizes endogenous Notch protein, and that it limits ubiquitination of Notch. Specifically, our genetic and biochemical evidence indicates that AKAP200 protects Notch from the E3-ubiquitin ligase Cbl, which targets Notch to the lysosomal pathway. Indeed, we demonstrate that the effect of AKAP200 on Notch levels depends on the lysosome. Interestingly, this function of AKAP200 is fully independent of its role in PKA signaling and independent of its ability to bind PKA. Taken together, our data indicate that AKAP200 is a novel tissue specific posttranslational regulator of Notch, maintaining high Notch protein levels and thus promoting Notch signaling.
Bala Tannan, Neeta; Collu, Giovanna; Humphries, Ashley C; Serysheva, Ekatherina; Weber, Ursula; Mlodzik, Marek
2018-01-01
AKAP200 is a Drosophila melanogaster member of the "A Kinase Associated Protein" family of scaffolding proteins, known for their role in the spatial and temporal regulation of Protein Kinase A (PKA) in multiple signaling contexts. Here, we demonstrate an unexpected function of AKAP200 in promoting Notch protein stability. In Drosophila, AKAP200 loss-of-function (LOF) mutants show phenotypes that resemble Notch LOF defects, including eye patterning and sensory organ specification defects. Through genetic interactions, we demonstrate that AKAP200 interacts positively with Notch in both the eye and the thorax. We further show that AKAP200 is part of a physical complex with Notch. Biochemical studies reveal that AKAP200 stabilizes endogenous Notch protein, and that it limits ubiquitination of Notch. Specifically, our genetic and biochemical evidence indicates that AKAP200 protects Notch from the E3-ubiquitin ligase Cbl, which targets Notch to the lysosomal pathway. Indeed, we demonstrate that the effect of AKAP200 on Notch levels depends on the lysosome. Interestingly, this function of AKAP200 is fully independent of its role in PKA signaling and independent of its ability to bind PKA. Taken together, our data indicate that AKAP200 is a novel tissue specific posttranslational regulator of Notch, maintaining high Notch protein levels and thus promoting Notch signaling.
JAERI 200 kV electron gun with an NEA-GaAs photocathode
International Nuclear Information System (INIS)
Nishitani, Tomohiro; Minehara, Eisuke J.; Hajima, Ryoichi; Nagai, Ryoji; Sawamura, Masaru; Nishimori, Nobuyuki; Kikuzawa, Nobuhiro; Yamauchi, Toshihiko
2004-01-01
The photocathode DC-gun with high average current, low beam emittance and long operational lifetime is considered to be indispensable for ERL-FEL. We have started the development program of a 200 keV electron gun with the NEA-GaAs photocathode for the first time in JAERI. In order to long an NEA surface lifetime, the JAERI 200 kV electron gun system consists of a 200 kV DC-gun chamber on extreme high vacuum condition and an NEA activation chamber with load-lock system. We report the goal of photocathode DC-gun R and D and the schedule of a developmental program. (author)
41 CFR 301-75.200 - How will we pay for pre-employment interviewee travel expenses?
2010-07-01
...-employment interviewee travel expenses? 301-75.200 Section 301-75.200 Public Contracts and Property Management Federal Travel Regulation System TEMPORARY DUTY (TDY) TRAVEL ALLOWANCES AGENCY RESPONSIBILITIES 75-PRE-EMPLOYMENT INTERVIEW TRAVEL Obtaining Travel Services and Claiming Reimbursement § 301-75.200 How...
19 CFR 200.735-104a - Proscribed actions.
2010-04-01
... independence or impartiality; (e) Making a Government decision outside official channels; or (f) Affecting...-104a Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES AND CONDUCT Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735-104a Proscribed...
Beyond metric gravity: Progress on PS-200
International Nuclear Information System (INIS)
Goldman, T.; Brown, R.E.; Camp, J.B.; Darling, T.; Dyer, P.; Holzscheiter, M.H.; Hughes, R.J.; Jarmie, N.; King, N.S.P.; Lizon, D.C.; Nieto, M.M.; Schauer, M.M.M.; Schecker, J.A.; Cornford, S.; Hosea, K.; Kenefick, R.A.; Hoibraaten, S.; Midzor, M.M.; Parry, S.P.; Ristenen, R.A.; Witteborn, F.C.
1993-01-01
The reconciliation of quantum mechanics and gravity on varying distance scales requires changes to General Relativity that may be testable implications. We briefly review the status of tests with matter of the inverse square law and the principle of equivalence, then report on progress on the drift-tube measurement section of PS- 200, the experiment to measure the gravitational acceleration of antiprotons
9 CFR 201.200 - Sale of livestock to a packer on credit.
2010-01-01
... 9 Animals and Animal Products 2 2010-01-01 2010-01-01 false Sale of livestock to a packer on credit. 201.200 Section 201.200 Animals and Animal Products GRAIN INSPECTION, PACKERS AND STOCKYARDS... credit to ________, a packer, and I understand that in doing so I will have no rights under the trust...
Main design and safety features of a 200MW nuclear heating reactor
International Nuclear Information System (INIS)
Zheng, Wenxiang; Gao, Zuying; Wang, Dazhong
1992-01-01
Inept has been in charge of the development of a nuclear heating reactor since 1980s, which is one of the national key R and D Programs in China. A 5MWt experimental NCR was completed at Inept in 1989 and has operated successfully for space heating since then. In order to realize the commercialization of the NCR, it has been decided to construct a 200MW demonstration NCR in 1993. A number of advanced features, including natural circulation, integrated arrangement, self-pressurized performance, dual vessel structure, hydraulic control rod drive and passive safety systems, have been incorporated into the NCR-200 to achieve its safety goal and economic viability. This makes the NCR safe, simple, reliable, easy-constructed and maintained. At present, the design work of the NCR-200 have shown that its safety characteristics are excellent. The NCR could play an important role in resolving future energy and environmental problems in China. The paper will mainly cover the key design considerations, main technical features and safety analysis results of the NCR-200
19 CFR 200.735-111 - Gambling, betting, and lotteries.
2010-04-01
... AND CONDUCT Provisions Governing Ethical and Other Conduct and Responsibilities of Employees § 200.735... or purchasing a numbers slip or ticket. However, this section does not preclude activities: (a...
2010-04-01
... under the HUD building product standards and certification program for carpet. 200.945 Section 200.945... requirements under the HUD building product standards and certification program for carpet. (a) Applicable.... (b) Labeling. Under the procedures set forth in § 200.935(d)(6) concerning labeling of a product, the...
The role of microRNA-200 in progression of human colorectal and breast cancer.
Directory of Open Access Journals (Sweden)
Linda Bojmar
Full Text Available The role of the epithelial-mesenchymal transition (EMT in cancer has been studied extensively in vitro, but involvement of the EMT in tumorigenesis in vivo is largely unknown. We investigated the potential of microRNAs as clinical markers and analyzed participation of the EMT-associated microRNA-200-ZEB-E-cadherin pathway in cancer progression. Expression of the microRNA-200 family was quantified by real-time RT-PCR analysis of fresh-frozen and microdissected formalin-fixed paraffin-embedded primary colorectal tumors, normal colon mucosa, and matched liver metastases. MicroRNA expression was validated by in situ hybridization and after in vitro culture of the malignant cells. To assess EMT as a predictive marker, factors considered relevant in colorectal cancer were investigated in 98 primary breast tumors from a treatment-randomized study. Associations between the studied EMT-markers were found in primary breast tumors and in colorectal liver metastases. MicroRNA-200 expression in epithelial cells was lower in malignant mucosa than in normal mucosa, and was also decreased in metastatic compared to non-metastatic colorectal cancer. Low microRNA-200 expression in colorectal liver metastases was associated with bad prognosis. In breast cancer, low levels of microRNA-200 were related to reduced survival and high expression of microRNA-200 was predictive of benefit from radiotheraphy. MicroRNA-200 was associated with ER positive status, and inversely correlated to HER2 and overactivation of the PI3K/AKT pathway, that was associated with high ZEB1 mRNA expression. Our findings suggest that the stability of microRNAs makes them suitable as clinical markers and that the EMT-related microRNA-200-ZEB-E-cadherin signaling pathway is connected to established clinical characteristics and can give useful prognostic and treatment-predictive information in progressive breast and colorectal cancers.
Generation and detection of ultrabroadband infrared wave exceeding 200 THz
Directory of Open Access Journals (Sweden)
Ashida Masaaki
2013-03-01
Full Text Available By focusing a hollow-fiber compressed intense 10–fs pulse and its second harmonic in air, an ultrabroadband infrared pulse with a spectral range of 1–200 THz is generated through a plasma. Coherent detection of the signal up to 100 THz is achieved with electro–optic sampling and THz air-breakdown-coherent-detection. The drastic dependence on the orientation of the second harmonic crystal is clarified in a range of 100–200 THz. From these, the whole frequency components are confirmed to be generated from the AC biased plasma and phase-locked.
Development of the Shimadzu computed tomographic scanner SCT-200N
International Nuclear Information System (INIS)
Ishihara, Hiroshi; Yamaoka, Nobuyuki; Saito, Masahiro
1982-01-01
The Shimadzu Computed Tomographic Scanner SCT-200N has been developed as an ideal CT scanner for diagnosing the head and spine. Due to the large aperture, moderate scan time and the Zoom Scan Mode, any part of the body can be scanned. High quality image can be obtained by adopting the precisely stabilized X-ray unit and densely packed array of 64-detectors. As for its operation, capability of computed radiography (CR) prior to patient positioning and real time reconstruction ensure efficient patient through-put. Details of the SCT-200N are described in this paper. (author)
Hanford 200 area (sanitary) waste water system
International Nuclear Information System (INIS)
Danch, D.A.; Gay, A.E.
1994-09-01
The US Department of Energy (DOE) Hanford Site is located in southeastern Washington State. The Hanford Site is approximately 1,450 sq. km (560 sq. mi) of semiarid land set aside for activities of the DOE. The reactor fuel processing and waste management facilities are located in the 200 Areas. Over the last 50 years at Hanford dicard of hazardous and sanitary waste water has resulted in billions of liters of waste water discharged to the ground. As part of the TPA, discharges of hazardous waste water to the ground and waters of Washington State are to be eliminated in 1995. Currently sanitary waste water from the 200 Area Plateau is handled with on-site septic tank and subsurface disposal systems, many of which were constructed in the 1940s and most do not meet current standards. Features unique to the proposed new sanitary waste water handling systems include: (1) cost effective operation of the treatment system as evaporative lagoons with state-of-the-art liner systems, and (2) routing collection lines to avoid historic contamination zones. The paper focuses on the challenges met in planning and designing the collection system
NSF Obligations for Top 200 Institutions by Fiscal Year
National Science Foundation — An text/xml file containing FY 2001 through FY 2015 National Science Foundation (NSF) obligations by institution for the top 200 recipients defined in terms of total...
MicroRNA-200a suppresses the Wnt/β-catenin signaling pathway by interacting with β-catenin.
Su, Juan; Zhang, Anling; Shi, Zhendong; Ma, Feifei; Pu, Peiyu; Wang, Tao; Zhang, Jie; Kang, Chunsheng; Zhang, Qingyu
2012-04-01
The Wnt/β-catenin signaling pathway is crucial for human organ development and is involved in tumor progression of many cancers. Accumulating evidence suggests that the expression of β-catenin is, in part, regulated by specific microRNAs (miRNAs). The purpose of this study was to determine the expression of a recently identified epithelial to mesenchymal transition (EMT)-associated tumor suppressor microRNA (miR)-200a, in cancer cells. We also aimed to identify specific miR-200a target genes and to investigate the antitumor effects of miR-200a on the Wnt/β-catenin signaling pathway. We employed TOP/FOP flash luciferase assays to identify the effect of miR-200a on the Wnt/β-catenin pathway and we confirmed our observations using fluorescence microscopy. To determine target genes of miR-200a, a 3' untranslated region (3' UTR) luciferase assay was performed. Cell viability, invasion and wound healing assays were carried out for functional analysis after miRNA transfection. We further investigated the role of miR-200a in EMT by Western blot analysis. We found fluctuation in the expression of miR-200a that was accompanied by changes in the expression of members of the Wnt/β-catenin signaling pathway. We also determined that miR-200a can directly interact with the 3' UTR of CTNNB1 (the gene that encodes β-catenin) to suppress Wnt/β-catenin signaling. MiR-200a could also influence the biological activities of SGC790 and U251 cells. Our results demonstrate that miR-200a is a new tumor suppressor that can regulate the activity of the Wnt/β-catenin signaling pathway via two mechanisms. MiR-200a is a candidate target for tumor treatment via its regulation of the Wnt/β-catenin signaling pathway.
Comparison of the Nellcor N-200 and N-3000 pulse oximeters during simulated postoperative activities
DEFF Research Database (Denmark)
Lie, C; Kehlet, H; Rosenberg, J
1997-01-01
Twenty-six healthy volunteers were monitored simultaneously with the Nellcor N-200 and N-3000 pulse oximeters during nonhypoxaemic simulated postoperative activity. The overall number of registered events (hypoxaemic episodes or loss of signal) was fewer with the N-3000 than with the N-200 (8 vs...... to loss of signal were significantly rarer with the N-3000 than with the N-200 (3 vs. 13, p = 0.001). The Nellcor N-3000 oximeter may offer an advantage over the N-200 model when monitoring patients in the postoperative period....
Inami, Eriko; Kataoka, Yaeko; Eto, Hiromi; Horiuchi, Shigeko
2010-06-01
To identify the prevalence of intimate partner violence (IPV) against Japanese women (JW) and non-Japanese women (NJW) in a perinatal setting. Additional purposes were to identify the associated factors of IPV, describe the characteristics of IPV against NJW, and assess the acceptability of the Violence Against Women Screen (VAWS) instrument as a screening tool. A cross-sectional survey was conducted from September to November 2007 in an urban hospital maternity clinic in Tokyo, Japan. Women who attended the maternity clinic received the VAWS instrument, which was translated into four languages (Japanese with Kanji and Hiragana, English, Chinese, and Tagalog) and was used to identify IPV. A total of 400 women participated in the study: 357 were JW and 43 were NJW. The prevalence rate of IPV among the JW was 31.4% and 21.4% among the NJW. There was no statistical significance between the two groups. A multiple logistic regression with adjusted odds ratio identified two associated factors for IPV: being multipara and previous experience of physical violence from a partner. The prevalence of IPV was not statistically different among JW and NJW. Screening for IPV, early intervention, and support should be expanded in hospitals and maternity clinics in Japan.
LLNL Site 200 Risk Management Plan
International Nuclear Information System (INIS)
Pinkston, D.; Johnson, M.
2008-01-01
2008, has been included as an appendix to the RMP Supplemental Information document. LLNL Site 200 is a research and development laboratory with infrastructure necessary to support its operations and personnel. Research and development activities at LLNL are focused on stockpile stewardship; achieving robust and vital scientific, engineering, and manufacturing capability; inertial confinement fusion; laser technology; materials and process science; computational and information sciences; basic sciences; engineering sciences; and biological sciences. Based upon CalARP Program regulations, guidance found in California Accidental Release Prevention Program (CalARP) Administering Guidance, Chapter 1, a review of facility specific documents, accident analyses summarized in this document and detailed in the LLNL Site 200 RMP Supporting Information document, LLNL has determined that each process meeting the CalARP threshold criteria meets the requirements for CalARP Program Level 1. In accordance with CalARP regulations, LLNL considers the natural segmentation of processes at Site 200 to be on a building basis and therefore consideration of inventory should be on a building basis rather than a 'site-wide' basis. Only those materials identified as equal to as or greater than the threshold quantities for the CalARP program on a building (process) level are reflected in this document. As such, materials and quantities reported in this document on a building (process) level will vary from materials and quantities reported in the LLNL Hazardous Materials Business Plan, Acutely Hazardous Material Registration Form on a site-wide level. For each process involving regulated quantities of lithium hydride, worst case accident analysis shows that the toxic endpoint lies within the site boundaries. These analyses document that the nearest public receptor is beyond the distance to a toxic or flammable endpoint. Refer to the LLNL Site 200 RMP Supporting Information document for a more
STUDY OF 200 CASES OF PLEURAL FLUID
Directory of Open Access Journals (Sweden)
Ramakrishna R
2016-09-01
Full Text Available BACKGROUND We have studied 200 patients of pleural fluid presenting to our tertiary care centre. Presence of cases of pleural fluid is a common presentation both in pulmonary and extrapulmonary diseases. We analysed the patients having both exudates and transudates and studied the results. MATERIALS AND METHODS We selected patients above 20 years of age and classified the patients with pleural fluid as having transudates and exudates. We studied the causes of transudates and exudates. A total of 200 patients are studied in this prospective study. Diagnosis of pleural exudates is made on the basis of Light’s criteria, chest x-ray, pleural fluid analysis, CT scan in selected patients, sputum examination, bronchoscopy and bronchial washings. Moribund and non-cooperative patients and HIV positives were excluded from the study. RESULTS Among the 200 patients, 91% have exudates. 9% have transudates by Light’s criteria. Tuberculosis is the commonest cause of effusions (64.83% followed by malignancy (13.73% and sympneumonic or parapneumonic effusions (9.89%. Pleural effusions occurred predominantly in males. Prevalence of diabetes Mellitus among cases of tuberculous pleural effusions is 13.56%. Tuberculous effusions are predominantly right-sided. CONCLUSION Predominant cases of pleural fluid are exudates. Commonest cause of pleural effusion is Tuberculosis followed by malignancy both pulmonary and extrapulmonary and sym. and parapneumonic effusions. Prevalence of Diabetes among Tuberculous pleural effusion cases is more or less same as in general population. Cough, expectoration fever, chest pain and breathlessness are the common symptoms occurring in three fourths of the patients of tuberculous pleural effusion. Most of the cases of Tuberculous effusion are above 30 years of age. In the diagnosis of tuberculous pleural effusion, Pleural fluid ADA is very important. Pleural fluid cytology, pleural biopsy, bronchoscopy, bronchial washings and sputum
Analysis of neutron dose rates on RGTT200K core using MCNP5
International Nuclear Information System (INIS)
Suwoto; Zuhair
2016-01-01
The conceptual design of RGTT200K (High Temperature Gas-cooled Reactor of 200 MWth Cogeneration) is the non-annular cylindrical reactor core with TRISO kernel coated fuel particles in the form of balls called pebble and cooled by helium gas. The RGTT200K reactor core design adopts high temperature gas cooled reactor (HTGR) technology with inherent passive safety. The RGTT200K spherical fuel called pebble fuel containing thousand of TRISO-coated fuel particles of uranium oxide (UO 2 ) 10 % enriched. TRISO coating comprises four layers, namely: porous carbon buffer layer, inner pyrolytic carbon layer (IPyC, Inner Pyrolytic Carbon), silicon carbide layer (SiC) and a layer of pyrolytic carbon outer portion (OPyC, Outer Pyrolytic Carbon). Modeling and analysis of preliminary calculation of neutron dose rate on normal operating temperature (T kernel =1200K) and accident temperature (T kernel =1800K) of the RGTT200K core were performed using Monte Carlo MCNP5v1.2 code. The continuous energy nuclear data cross-sections was taken from ENDF/B-VII, JENDL-4 and JEFF-3.1 nuclear data files . Double heterogeneity model in TRISO-coated fuel particles kernel and the pebble of RGTT200K core. By utilizing EGS99304 code, the 640 amount of energy group structures (SAND-II neutron group structures) is used in the neutron fluxes and spectrum calculation in RGTT200K reactor. The RGTT200K reactor core is divided into 25 zones (5 zones in radial and 10 zones in axial directions), while the modeling of radiation and biological shielding reactor RGTT200K are used to determine of preliminary neutron dose rate emitted by the neutron source with tally cards are available in the MCNP5v1.2 code. The calculation result analyses of the neutron dose rate distributions are determined using a conversion factor of flux-to-dose taken from International Commission on Radiological Protection, ICRP. The preliminary calculations result show that the neutrons dose rate using ICRP-74 conversion factor for
Methodology for completing Hanford 200 Area tank waste physical/chemical profile estimations
International Nuclear Information System (INIS)
Kruger, A.A.
1996-01-01
The purpose of the Methodology for Completing Hanford 200 Area Tank Waste Physical/Chemical Profile Estimations is to capture the logic inherent to completing 200 Area waste tank physical and chemical profile estimates. Since there has been good correlation between the estimate profiles and actual conditions during sampling and sub-segment analysis, it is worthwhile to document the current estimate methodology
Development of a 200kW multi-fuel type PAFC power plant
Energy Technology Data Exchange (ETDEWEB)
Take, Tetsuo; Kuwata, Yutaka; Adachi, Masahito; Ogata, Tsutomu [NTT Integrated Information & Energy System Labs., Tokyo (Japan)
1996-12-31
Nippon Telegraph and Telephone Corporation (NFT) has been developing a 200 kW multi-fuel type PAFC power plant which can generate AC 200 kW of constant power by switching fuel from pipeline town gas to liquefied propane gas (LPG) and vice versa. This paper describes the outline of the demonstration test plant and test results of its fundamental characteristics.
Microstructure and properties of ultrafine grain nickel 200 after hydrostatic extrusion processes
Sitek, R.; Krajewski, C.; Kamiński, J.; Spychalski, M.; Garbacz, H.; Pachla, W.; Kurzydłowski, K. J.
2012-09-01
This paper presents the results of the studies of the structure and properties of ultrafine grained nickel 200 obtained by hydrostatic extrusion processes. Microstructure was characterized by means of optical microscopy and electron transmission microscopy. Corrosion resistance was studied by impedance and potentiodynamic methods using an AutoLab PGSTAT 100 potentiostat in 0.1 M Na2SO4 solution and in acidified (by addition of H2SO4) 0.1 M NaCl solution at pH = 4.2 at room temperature. Microhardness tests were also performed. The results showed that hydrostatic extrusion produces a heterogeneous, ultrafine-grained microstructure in nickel 200. The corrosive resistance tests showed that the grain refinement by hydrostatic extrusion is accompanied by a decreased corrosive resistance of nickel 200.
20 CFR 670.200 - Who decides where Job Corps centers will be located?
2010-04-01
... for making decisions concerning the establishment, relocation, expansion, or closing of contract... 20 Employees' Benefits 3 2010-04-01 2010-04-01 false Who decides where Job Corps centers will be located? 670.200 Section 670.200 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION, DEPARTMENT OF...
200-ZP-1 IRM phase 2 and 3 remedial design report, Revision 1
International Nuclear Information System (INIS)
1996-07-01
This 200-ZP-1 remedial design report presents the objectives and rationale developed for the design and implementation of the selected interim remedial measure (IRM) for the 200-ZP-1 Operable Unit, located in the 200 West Area of the Hanford Site.The IRM was chosen in accordance with the Comprehensive Environmental Response, Compensation, and Liability Act of 1980, (CERCLA), as amended by the Superfund Amendments and Reauthorization Act of 1986, the Hanford Federal Facility Agreement and Consent Order (also known as the Tri- party Agreement), and the National Oil and Hazardous Substance Pollution Contingency Plan
RCRA facility investigation report for the 200-PO-1 operable unit. Revision 1
International Nuclear Information System (INIS)
1997-05-01
This Resource Conservation and Recovery Act (RCRA) Facility Investigation (RFI) report is prepared in support of the RFI/corrective measures study process for the 200-PO-1 Groundwater Operable Unit in the 200 East Area of the Hanford Site. This report summarizes existing information on this operable unit presented in the 200 East and PUREX Aggregate Area Management Study Reports, contaminant specific studies, available modeling data, and groundwater monitoring data summary reports. Existing contaminant data are screened against current regulatory limits to determine contaminants of potential concern (COPC). Each identified COPC is evaluated using well-specific and plume trend analyses
On sbottom hadronization at LEP 200
International Nuclear Information System (INIS)
Gris, Ph.
1997-01-01
The question of the hadronization of the sbottom is of interest for experimental searches. A study concerning this feature is presented for masses accessible at LEP 200 assuming that the sbottom is the lightest squark. Numerical evaluations of the decay modes b-bar 1 → b X -bar 1 0 and b-bar 1 → b X -bar 2 0 are done by varying the SUSY space parameters M 2 and μ. The results obtained allow to assert in which conditions the sbottom hadronizes and which decay dominates. (authors)
Interim remedial measures proposed plan for the 200-ZP-1 Operable Unit, Hanford Site, Washington
International Nuclear Information System (INIS)
Parker, D.L.
1993-12-01
The purpose of this interim remedial measures (IRM) proposed plan is to present and solicit public comments on the IRM planned for the 200-ZP-1 Operable Unit at the Hanford Site in Washington state. The 200-ZP-1 is one of two operable units that envelop the groundwater beneath the 200 West Area of the Hanford Site
Sánchez-Cid, Lourdes; Pons, Mònica; Lozano, Juan José; Rubio, Nuria; Guerra-Rebollo, Marta; Soriano, Aroa; Paris-Coderch, Laia; Segura, Miquel F; Fueyo, Raquel; Arguimbau, Judit; Zodda, Erika; Bermudo, Raquel; Alonso, Immaculada; Caparrós, Xavier; Cascante, Marta; Rafii, Arash; Kang, Yibin; Martínez-Balbás, Marian; Weiss, Stephen J; Blanco, Jerónimo; Muñoz, Montserrat; Fernández, Pedro L; Thomson, Timothy M
2017-10-13
MicroRNAs are critical regulators of gene networks in normal and abnormal biological processes. Focusing on invasive ductal breast cancer (IDC), we have found dysregulated expression in tumor samples of several microRNAs, including the miR-200 family, along progression from primary tumors to distant metastases, further reflected in higher blood levels of miR-200b and miR-7 in IDC patients with regional or distant metastases relative to patients with primary node-negative tumors. Forced expression of miR-200s in MCF10CA1h mammary cells induced an enhanced epithelial program, aldehyde dehydrogenase (ALDH) activity, mammosphere growth and ability to form branched tubuloalveolar structures while promoting orthotopic tumor growth and lung colonization in vivo . MiR-200s also induced the constitutive activation of the PI3K-Akt signaling through downregulation of PTEN, and the enhanced mammosphere growth and ALDH activity induced in MCF10CA1h cells by miR-200s required the activation of this signaling pathway. Interestingly, the morphology of tumors formed in vivo by cells expressing miR-200s was reminiscent of metaplastic breast cancer (MBC). Indeed, the epithelial components of MBC samples expressed significantly higher levels of miR-200s than their mesenchymal components and displayed a marker profile compatible with luminal progenitor cells. We propose that microRNAs of the miR-200 family promote traits of highly proliferative breast luminal progenitor cells, thereby exacerbating the growth and metastatic properties of transformed mammary epithelial cells.
20 CFR 663.200 - What are intensive services for adults and dislocated workers?
2010-04-01
... dislocated workers? 663.200 Section 663.200 Employees' Benefits EMPLOYMENT AND TRAINING ADMINISTRATION... assessment or individual employment plan. (b) For the purposes of paragraph (a) of this section, work experience is a planned, structured learning experience that takes place in a workplace for a limited period...
34 CFR 200.89 - MEP allocations; Re-interviewing; Eligibility documentation; and Quality control.
2010-07-01
... of recruiters, size or growth in local migratory child population, effectiveness of local quality... documentation; and Quality control. 200.89 Section 200.89 Education Regulations of the Offices of the Department...-interviewing; Eligibility documentation; and Quality control. (a) Allocation of funds under the MEP for fiscal...
Characterization and decant of Tank 42H sludge sample ESP-200
International Nuclear Information System (INIS)
Hay, M.S.
2000-01-01
DWPF Engineering requested that the Savannah River Technology Center (SRTC) provide a demonstration of the DWPF flowsheet on sludge from Tank 42H in the Shielded Cell facility. A 5 liter sample of the Tank 42H sludge (ESP-200), obtained with the tank contents fully mixed, arrived at SRTC on January 20, 1998. This report details receipt of the 5 liter sample at SRTC, the decant of the sample, and the characterization of the pre- and post-decant Tank 42H sludge. Evaluation of the measured composition of the supernate indicates Sample ESP-200 became diluted approximately 20 percent by volume prior to receipt. This dilution complicates the relationship of the characterization of Post-Decant ESP-200 to the current contents of Tank 42H. For the purposes of modeling the current tank contents of Tank 42H, this report provides an estimated composition based on analytical data of recent samples from Tank 42H
Characterization and decant of Tank 42H sludge sample ESP-200
Energy Technology Data Exchange (ETDEWEB)
Hay, M.S.
2000-04-25
DWPF Engineering requested that the Savannah River Technology Center (SRTC) provide a demonstration of the DWPF flowsheet on sludge from Tank 42H in the Shielded Cell facility. A 5 liter sample of the Tank 42H sludge (ESP-200), obtained with the tank contents fully mixed, arrived at SRTC on January 20, 1998. This report details receipt of the 5 liter sample at SRTC, the decant of the sample, and the characterization of the pre- and post-decant Tank 42H sludge. Evaluation of the measured composition of the supernate indicates Sample ESP-200 became diluted approximately 20 percent by volume prior to receipt. This dilution complicates the relationship of the characterization of Post-Decant ESP-200 to the current contents of Tank 42H. For the purposes of modeling the current tank contents of Tank 42H, this report provides an estimated composition based on analytical data of recent samples from Tank 42H.
200-ZP-1 phase 2 interim remedial measure quarterly report, August--October 1996
International Nuclear Information System (INIS)
Freeman-Pollard, J.R.; Jacques, I.D.; McMahon, W.J.; Singleton, K.M.; Strope, S.A.; Swanson, L.C.; Windmueller, C.R.
1996-11-01
A groundwater pump-and-treat system is being operated in the 200-ZP-1 Operable Unit under authority of the Hanford Federal Facility Agreement and Consent Order . The purpose of the pump-and-treat system is to accomplish the following: Minimize further migration of the high-concentration portion of the carbon tetrachloride plume and co-contaminants chloroform and trichlorethylene in the 200-ZP-1 Operable Unit Provide data for evaluation of final remedy selection. The 200-ZP-1 pump-and-treat operations were conducted as a pilot-scale treatability test and interim remedial measure treatment system between August 1994 and July 1996 to assess the effectiveness of liquid-phase granular activated carbon carbon tetrachloride removal. The pilot-scale treatability test's removal efficiently was determined to be 99.96% for carbon tetrachloride, chloroform, and trichloroethylene. This report summarizes and evaluates treatment, hydraulic, and hydrochemistry data collected for the 200-ZP-1 interim remedial measure from August through September 1996
Verification of the 2.00 WAPPA-B [Waste Package Performance Assessment-B version] code
International Nuclear Information System (INIS)
Tylock, B.; Jansen, G.; Raines, G.E.
1987-07-01
The old version of the Waste Package Performance Assessment (WAPPA) code has been modified into a new code version, 2.00 WAPPA-B. The input files and the results for two benchmarks at repository conditions are fully documented in the appendixes of the EA reference report. The 2.00 WAPPA-B version of the code is suitable for computation of barrier failure due to uniform corrosion; however, an improved sub-version, 2.01 WAPPA-B, is recommended for general use due to minor errors found in 2.00 WAPPA-B during its verification procedures. The input files and input echoes have been modified to include behavior of both radionuclides and elements, but the 2.00 WAPPA-B version of the WAPPA code is not recommended for computation of radionuclide releases. The 2.00 WAPPA-B version computes only mass balances and the initial presence of radionuclides that can be released. Future code development in the 3.00 WAPPA-C version will include radionuclide release computations. 19 refs., 10 figs., 1 tab
Hoefert, Jaimee E; Bjerke, Glen A; Wang, Dongmei; Yi, Rui
2018-06-04
The microRNA (miRNA)-200 (miR-200) family is highly expressed in epithelial cells and frequently lost in metastatic cancer. Despite intensive studies into their roles in cancer, their targets and functions in normal epithelial tissues remain unclear. Importantly, it remains unclear how the two subfamilies of the five-miRNA family, distinguished by a single nucleotide within the seed region, regulate their targets. By directly ligating miRNAs to their targeted mRNA regions, we identify numerous miR-200 targets involved in the regulation of focal adhesion, actin cytoskeleton, cell cycle, and Hippo/Yap signaling. The two subfamilies bind to largely distinct target sites, but many genes are coordinately regulated by both subfamilies. Using inducible and knockout mouse models, we show that the miR-200 family regulates cell adhesion and orientation in the hair germ, contributing to precise cell fate specification and hair morphogenesis. Our findings demonstrate that combinatorial targeting of many genes is critical for miRNA function and provide new insights into miR-200's functions. © 2018 Hoefert et al.
34 CFR 200.51 - Notice of SEA action.
2010-07-01
... Programs Operated by Local Educational Agencies Lea and School Improvement § 200.51 Notice of SEA action... parents— (A) In an understandable and uniform format, including alternative formats upon request; and (B... information to the parents of each student enrolled in a school served by the LEA— (i) Directly, through such...
Facile synthesis, spectral properties and formation mechanism of sulfur nanorods in PEG-200
International Nuclear Information System (INIS)
Xie, Xin-yuan; Li, Li-yun; Zheng, Pu-sheng; Zheng, Wen-jie; Bai, Yan; Cheng, Tian-feng; Liu, Jie
2012-01-01
Graphical abstract: Homogeneous rod-like structure of sulfur with a typical diameter of about 80 nm and an average aspect ratio of about 6–8 was obtained. The sulfur nanoparticles could self-assemble from spherical particles to nanorods in PEG-200. During the self-assembling process, the absorption band showed a red shift which was due to the production of nanorods. Highlights: ► A novel, facile and greener method to synthesize sulfur nanorods by the solubilizing and templating effect of PEG-200 was reported. ► S 0 nanoparticles could self assemble in PEG-200 and finally form monodisperse and homogeneous rod-like structure with an average diameter of about 80 nm, the length ca. 600 nm. ► The absorption band showed a red shift and the RRS intensity enhanced continuously during the self-assembling process. ► PEG-200 induced the oriented attachment of sulfur nanoparticles by the terminal hydroxyl groups. -- Abstract: The synthesis of nano-sulfur sol by dissolving sublimed sulfur in a green solvent-PEG-200 was studied. Homogeneous rod-like structure of sulfur with a typical diameter of about 80 nm and an average aspect ratio of 6–8 was obtained. The structure, morphology, size, and stability of the products were investigated by transmission electron microscopy (TEM), high resolution transmission electron microscopy (HRTEM), X-ray diffraction (XRD), Fourier transform infrared spectroscopy (FTIR) and dynamic light scattering (DLS) measurements. The spectral properties of the products were investigated by ultraviolet-visible (UV–vis) absorption and resonance Rayleigh scattering spectroscopy (RRS). The results showed that the spherical sulfur nanoparticles could self-assemble into nanorods in PEG-200. During the self-assembling process, the absorption band showed a red shift and the RRS intensity enhanced continuously. There was physical cross-linking between PEG and sulfur nanoparticles. PEG-200 induced the oriented attachment of sulfur nanoparticles by the
The development of a 200 kV monochromated field emission electron source
Energy Technology Data Exchange (ETDEWEB)
Mukai, Masaki, E-mail: mmukai@jeol.co.jp [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Kim, Judy S. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom); Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu [JEOL Ltd., 3-1-2 Musashino, Akishima, Tokyo 196-8558 (Japan); Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I. [University of Oxford, Department of Materials, Parks Road, Oxford, OX1 3PH (United Kingdom)
2014-05-01
We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination.
The development of a 200 kV monochromated field emission electron source
International Nuclear Information System (INIS)
Mukai, Masaki; Kim, Judy S.; Omoto, Kazuya; Sawada, Hidetaka; Kimura, Atsushi; Ikeda, Akihiro; Zhou, Jun; Kaneyama, Toshikatsu; Young, Neil P.; Warner, Jamie H.; Nellist, Peter D.; Kirkland, Angus I.
2014-01-01
We report the development of a monochromator for an intermediate-voltage aberration-corrected electron microscope suitable for operation in both STEM and TEM imaging modes. The monochromator consists of two Wien filters with a variable energy selecting slit located between them and is located prior to the accelerator. The second filter cancels the energy dispersion produced by the first filter and after energy selection forms a round monochromated, achromatic probe at the specimen plane. The ultimate achievable energy resolution has been measured as 36 meV at 200 kV and 26 meV at 80 kV. High-resolution Annular Dark Field STEM images recorded using a monochromated probe resolve Si–Si spacings of 135.8 pm using energy spreads of 218 meV at 200 kV and 217 meV at 80 kV respectively. In TEM mode an improvement in non-linear spatial resolution to 64 pm due to the reduction in the effects of partial temporal coherence has been demonstrated using broad beam illumination with an energy spread of 134 meV at 200 kV. - Highlights: • Monochromator for 200 kV aberration corrected TEM and STEM was developed. • Monochromator produces monochromated and achromatic probe at specimen plane. • Ultimate energy resolution was measured to be 36 meV at 200 kV and 26 meV at 80 kV. • Atomic resolution STEM images were recorded using monochromated electron probe. • Improvements of TEM resolution were confirmed using monochromated illumination
Pilot-scale treatability test plan for the 200-BP-5 operable unit
International Nuclear Information System (INIS)
1994-08-01
This document presents the treatability test plan for pilot-scale pump and treat testing at the 200-BP-5 Operable Unit. This treatability test plan has been prepared in response to an agreement between the U.S. Department of Energy (DOE), the U.S. Environmental Protection Agency (EPA), and the State of Washington Department of Ecology (Ecology), as documented in Hanford Federal Facility Agreement and Consent Order (Tri-Party Agreement, Ecology et al. 1989a) Change Control Form M-13-93-03 (Ecology et al. 1994) and a recent 200 NPL Agreement Change Control Form (Appendix A). The agreement also requires that, following completion of the activities described in this test plan, a 200-BP-5 Operable Unit Interim Remedial Measure (IRM) Proposed Plan be developed for use in preparing an Interim Action Record of Decision (ROD). The IRM Proposed Plan will be supported by the results of this treatability test plan, as well as by other 200-BP-5 Operable Unit activities (e.g., development of a qualitative risk assessment). Once issued, the Interim Action ROD will specify the interim action(s) for groundwater contamination at the 200-BP-5 Operable Unit. The treatability test approach is to conduct a pilot-scale pump and treat test for each of the two contaminant plumes associated with the 200-BP-5 Operable Unit. Primary contaminants of concern are 99 Tc and 60 Co for underwater affected by past discharges to the 216-BY Cribs, and 90 Sr, 239/240 Pu, and Cs for groundwater affected by past discharges to the 216-B-5 Reverse Well. The purpose of the pilot-scale treatability testing presented in this testplan is to provide the data basis for preparing an IRM Proposed Plan. To achieve this objective, treatability testing must: Assess the performance of groundwater pumping with respect to the ability to extract a significant amount of the primary contaminant mass present in the two contaminant plumes
2010-07-01
... assessments to private schools and private school students. (a) Nothing in § 200.1 or § 200.2 requires a... 34 Education 1 2010-07-01 2010-07-01 false Applicability of a State's academic assessments to private schools and private school students. 200.10 Section 200.10 Education Regulations of the Offices of...
Directory of Open Access Journals (Sweden)
Marek Strzala
2015-03-01
Full Text Available The aim of this study was to investigate somatic properties and physiological capacity, and analyze kinematic parameters in the 200 m breaststroke swimming race. Twenty-seven male swimmers participated in the study. They were 15.7±1.98 years old. Their average height was 1.80 ± 0.02 m and lean body mass (LBM was 62.45 ± 8.29 kg. Physiological exercise capacity was measured in two separate 90 sec. all-out tests, one for the arms and second for legs. During the tests total work of arm cranking (TWAR and cycling (TWLG as well as peak of VO2 for arm (VO2peakAR and leg (VO2peakLG were measured. The underwater swimmers body movements were recorded during the all-out swimming 200m breaststroke speed test using an underwater camera installed on a portable trolley. The swimming kinematic parameters and propulsive or non-propulsive movement phases of the arms and legs as well as average speed (V200, surface speed (V200surface and swimming speed in turn zones (V200turns were extracted. V200surface was significantly related to the percentage of leg propulsion and was shown to have large effect on VO2peakLG in the Cohen analysis. V200turns depended significantly on the indicators of physiological performance and body structure: TWAR, VO2peak LG and LBM, LBM, which in turn strongly determined the measured results of TWAR, TWLG, VO2peakAR and VO2peakLG. The V200turns and V200surface were strongly associated with V200, 0.92, p < 0.001 and 0.91, p < 0.001 respectively. In each lap of the 200m swimming there was an increased percentage of propulsion of limb movement observed simultaneously with a reduction in the gliding phase in the breaststroke cycles.
19 CFR 200.735-113 - Miscellaneous statutory provisions.
2010-04-01
... 19 Customs Duties 3 2010-04-01 2010-04-01 false Miscellaneous statutory provisions. 200.735-113... Government Service.” (b) Chapter 11 of Title 18, United States Code, relating to bribery, graft, and... agent of a foreign principal registered under the Foreign Agents Registration Act (18 U.S.C. 219). [31...
Clinical analysis of CT features in 200 neonates with hypoxic-ischemic encephalopathy (HIE)
International Nuclear Information System (INIS)
Zhang Fan
2003-01-01
Objective: To analyze the CT features of HIE in neonates. Methods: CT scanning was performed in 200 neonates with HIE. Results: The CT features in 200 HIE were hypo-attenuated substantia alba, accompanied with intra-cranial hemorrhage, widened cavity of septum pellucidum and cerebral infarction. In total 200 cases, mild HIE was found in 118 cases, moderate HIE was revealed in 67 cases and severe condition was observed in 15 cases. Intra-cranial hemorrhage was noted in 87 cases. Conclusion: The cerebral injury should be diagnosed by the findings of hypo-attenuated substantia alba and intracranial hemorrhage on CT scan, combined with clinical histories and manifestations of intro-uterine neonate asphyxia
33 CFR 166.200 - Shipping safety fairways and anchorage areas, Gulf of Mexico.
2010-07-01
... anchorage areas, Gulf of Mexico. 166.200 Section 166.200 Navigation and Navigable Waters COAST GUARD... the erection of structures therein to provide safe approaches through oil fields in the Gulf of Mexico... for Fairway Anchorages in the Gulf of Mexico. Structures may be placed within an area designated as a...
Barnacle larval destination: piloting possibilities by bacteria and lectin interaction
Digital Repository Service at National Institute of Oceanography (India)
Khandeparker, L.; Anil, A.C.; Raghukumar, S.
considerable hike in metamorphosis was evident in the Glycine max-treated films. 4. Discussion Epifluorescence microscopy coupled with the lectin specificity has been suggested as a new way to probe rapidly and precisely spatial relationships of complex.... 238, 86–95. Costerton, J.W., Lewandowski, Z., DeBeer, D., Caldwell, D., Korber, D., James, G., 1994. Minireview: biofilms, the customized microniche. J. Bacteriol. 176, 2137–2142. Costerton, J.W., Lewandowski, Z., Caldwell, D.E., Korber, D.R., Lappin...
Antimetastatic Effects of a Novel Telomerase Inhibitor, GRN163L, on Human Prostate Cancer
2010-05-01
Human Papilloma Virus Type 18 (HPV-18) DNA. PZ-HPV-7 cells are generally considered as non-tumorigenic in subcutaneous xenograft animal models...6481. [39] H.J. Sommerfeld, A.K. Meeker, M.A. Piatyszek, G.S. Bova, J.W. Shay, D.S. Coffey, Telomerase activity: a prevalent marker of malignant human ...6:192–8. 31. Sommerfeld HJ, Meeker AK, Piatyszek MA, Bova GS, Shay JW, Coffey DS. Telomerase activity: a prevalent marker of malignant human prostate
1993-10-01
Dermatology. REVIEW ARTICLE: 12 REFS. 94. Cambier PA, Kirby WC, Wortham DC, Moore JW. Percutaneous closure of the small (ɚ.5mm) patent ductus arteriosus ...of the small (ɚ.5mm) patent ductus arteriosus using coil embolization. Am J Cardiol 1992 Mar;69(8):815-6. Medicine. Cardiology. 279. Cammarata FA...patency of the ductus arteriosus in newborn lambs. Cardiovasc Intervent Radio! 1991 Sep; 14(5):299-301. Medicine. Carc’iology. 1141. Moore JW, Kirby
Zhao, Baisuo; Hu, Qingping; Guo, Xiaomeng; Liao, Ziya; Sarmiento, Felipe; Mesbah, Noha M; Yan, Yanchun; Li, Jun; Wiegel, Juergen
2018-02-01
An obligately aerobic extremely halophilic alkalithermophilic archaeon, strain JW/NM-HA 15 T , was isolated from the sediments of Wadi An Natrun in Egypt. Phylogenetic analysis based on 16S rRNA and rpoB' gene sequences indicated that it belongs to the family Natrialbaceae of the order Natrialbales. The closest relatives were Natronolimnobius baerhuensis IHC-005 T and Natronolimnobius innermongolicus N-1311 T (95.3 and 94.5 % 16S rRNA gene sequence similarity, respectively). Genome relatedness between strain JW/NM-HA 15 T and its neighbours was evaluated using average nucleotide identity, digital DNA-DNA hybridization and average amino acid identity with the values of 75.7-85.0, 18.1-20.0, and 70.2-71.0%, respectively. Cells were obligately aerobic, rod-shaped, non-motile, Gram-stain-negative and chemo-organotrophic. The strain grew in the presence of 2.57 M to saturating Na + (optimum 3.25-4.60 M Na + ), at pH 55 °C 7.5-10.5 (optimum pH 55 °C 9.0-9.5), and at 30-56 °C (optimum 52 °C). The major polar lipids consisted of phosphatidylglycerol, methylated phosphatidylglycerolphosphate and two phospholipids. The complete genome size of strain JW/NM-HA 15 T is approximately 3.93 Mb, with a DNA G+C content of 64.1 mol%. On the basis of phylogenetic features, genomic relatedness, phenotypic and chemotaxonomic data, strain JW/NM-HA 15 T was thus considered to represent a novel species within the genus Natronolimnobius, for which the name Natronolimnobius aegyptiacus sp. nov. is proposed. The type strain is JW/NM-HA 15 T (=ATCC BAA-2088 T =DSM 23470 T ).
Liu, Chung-Ming; Chen, Jui-Wen; Tsai, Jen-Hui; Lin, Wei-Shian; Yen, M-T; Chen, Ting-Hao
2012-01-01
This study determines whether environment-protecting pervious pavement can dilute pollutants immediately after emissions from vehicle. The turbulence-driven dry-deposition process is too slow to be considered in this aspect. The pavement used is the JW pavement (according to its inventors name), a high-load-bearing water-permeable pavement with patents in over 100 countries, which has already been used for more than 8 years in Taiwan and is well suited to replacing conventional road pavement, making the potential implementation of the study results feasible. The design of this study included two sets of experiments. Variation of the air pollutant concentrations within a fenced area over the JW pavement with one vehicle discharging emissions into was monitored and compared with results over a non-JW pavement. The ambient wind speed was low during the first experiment, and the results obtained were highly credible. It was found that the JW pavement diluted vehicle pollutant emissions near the ground surface by 40%-87% within 5 min of emission; whereas the data at 2 m height suggested that about 58%-97% of pollutants were trapped underneath the pavement 20 min after emission. Those quantitative estimations may be off by +/- 10%, if errors in emissions and measurements were considered. SO2 and CO2 underwent the most significant reduction. Very likely, pollutants were forced to move underneath due to the special design of the pavement. During the second experiment, ambient wind speeds were high and the results obtained had less credibility, but they did not disprove the pollutant dilution capacity of the JW pavement. In order to track the fate of pollutants, parts of the pavement were removed to reveal a micro version of wetland underneath, which could possibly hold the responsibility of absorbing and decomposing pollutants to forms harmless to the environment and human health.
Continuous pulse oximetry in the general surgical ward: Nellcor N-200 versus Nellcor N-3000
DEFF Research Database (Denmark)
Christensen, M; Lie, C; Rosenberg, J
1999-01-01
of drop-outs (loss of signal) was 13 (range 1-46) with the N-200 compared with nine (2-41) with the N-3000 (p = 0.06). The N-200 registered saturation values of 85% or below for 23% of the observation time compared with 6% of the observation time with the N-3000 pulse oximeter (p ... Symphony N-3000 with the Nellcor N-200 pulse oximeter, when monitoring patients in the general surgical ward. Twenty-two patients were monitored during unrestricted ward activities for a total of 275 h with a N-3000 and a N-200 pulse oximeter simultaneously. Data were analysed for lack of concordance...... between the two pulse oximeters with respect to frequency of registered hypoxaemic episodes and thus the amount of time spent in the alarm state. The median number of desaturation episodes with the N-200 was 18 (range 0-511) compared with four (range 0-476) with the N-3000 (p
200 Area Deactivation Project Facilities Authorization Envelope Document
International Nuclear Information System (INIS)
DODD, E.N.
2000-01-01
Project facilities as required by HNF-PRO-2701, Authorization Envelope and Authorization Agreement. The Authorization Agreements (AA's) do not identify the specific set of environmental safety and health requirements that are applicable to the facility. Therefore, the facility Authorization Envelopes are defined here to identify the applicable requirements. This document identifies the authorization envelopes for the 200 Area Deactivation
200 MeV RF linac for synchrotron injection
International Nuclear Information System (INIS)
Whitham, K.; Anamkath, H.; Lyons, S.; Manca, J.; Miller, R.; Treas, P.; Zante, T.; Miller, R.
1992-01-01
Construction has been completed on an electron linear accelerator for the Brookhaven National Laboratory. This accelerator will be used for the injection of a 200 MeV electron beam into a synchrotron for lithography experiments. This paper describes the conceptual design of the linac, its e-gun pulser, and its control and timing systems. 3 figs., ref
20 CFR 10.200 - What is continuation of pay?
2010-04-01
... 10.200 Employees' Benefits OFFICE OF WORKERS' COMPENSATION PROGRAMS, DEPARTMENT OF LABOR FEDERAL EMPLOYEES' COMPENSATION ACT CLAIMS FOR COMPENSATION UNDER THE FEDERAL EMPLOYEES' COMPENSATION ACT, AS... for members of these excluded groups, which include but are not limited to: persons rendering personal...
17 CFR 200.553 - Draft, final and supplemental impact statements.
2010-04-01
... COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Regulations Pertaining to the Protection of the Environment § 200.553 Draft, final and supplemental impact statements. If the Commission...
2010-04-01
... procedures for HUD building products certification programs. 200.935 Section 200.935 Housing and Urban... for HUD building products certification programs. (a) General. This section establishes administrator qualifications and procedures for the HUD Building Products Certification Programs under section 521 of the...
DEFF Research Database (Denmark)
Pankratova, Stanislava; Björnsdóttir, Halla; Christensen, Claus
2016-01-01
The CD200 ligand is expressed by a variety of cell types, including vascular endothelia, kidney glomeruli, some subsets of T and B cells, and neurons in the brain and periphery. In contrast, the receptor of CD200, CD200R, has a limited expression pattern and is mainly expressed by cells of myeloi...
Lu, Yifei; Yan, Hongxiang; Deng, Jiezhong; Huang, Zhigang; Jin, Xurui; Yu, Yanlan; Hu, Qiwen; Hu, Fuquan; Wang, Jing
2017-09-18
Lactococcus lactis is a food grade probiotics and widely used to express heterologous proteins. Generally, target genes are knocked into the L. lactis genome through double-crossover recombination to express heterologous proteins stably. However, creating marker-less heterologous genes knocked-in clones is laborious. In this study, an efficient heterologous gene knock-in reporter system was developed in L. lactis NZ9000. Our knock-in reporter system consists of a temperature-sensitive plasmid pJW and a recombinant L. lactis strain named NZB. The pJW contains homologous arms, and was constructed to knock-in heterologous genes at a fixed locus of NZ9000 genome. lacZ (β-galactosidase) gene was knocked into the chromosome of NZ9000 as a counter-selective marker through the plasmid pJW to generate NZB. The engineered NZB strain formed blue colonies on X-Gal plate. The desired double-crossover mutants formed white colonies distinctive from the predominantly blue colonies (parental and plasmid-integrated clones) when the embedded lacZ was replaced with the target heterologous genes carried by pJW in NZB. By using the system, the heterologous gene knocked-in clones are screened by colony phenotype change rather than by checking colonies individually. Our new knock-in reporter system provides an efficient method to create heterologous genes knocked-in clones.
Summary of radioactive solid waste received in the 200 Areas during calendar year 1995
International Nuclear Information System (INIS)
Hladek, K.L.
1996-01-01
Westinghouse Hanford Company manages and operates the Hanford Site 200 Area radioactive solid waste storage and disposal facilities for the US Department of Energy, Richland Operations Office. These facilities include radioactive solid waste disposal sites and radioactive solid waste storage areas. This document summarizes the amount of radioactive materials that have been buried and stored in the 200 Area radioactive solid waste storage and disposal facilities since startup in 1944 through calendar year 1995. This report does not include backlog waste, solid radioactive wastes in storage or disposed of in other areas, or facilities such as the underground tank farms. Unless packaged within the scope of WHC-EP-0063, Hanford Site Solid Waste Acceptance Criteria, liquid waste data are not included in this document. This annual report provides a summary of the radioactive solid waste received in the both the 200-East and 200-West Areas during the calendar year 1995
Summary of radioactive solid waste received in the 200 Areas during calendar year 1995
Energy Technology Data Exchange (ETDEWEB)
Hladek, K.L.
1996-06-06
Westinghouse Hanford Company manages and operates the Hanford Site 200 Area radioactive solid waste storage and disposal facilities for the US Department of Energy, Richland Operations Office. These facilities include radioactive solid waste disposal sites and radioactive solid waste storage areas. This document summarizes the amount of radioactive materials that have been buried and stored in the 200 Area radioactive solid waste storage and disposal facilities since startup in 1944 through calendar year 1995. This report does not include backlog waste, solid radioactive wastes in storage or disposed of in other areas, or facilities such as the underground tank farms. Unless packaged within the scope of WHC-EP-0063, Hanford Site Solid Waste Acceptance Criteria, liquid waste data are not included in this document. This annual report provides a summary of the radioactive solid waste received in the both the 200-East and 200-West Areas during the calendar year 1995.
Wilczynski, Milosz; Danielska, Justyna; Domanska-Senderowska, Daria; Dzieniecka, Monika; Szymanska, Bozena; Malinowski, Andrzej
2018-05-01
MicroRNAs (miRNAs) are regulators of gene expression, which play an important role in many critical cellular processes including apoptosis, proliferation and cell differentiation. Aberrant miRNA expression has been reported in a variety of human malignancies. Therefore, miRNAs may be potentially used as cancer biomarkers. miRNA-200c, which is a member of the miRNA-200 family, might play an essential role in tumor progression. The purpose of this study was to evaluate the prognostic and clinical significance of miRNA-200c in women with endometrioid endometrial cancer. Total RNA extraction from 90 archival formalin-fixed paraffin-embedded tissue samples of endometri-oid endometrial cancer and 10 normal endometrium samples was performed. After cDNA synthesis, real-time polymerase chain reaction was conducted and relative expression of miRNA-200c was assessed. Then, miRNA-200c expression levels were evaluated with regard to clinicopathological characteristics. The expression levels of miRNA-200c were significantly increased in endometrioid endometrial cancer samples. Expression of miRNA-200c maintained at significantly higher levels in the early stage endometrioid endometrial cancer compared with more advanced stages. In the Kaplan-Meier analysis, lower levels of miRNA-200c expression were associated with inferior survival. Expression levels of miRNA-200c might be associated with clinicopathological factors and survival in endometrioid endometrial cancer. © 2018 Nordic Federation of Societies of Obstetrics and Gynecology.
CD200R1 supports HSV-1 viral replication and licenses pro-inflammatory signaling functions of TLR2.
Directory of Open Access Journals (Sweden)
Roy J Soberman
Full Text Available The CD200R1:CD200 axis is traditionally considered to limit tissue inflammation by down-regulating pro-inflammatory signaling in myeloid cells bearing the receptor. We generated CD200R1(-/- mice and employed them to explore both the role of CD200R1 in regulating macrophage signaling via TLR2 as well as the host response to an in vivo, TLR2-dependent model, herpes simplex virus 1 (HSV-1 infection. CD200R1(-/- peritoneal macrophages demonstrated a 70-75% decrease in the generation of IL-6 and CCL5 (Rantes in response to the TLR2 agonist Pam(2CSK(4 and to HSV-1. CD200R1(-/- macrophages could neither up-regulate the expression of TLR2, nor assemble a functional inflammasome in response to HSV-1. CD200R1(-/- mice were protected from HSV-1 infection and exhibited dysfunctional TLR2 signaling. Finally, both CD200R1(-/- mice and CD200R1(-/- fibroblasts and macrophages showed a markedly reduced ability to support HSV-1 replication. In summary, our data demonstrate an unanticipated and novel requirement for CD200R1 in "licensing" pro-inflammatory functions of TLR2 and in limiting viral replication that are supported by ex vivo and in vivo evidence.
28 CFR 44.200 - Unfair immigration-related employment practices.
2010-07-01
... 28 Judicial Administration 2 2010-07-01 2010-07-01 false Unfair immigration-related employment... IMMIGRATION-RELATED EMPLOYMENT PRACTICES Prohibited Practices § 44.200 Unfair immigration-related employment practices. (a)(1) General. It is unfair immigration-related employment practice for a person or other entity...
19 CFR 200.735-105 - Gifts, entertainment, and favors.
2010-04-01
... obvious family or personal relationships (such as those between parents, children, or spouse of the employee and the employee) when the circumstances make it clear that it is those relationships rather than... Section 200.735-105 Customs Duties UNITED STATES INTERNATIONAL TRADE COMMISSION EMPLOYEE RESPONSIBILITIES...
45 CFR 2541.200 - Standards for financial management systems.
2010-10-01
... 45 Public Welfare 4 2010-10-01 2010-10-01 false Standards for financial management systems. 2541... STATE AND LOCAL GOVERNMENTS Post-Award Requirements § 2541.200 Standards for financial management... violation of the restrictions and prohibitions of applicable statutes. (b) The financial management systems...
Pion interferometry of O+Au at 200 AGeV
International Nuclear Information System (INIS)
Padula, S.S.; Gyulassy, M.
1989-01-01
We analyse NA35 data on O+Au→π - π - +X at 200 A GeV including resonance decays and non-ideal dynamical and geometrical effects and find that a τ f =R perpendicular tof =4 fm chaotic source is consistent with the data. (orig.)
Physics capabilities of the second stage Baikal detector NT-200
International Nuclear Information System (INIS)
Spiering, C.; Heller, R.; Heukenkamp, H.; Krabi, J.; Mikolajski, T.; Thon, T.; Wischnewski, R.; Alatin, S.D.; Fialkovsky, S.V.; Kulepov, V.F.; Milenin, M.B.; Belolaptikov, I.A.; Bezrukov, L.B.; Borisovets, B.A.; Bugaev, E.V.; Djilkibaev, Zh.A.M.; Domogatsky, G.V.; Donskich, L.A.; Doroshenko, A.A.; Galperin, M.D.; Gushtan, M.N.; Klabukov, A.M.; Klimushin, S.I.; Lanin, O.J.; Lubsandorzhiev, B.K.; Ogievietzky, N.V.; Panfilov, A.I.; Sokalsky, I.A.; Trofimenko, I.I.; Budnev, N.M.; Chensky, A.G.; Dobrynin, V.I.; Gress, O.A.; Koshechkin, A.P.; Lanin, J.B.; Litunenko, G.A.; Lopin, A.L.; Naumov, V.A.; Nemchenko, M.I.; Parfenov, Yu.V.; Pavlov, A.A.; Pokalev, O.P.; Primin, V.A.; Sumanov, A.A.; Tarashansky, V.A.; Zurbanov, V.L.; Dudkin, G.N.; Egorov, V.Yu.; Lukanin, A.A.; Ovcharov, A.M.; Padalko, V.M.; Padusenko, A.H.; Golikov, A.V.; Kabikov, V.B.; Kuzmichov, L.A.; Osipova, E.A.; Zaslavskaya, E.S.; Jenek, L.; Kiss, D.; Tanko, L.; Kusner, Yu.S.; Poleschuk, V.A.; Sherstyankin, P.P.; Levin, A.A.; Nikiforov, A.I.; Rosanov, M.I.
1991-12-01
We describe the lake Baikal deep underwater detector 'NT-200' and discuss its physics capabilities to investigate problems in the field of neutrino astrophysics, cosmic ray physics and particle physics. (orig.)
17 CFR 200.60 - Qualification to participate in particular matters.
2010-04-01
... EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Canons of Ethics § 200... respect to any matter wherein he or any relatives or former business associates or clients are involved...
The VASIMR[registered trademark] VF-200-1 ISS Experiment as a Laboratory for Astrophysics
Glover Tim W.; Squire, Jared P.; Longmier, Benjamin; Cassady, Leonard; Ilin, Andrew; Carter, Mark; Olsen, Chris S.; McCaskill, Greg; Diaz, Franklin Chang; Girimaji, Sharath;
2010-01-01
The VASIMR[R] Flight Experiment (VF-200-1) will be tested in space aboard the International Space Station (ISS) in about four years. It will consist of two 100 kW parallel plasma engines with opposite magnetic dipoles, resulting in a near zero-torque magnetic system. Electrical energy will come from ISS at low power level, be stored in batteries and used to fire the engine at 200 kW. The VF-200-1 project will provide a unique opportunity on the ISS National Laboratory for astrophysicists and space physicists to study the dynamic evolution of an expanding and reconnecting plasma loop. Here, we review the status of the project and discuss our current plans for computational modeling and in situ observation of a dynamic plasma loop on an experimental platform in low-Earth orbit. The VF-200-1 project is still in the early stages of development and we welcome new collaborators.
miR-200c and GATA binding protein 4 regulate human embryonic stem cell renewal and differentiation
Directory of Open Access Journals (Sweden)
Hsiao-Ning Huang
2014-03-01
Full Text Available Human embryonic stem cells (hESCs are functionally unique for their self-renewal ability and pluripotency, but the molecular mechanisms giving rise to these properties are not fully understood. hESCs can differentiate into embryoid bodies (EBs containing ectoderm, mesoderm, and endoderm. In the miR-200 family, miR-200c was especially enriched in undifferentiated hESCs and significantly downregulated in EBs. The knockdown of the miR-200c in hESCs downregulated Nanog expression, upregulated GATA binding protein 4 (GATA4 expression, and induced hESC apoptosis. The knockdown of GATA4 rescued hESC apoptosis induced by downregulation of miR-200c. miR-200c directly targeted the 3′-untranslated region of GATA4. Interestingly, the downregulation of GATA4 significantly inhibited EB formation in hESCs. Overexpression of miR-200c inhibited EB formation and repressed the expression of ectoderm, endoderm, and mesoderm markers, which could partially be rescued by ectopic expression of GATA4. Fibroblast growth factor (FGF and activin A/nodal can sustain hESC renewal in the absence of feeder layer. Inhibition of transforming growth factor-β (TGF-β/activin A/nodal signaling by SB431542 treatment downregulated the expression of miR-200c. Overexpression of miR-200c partially rescued the expression of Nanog/phospho-Smad2 that was downregulated by SB431542 treatment. Our observations have uncovered novel functions of miR-200c and GATA4 in regulating hESC renewal and differentiation.
NSRL 200 MeV linac beam energy stabilization system
International Nuclear Information System (INIS)
Huang Guirong; Pei Yuanji; Dong Sai
2001-01-01
By using the computer image processing technology and RF phase auto-shifting system, the ESS (Energy Stabilization System) was applied to 200 MeV Linac. the ESS adjusts beam energy automatically in a range of +-4 MeV. After adjustment beam energy stability is improved to +-6%
40 CFR 52.200 - Original identification of plan section.
2010-07-01
... 40 Protection of Environment 3 2010-07-01 2010-07-01 false Original identification of plan section... PROGRAMS (CONTINUED) APPROVAL AND PROMULGATION OF IMPLEMENTATION PLANS Arkansas § 52.200 Original identification of plan section. (a) This section identifies the original “Arkansas Plan for Implementation for...
OPTIMASI LAJU ALIR MASSA DALAM PURIFIKASI PENDINGIN RGTT200K UNTUK PROSES KONVERSI KARBONMONOKSIDA
Directory of Open Access Journals (Sweden)
Sumijanto Sumijanto
2016-03-01
Full Text Available ABSTRAK OPTIMASI LAJU ALIR MASSA DALAM PURIFIKASI PENDINGIN RGTT200K UNTUK PROSES KONVERSI KARBONMONOKSIDA. Karbonmonoksida adalah spesi yang sulit dipisahkan dari helium pendingin reaktor karena mempunyai ukuran molekul relatif kecil sehingga diperlukan proses konversi menjadi karbondioksida. Laju konversi karbonmonoksida dalam sistem purifikasi dipengaruhi oleh beberapa parameter diantaranya konsentrasi, temperatur dan laju alir massa. Dalam penelitian ini dilakukan optimasi laju alir massa dalam purifikasi pendingin RGTT200K untuk proses konversi karbonmonoksida. Optimasi dilakukan melalui simulasi proses konversi karbonmonoksida menggunakan perangkat lunak Super Pro Designer. Laju pengurangan spesi reaktan, laju pertumbuhan spesi antara dan spesi produk dalam kesetimbangan reaksi konversi dianalisis untuk memperoleh optimasi laju alir massa purifikasi terhadap proses konversi karbonmonoksida. Tujuan penelitian ini adalah menyediakan data laju alir massa purifikasi untuk pembuatan dasar desain sistem purifikasi helium pendingin RGTT200K. Hasil analisis menunjukkan bahwa pada laju alir massa 0,6 kg/detik proses konversi belum optimal, pada laju alir massa 1,2 kg/detik mencapai optimal dan pada laju alir 3,6 kg/detik s/d 12,0 kg/detik tidak efektif. Untuk memdukung dasar desain sistem purifikasi helium pendingin RGTT200K maka laju alir massa purifikasi untuk proses konversi karbonmonoksida digunakan laju alir massa 1,2 kg/detik. Kata kunci: Karbonmonoksida, konversi, purifikasi, laju alir massa, RGTT200K. ABSTRACT OPTIMIZATION OF MASS FLOW RATE IN RGTT200K COOLANT PURIFICATION FOR CARBONMONOXIDE CONVERSION PROCESS. Carbonmonoxide is a species that is difficult to be separated from the reactor coolant helium because it has a relatively small molecular size. So it needs a process of conversion from carbonmonoxide to carbondioxide. The rate of conversion of carbonmonoxide in the purification system is influenced by several parameters
Annex D-200 Area Interim Storage Area Final Safety Analysis Report [FSAR] [Section 1 & 2
Energy Technology Data Exchange (ETDEWEB)
CARRELL, R D
2002-07-16
The 200 Area Interim Storage Area (200 Area ISA) at the Hanford Site provides for the interim storage of non-defense reactor spent nuclear fuel (SNF) housed in aboveground dry cask storage systems. The 200 Area ISA is a relatively simple facility consisting of a boundary fence with gates, perimeter lighting, and concrete and gravel pads on which to place the dry storage casks. The fence supports safeguards and security and establishes a radiation protection buffer zone. The 200 Area ISA is nominally 200,000 ft{sup 2} and is located west of the Canister Storage Building (CSB). Interim storage at the 200 Area ISA is intended for a period of up to 40 years until the materials are shipped off-site to a disposal facility. This Final Safety Analysis Report (FSAR) does not address removal from storage or shipment from the 200 Area ISA. Three different SNF types contained in three different dry cask storage systems are to be stored at the 200 Area ISA, as follows: (1) Fast Flux Test Facility Fuel--Fifty-three interim storage casks (ISC), each holding a core component container (CCC), will be used to store the Fast Flux Test Facility (FFTF) SNF currently in the 400 Area. (2) Neutron Radiography Facility (NRF) TRIGA'--One Rad-Vault' container will store two DOT-6M3 containers and six NRF TRIGA casks currently stored in the 400 Area. (3) Commercial Light Water Reactor Fuel--Six International Standards Organization (ISO) containers, each holding a NAC-I cask4 with an inner commercial light water reactor (LWR) canister, will be used for commercial LWR SNF from the 300 Area. An aboveground dry cask storage location is necessary for the spent fuel because the current storage facilities are being shut down and deactivated. The spent fuel is being transferred to interim storage because there is no permanent repository storage currently available.
36 CFR 200.6 - Information available; inspection, copying, and charges.
2010-07-01
... public upon request, such as recreational brochures, pamphlets, maps, and technical guides as well as... Directive System (§ 200.4). For example, some pamphlets and small segments of the Forest Service Manual and...
Yang, Junzheng; Zhou, Yilan; Ng, Shu-Kay; Huang, Kuan-Chun; Ni, Xiaoyan; Choi, Pui-Wah; Hasselblatt, Kathleen; Muto, Michael G; Welch, William R; Berkowitz, Ross S; Ng, Shu-Wing
2017-06-17
Ovarian cancer is the leading cause of death among gynecologic diseases in Western countries. We have previously identified a miR-200-E-cadherin axis that plays an important role in ovarian inclusion cyst formation and tumor invasion. The purpose of this study was to determine if the miR-200 pathway is involved in the early stages of ovarian cancer pathogenesis by studying the expression levels of the pathway components in a panel of clinical ovarian tissues, and fallopian tube tissues harboring serous tubal intraepithelial carcinomas (STICs), a suggested precursor lesion for high-grade serous tumors. RNA prepared from ovarian and fallopian tube epithelial and stromal fibroblasts was subjected to quantitative real-time reverse-transcription polymerase chain reaction (qRT-PCR) to determine the expression of miR-200 families, target and effector genes and analyzed for clinical association. The effects of exogenous miR-200 on marker expression in normal cells were determined by qRT-PCR and fluorescence imaging after transfection of miR-200 precursors. Ovarian epithelial tumor cells showed concurrent up-regulation of miR-200, down-regulation of the four target genes (ZEB1, ZEB2, TGFβ1 and TGFβ2), and up-regulation of effector genes that were negatively regulated by the target genes. STIC tumor cells showed a similar trend of expression patterns, although the effects did not reach significance because of small sample sizes. Transfection of synthetic miR-200 precursors into normal ovarian surface epithelial (OSE) and fallopian tube epithelial (FTE) cells confirmed reduced expression of the target genes and elevated levels of the effector genes CDH1, CRB3 and EpCAM in both normal OSE and FTE cells. However, only FTE cells had a specific induction of CA125 after miR-200 precursor transfection. The activation of the miR-200 pathway may be an early event that renders the OSE and FTE cells more susceptible to oncogenic mutations and histologic differentiation. As high
Manitoba Dept. of Education and Training, Winnipeg. Curriculum Services Branch.
This report describes the June 1992 assessment of the Biologie 200 curriculum in schools in Manitoba, Canada. It contains a description and analysis of the test results and the teacher survey. The report also includes recommendations on ways to improve the Biologie 200 curriculum and how it is taught in the French Immersion program and…
TMBP200, a XMAP215 homologue of tobacco BY-2 cells, has an essential role in plant mitosis.
Yasuhara, Hiroki; Oe, Yuki
2011-07-01
TMBP200 from tobacco BY-2 cells is a member of the highly conserved family of microtubule-associated proteins that includes Xenopus XMAP215, human TOGp, and Arabidopsis MOR1/GEM1. XMAP215 homologues have an essential role in spindle assembly and function in animals and yeast, but their role in plant mitosis is not fully clarified. Here, we show by immunoblot analysis that TMBP200 levels in synchronously cultured BY-2 cells increased when the cells entered mitosis, thus indicating that TMBP200 plays an important role in mitosis in tobacco. To investigate the role of TMBP200 in mitosis, we employed inducible RNA interference to silence TMBP200 expression in BY-2 cells. The resulting depletion of TMBP200 caused severe defects in bipolar spindle formation and resulted in the appearance of multinucleated cells with variable-sized nuclei. This finding indicates that TMBP200 has an essential role in bipolar spindle formation and function.
Directory of Open Access Journals (Sweden)
Tu Zhijian
2008-08-01
Full Text Available Abstract Background SINEs (Short INterspersed Elements are homoplasy-free and co-dominant genetic markers which are considered to represent useful tools for population genetic studies, and could help clarifying the speciation processes ongoing within the major malaria vector in Africa, Anopheles gambiae s.s. Here, we report the results of the analysis of the insertion polymorphism of a nearly 200 bp-long SINE (SINE200 within genome areas of high differentiation (i.e. "speciation islands" of M and S A. gambiae molecular forms. Methods A SINE-PCR approach was carried out on thirteen SINE200 insertions in M and S females collected along the whole range of distribution of A. gambiae s.s. in sub-Saharan Africa. Ten specimens each for Anopheles arabiensis, Anopheles melas, Anopheles quadriannulatus A and 15 M/S hybrids from laboratory crosses were also analysed. Results Eight loci were successfully amplified and were found to be specific for A. gambiae s.s.: 5 on 2L chromosome and one on X chromosome resulted monomorphic, while two loci positioned respectively on 2R (i.e. S200 2R12D and X (i.e. S200 X6.1 chromosomes were found to be polymorphic. S200 2R12D was homozygote for the insertion in most S-form samples, while intermediate levels of polymorphism were shown in M-form, resulting in an overall high degree of genetic differentiation between molecular forms (Fst = 0.46 p S200 X6.1 was found to be fixed in all M- and absent in all S-specimens. This led to develop a novel easy-to-use PCR approach to straightforwardly identify A. gambiae molecular forms. This novel approach allows to overcome the constraints associated with markers on the rDNA region commonly used for M and S identification. In fact, it is based on a single copy and irreversible SINE200 insertion and, thus, is not subjected to peculiar evolutionary patterns affecting rDNA markers, e.g. incomplete homogenization of the arrays through concerted evolution and/or mixtures of M and S IGS
24 CFR 200.625 - Affirmative fair housing marketing plan.
2010-04-01
... Regulations § 200.625 Affirmative fair housing marketing plan. Each applicant for participation in FHA housing... information indicating his affirmative fair housing marketing plan to comply with the requirements set forth... 24 Housing and Urban Development 2 2010-04-01 2010-04-01 false Affirmative fair housing marketing...
Thin films of In2O3 by atomic layer deposition using In(acac)3
International Nuclear Information System (INIS)
Nilsen, O.; Balasundaraprabhu, R.; Monakhov, E.V.; Muthukumarasamy, N.; Fjellvag, H.; Svensson, B.G.
2009-01-01
Thin films of indium oxide have been deposited using the atomic layer deposition (ALD) technique using In(acac) 3 (acac = acetylacetonate, pentane-2,4-dione) and either H 2 O or O 3 as precursors. Successful growth using In(acac) 3 is contradictory to what has been reported previously in the literature [J.W. Elam, A.B.F. Martinson, M.J. Pellin, J.T. Hupp, Chem. Mater. 18 (2006) 3571.]. Investigation of the dependence of temperature on the deposition shows windows where the growth rates are relatively unaffected by temperature in the ranges 165-200 o C for In(acac) 3 and H 2 O, 165-225 o C for In(acac) 3 and O 3 . The growth rates obtained are of the order 20 pm/cycle for In(acac) 3 and H 2 O, 12 pm/cycle for In(acac) 3 .
Survey of 200 cases of the abdominal aortography
International Nuclear Information System (INIS)
Kim, Ki Jeung; Choi, Doo Suk; Hah, Hae Koo
1972-01-01
From 1962 to 1970 about 200 abdominal aortographies were performed in Department of Radiology of National Medical Center, Seoul, Korea, with percutaneous retrograde seldinger catheterization technique. The 200 cases of the abdominal aortography were analyzed as followings. 1) The sex ratio of all patients was 105 (52.5%) males to 95 (47.5%) females. And high incidence was noted in middle age group. (46 patients were from 30 years to 40 years of age) 2) Radiological findings were grouped as 62 (31%) vascular lesion, 113 (56.5%) visceral or other expanding lesions and 29 (14.5%) angiographically nonspecific findings. Total is over 200 due to double lesions in 4 patients. 3) The 62 vascular lesions were composed of 40 aortitis, 28 renal hypertension etc. a) The 40 aortitis was divided into 25 artherosclerotic and 15 nonspecific. The 15 nonspecific aortitis revealed segmental narrowing (2-4 cm) with collaterals. b) In 28 renal hypertension, 17 cases were combined with aortitis, but not in 11 cases (Pure renal hypertension), and 19 cases were unilateral. 4) The highest incidence in 113 (56.5%) visceral or other expanding lesions, was renal lesions (88 cases), and other lesions, such as 12 retroperitoneal masses, 9 liver and pancreatic masses were also noted. The 88 renal lesions were composed of 37 renal tbc, 17 hydronephrosis (excluding tbc hydro), Tumors, 10 cyst etc. a) The most significant findings of renal tuberculosis in renal arteriogrpahy was rarefaction of contrast staining in involved area which was noted in 32 cases (87%) out of 37 renal Tuberculosis. b) All 12 hypernephroma, 1 wilm's tumor, metastaic tumor from fibromyomata uteri revealed pathological vessels and tumor stainings, however these findings were not noted in 2 ureteral carcinoma involving renal pelvis. 5) No permanent complications arose after abdominal aortography. (Percutaneous retrograde seldinger catheterization technique) 6) Abdominal aortography and selective visceral injections gave more
Survey of 200 cases of the abdominal aortography
Energy Technology Data Exchange (ETDEWEB)
Kim, Ki Jeung; Choi, Doo Suk; Hah, Hae Koo [National Medical Center, Seoul (Korea, Republic of)
1972-12-15
From 1962 to 1970 about 200 abdominal aortographies were performed in Department of Radiology of National Medical Center, Seoul, Korea, with percutaneous retrograde seldinger catheterization technique. The 200 cases of the abdominal aortography were analyzed as followings. 1) The sex ratio of all patients was 105 (52.5%) males to 95 (47.5%) females. And high incidence was noted in middle age group. (46 patients were from 30 years to 40 years of age) 2) Radiological findings were grouped as 62 (31%) vascular lesion, 113 (56.5%) visceral or other expanding lesions and 29 (14.5%) angiographically nonspecific findings. Total is over 200 due to double lesions in 4 patients. 3) The 62 vascular lesions were composed of 40 aortitis, 28 renal hypertension etc. a) The 40 aortitis was divided into 25 artherosclerotic and 15 nonspecific. The 15 nonspecific aortitis revealed segmental narrowing (2-4 cm) with collaterals. b) In 28 renal hypertension, 17 cases were combined with aortitis, but not in 11 cases (Pure renal hypertension), and 19 cases were unilateral. 4) The highest incidence in 113 (56.5%) visceral or other expanding lesions, was renal lesions (88 cases), and other lesions, such as 12 retroperitoneal masses, 9 liver and pancreatic masses were also noted. The 88 renal lesions were composed of 37 renal tbc, 17 hydronephrosis (excluding tbc hydro), Tumors, 10 cyst etc. a) The most significant findings of renal tuberculosis in renal arteriogrpahy was rarefaction of contrast staining in involved area which was noted in 32 cases (87%) out of 37 renal Tuberculosis. b) All 12 hypernephroma, 1 wilm's tumor, metastaic tumor from fibromyomata uteri revealed pathological vessels and tumor stainings, however these findings were not noted in 2 ureteral carcinoma involving renal pelvis. 5) No permanent complications arose after abdominal aortography. (Percutaneous retrograde seldinger catheterization technique) 6) Abdominal aortography and selective visceral injections gave more
17 CFR 200.19c - Director of the Office of Compliance Inspections and Examinations.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Director of the Office of Compliance Inspections and Examinations. 200.19c Section 200.19c Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General Organizatio...
Prospects for the Higgs boson in e+e- collisions at LEP 200
International Nuclear Information System (INIS)
Gross, E.; Lellouch, D.; Read, A.L.
1998-05-01
The authors evaluate the combined sensitivity of the four LEP collaborations to exclude or discover the Standard Model Higgs boson with the LEP collider at centre-of-mass energies of 189-200 GeV. It is argued that neighter Standard Model nor the Supersymmetric Higgs search benefits from an upgrade of LEP to its peak centre-of-mass energy (e.g. upgrade 198 GeV to 200 GeV) if this degrades the integrated luminosity by a factor of two or more. 7 refs., 11 figs
Euroopa Liit võtab Eestilt statistikaga 200 miljonit / Aivar Reinap
Reinap, Aivar, 1968-
2004-01-01
EL-i arvutusnõuete tõttu kasvas Eesti 2003. aasta SKP ligi 10 miljardi krooni võrra, mistõttu peab Eesti maksma igal aastal 200 miljoni võrra senisest rohkem liikmemaksu. Lisa: Pool miljardit lisaks
MiR-200a is involved in rat epididymal development by targeting β-catenin mRNA
Institute of Scientific and Technical Information of China (English)
Xiaojiang Wu; Botao Zhao; Wei Li; Yue Chen; Ruqiang Liang; Lin Li; Youxin Jin; Kangcheng Ruan
2012-01-01
The expression of 350 microRNAs (miRNAs) in epididymis of rat from postnatal development to adult (from postnatal days 7-70) was profiled with home-made miRNA microarray.Among them,48 miRNAs changed significantly, in which the expression of miR-200a increased obviously with time,in a good agreement with that obtained from northern blot analysis.The real-time quantitative-polymerase chain reaction result indicated that temporal expression of rat β-catenin was exactly inversed to that of miR-200a during rat epididymal development,implying that miR-200a might also target β-catenin mRNA in rat epididymis as reported by Saydam et al.in humans.The bioinformatic analysis indicated that 3' untranslated region of rat β-catenin mRNA did contain a putative binding site for miR-200a.Meanwhile,it was found that the sequence of this binding site was different from that of human β-catenin mRNA with a deletion of two adjacent nucleotides (U and C).But the results of luciferase targeting assay in HEK 293T cells and the overexpression of miR-200a in rat NRK cells demonstrated that miR-200a did target rat β-catenin mRNA and cause the suppression of its expression.All these results show that miR-200a should be involved in rat epididymal development by targeting β-catenin mRNA of rat and suppressing its expression.
Historical records of radioactive contamination in biota at the 200 Areas of the Hanford Site
International Nuclear Information System (INIS)
Johnson, A.R.; Markes, B.M.; Schmidt, J.W.; Shah, A.N.; Weiss, S.G.; Wilson, K.J.
1994-06-01
This document summarizes and reports a literature search of 85 environmental monitoring records of wildlife and vegetation (biota) at the 200 East Area and the 200 West Area of the Hanford Site since 1965. These records were published annually and provided the majority of the data in this report. Additional sources of data have included records of specific facilities, such as site characterization documents and preoperational environmental surveys. These documents have been released for public use. Records before 1965 were still being researched and therefore not included in this document. The intent of compiling these data into a single source was to identify past and current concentrations of radionuclides in biota at specific facilities and waste sites within each operable unit that may be used to help guide cleanup activities in the 200 Areas to be completed under the Comprehensive Environmental Response and Liability Act (CERCLA). The 200 East Area and 200 West Area were the locations of the Hanford Site separation and process facilities and waste management units. For the purposes of this document, a sample was of interest if a Geiger-Mueller counter equipped with a pancake probe-indicated beta/gamma emitting radioactivity above 200 counts per minute (cpm), or if laboratory radioanalyses indicated a radionuclide concentration equaled or exceeded 10 picocuries per gram (pCi/g). About 4,500 individual cases of monitoring for radionuclide uptake or transport in biota in the 200 Areas environs were included in the documents reviewed. About 1,900 (i.e., 42%) of these biota had radionuclide concentrations in excess of 10 pCi/g. These radionuclide transport or uptake cases were distributed among 45 species of wildlife (primarily small mammals and feces) and 30 species of vegetation. The wildlife species most commonly associated with radioactive contamination were the house mouse and the deer mouse and of vegetation species, the Russian thistle
Cisplatin binds to pre-miR-200b and impairs its processing to mature microRNA.
Mezencev, R; Wartell, R M
2018-01-01
Cisplatin is an important anticancer drug with a complex mode of action, a variety of possible targets, and numerous resistance mechanisms. While genomic DNA has traditionally been considered to be its most critical anticancer target, several lines of evidence suggest that various RNAs and other biomolecules may play a role in its anticancer mode of action. In this report we demonstrate that cisplatin modifies pre-miR-200b, impairs its processing to mature miRNA, and decreases miR-200b expression in ovarian cancer cells. Considering the role of miR-200b in epithelial-to-mesenchymal transition and cancer chemosensitivity, cisplatin-induced modification of pre-miR-200b and subsequent deregulation of mature miR-200b may, depending on cell context, limit anticancer activity of this important anticancer drug. More gener- ally, precursor miRNAs may be important targets of cisplatin and play a role in this drug's anticancer activity or modulate cell responses to this drug.
Pion interferometry of O+Au at 200 AGeV
Energy Technology Data Exchange (ETDEWEB)
Padula, S.S.; Gyulassy, M.
1989-07-10
We analyse NA35 data on O+Au->/pi//sup -//pi//sup -/+X at 200 A GeV including resonance decays and non-ideal dynamical and geometrical effects and find that a tau/sub f/=R/sub perpendicular/ /sub tof/=4 fm chaotic source is consistent with the data. (orig.).
Rocha, CFD.; Siqueira, CC.
2008-01-01
Tropidurus species commonly prey on arthropods, but they may also feed on vertebrates and plant material. The lizard Tropidurus oreadicus (Tropiduridae) is common in open vegetation habitats and generally has sexual dimorphism. In this study we analyzed the diet of T. oreadicus at Serra dos Carajás, Pará, in the north of Brazil. Snout-vent length (SVL) and jaw width (JW) were taken for 34 lizards. There was a significant difference in SVL and in JW, with males being larger than females. All l...
Positron acceleration to 200 MeV
International Nuclear Information System (INIS)
Leboutet, H.
1983-01-01
220 MeV is the energy that has to be obtained in routine operation. A standard 12m girder with SLED II can give 220 MeV minus a few percent due to not riding at the crest of the wave. In order to have the 200 MeV with only one girder, a klystron at full power all the time would be required - kept brand new. Then, for safety it is necessary to use two klystrons as designated in the SLC design. Having two klystrons gives freedom for the choice of the best arrangement. Since there will be excess rf power, it can be traded against higher gradient, shorter waveguides, larger apertures (lower shunt impedence)
Pilot-scale treatability test plan for the 200-UP-1 groundwater Operable Unit
International Nuclear Information System (INIS)
Wittreich, C.D.
1994-05-01
This document presents the treatability test plan for pilot-scale pump and treat testing at the 200-UP-1 Operable Unit. This treatability test plan has been prepared in response to an agreement between the US Department of Energy, the US Environmental Protection Agency, and the Washington State Department of Ecology, as documented in Hanford Federal Facility Agreement and Consent Order (Ecology et al. 1989a) Change Control Form M-13-93-03 (Ecology et al. 1994). The agreement also requires that, following completion of the activities described in this test plan, a 200-UP-1 Operable Unit interim remedial measure (IRM) proposed plan be developed for use in preparing an interim action record of decision (ROD). The IRM Proposed Plan will be supported by the results of the testing described in this treatability test plan, as well as by other 200-UP-1 Operable Unit activities (e.g., limited field investigation, development of a qualitative risk assessment). Once issued, the interim action ROD will specify the interim action for groundwater contamination at the 200-UP-1 Operable Unit. The approach discussed in this treatability test plan is to conduct a pilot-scale pump and treat test for the contaminant plume associated with the 200-UP-1 Operable Unit. Primary contaminants of concern are uranium and technetium-99; the secondary contaminant of concern is nitrate. The pilot-scale treatability testing presented in this test plan has as its primary purpose to assess the performance of aboveground treatment systems with respect to the ability to remove the primary contaminants in groundwater withdrawn from the contaminant plume
Pediatric esophageal scintigraphy. Results of 200 studies
International Nuclear Information System (INIS)
Guillet, J.; Wynchank, S.; Basse-Cathalinat, B.; Christophe, E.; Ducassou, D.; Blanquet, P.
1983-01-01
Esophageal transit of a small volume of watery liquid has been observed scintigraphically in 200 studies performed on patients aged between 6 days and 16 years. Qualitative information concerning esophageal morphology and function in the various phases of deglutition, and scintigraphic features of achalasia, stenosis, and other pathologies are described. Measured esophageal transit time and its normal variation, its relevance to the diagnosis of esophagitis, and the monitoring of treatment are discussed. This technique observing distinct deglutitions has proven a useful diagnostic tool. Its advantages and limitations are discussed in comparison with other methods
Pediatric esophageal scintigraphy. Results of 200 studies
Energy Technology Data Exchange (ETDEWEB)
Guillet, J.; Wynchank, S.; Basse-Cathalinat, B.; Christophe, E.; Ducassou, D.; Blanquet, P.
1983-09-01
Esophageal transit of a small volume of watery liquid has been observed scintigraphically in 200 studies performed on patients aged between 6 days and 16 years. Qualitative information concerning esophageal morphology and function in the various phases of deglutition, and scintigraphic features of achalasia, stenosis, and other pathologies are described. Measured esophageal transit time and its normal variation, its relevance to the diagnosis of esophagitis, and the monitoring of treatment are discussed. This technique observing distinct deglutitions has proven a useful diagnostic tool. Its advantages and limitations are discussed in comparison with other methods.
Sulphur dissociation in nuclear emulsion at 3.7 and 200A GeV
Energy Technology Data Exchange (ETDEWEB)
El-Nadi, M.; Abdelsalam, A.; Shaat, E.A.; Abou Moussa, Z. [Physics Department, Faculty of Science, Cairo University, Giza (Egypt); Hussien, A. [Physics Department, Faculty of Science, Cairo University, Fayoum Branch, Fayoum (Egypt); Ali-Mossa, N. [Basic Science Department, Faculty of Engineering, Banha Branch, Zagazig University, Banha (Egypt); Kamel, S.; Hafiz, M.E. [Physics Department, Faculty of Education, Ain Shams University, Cairo (Egypt); Abdel-Waged, K.H. [Physics Department, Faculty of Science, Zagazig University, Banha (Egypt)
2002-02-01
In this work, the electromagnetic dissociation (EMD) of sulphur projectile induced by two widely differing energies in nuclear emulsions is investigated. Although the percentages of EMD events of the total numbers of studied interactions are relatively small, i.e. 5.7 and 14.4% for 3.7 and 200A GeV interactions respectively, one could extract some results out of them. The emission of a proton through the {sup 32}S({gamma}, p){sup 31}P channel is found to be a dominant process (43.8%) at 200A GeV whereas the single alpha emission through the {sup 32}S({gamma}, {alpha}){sup 28}Si channel is the dominant one (34.0%) at 3.7A GeV. Multiplicity distributions of hydrogen and helium isotopes as well as the measured probabilities for the different modes of fragmentation are studied. The comparison of the present results, from electromagnetic and peripheral nuclear interactions, indicates the effective role of the different reaction mechanisms at ultra-relativistic energy (200A GeV). The experimental inclusive cross sections of different fragmentation modes produced in the EMD of {sup 32}S ions at 200A GeV were found to be in satisfactory agreement with the predictions of the combined approach of Pshenichnov et al. (author)
Nouvelle application de control des cavités 200 MHz RF du PS (CERN)
Cotte, D
2011-01-01
Le système Radio Fréquence (RF) 200MHz du PS est un outil essentiel pour la préparation des faisceaux haute intensité du PS. Dans l’anneau PS on trouve 6 cavités 200 MHz utilisées pour contrôler : • l’émittance longitudinale des « bunches » • le processus de « Rebunching » du faisceau avant de l’envoyer au SPS. Chaque cavité est pilotée par des événements appelés « timing » et suit une fonction de tension programmée. Cependant, l’électronique utilisée pour piloter les cavités 200 MHz du PS est obsolète et sa fiabilité non garantie pour cause du manque de pièces de rechange. Ce document décrit le fonctionnement du nouveau programme d’application qui fait abstraction de l’ancienne matrice hardware. Elle suit les recommandations décrites dans l’étude d’une nouvelle structure pour le système RF 200MHz du PS. [1
Remedial investigation for the 200-BP-1 operable unit, Hanford Site, Richland, Washington
International Nuclear Information System (INIS)
Buckmaster, M.A.
1991-01-01
The Hanford Site, Richland, Washington, contains over 1500 identified waste sites that will be characterized and remediated over the next 30 years. In support of the ''Hanford Federal Facility Agreement and Consent Order,'' the US Department of Energy has initiated a remedial investigation/feasibility study (RI/FS) at the 200-BP-1 operable unit. The 200-BP-1 RI is the first Comprehensive Environmental Response, Compensation, and Liability Act (CERCLA) investigation on the Hanford Site that involves drilling into highly radioactive and chemically contaminated soils. The initial phase of the site characterization is oriented toward determining the nature and extent of any contamination present in the vicinity of the 200-BP-1 operable unit. The major focus of the Phase I RI is the drilling and sampling of 10 inactive waste disposal units which received low level radioactive liquid waste
Doukyu, N; Aono, R
1997-05-01
Pseudomonas sp. strain ST-200 grew on indole as a sole carbon source. The minimal inhibitory concentration of indole was 0.3 mg/ml for ST-200. However, ST-200 grew in a persolvent fermentation system containing a large amount of indole (a medium containing 20% by vol. diphenylmethane and 4 mg/ml indole), because most of the indole was partitioned in the organic solvent layer. When the organism was grown in the medium containing indole at 1 mg/ml in the presence of diphenylmethane, more than 98% of the indole was consumed after 48h. Isatic acid (0.4 mg/ml) and isatin (0.03 mg/ml) were produced as the metabolites in the aqueous medium layer.
Fire Hazards Analysis for the 200 Area Interim Storage Area
International Nuclear Information System (INIS)
JOHNSON, D.M.
2000-01-01
This documents the Fire Hazards Analysis (FHA) for the 200 Area Interim Storage Area. The Interim Storage Cask, Rad-Vault, and NAC-1 Cask are analyzed for fire hazards and the 200 Area Interim Storage Area is assessed according to HNF-PRO-350 and the objectives of DOE Order 5480 7A. This FHA addresses the potential fire hazards associated with the Interim Storage Area (ISA) facility in accordance with the requirements of DOE Order 5480 7A. It is intended to assess the risk from fire to ensure there are no undue fire hazards to site personnel and the public and to ensure property damage potential from fire is within acceptable limits. This FHA will be in the form of a graded approach commensurate with the complexity of the structure or area and the associated fire hazards
39 CFR 946.5 - Disposition of property having a value of less than $200.
2010-07-01
... that fair market value of such property is $200 or less, title to the property vests in the United... 39 Postal Service 1 2010-07-01 2010-07-01 false Disposition of property having a value of less... SERVICE FOR USE AS EVIDENCE § 946.5 Disposition of property having a value of less than $200. Where the...
Haridusministeerium kingib koolilõpetajatele 200 000 eest šokolaadi / Mirko Ojakivi
Ojakivi, Mirko
2006-01-01
Haridus- ja Teadusministeerium kingib keskkoolide, gümnaasiumide ja kutsekoolide lõpetajatele 200 000 krooni eest Kalevi erikujundusega šokolaadi. Seda otsust kritiseerib endine haridusminister Tõnis Lukas
Review of reports by J.W. Gofman on inhaled plutonium
International Nuclear Information System (INIS)
Bair, W.J.
1975-01-01
Two recent widely circulated reports on the subject of inhaled plutonium have provoked concern among the press and in Congress. These reports, The Cancer Hazard from Inhaled Plutonium, CNR Report 1975-1R, May 14, 1975, and Estimated Production of Human Lung Cancers by Plutonium from Worldwide Fallout, CNR Report 1975-2, July 10, 1975, were written by John W. Gofman and issued by the Committee for Nuclear Responsibility, P. O. Box 2329, Dublin, California 94566. Gofman's reports do not present an objective analysis of the hazard of inhaled plutonium; his arguments, in fact, contradict many conclusions drawn in the scientific literature and supported by experimental data. Because the reports are skillfully written, however, they could easily mislead readers who are not well versed in this area. The purpose of this review, therefore, is to examine Gofman's reports in the light of recent research studies and to identify errors of fact and logic in his arguments
Traditional Herbal Medicine in National Healthcare in Kenya J.W. ...
African Journals Online (AJOL)
e ~ a r t m e n t of Pharmaceutical Chemistry, School of Pharmacy, University of Nairobi, P.O. Box 19767 ... care [I]. At the moment, a large number of people in developing countries irrespective of their social status, ethnic group ... diseases such as heart disease, rheumatoid arthritis, cancer, diabetes and mental disorders as.
Photoproduction in the Energy Range 70-200 GeV
2002-01-01
This experiment continues the photoproduction studies of WA4 and WA57 up to the higher energies made available by the upgrading of the West Hall. An electron beam of energy 200 GeV is used to produce tagged photons in the range 65-180 GeV; The photon beam is incident on a 60 cm liquid hydrogen target in the Omega Spectrometer. A Ring Image Cherenkov detector provides pion/kaon separation up to 150 GeV/c. The Transition Radiation Detector extends the charged pion identification to the momentum range from about 80 GeV/c upwards. The large lead/liquid scintillator calorimeter built by the WA70 collaboration and the new lead/scintillating fibre det (Plug) are used for the detection of the $\\gamma$ rays produced by the interactions of the primary photons in the hydrogen target. \\\\ \\\\ The aim is to make a survey of photoproduction reactions up to photon energies of 200 GeV. The large aperture of the Omega Spectrometer will particularly enable study of fragmentation of the photon to states of high mass, up to @C 9 G...
Characterization of reduced height mutant of emmer wheat var. NP200 (Triticum dicoccum)
International Nuclear Information System (INIS)
Suman, Sud; Nayeem, K.A.; Bhagwat, S.G.
2006-01-01
Full text: Emmer wheat commonly known as Khapli is cultivated on limited area in Tamil Nadu, Andhra Pradesh, Karnataka, Maharashtra and Gujarat. Although cultivation of emmer wheat is confirmed to a small area, improvement work in this species is gaining importance because of its potential for diabetic patients and high dietary fibre in comparison to durum and bread wheats. Emmer wheat cultivar NP200 is a selection from local wheats of Andhra Pradesh. The cultivar NP200 is tall and is prone to lodging leading to yield loss. Therefore, systematic effort to improve cultivar NP200 is needed with the objective to reduce height and introduce lodging tolerance and to improve harvest index. The cultivar NP200 was irradiated with γ-rays. A reduced height mutant with vigorous growth and high tillering was found in M2 population. The mutant was designated as HW1095. The progeny of mutant in M3 showed 35.7 percent reduction in height as compared to parent. The HW1095 mutant was subjected to gibberellic acid treatment at seedling stage and was found to be insensitive to gibberellic acid. An allele specific marker for major dwarfing gene Rht B1b was used to check the status of dwarfing gene in semi dwarf emmer (DDK1009, DDK1025, HW5013, HW5301 and MACS2961) and tall emmer (Np200 and NP201), semi dwarf durums (HD4502, HD4530, MACS2846) along with dwarf mutant (HW1095). The validity of primer in semi dwarf durums and emmer for Rht B 1b gene was found to be perfect. The parent variety NP200 showed presence of wild type allele (Rht B1a) with the primer pair BF-WR1. All semi dwarf emmer showed a band of 237 bp with primer pair BF-MR1. However, mutant (HW1095) showed absence of amplification for both Rht B1a and Rht B1b alleles with respective primer pairs. The results indicated that the reduced height mutant carried a mutation different than from the existing allele (Rht B1b)
Degenerate Higgs and Z boson at Lep200
International Nuclear Information System (INIS)
Brown, N.
1990-08-01
We investigate the problem of detecting the Higgs boson if M H ≅ M Z at LEP200, the main problem being the large background from ZZ production. Since this background should be accurately calculable, we estimate that the existence of the Higgs can be established with about 3fb -1 of integrated luminosity. We also discuss how the signal can be improved if efficient tagging of b quarks is available. (author)
Directory of Open Access Journals (Sweden)
Xiao-Lei Shao
2017-08-01
Full Text Available AIM: To analyze the relationship between clinical features and epithelial mesenchymal transition (EMT in retinoblastoma (RB, further to investigate whether miR-200c regulates the EMT and migration of RB cells. METHODS: Expression of EMT-related markers and tumor-related factors were detected by immuno-histochemistry analysis in RB tissue from 29 cases. Correlations between their expression and clinical characteristics were analyzed. The regulation effects of miR-200c on EMT-related markers, tumor-related factors were observed in mRNA level and protein level by real-time polymerase chain reaction (PCR and Western blot, respectively, in Y79 and Weri-rb1 cells. Its effects on migration force of these RB cell lines were also detected with Transwell test. RESULTS: Lower expression of E-cadherin was present in the cases with malignant prognosis. MiR-200c promoted the expression of E-cadherin and decreased the expression of Vimentin and N-cadherin in Y79 and Weri-rb1 cells. Migration force of RB cells could be inhibited by miR-200c. CONCLUSION: EMT might be associated with bad prognosis in RB. MiR-200c suppresses the migration of retinoblastomatous cells by reverse EMT.
Directory of Open Access Journals (Sweden)
Klein Michael
2005-08-01
Full Text Available Abstract Background For solid tumors, image cytometry has been shown to be more sensitive for diagnosing DNA content abnormalities (aneuploidy than flow cytometry. Image cytometry has often been performed using the semi-automated CAS 200 system. Recently, an Automated Cellular Imaging System (ACIS was introduced to determine DNA content (DNA index, but it has not been validated. Methods Using the CAS 200 system and ACIS, we compared the DNA index (DI obtained from the same archived formalin-fixed and paraffin embedded tissue samples from Barrett's esophagus related lesions, including samples with specialized intestinal metaplasia without dysplasia, low-grade dysplasia, high-grade dysplasia and adenocarcinoma. Results Although there was a very good correlation between the DI values determined by ACIS and CAS 200, the former was 25% more sensitive in detecting aneuploidy. ACIS yielded a mean DI value 18% higher than that obtained by CAS 200 (p t test. In addition, the average time required to perform a DNA ploidy analysis was shorter with the ACIS (30–40 min than with the CAS 200 (40–70 min. Results obtained by ACIS gave excellent inter-and intra-observer variability (coefficient of correlation >0.9 for both, p Conclusion Compared with the CAS 200, the ACIS is a more sensitive and less time consuming technique for determining DNA ploidy. Results obtained by ACIS are also highly reproducible.
34 CFR 200.13 - Adequate yearly progress in general.
2010-07-01
... assessed in reading/language arts and in mathematics. (3) A State's or LEA's number of proficient and... section at the State or LEA level, the State must do the following: (i) Consistent with § 200.7(a... subgroup at the school, LEA, and State level. (v) Ensure that parents of a child who is assessed based on...
DEFF Research Database (Denmark)
Bendix, Laila; Kølvraa, Steen
2010-01-01
In 2009 the Nobel Prize in Medicine was awarded to EH Blackburn, CW Greider and JW Szostak for their work on "How chromosomes are protected by telomeres and the enzyme telomerase". Telomeres are specialized DNA structures localized at the end of linear chromosomes. Telomeres are known as the biol......In 2009 the Nobel Prize in Medicine was awarded to EH Blackburn, CW Greider and JW Szostak for their work on "How chromosomes are protected by telomeres and the enzyme telomerase". Telomeres are specialized DNA structures localized at the end of linear chromosomes. Telomeres are known...
Always on the starting line: ELCAT 200 - the new-generation electric vehicle
Energy Technology Data Exchange (ETDEWEB)
Baeckstroem, K.; Leisio, C. [ed.
1997-11-01
The Elcat 200 electric van can always be left charging. With most other electric van models, the situation is different. They run the risk of overcharging, which prevents continual `refuelling` of their batteries and thus considerably reduces the performance of the vehicles. The Elcat electric vehicle project has so far manufactured over 160 electric vans. Of these, the Elcat Cityvan accounts for 130, and the state-of-the-art Elcat 200 just over 30. The greatest single Elcat user is Finland Post, with 50 electric vehicles. Fifty Elcats have been sold abroad, most of them to Sweden
Optimization of 200 kV electrostatic accelerator
Directory of Open Access Journals (Sweden)
M Nazmabadi
2015-09-01
Full Text Available Optimizations on 200 kV electrostatic accelerator have been done in order to increasing ion current on target, improving vacuum condition and reduction in x-rays emission, increasing stability of high voltage power supply and reaching much greater achievable voltage value. The accelerator tube has most important effect on beam tracing in the electrostatic accelerators. So precautions most be considered in designing and constructing of this part. In order to finding permissible tolerances in construction and assembling of 200 kV electrostatic accelerator column, first the effects of angle deviation of a part from accelerator axis on beam track in the accelerator tube was simulated with Simion 7.0 computer program. We found that in order to prevent beam lost, the tolerances of balancing and co-centering of each part should be smaller than 0.1 mm. Each part of accelerator tube constructed by tolerances lower than 0.05 mm. Ultrasonic cleaning method used in pre-assembling process of parts. Because of its excellences, in the new tube we used borosilicate glass instead of high density alumina as insulators between the metallic electrodes. After three days of working vacuum pumps the system reached to 8.0×10-7 and after months to 5.0×10-7 ultimate pressure values. Measurements showed that by these considerations the maximum of reachable ion current on target was 1.1 mA which increased 50% compared to old machine, while x-ray emission intensity was increased by 25%. Optimizations of high voltage power supply are now under studies and tests
Russia to invest 200 million Swiss Francs in international accelerator
2001-01-01
Russia will invest 200 million CHF in the LHC project, according to first deputy industry, science and technologies minister. The results of scientific research in the center will be use in various industries, enabling new Russian technologies to enter the world market.
Gonzalez-Carrillo, Carolina; Millan-Sauceda, Cassandra; Lozano-Garza, Hector Gerardo; Ortiz-Lopez, Rocio; Elizondo-Gonzalez, Ramiro; Welsh, Oliverio; Ocampo-Candiani, Jorge; Vera-Cabrera, Lucio
2016-09-01
Nocardia species, particularly Nocardia brasiliensis, are etiologic agents of mycetoma, a chronic subcutaneous infection. Until now, little has been known about the pathogenic mechanisms involved in nocardial infection. Traditionally, subculture in rich media has been a simple way to induce attenuation. In this work, we report the changes in virulence toward mice and in genomic constitution of N. brasiliensis produced after 200 continuous subcultures in brain heart infusion (BHI) medium (P-200 strain). The ability of the N. brasiliensis P-200 strain to produce experimental infection was tested using BALB/c mice. P-200 was also used to immunize mice to determine whether it could induce resistance against a challenge with a nonsubcultured isolate (P-0). Comparative proteomic analysis between N. brasiliensis P-0 and P-200 was performed by two-dimensional (2-D) electrophoresis, and the genome sequence was obtained through Roche 454 sequence analysis. Virulence in BALB/c mice was completely lost, and BALB/c mice immunized with P-200 bacterial cells were resistant to mycetoma production by the nonsubcultured strain. Whole-genome sequence analysis revealed that P-200 lost a total of 262,913 bp distributed in 19 deleted regions, involving a total of 213 open reading frames (ORFs). The deleted genes included those encoding bacterial virulence factors, e.g., catalase, nitrate reductase enzymes, and a group of mammalian cell entry (MCE) family proteins, which may explain the loss of virulence of the isolate. Thus, completely attenuated N. brasiliensis was obtained after 200 passages in BHI medium, and putative Nocardia virulence genes were identified for the first time. Copyright © 2016, American Society for Microbiology. All Rights Reserved.
Annex D-200 Area Interim Storage Area Final Safety Analysis Report [FSAR] [Section 1 and 2
International Nuclear Information System (INIS)
CARRELL, R.D.
2002-01-01
The 200 Area Interim Storage Area (200 Area ISA) at the Hanford Site provides for the interim storage of non-defense reactor spent nuclear fuel (SNF) housed in aboveground dry cask storage systems. The 200 Area ISA is a relatively simple facility consisting of a boundary fence with gates, perimeter lighting, and concrete and gravel pads on which to place the dry storage casks. The fence supports safeguards and security and establishes a radiation protection buffer zone. The 200 Area ISA is nominally 200,000 ft 2 and is located west of the Canister Storage Building (CSB). Interim storage at the 200 Area ISA is intended for a period of up to 40 years until the materials are shipped off-site to a disposal facility. This Final Safety Analysis Report (FSAR) does not address removal from storage or shipment from the 200 Area ISA. Three different SNF types contained in three different dry cask storage systems are to be stored at the 200 Area ISA, as follows: (1) Fast Flux Test Facility Fuel--Fifty-three interim storage casks (ISC), each holding a core component container (CCC), will be used to store the Fast Flux Test Facility (FFTF) SNF currently in the 400 Area. (2) Neutron Radiography Facility (NRF) TRIGA'--One Rad-Vault' container will store two DOT-6M3 containers and six NRF TRIGA casks currently stored in the 400 Area. (3) Commercial Light Water Reactor Fuel--Six International Standards Organization (ISO) containers, each holding a NAC-I cask4 with an inner commercial light water reactor (LWR) canister, will be used for commercial LWR SNF from the 300 Area. An aboveground dry cask storage location is necessary for the spent fuel because the current storage facilities are being shut down and deactivated. The spent fuel is being transferred to interim storage because there is no permanent repository storage currently available
Facility effluent monitoring plan determinations for the 200 Area facilities
International Nuclear Information System (INIS)
Nickels, J.M.
1991-11-01
The following facility effluent monitoring plan determinations document the evaluations conducted for the Westinghouse Hanford Company 200 Area facilities (chemical processing, waste management, 222-S Laboratory, and laundry) on the Hanford Site in south central Washington State. These evaluations determined the need for facility effluent monitoring plans for the 200 Area facilities. The facility effluent monitoring plan determinations have been prepared in accordance with A Guide for Preparing Hanford Site Facility Effluent Monitoring Plans, WHC-EP-0438 (WHC 1991). The Plutonium/Uranium Extraction Plant and UO 3 facility effluent monitoring plan determinations were prepared by Los Alamos Technical Associates, Richland, Washington. The Plutonium Finishing Plant, Transuranic Waste Storage and Assay Facility, T Plant, Tank Farms, Low Level Burial Grounds, and 222-S Laboratory determinations were prepared by Science Applications International Corporation of Richland, Washington. The B Plant Facility Effluent Monitoring Plan Determination was prepared by ERCE Environmental Services of Richland, Washington
A 200-kW wind turbine generator conceptual design study
1979-01-01
A conceptual design study was conducted to define a 200 kW wind turbine power system configuration for remote applications. The goal was to attain an energy cost of 1 to 2 cents per kilowatt-hour at a 14-mph site (mean average wind velocity at an altitude of 30 ft.) The costs of the Clayton, New Mexico, Mod-OA (200-kW) were used to identify the components, subsystems, and other factors that were high in cost and thus candidates for cost reduction. Efforts devoted to developing component and subsystem concepts and ideas resulted in a machine concept that is considerably simpler, lighter in weight, and lower in cost than the present Mod-OA wind turbines. In this report are described the various innovations that contributed to the lower cost and lighter weight design as well as the method used to calculate the cost of energy.
The MicroRNA-200 Family Is Upregulated in Endometrial Carcinoma
Snowdon, Jaime; Zhang, Xiao; Childs, Tim; Tron, Victor A.; Feilotter, Harriet
2011-01-01
Background MicroRNAs (miRNAs, miRs) are small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. MicroRNAs are dysregulated in cancer and may play essential roles in tumorigenesis. Additionally, miRNAs have been shown to have prognostic and diagnostic value in certain types of cancer. The objective of this study was to identify dysregulated miRNAs in endometrioid endometrial adenocarcinoma (EEC) and the precursor lesion, complex atypical hyperplasia (CAH). Methodology We compared the expression profiles of 723 human miRNAs from 14 cases of EEC, 10 cases of CAH, and 10 normal proliferative endometria controls using Agilent Human miRNA arrays following RNA extraction from formalin-fixed paraffin-embedded (FFPE) tissues. The expression of 4 dysregulated miRNAs was validated using real time reverse transcription-PCR. Results Forty-three miRNAs were dysregulated in EEC and CAH compared to normal controls (p<0.05). The entire miR-200 family (miR-200a/b/c, miR-141, and miR-429) was up-regulated in cases of EEC. Conclusions This information contributes to the candidate miRNA expression profile that has been generated for EEC and shows that certain miRNAs are dysregulated in the precursor lesion, CAH. These miRNAs in particular may play important roles in tumorigenesis. Examination of miRNAs that are consistently dysregulated in various studies of EEC, like the miR-200 family, will aid in the understanding of the role that miRNAs play in tumorigenesis in this tumour type. PMID:21897839
The microRNA-200 family is upregulated in endometrial carcinoma.
Directory of Open Access Journals (Sweden)
Jaime Snowdon
Full Text Available BACKGROUND: MicroRNAs (miRNAs, miRs are small non-coding RNAs that negatively regulate gene expression at the post-transcriptional level. MicroRNAs are dysregulated in cancer and may play essential roles in tumorigenesis. Additionally, miRNAs have been shown to have prognostic and diagnostic value in certain types of cancer. The objective of this study was to identify dysregulated miRNAs in endometrioid endometrial adenocarcinoma (EEC and the precursor lesion, complex atypical hyperplasia (CAH. METHODOLOGY: We compared the expression profiles of 723 human miRNAs from 14 cases of EEC, 10 cases of CAH, and 10 normal proliferative endometria controls using Agilent Human miRNA arrays following RNA extraction from formalin-fixed paraffin-embedded (FFPE tissues. The expression of 4 dysregulated miRNAs was validated using real time reverse transcription-PCR. RESULTS: Forty-three miRNAs were dysregulated in EEC and CAH compared to normal controls (p<0.05. The entire miR-200 family (miR-200a/b/c, miR-141, and miR-429 was up-regulated in cases of EEC. CONCLUSIONS: This information contributes to the candidate miRNA expression profile that has been generated for EEC and shows that certain miRNAs are dysregulated in the precursor lesion, CAH. These miRNAs in particular may play important roles in tumorigenesis. Examination of miRNAs that are consistently dysregulated in various studies of EEC, like the miR-200 family, will aid in the understanding of the role that miRNAs play in tumorigenesis in this tumour type.
Operation of the Brookhaven 200 MeV Linac
International Nuclear Information System (INIS)
Fewell, N.M.; LoDestro, V.
1979-01-01
During the past three years the 200 MeV linear accelerator has continued to operate at a high level of performance and reliability. The linac output beam current has been limited to 60 mA in order to obtain the maximum rf power tube life without compromising the output performance of the AGS. Despite a reduction in pulse repetition rate, total beam current to the BLIP facility has increased to an average of 300 mA hours/year
DEFF Research Database (Denmark)
Singh, Amardeep; Falk, Mads K; Hviid, Thomas V F
2013-01-01
OBJECTIVE: Dysregulation of retinal microglial activity has been implicated in the pathogenesis of neovascular age-related macular degeneration. Microglia activity can be regulated through the membrane protein CD200 and its corresponding receptor, the CD200 receptor (CD200R). Because both...... with neovascular age-related macular degeneration (AMD) and 44 age-matched controls without AMD. METHODS: The participants were aged 60 years or older, had no history of immune dysfunction or cancer, and were not receiving immune-modulating therapy. All participants were subjected to a structured interview......: Patients with neovascular AMD had a higher percentage of CD11b+CD200+ monocytes and CD200+ monocytes compared with controls. Multiple regression analysis revealed that the intergroup differences observed were independent of age. Moreover, an age-related increment in CD200 expression on monocytes...
Kinematical Comparison of the 200 m Backstroke Turns between National and Regional Level Swimmers
Veiga, Santiago; Cala, Antonio; Frutos, Pablo González; Navarro, Enrique
2013-01-01
The aims of this investigation were to determine the evolution of selected turn variables during competitive backstroke races and to compare these kinematic variables between two different levels of swimmers. Sixteen national and regional level male swimmers participant in the 200 m backstroke event at the Spanish Swimming Championships in short course (25 m) were selected to analyze their turn performances. The individual distances method with two-dimensional Direct Linear Transformation (2D-DLT) algorithms was used to perform race analyses. National level swimmers presented a shorter “turn time”, a longer “distance in”, a faster “underwater velocity” and “normalized underwater velocity”, and a faster “stroking velocity” than regional level swimmers, whereas no significant differences were detected between levels for the “underwater distance”. National level swimmers maintained similar “turn times” over the event and increased “underwater velocity” and “normalized underwater velocity” in the last (seventh) turn segment, whereas regional level swimmers increased “turn time” in the last half of the race. For both national and regional level swimmers, turn “underwater distance” during the last three turns of the race was significantly shorter while no significant differences in distance into the wall occurred throughout the race. The skill level of the swimmers has an impact on the competitive backstroke turn segments. In a 200 m event, the underwater velocity should be maximized to maintain turn proficiency, whereas turn distance must be subordinated to the average velocity. Key Points The underwater turn velocity is as a critical variable related to the swimmers’ level of skill in a 200 m backstroke event. Best swimmers perform faster but no longer turn segments during a 200 m backstroke event. Best swimmers maintain their turn performance throughout the 200 m backstroke event by increasing the underwater velocity
Lim, Yat-Yuen; Wright, Josephine A; Attema, Joanne L; Gregory, Philip A; Bert, Andrew G; Smith, Eric; Thomas, Daniel; Lopez, Angel F; Drew, Paul A; Khew-Goodall, Yeesim; Goodall, Gregory J
2013-05-15
The miR-200 family is a key regulator of the epithelial-mesenchymal transition, however, its role in controlling the transition between cancer stem-cell-like and non-stem-cell-like phenotypes is not well understood. We utilized immortalized human mammary epithelial (HMLE) cells to investigate the regulation of the miR-200 family during their conversion to a stem-like phenotype. HMLE cells were found to be capable of spontaneous conversion from a non-stem to a stem-like phenotype and this conversion was accompanied by the loss of miR-200 expression. Stem-like cell fractions isolated from metastatic breast cancers also displayed loss of miR-200 indicating similar molecular changes may occur during breast cancer progression. The phenotypic change observed in HMLE cells was directly controlled by miR-200 because restoration of its expression decreased stem-like properties while promoting a transition to an epithelial phenotype. Investigation of the mechanisms controlling miR-200 expression revealed both DNA methylation and histone modifications were significantly altered in the stem-like and non-stem phenotypes. In particular, in the stem-like phenotype, the miR-200b-200a-429 cluster was silenced primarily through polycomb group-mediated histone modifications whereas the miR-200c-141 cluster was repressed by DNA methylation. These results indicate that the miR-200 family plays a crucial role in the transition between stem-like and non-stem phenotypes and that distinct epigenetic-based mechanisms regulate each miR-200 gene in this process. Therapy targeted against miR-200 family members and epigenetic modifications might therefore be applicable to breast cancer.
Liu, Chibo; Pan, Chunqin; Cai, Yanqun; Wang, Haibao
2017-08-01
In our previous study, we found long noncoding RNA ZEB1-AS1 is upregulated and functions as an oncogene in osteosarcoma. MiR-200 family (miR-200s) functions as tumor suppressor via directly targeting ZEB1 in various cancers. In this study, we further investigate the potential interplay between ZEB1-AS1, miR-200s, and ZEB1 in osteosarcoma. Our results showed that ZEB1-AS1 functions as a molecular sponge for miR-200s and relieves the inhibition of ZEB1 caused by miR-200s. ZEB1-AS1 and miR-200s reciprocally negatively regulate each other. MiR-200s are downregulated in osteosarcoma tissues, and negatively correlated with ZEB1-AS1 and ZEB1 expression levels in osteosarcoma. Functional experiments showed that consistent with ZEB1-AS1 depletion, miR-200s overexpression and ZEB1 depletion both inhibit osteosarcoma cell proliferation and migration. Overexpression of miR-200s partially abolished the effects of ZEB1-AS1 on osteosarcoma cell proliferation and migration. Moreover, the combination of ZEB1-AS1 depletion and miR-200s overexpression significantly inhibits osteosarcoma cell proliferation and migration. In conclusion, this study revealed a novel regulatory mechanism between ZEB1-AS1, miR-200s, and ZEB1. The interplay between ZEB1-AS1 and miR-200s contributes to osteosarcoma cell proliferation and migration, and targeting this interplay could be a promising strategy for osteosarcoma treatment. J. Cell. Biochem. 118: 2250-2260, 2017. © 2017 Wiley Periodicals, Inc. © 2017 Wiley Periodicals, Inc.
13 CFR 123.200 - Am I eligible to apply for a physical disaster business loan?
2010-01-01
..., corporation, limited liability company, or other legal entity recognized under State law. Your business' size... 13 Business Credit and Assistance 1 2010-01-01 2010-01-01 false Am I eligible to apply for a physical disaster business loan? 123.200 Section 123.200 Business Credit and Assistance SMALL BUSINESS...
17 CFR 200.30-1 - Delegation of authority to Director of Division of Corporation Finance.
2010-04-01
... 17 Commodity and Securities Exchanges 2 2010-04-01 2010-04-01 false Delegation of authority to Director of Division of Corporation Finance. 200.30-1 Section 200.30-1 Commodity and Securities Exchanges SECURITIES AND EXCHANGE COMMISSION ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Organization and Program Management General...
17 CFR 200.30-5 - Delegation of authority to Director of Division of Investment Management.
2010-04-01
... Director of Division of Investment Management. 200.30-5 Section 200.30-5 Commodity and Securities Exchanges... Division of Investment Management. Pursuant to the provisions of Pub. L. 87-592, 76 Stat. 394 (15 U.S.C... otherwise, the following functions to the Director of the Division of Investment Management, to be performed...
20 CFR 200.1 - Designation of central and field organization.
2010-04-01
... responsible for the financial management of the agency, and the Chief Information Officer is responsible for... ADMINISTRATION § 200.1 Designation of central and field organization. (a) Introduction. (1) The Railroad... Programs, the Chief Financial Officer, the Chief Information Officer, and the Chief Actuary. (2) The...
Volume of Anesthetic in 0.5% Marcaine with 1:200,000 Epinephrine Dental Carpule
2016-04-01
copyrighted material in the thesis manuscript entitled: "Volume of Anesthetic in 0.5% Marcaine with 1:200,000 Epinephrine Dental Carpule" Is...3. School/DepartmenUCenter: Army Postgraduate Dental School, AEGD-2 Program, Fort Hood, TX 4. Phone: (708) 227-2152 5. Type of clearance...X_Thesis _Article _Book _Poster _Presentation _Other 6. Title: "Volume of Anesthetic in 0.5% Marcaine with 1:200,000 Epinephrine Dental Carpule
Directory of Open Access Journals (Sweden)
Michael Anthony Ruiz
Full Text Available Glucose-induced augmented vascular endothelial growth factor (VEGF production is a key event in diabetic retinopathy. We have previously demonstrated that downregulation of miR-200b increases VEGF, mediating structural and functional changes in the retina in diabetes. However, mechanisms regulating miR-200b in diabetes are not known. Histone methyltransferase complex, Polycomb Repressive Complex 2 (PRC2, has been shown to repress miRNAs in neoplastic process. We hypothesized that, in diabetes, PRC2 represses miR-200b through its histone H3 lysine-27 trimethylation mark. We show that human retinal microvascular endothelial cells exposed to high levels of glucose regulate miR-200b repression through histone methylation and that inhibition of PRC2 increases miR-200b while reducing VEGF. Furthermore, retinal tissue from animal models of diabetes showed increased expression of major PRC2 components, demonstrating in vivo relevance. This research established a repressive relationship between PRC2 and miR-200b, providing evidence of a novel mechanism of miRNA regulation through histone methylation.
ANALISIS EFEK KECELAKAAN WATER INGRESS TERHADAP REAKTIVITAS DOPPLER TERAS RGTT200K
Directory of Open Access Journals (Sweden)
Zuhair Zuhair
2015-03-01
Full Text Available Dalam high temperature reactor, koefisien reaktivitas temperatur yang didesain negatif menjamin reaksi fisi dalam teras tetap berada di bawah kendali dan panas peluruhan tidak akan pernah melelehkan bahan bakar yang menyebabkan terlepasnya zat radioaktif ke lingkungan. Namun masuknya air (water ingress ke dalam teras reaktor akibat pecahnya tabung penukar panas generator uap, yang dikenal sebagai salah satu kecelakaan dasar desain, dapat mengintroduksi reaktivitas positif dengan potensi bahaya lainnya seperti korosi grafit dan kerusakan material struktur reflektor. Makalah ini akan menganalisis efek kecelakaan water ingress terhadap reaktivitas Doppler teras RGTT200K. Kapabilitas koefisien reaktivitas Doppler untuk mengkompensasi reaktivitas positif yang timbul selama kecelakaan water ingress akan diuji melalui serangkaian perhitungan dengan program MCNPX dan pustaka ENDF/B-VII untuk perubahan temperatur bahan bakar dari 800K hingga 1800K. Tiga opsi kernel bahan bakar UO2, ThO2/UO2 dan PuO2 dengan tiga model kisi bahan bakar pebble di teras reaktor diterapkan untuk kondisi water ingress dengan densitas air dari 0 hingga 1.000 kg/m3. Hasil perhitungan memperlihatkan koefisien reaktivitas Doppler tetap negatif untuk seluruh opsi bahan bakar yang dipertimbangkan bahkan untuk posibilitas water ingress yang besar. Efek water ingress lebih kuat pada model kisi dengan fraksi packing lebih rendah karena lebih banyak volume yang tersedia untuk air yang memasuki teras reaktor. Efek water ingress juga lebih kuat di teras uranium dibandingkan teras thorium dan plutonium sebagai konsekuensi dari fenomena Doppler dimana absorpsi neutron di daerah resonansi 238U lebih besar daripada 232Th dan 240Pu. Secara keseluruhan dapat disimpulkan bahwa, koefisien Doppler teras RGTT200K mampu mengkompensasi insersi reaktivitas yang diintroduksi oleh kecelakaan water ingress. Teras RGTT200K dengan bahan bakar UO2, ThO2/UO2 dan PuO2 dapat mempertahankan fitur keselamatan
Directory of Open Access Journals (Sweden)
Kan Casina WS
2012-12-01
Full Text Available Abstract Background There is a critical need for improved diagnostic markers for high grade serous epithelial ovarian cancer (SEOC. MicroRNAs are stable in the circulation and may have utility as biomarkers of malignancy. We investigated whether levels of serum microRNA could discriminate women with high-grade SEOC from age matched healthy volunteers. Methods To identify microRNA of interest, microRNA expression profiling was performed on 4 SEOC cell lines and normal human ovarian surface epithelial cells. Total RNA was extracted from 500 μL aliquots of serum collected from patients with SEOC (n = 28 and age-matched healthy donors (n = 28. Serum microRNA levels were assessed by quantitative RT-PCR following preamplification. Results microRNA (miR-182, miR-200a, miR-200b and miR-200c were highly overexpressed in the SEOC cell lines relative to normal human ovarian surface epithelial cells and were assessed in RNA extracted from serum as candidate biomarkers. miR-103, miR-92a and miR -638 had relatively invariant expression across all ovarian cell lines, and with small-nucleolar C/D box 48 (RNU48 were assessed in RNA extracted from serum as candidate endogenous normalizers. No correlation between serum levels and age were observed (age range 30-79 years for any of these microRNA or RNU48. Individually, miR-200a, miR-200b and miR-200c normalized to serum volume and miR-103 were significantly higher in serum of the SEOC cohort (P Conclusions We identified serum microRNAs able to discriminate patients with high grade SEOC from age-matched healthy controls. The addition of these microRNAs to current testing regimes may improve diagnosis for women with SEOC.
Energy Technology Data Exchange (ETDEWEB)
Wang, Xinsheng; Jiang, Fuquan; Song, Haitao; Li, Xu; Xian, Jiantao; Gu, Xinquan, E-mail: guxqprofessor@163.com
2016-02-12
Sperm-associated antigen 9(SPAG9), as a well-recognized oncogene protein, has a critical effect on renal cell carcinoma (RCC) progression. Our study tried to explore the mediator of miR-200a-3p, a tumor suppressing miRNA on SPAG9 expression and renal cell proliferation and apoptosis. We found the expression of miR-200a-3p was significantly lower in RCC specimens. Based on in vitro assays, we found miR-200a-3p significantly inhibit cancer cell proliferation by inducing apoptosis. In addition, our study uncovered that miR-200a-3p directly regulates oncogenic SPAG9 in 786-O and ACHN cells. Silencing of SPAG9 resulted in significantly decreased in the growth and the cell cycle of the renal cancer cell lines. Understanding of oncogenic SPAG9 regulated by miR-200a-3p might be beneficial to reveal new therapeutic targets for RCC. - Highlights: • MiR-200a-3p is downregulated in renal cell carcinoma. • MiR-200a-3p regulates cell proliferation through inducing apoptosis. • MiR-200a-3p is involved in cell cycle regulation. • SPAG9 is a potential target of miR-200a-3p.
Identification of targets of miR-200b by a SILAC-based quantitative proteomic approach
Directory of Open Access Journals (Sweden)
Arivusudar Marimuthu
2014-09-01
Full Text Available miRNAs regulate gene expression by binding to cognate mRNAs causing mRNA degradation or translational repression. Mass spectrometry-based proteomic analysis is being widely used to identify miRNA targets. The miR-200b miRNA cluster is often overexpressed in multiple cancer types, but the identity of the targets remains elusive. Using SILAC-based analysis, we examined the effects of overexpression of a miR-200b mimic or a control miRNA in fibrosarcoma cells. We identified around 300 potential targets of miR-200b based on a change in the expression of protein levels. We validated a subset of potential targets at the transcript level using quantitative PCR.
Memarian, Ali; Nourizadeh, Maryam; Masoumi, Farimah; Tabrizi, Mina; Emami, Amir Hossein; Alimoghaddam, Kamran; Hadjati, Jamshid; Mirahmadian, Mahroo; Jeddi-Tehrani, Mahmood
2013-02-01
Immunosuppression in acute myeloid leukemia (AML) is an important mechanism of tumor escape. CD200, as an immunosuppressive molecule, is overexpressed in some hematological malignancies and it has also been shown to be an independent prognostic factor in AML. In the current study, simultaneous CD200 expression and Foxp3(+) regulatory T cell levels were investigated in Iranian patients with AML by flow cytometry. We also assessed the effect of CD200-CD200R blockade on Th1 and T-reg cytokine production and T cell proliferation in autologous AML- and monocyte-DC mixed lymphocyte reactions (MLRs). ELISA assay was performed to detect IL-2, IL-12, IFN-γ, IL-10, and TGF-β production in MLR supernatants. Expression of Foxp3, IL-10, and TGF-β mRNAs in MLRs were detected by real-time PCR. Our results demonstrated significant overexpression of CD200 (P = 0.001) in association with higher frequencies of Foxp3(+) T cells in AML patients (r = 0.8, P T cell levels with lower Foxp3 intensity was also shown in CD200-CD200R-blocked MLRs. Expression of IL-10 mRNA declined significantly only in AML-DC MLRs where CD200-CD200R interaction was blocked and the same result was observed for TGF-β and Foxp3 mRNA in both AML- and monocyte-DC MLRs. These data present a significant role for CD200 in suppressing anti-tumor immune response through stimulation of regulatory mechanisms in AML patients and suggest that CD200 may have a prognostic value in this malignancy and its blockade may be used as a target for AML immunotherapy.
Directory of Open Access Journals (Sweden)
Anna Curry
Full Text Available Cell-surface CD200 expression by mouse EMT6 breast tumor cells increased primary tumor growth and metastasis to the draining lymph nodes (DLN in normal (WT BALB/c female recipients, while lack of CD200R1 expression in a CD200R1-/- host negated this effect. Silencing CD200 expression in EMT6siCD200 tumor cells also reduced their ability to grow and metastasize in WT animals. The cellular mechanisms responsible for these effects have not been studied in detail. We report characterization of tumor infiltrating (TILs and draining lymph node (DLN cells in WT and CD200-/- BALB/c mice, receiving WT tumor cells, or EMT6 lacking CD200 expression (EMT6siCD200 cells. Our data show an important correlation with augmented CD8+ cytotoxic T cells and resistance to tumor growth in mice lacking exposure (on either host cells or tumor to the immunoregulatory molecule CD200. Confirmation of the importance of such CD8+ cells came from monitoring tumor growth and characterization of the TILs and DLN cells in WT mice challenged with EMT6 and EMT6siCD200 tumors and treated with CD8 and CD4 depleting antibodies. Finally, we have assessed the mechanisms(s whereby addition of metformin as an augmenting chemotherapeutic agent in CD200-/- animals given EMT6 tumors and treated with a previously established immunotherapy regime can increase host resistance. Our data support the hypothesis that increased autophagy in the presence of metformin increases CD8+ responses and tumor resistance, an effect attenuated by the autophagy inhibitor verteporfin.
Enhanced R200 with Frisch-Grid CZT
Energy Technology Data Exchange (ETDEWEB)
Bolotnikov, A. [Brookhaven National Lab. (BNL), Upton, NY (United States)
2017-12-01
The goal of this project is to demonstrate an engineering prototype of a gamma ray spectrometer that uses Cadmium Zinc Telluride (CZT) in a configuration comprised of an array of position-sensitive virtual Frisch grid (PSVFG) detectors and show its capability to perform functions that would be useful to the IAEA. The detectors should achieve energy resolution of ~2% at 200 keV and <1% at > 662 keV, thereby outperforming all hand-held instruments currently in use other than cryogenically cooled germanium. BNL will make every effort to transfer the technology to an industrial partner so that robust, fieldable instruments can be manufactured.
Single top quark production at LEP200?
International Nuclear Information System (INIS)
Boos, E.; Ishikawa, T.; Kaneko, T.; Kawabata, S.; Kurihara, Y.; Shimizu, Y.; Tanaka, H.
1994-01-01
A complete tree-level calculation of the reaction e + e - → e + ν e anti tb (e - anti ν e t anti b) in the electroweak standard theory in the LEP200 energy range is presented. For top quark masses in the range 130 to 190 GeV the cross sections are found to be in the order of 10 -5 to 10 -6 pb. Therefore, the number of single top quark events is expected to be negligible even with an integrated luminosity of L = 500 pb -1 . It is further demonstrated that the Weizsaecker-Williams approximation is approaching the accurate cross section calculations resonably well. (orig.)
Energy Technology Data Exchange (ETDEWEB)
Helms, L.; Knuenz, D.; Mickeler, S.; Ruehmann, H.R.; Stemme, H.; Wendt, H.; Wodarg, N.
1991-03-01
The research project promoted the design, construction, testing and demonstration of a medium-sized, isolated wind power plant with an output of ca. 200 kW and a rotor diameter of 25 m for electric power supplies to a greenhouse gardener's shop in East Frisia, Germany. The control of the connecting and disconnecting constant loads was to be developed for optimum utilization of the wind supply. The report discusses the project stages placing emphasis on the operational results. (BWI).
Fgf signaling controls pharyngeal taste bud formation through miR-200 and Delta-Notch activity.
Kapsimali, Marika; Kaushik, Anna-Lila; Gibon, Guillaume; Dirian, Lara; Ernest, Sylvain; Rosa, Frederic M
2011-08-01
Taste buds, the taste sensory organs, are conserved in vertebrates and composed of distinct cell types, including taste receptor, basal/presynaptic and support cells. Here, we characterize zebrafish taste bud development and show that compromised Fgf signaling in the larva results in taste bud reduction and disorganization. We determine that Fgf activity is required within pharyngeal endoderm for formation of Calb2b(+) cells and reveal miR-200 and Delta-Notch signaling as key factors in this process. miR-200 knock down shows that miR-200 activity is required for taste bud formation and in particular for Calb2b(+) cell formation. Compromised delta activity in mib(-/-) dramatically reduces the number of Calb2b(+) cells and increases the number of 5HT(+) cells. Conversely, larvae with increased Notch activity and ascl1a(-/-) mutants are devoid of 5HT(+) cells, but have maintained and increased Calb2b(+) cells, respectively. These results show that Delta-Notch signaling is required for intact taste bud organ formation. Consistent with this, Notch activity restores Calb2b(+) cell formation in pharyngeal endoderm with compromised Fgf signaling, but fails to restore the formation of these cells after miR-200 knock down. Altogether, this study provides genetic evidence that supports a novel model where Fgf regulates Delta-Notch signaling, and subsequently miR-200 activity, in order to promote taste bud cell type differentiation.
24 CFR 200.926e - Supplemental information for use with the CABO One and Two Family Dwelling Code.
2010-04-01
... with the CABO One and Two Family Dwelling Code. 200.926e Section 200.926e Housing and Urban Development... PROGRAMS Minimum Property Standards § 200.926e Supplemental information for use with the CABO One and Two... Criteria of the CABO One and Two Family Dwelling Code. (a) Roof live loads. Roof slope 3 in 12 or less: 20...
17 CFR 200.80f - Appendix F-Records control schedule.
2010-04-01
... ORGANIZATION; CONDUCT AND ETHICS; AND INFORMATION AND REQUESTS Information and Requests § 200.80f Appendix F... in purchasing new issues of securities from underwriters 6 years. 821- Reports by registered small... state or federal laws in the purchase and sale of securities Until date of last reported action plus 10...
18 CFR 260.200 - Original cost statement of utility property.
2010-04-01
... 18 Conservation of Power and Water Resources 1 2010-04-01 2010-04-01 false Original cost statement...) § 260.200 Original cost statement of utility property. Any natural gas company becoming subject to the... of its predecessors: (1) The original cost (estimated only if not determinable from existing records...
38 CFR 200.4 - Implementation of NEPA and related authorities.
2010-07-01
... definition of a CATEX. Segmentation can occur when an action is broken down into small parts in order to avoid the appearance of significance of the total action. An action can be too narrowly defined... RETIREMENT HOME COMPLIANCE WITH THE NATIONAL ENVIRONMENTAL POLICY ACT § 200.4 Implementation of NEPA and...
Directory of Open Access Journals (Sweden)
Jielu Wei
2017-10-01
Full Text Available Celangulin V (CV, one of dihydroagarofuran sesquiterpene polyesters isolated from Chinese bittersweet (Celastrus angulatus Maxim, is famous natural botanical insecticide. Decades of research suggests that is displays excellent insecticidal activity against some insects, such as Mythimna separata Walker. Recently, it has been validated that the H subunit of V-ATPase is one of the target proteins of the insecticidal dihydroagarofuran sesquiterpene polyesters. As a continuation of the development of new pesticides from these natural products, a series of β-dihydroagarofuran derivatives have been designed and synthesized. The compound JW-3, an insecticidal derivative of CV with a p-fluorobenzyl group, exhibits higher insecticidal activity than CV. In this study, the potential inhibitory effect aused by the interaction of JW-3 with the H subunit of V-ATPase c was verified by confirmatory experiments at the molecular level. Both spectroscopic techniques and isothermal titration calorimetry measurements showed the binding of JW-3 to the subunit H of V-ATPase was specific and spontaneous. In addition, the possible mechanism of action of the compound was discussed. Docking results indicated compound JW-3 could bind well in ‘the interdomain cleft’ of the V-ATPase subunit H by the hydrogen bonding and make conformation of the ligand–protein complex become more stable. All results are the further validations of the hypothesis, that the target protein of insecticidal dihydroagarofuran sesquiterpene polyesters and their β-dihydroagarofuran derivatives is the subunit H of V-ATPase. The results also provide new ideas for developing pesticides acting on V-ATPase of insects.
Radioactive liquid wastes discharged to ground in the 200 areas during 1985
International Nuclear Information System (INIS)
Aldrich, R.C.
1986-03-01
This document summarizes radioactive liquids discharged to the ground in the 200 areas of the Hanford site and is provided pursuant to Department of Energy (DOE) Order 5484.1A, ''Environmental Protection, Safety, and Health Protection Information Reporting Requirements.'' There are twenty-eight liquid discharge streams in the 200 areas excluding sanitary sewers. Twenty-five streams were normally or potentially contaminated with radioactive material in 1985. Two streams had no potential for radioactive contamination but were included as adjustments in this report to maintain an accurate record of the total volume of the discharges to each disposal site. One stream, the 242-S Evaporator cooling water discharge, was not used during 1985
New Control Structure of the 200 MHz RF System in the CERN PS
Damerau, H; CERN. Geneva. AB Department
2008-01-01
The 200 MHz RF system is an essential tool for the preparation of high-intensity beams in the CERN PS. Presently, six RF cavities are operated to control the longitudinal bunch emittance and rebunching of the beam before the transfer to the SPS. Cavities are selected for the various processes with a dedicated hardware matrix, switching the individual timing pulses and voltage programs per cavity. However, the electronics used for the matrix hardware is obsolete and its reliability cannot be guaranteed due to a lack of spare modules and components. Instead of replacing the old hardware matrix by modern hardware, this note describes a new control structure for the 200MHz RF system so that no dedicated hardware will be required anymore. The implementation of the new control structure is based on two main concepts. Firstly, linked timing trees per blow-up or rebunching are used to handle all related timing and to store one row of the matrix. Secondly, as a reflection of the RF signal generation for the 200 MHz sy...
Liu, Qin; Li, Ru-Tian; Qian, Han-Qing; Wei, Jia; Xie, Li; Shen, Jie; Yang, Mi; Qian, Xiao-Ping; Yu, Li-Xia; Jiang, Xi-Qun; Liu, Bao-Rui
2013-09-01
Cancer stem cells (CSCs) are recently discovered as vital obstacles for the successful cancer therapy. Emerging evidences suggest that miR-200c functions as an effective CSCs inhibitor and can restore sensitivity to microtubule-targeting drugs. In the present work, the intelligent gelatinases-stimuli nanoparticles (NPs) was set up to co-deliver miR-200c and docetaxel (DOC) to verify their synergetic effects on inhibition of CSCs and non-CSC cancer cells. After tumor cells were treated with miR-200c NPs, miR-200c and its targeted gene class III beta-tubulin (TUBB3)TUBB3 expression were evaluated. The effects of miR-200c/DOC NPs on tumor cell viability, migration and invasion as well as the expression of E-cadherin and CD44 were studied. The antitumor effects of miR-200c/DOC NPs were compared with DOC NPs in xenograft gastric cancer mice. Moreover, the residual tumors after treatment were subcutaneously seeded into nude mice to further investigate the effective maintenance of NPs. We found that the gelatinases-stimuli NPs facilitated miR-200c into cells, achieving sustained miR-200c expression in tumor cells during 9 days. The miR-200c/DOC NPs significantly enhanced cytotoxicity of DOC, possibly by decreasing TUBB3 level, and reversing EMT. The miR-200c NPs achieved high levels of in vivo accumulation and long retention in gastric cancer xenografts after intravenous administration. The miR-200c/DOC NPs prominently suppressed in vivo tumor growth with elevated miR-200c and E-cadherin levels and down-regulated TUBB3 and CD44 expressions. When the residual tumors after miR-200c/DOC NPs treatment were re-transplanted into nude mice, the tumors demonstrated the slowest growth speed. The miR-200c/DOC NPs may provide a promising modality for co-delivery of nucleic acid and drugs to simultaneously inhibit CSCs and non-CSC cancer cells. Copyright © 2013 Elsevier Ltd. All rights reserved.
Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells
Directory of Open Access Journals (Sweden)
Wernet Peter
2010-08-01
Full Text Available Abstract Background The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. Findings We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. Conclusions The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.
Role of DNA methylation in miR-200c/141 cluster silencing in invasive breast cancer cells.
Neves, Rui; Scheel, Christina; Weinhold, Sandra; Honisch, Ellen; Iwaniuk, Katharina M; Trompeter, Hans-Ingo; Niederacher, Dieter; Wernet, Peter; Santourlidis, Simeon; Uhrberg, Markus
2010-08-03
The miR-200c/141 cluster has recently been implicated in the epithelial to mesenchymal transition (EMT) process. The expression of these two miRNAs is inversely correlated with tumorigenicity and invasiveness in several human cancers. The role of these miRNAs in cancer progression is based in part on their capacity to target the EMT activators ZEB1 and ZEB2, two transcription factors, which in turn repress expression of E-cadherin. Little is known about the regulation of the mir200c/141 cluster, whose targeting has been proposed as a promising new therapy for the most aggressive tumors. We show that the miR-200c/141 cluster is repressed by DNA methylation of a CpG island located in the promoter region of these miRNAs. Whereas in vitro methylation of the miR-200c/141 promoter led to shutdown of promoter activity, treatment with a demethylating agent caused transcriptional reactivation in breast cancer cells formerly lacking expression of miR-200c and miR-141. More importantly, we observed that DNA methylation of the identified miR-200c/141 promoter was tightly correlated with phenotype and the invasive capacity in a panel of 8 human breast cancer cell lines. In line with this, in vitro induction of EMT by ectopic expression of the EMT transcription factor Twist in human immortalized mammary epithelial cells (HMLE) was accompanied by increased DNA methylation and concomitant repression of the miR-200c/141 locus. The present study demonstrates that expression of the miR-200c/141 cluster is regulated by DNA methylation, suggesting epigenetic regulation of this miRNA locus in aggressive breast cancer cell lines as well as untransformed mammary epithelial cells. This epigenetic silencing mechanism might represent a novel component of the regulatory circuit for the maintenance of EMT programs in cancer and normal cells.
Beam profile measurement of ES-200 using secondary electron emission monitor
Directory of Open Access Journals (Sweden)
E Ebrahimi Basabi
2015-09-01
Full Text Available Up to now, different designs have been introduced for measurement beam profile accelerators. Secondary electron emission monitors (SEM are one of these devices which have been used for this purpose. In this work, a SEM has been constructed to measure beam profile of ES-200 accelerator, a proton electrostatic accelerator which is installed at SBU. Profile grid for both planes designed with 16 wires which are insulated relative to each other. The particles with maximum energy of 200 keV and maximum current of 400 μA are stopped in copper wires. Each of the wires has an individual current-to-voltage amplifier. With a multiplexer, the analogue values are transported to an ADC. The ADCs are read out by a microcontroller and finally profile of beam shows by a user interface program
Microbial keratitis in Gujarat, Western India: findings from 200 cases ...
African Journals Online (AJOL)
Results: Of the 200 ulcers 55% were culture positive, 26.5% were bacterial ulcers of which 47% were due to Staphylococcus spp. Pure fungal growth was seen in 22% while 6% were mixed ulcers. Fusarium spp. (30%) was the most common fungus followed by Aspergillus spp. (21%). Only one case of Acanthamoeba ...
An Elastic-Plastic Finite Element Analysis of Notched Aluminum Panels.
1981-03-01
ZL. 0j W 0 WOO0 U w~ZZ%"*Q’c-- aIIUX(>-’j...W * 4%eweJW W *CI W. 4 * Q ~7.j W I~7 b-.~ i i t~e W W 00I 20 ~ ~ ~ ~ ~ t 2: aZ2a... Zaw Z Nctl-l*Z.J ’Z...34 Q"-Z=LU. LLZZoUZO 000 uzm3- LCWIn 40 Wi 0 %no* 0-4 004 to O*tt) -0 *0a -Or (* 0 . tuN * *010 ("~o 0-t a%* n Inl *0 101o 0- W* *4 -d .. *..i -4.4 144
Readiness evaluation plan for operation of the 200-ZP-1 pump-and-treat system
International Nuclear Information System (INIS)
Lehrschall, R.R.
1996-03-01
The Project Readiness Evaluation (RE) process will show that the 200-ZP-1 Phase 2 and Phase 3 Interim Response Measure (IRM) remedial activity is prepared to safely and effectively commence work activities. In order to ensure readiness to commence the 200-ZP-1 Pump-and-Treat (P and T) activities, a formal RE will be performed in accordance with this plan. A Readiness Evaluation Team (RET) will evaluate and confirm readiness by reviewing the work activities and by conducting field verifications. The Project Final Hazard Classification (FHC) prepared for the 200-ZP-1 P and T IRM has determined that the operation is a Non-Nuclear Low Hazard activity. The goal of this IRM is to reduce further migration of the carbon tetrachloride, chloroform, and trichloroethylene (TCE) in the groundwater of the 200 West Area. The Phase 2 and Phase 3 IRM treatment system will be designed to initiate hydraulic containment of the contaminant mass in the high-concentration portion (i.e., the 2,000- to 3,000-ppb contour) of the CCl 4 plume. This system will be located just north of the Plutonium Finishing Plant in the 200 West Area and will utilize air stripping and vapor-phase granular activated carbon (GAC) adsorption of the CCl 4 . Air stripping is performed by forcing clean air through the contaminated groundwater stream. Based on chemical equilibrium, volatile organic compounds are transferred from the groundwater stream into the air stream. The air stream, containing the contamination in vapor phase, will be passed through vapor-phase GAC columns to remove and collect the organic contaminants. Saturated GAC will then be shipped offsite for carbon regeneration, where the contamination will be destroyed at a permitted facility
Stabilization of 200-atom platinum nanoparticles by organosilane fragments
Pelzer, Katrin
2011-04-19
Three\\'s a charm: Platinum nanoparticles of 2 nm diameter and containing approximately 200 atoms covered with n-octylsilyl groups (see picture, right; Pt blue, Si red, C gray, H turquoise) form when [Pt(dba)2] (dba=dibenzylideneacetone) decomposes in the presence of n-octylsilane. The particles adopt a cuboctahedral structure with an edge length of three atoms. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Stabilization of 200-atom platinum nanoparticles by organosilane fragments
Pelzer, Katrin; Hä vecker, Michael; Boualleg, Malika; Candy, Jean Pierre; Basset, Jean-Marie
2011-01-01
Three's a charm: Platinum nanoparticles of 2 nm diameter and containing approximately 200 atoms covered with n-octylsilyl groups (see picture, right; Pt blue, Si red, C gray, H turquoise) form when [Pt(dba)2] (dba=dibenzylideneacetone) decomposes in the presence of n-octylsilane. The particles adopt a cuboctahedral structure with an edge length of three atoms. Copyright © 2011 WILEY-VCH Verlag GmbH & Co. KGaA, Weinheim.
Manyam, Bala V; Dhanasekaran, Muralikrishnan; Hare, Theodore A
2004-02-01
HP-200, which contains Mucuna pruriens endocarp, has been shown to be effective in the treatment of Parkinson's disease. Mucuna pruriens endocarp has also been shown to be more effective compared to synthetic levodopa in an animal model of Parkinson's disease. The present study was designed to elucidate the long-term effect of Mucuna pruriens endocarp in HP-200 on monoaminergic neurotransmitters and its metabolite in various regions of the rat brain. HP-200 at a dose of 2.5, 5.0 or 10.0 g/kg/day was mixed with rat chow and fed daily ad lib to Sprague-Dawley rats (n = 6 for each group) for 52 weeks. Controls (n = 6) received no drug. Random assignment was made for doses and control. The rats were sacrificed at the end of 52 weeks and the neurotransmitters were analyzed in the cortex, hippocampus, substantia nigra and striatum. Oral administration of Mucuna pruriens endocarp in the form of HP-200 had a significant effect on dopamine content in the cortex with no significant effect on levodopa, norepinephrine or dopamine, serotonin, and their metabolites- HVA, DOPAC and 5-HIAA in the nigrostriatal tract. The failure of Mucuna pruriens endocarp to significantly affect dopamine metabolism in the striatonigral tract along with its ability to improve Parkinsonian symptoms in the 6-hydorxydopamine animal model and humans may suggest that its antiparkinson effect may be due to components other than levodopa or that it has an levodopa enhancing effect. Copyright 2004 John Wiley & Sons, Ltd. Copyright 2004 John Wiley & Sons, Ltd.
Aidala, C.; Akiba, Y.; Alfred, M.; Andrieux, V.; Aoki, K.; Apadula, N.; Asano, H.; Ayuso, C.; Azmoun, B.; Babintsev, V.; Bagoly, A.; Bandara, N. S.; Barish, K. N.; Bathe, S.; Bazilevsky, A.; Beaumier, M.; Belmont, R.; Berdnikov, A.; Berdnikov, Y.; Blau, D. S.; Boer, M.; Bok, J. S.; Brooks, M. L.; Bryslawskyj, J.; Bumazhnov, V.; Butler, C.; Campbell, S.; Canoa Roman, V.; Cervantes, R.; Chi, C. Y.; Chiu, M.; Choi, I. J.; Choi, J. B.; Citron, Z.; Connors, M.; Cronin, N.; Csanád, M.; Csörgő, T.; Danley, T. W.; Daugherity, M. S.; David, G.; Deblasio, K.; Dehmelt, K.; Denisov, A.; Deshpande, A.; Desmond, E. J.; Dion, A.; Dixit, D.; Do, J. H.; Drees, A.; Drees, K. A.; Dumancic, M.; Durham, J. M.; Durum, A.; Elder, T.; Enokizono, A.; En'yo, H.; Esumi, S.; Fadem, B.; Fan, W.; Feege, N.; Fields, D. E.; Finger, M.; Finger, M.; Fokin, S. L.; Frantz, J. E.; Franz, A.; Frawley, A. D.; Fukuda, Y.; Gal, C.; Gallus, P.; Garg, P.; Ge, H.; Giordano, F.; Goto, Y.; Grau, N.; Greene, S. V.; Grosse Perdekamp, M.; Gunji, T.; Guragain, H.; Hachiya, T.; Haggerty, J. S.; Hahn, K. I.; Hamagaki, H.; Hamilton, H. F.; Han, S. Y.; Hanks, J.; Hasegawa, S.; Haseler, T. O. S.; He, X.; Hemmick, T. K.; Hill, J. C.; Hill, K.; Hodges, A.; Hollis, R. S.; Homma, K.; Hong, B.; Hoshino, T.; Hotvedt, N.; Huang, J.; Huang, S.; Imai, K.; Imrek, J.; Inaba, M.; Iordanova, A.; Isenhower, D.; Ito, Y.; Ivanishchev, D.; Jacak, B. V.; Jezghani, M.; Ji, Z.; Jiang, X.; Johnson, B. M.; Jorjadze, V.; Jouan, D.; Jumper, D. S.; Kang, J. H.; Kapukchyan, D.; Karthas, S.; Kawall, D.; Kazantsev, A. V.; Khachatryan, V.; Khanzadeev, A.; Kim, C.; Kim, D. J.; Kim, E.-J.; Kim, M.; Kim, M. H.; Kincses, D.; Kistenev, E.; Klatsky, J.; Kline, P.; Koblesky, T.; Kotov, D.; Kudo, S.; Kurita, K.; Kwon, Y.; Lajoie, J. G.; Lallow, E. O.; Lebedev, A.; Lee, S.; Lee, S. H.; Leitch, M. J.; Leung, Y. H.; Lewis, N. A.; Li, X.; Lim, S. H.; Liu, L. D.; Liu, M. X.; Loggins, V.-R.; Lökös, S.; Lovasz, K.; Lynch, D.; Majoros, T.; Makdisi, Y. I.; Makek, M.; Malaev, M.; Manko, V. I.; Mannel, E.; Masuda, H.; McCumber, M.; McGaughey, P. L.; McGlinchey, D.; McKinney, C.; Mendoza, M.; Metzger, W. J.; Mignerey, A. C.; Mihalik, D. E.; Milov, A.; Mishra, D. K.; Mitchell, J. T.; Mitsuka, G.; Miyasaka, S.; Mizuno, S.; Montuenga, P.; Moon, T.; Morrison, D. P.; Morrow, S. I. M.; Murakami, T.; Murata, J.; Nagai, K.; Nagashima, K.; Nagashima, T.; Nagle, J. L.; Nagy, M. I.; Nakagawa, I.; Nakagomi, H.; Nakano, K.; Nattrass, C.; Niida, T.; Nouicer, R.; Novák, T.; Novitzky, N.; Novotny, R.; Nyanin, A. S.; O'Brien, E.; Ogilvie, C. A.; Orjuela Koop, J. D.; Osborn, J. D.; Oskarsson, A.; Ottino, G. J.; Ozawa, K.; Pantuev, V.; Papavassiliou, V.; Park, J. S.; Park, S.; Pate, S. F.; Patel, M.; Peng, W.; Perepelitsa, D. V.; Perera, G. D. N.; Peressounko, D. Yu.; Perezlara, C. E.; Perry, J.; Petti, R.; Phipps, M.; Pinkenburg, C.; Pisani, R. P.; Pun, A.; Purschke, M. L.; Radzevich, P. V.; Read, K. F.; Reynolds, D.; Riabov, V.; Riabov, Y.; Richford, D.; Rinn, T.; Rolnick, S. D.; Rosati, M.; Rowan, Z.; Runchey, J.; Safonov, A. S.; Sakaguchi, T.; Sako, H.; Samsonov, V.; Sarsour, M.; Sato, K.; Sato, S.; Schaefer, B.; Schmoll, B. K.; Sedgwick, K.; Seidl, R.; Sen, A.; Seto, R.; Sexton, A.; Sharma, D.; Shein, I.; Shibata, T.-A.; Shigaki, K.; Shimomura, M.; Shioya, T.; Shukla, P.; Sickles, A.; Silva, C. L.; Silvermyr, D.; Singh, B. K.; Singh, C. P.; Singh, V.; Skoby, M. J.; Slunečka, M.; Smith, K. L.; Snowball, M.; Soltz, R. A.; Sondheim, W. E.; Sorensen, S. P.; Sourikova, I. V.; Stankus, P. W.; Stoll, S. P.; Sugitate, T.; Sukhanov, A.; Sumita, T.; Sun, J.; Syed, S.; Sziklai, J.; Takeda, A.; Tanida, K.; Tannenbaum, M. J.; Tarafdar, S.; Taranenko, A.; Tarnai, G.; Tieulent, R.; Timilsina, A.; Todoroki, T.; Tomášek, M.; Towell, C. L.; Towell, R. S.; Tserruya, I.; Ueda, Y.; Ujvari, B.; van Hecke, H. W.; Vazquez-Carson, S.; Velkovska, J.; Virius, M.; Vrba, V.; Vukman, N.; Wang, X. R.; Wang, Z.; Watanabe, Y.; Watanabe, Y. S.; Wong, C. P.; Woody, C. L.; Xu, C.; Xu, Q.; Xue, L.; Yalcin, S.; Yamaguchi, Y. L.; Yamamoto, H.; Yanovich, A.; Yin, P.; Yoo, J. H.; Yoon, I.; Yu, H.; Yushmanov, I. E.; Zajc, W. A.; Zelenski, A.; Zharko, S.; Zou, L.; Phenix Collaboration
2018-02-01
Recently, multiparticle-correlation measurements of relativistic p /d /He 3 +Au , p +Pb , and even p +p collisions show surprising collective signatures. Here, we present beam-energy-scan measurements of two-, four-, and six-particle angular correlations in d +Au collisions at √{sN N}=200 , 62.4, 39, and 19.6 GeV. We also present measurements of two- and four-particle angular correlations in p +Au collisions at √{sN N}=200 GeV . We find the four-particle cumulant to be real valued for d +Au collisions at all four energies. We also find that the four-particle cumulant in p +Au has the opposite sign as that in d +Au . Further, we find that the six-particle cumulant agrees with the four-particle cumulant in d +Au collisions at 200 GeV, indicating that nonflow effects are subdominant. These observations provide strong evidence that the correlations originate from the initial geometric configuration, which is then translated into the momentum distribution for all particles, commonly referred to as collectivity.
Waste segregation analysis for salt well pumping in the 200 W Area -- Task 3.4
International Nuclear Information System (INIS)
Reynolds, D.A.
1995-01-01
There is an estimated 7 million liters (1.9 million gallons) of potentially complexed waste that need to be pumped from single-shell tanks (SST) in the 200 West Area. This represents up to 40% of the salt well liquor that needs to be pumped in the 200 West Area. There are three double-shell (DST) tanks in the 241-SY tank farm in the 200 West Area. Tank 241-SY-101 is full and not usable. Tank 241-SY-102 has a transuranic (TRU) sludge in the bottom. Current rules prohibit mixing complexed waste with TRU waste. Tank 241-SY-103 has three major problems. First, 241-SY-103 is on the Flammable Watch list. Second, adding waste to tank 241-SY-103 has the potential for an episodic release of hydrogen gas. Third, 241-SY-103 will not hold all of the potentially complexed waste from the SSTs. This document looks at more details regarding the salt well pumping of the 200 West Area tank farm. Some options are considered but it is beyond the scope of this document to provide an in-depth study necessary to provide a defensible solution to the complexed waste problem
ExB Measurements of a 200 W Xenon Hall Thruster (Preprint)
National Research Council Canada - National Science Library
Ekholm, Jared M; Hargus, Jr, William A
2007-01-01
Angularly resolved ion species fractions of Xe+1, Xe+2, and Xe+3 in a low power xenon Hall thruster Busek BHT-200 plume were measured using an ExB probe under a variety of thruster operating conditions and background pressures...
Improving 200 MW NDHR reactor protection system with GAL devices
International Nuclear Information System (INIS)
Shi Mingde; Li Duo; Xie Zhengguo
1999-01-01
The emergence of General Array Logic (GAL), a fairly new type of logic devices with the characteristics of user-definable logic functions, have led to a revolutionary change in the design of logical circuits. The improvements of the reactor protection system for the 200 MW nuclear district heating reactor (NDHR) using GAL are covered
2 CFR 1.200 - Purpose of chapters I and II.
2010-01-01
... (and thereby implement the Federal Financial Assistance Management Improvement Act of 1999, Pub. L. 106... Introduction toSubtitle A § 1.200 Purpose of chapters I and II. (a) Chapters I and II of subtitle A provide OMB... procedures for management of the agencies' grants and agreements. (b) There are two chapters for publication...
46 CFR 170.200 - Estimated lightweight vertical center of gravity.
2010-10-01
... 46 Shipping 7 2010-10-01 2010-10-01 false Estimated lightweight vertical center of gravity. 170... Centers of Gravity § 170.200 Estimated lightweight vertical center of gravity. (a) Each tank vessel that... calculations required by §§ 170.170 and 172.065, the vertical center of gravity of a tank vessel in the...
Energy Technology Data Exchange (ETDEWEB)
Kim, Chang-Yeoul, E-mail: cykim15@kicet.re.kr [Nano-Convergence Intelligence Material Team, Korea Institute of Ceramic Eng. and Tech., Gasan-digtial-ro 10 Gil 77 Geumcheon-gu, 153-801 Seoul (Korea, Republic of); Riu, Doh-Hyung [Dept. of New Material Sci. and Eng., Seoul National University of Technology, Seoul (Korea, Republic of)
2014-12-15
(200) and (301) preferred oriented fluorine-doped tin oxide (FTO) thin films were fabricated by spray pyrolysis of ethanol-added and water-based FTO precursor solutions, respectively. (200) oriented FTO thin film from ethanol-added solution shows the lower electrical resistivity and visible light transmission than (301) preferred thin film from water-based solution. It is due to the higher carrier concentration and electron mobility in (200) oriented crystals, that is, the lower ionized impurity scattering. The higher electron concentration is related to the higher optical band gap energy, the lower visible light transmission, and the higher IR reflection. For (301) preferred FTO thin films from water-based solution, the lower carrier concentration and electron mobility make the higher electrical resistivity and visible light transmission. Raman scattering analysis shows that IR active modes prominent in (200) oriented FTO thin film are related with the lower electrical resistivity. - Highlights: • We coated fluorine-doped tin oxide thin films with preferred orientation of (200) and (301). • We examine changes in the level of electrical and optical properties with the orientation. • (200) preferred orientation showed lower electrical resistivity and optical transmittance. • (200) oriented thin films have higher electron concentrations that are related with IR active modes.
Energy Technology Data Exchange (ETDEWEB)
Vrba, Lukas; Jensen, Taylor J.; Garbe, James C.; Heimark, Ronald L.; Cress, Anne E.; Dickinson, Sally; Stampfer, Martha R.; Futscher, Bernard W.
2009-12-23
BACKGROUND: The microRNA-200 family participates in the maintenance of an epithelial phenotype and loss of its expression can result in epithelial to mesenchymal transition (EMT). Furthermore, the loss of expression of miR-200 family members is linked to an aggressive cancer phenotype. Regulation of the miR-200 family expression in normal and cancer cells is not fully understood. METHODOLOGY/ PRINCIPAL FINDINGS: Epigenetic mechanisms participate in the control of miR-200c and miR-141 expression in both normal and cancer cells. A CpG island near the predicted mir-200c/mir-141 transcription start site shows a striking correlation between miR-200c and miR-141 expression and DNA methylation in both normal and cancer cells, as determined by MassARRAY technology. The CpG island is unmethylated in human miR-200/miR-141 expressing epithelial cells and in miR-200c/miR-141 positive tumor cells. The CpG island is heavily methylated in human miR-200c/miR-141 negative fibroblasts and miR-200c/miR-141 negative tumor cells. Mouse cells show a similar inverse correlation between DNA methylation and miR-200c expression. Enrichment of permissive histone modifications, H3 acetylation and H3K4 trimethylation, is seen in normal miR-200c/miR-141-positive epithelial cells, as determined by chromatin immunoprecipitation coupled to real-time PCR. In contrast, repressive H3K9 dimethylation marks are present in normal miR-200c/miR-141-negative fibroblasts and miR-200c/miR-141 negative cancer cells and the permissive histone modifications are absent. The epigenetic modifier drug, 5-aza-2'-deoxycytidine, reactivates miR-200c/miR-141 expression showing that epigenetic mechanisms play a functional role in their transcriptional control. CONCLUSIONS/ SIGNIFICANCE: We report that DNA methylation plays a role in the normal cell type-specific expression of miR-200c and miR-141 and this role appears evolutionarily conserved, since similar results were obtained in mouse. Aberrant DNA methylation
Annex D 200 Area Interim Storage Area Final Safety Analysis Report Volume 5 (FSAR) (Section 1 and 2)
International Nuclear Information System (INIS)
CARRELL, R.D.
2003-01-01
The 200 Area Interim Storage Area (200 Area ISA) at the Hanford Site provides for the interim storage of non-defense reactor spent nuclear fuel (SNF) housed in aboveground dry cask storage systems. The 200 Area ISA is a relatively simple facility consisting of a boundary fence with gates, perimeter lighting, and concrete and gravel pads on which to place the dry storage casks. The fence supports safeguards and security and establishes a radiation protection buffer zone. The 200 Area ISA is nominally 200,000 ft 2 and is located west of the Canister Storage Building (CSB). Interim storage at the 200 Area ISA is intended for a period of up to 40 years until the materials are shipped offsite to a disposal facility. This Final Safety Analysis Report (FSAR) does not address removal from storage or shipment from the 200 Area ISA. Three different SNF types contained in three different dry cask storage systems are to be stored at the 200 Area ISA, as follows: (1) Fast Flux Test Facility (FFTF) Fuel--Fifty-three interim storage casks (ISC), each holding a core component container (CCC), will be used to store the FFTF SNF currently in the 400 Area. (2) Neutron Radiography Facility (NRF)TRIGA--One Rad-Vault container stores two DOT-6M 3 containers and six NRF TRIGA casks. (3) Commercial Light Water Reactor Fuel--Six International Standards Organization (ISO) containers, each holding a NAC-1 cask with an inner commercial light water reactor (LWR) canister, are used for storing commercial LWR SNF from the 300 Area. An aboveground dry cask storage location is necessary for the spent fuel because the current storage facilities are being shut down and deactivated. The spent fuel is being transferred to interim storage because there is no permanent repository storage currently available
All-to-All Communication on the Connection Machine CM-200
Directory of Open Access Journals (Sweden)
Kapil K. Mathur
1995-01-01
Full Text Available Detailed algorithms for all-to-all broadcast and reduction are given for arrays mapped by binary or binary-reflected Gray code encoding to the processing nodes of binary cube networks. Algorithms are also given for the local computation of the array indices for the communicated data, thereby reducing the demand for the communications bandwidth. For the Connection Machine system CM-200, Hamiltonian cycle-based all-to-all communication algorithms yield a performance that is a factor of 2 to 10 higher than the performance offered by algorithms based on trees, butterfly networks, or the Connection Machine router. The peak data rate achieved for all-to-all broadcast on a 2,048-node Connection Machine system CM-200 is 5.4 Gbyte/s. The index order of the data in local memory depends on implementation details of the algorithms, but it is well defined. If a linear ordering is desired, then including the time for local data reordering reduces the effective peak data rate to 2.5 Gbyte/s.
Hydrogeology of the 200 Areas low-level burial grounds
International Nuclear Information System (INIS)
Last, G.V.; Bjornstad, B.N.; Bergeron, M.P.
1989-01-01
This report presents information derived from the installation of 35 ground-water monitoring wells around six low-level radioactive/hazardous waste burial grounds located in the 200 Areas of the Hanford Site in southeastern Washington State. This information was collected between May 20, 1987 and August 1, 1988. The contents of this report have been divided into two volumes. This volume contains the main text. Volume 2 contains the appendixes, including data and supporting information that verify content and results found in the main text. This report documents information collected by the Pacific Northwest Laboratory at the request of Westinghouse Hanford Company. Presented in this report are the preliminary interpretations of the hydrogeologic environment of six low-level burial grounds, which comprise four waste management areas (WMAs) located in the 200 Areas of the Hanford Site. This information and its accompanying interpretations were derived from sampling and testing activities associated with the construction of 35 ground-water monitoring wells as well as a multitude of previously existing boreholes. The new monitoring wells were installed as part of a ground-water monitoring program initiated in 1986. This ground-water monitoring program is based on requirements for interim status facilities in compliance with the Resource Conservation and Recovery Act (1976)
MicroRNA-200a suppresses the Wnt/?-catenin signaling pathway by interacting with ?-catenin
SU, JUAN; ZHANG, ANLING; SHI, ZHENDONG; MA, FEIFEI; PU, PEIYU; WANG, TAO; ZHANG, JIE; KANG, CHUNSHENG; ZHANG, QINGYU
2011-01-01
The Wnt/?-catenin signaling pathway is crucial for human organ development and is involved in tumor progression of many cancers. Accumulating evidence suggests that the expression of ?-catenin is, in part, regulated by specific microRNAs (miRNAs). The purpose of this study was to determine the expression of a recently identified epithelial to mesenchymal transition (EMT)-associated tumor suppressor microRNA (miR)-200a, in cancer cells. We also aimed to identify specific miR-200a target genes ...